1G12A

Zinc peptidase from grifola frondosa
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
167
structure length
167
Chain Sequence
TYNGCSSSEQSALAAAASAAQSYVAESLSYLQTHTAATPRYTTWFGSYISSRHSTVLQHYTDMNSNDFSSYSFDCTCTAAGTFAYVYPNRFGTVYLCGAFWKAPTTGTDSQAGTLVHESSHFTRNGGTKDYAYGQAAAKSLATMDPDKAVMNADNHEYFSENNPAQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-LYS METALLOENDOPEPTIDASE
publication title Structure of a new 'aspzincin' metalloendopeptidase from Grifola frondosa: implications for the catalytic mechanism and substrate specificity based on several different crystal forms.
pubmed doi rcsb
molecule tags Hydrolase
total genus 64
structure length 167
sequence length 167
ec nomenclature ec 3.4.24.20: Peptidyl-Lys metalloendopeptidase.
pdb deposition date 2000-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14521 Aspzincin_M35 Lysine-specific metallo-endopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1g12A00
1AYKA 1ZTQA 1CGLA 2EROA 1EB6A 2D1NA 4PKTA 3V96B 1BKCE 4FXQA 1ZXVA 1KUGA 1BUVM 1Y0VA 1XFUA 2JT5A 2AYKA 2Y6DA 4WF6A 4I03A 3DL1A 4GWNA 3LGPA 3KEKA 1OM8A 1BKCA 1JAPA 1J7NA 2A8HA 1OM7A 4AXQA 4PKSA 4PKVA 1QJIA 3F15A 1MMRA 1SMPA 1FBLA 2ERPA 2USNA 5B5PA 3AIGA 1ZS0A 1GO8P 1UMTA 1I73A 2WOAA 2OXZA 3EHXA 1H71P 4JQGA 3KMEA 1G49A 4DF9A 1MMBA 3HBVP 1JKYA 2PJTA 1GKDA 2OI0A 1XUCA 4HMAA 1CGEA 3RTTA 2N8RA 5L79A 2MZEA 1DTHA 4L19A 4Q1LA 4AUOA 2FV5A 2W0DA 1HY7A 4IN9A 1GE7A 1MMPA 1XFYA 1QIAA 4XM8A 3KMCA 2W12A 4CTHA 4GR3A 3LE9A 1UTTA 1JK3A 2X7MA 2OXUA 4PKQA 2SRTA 1ZXCA 1L6JA 4ILWD 3B92A 3LJGA 1Q3AA 1ZVXA 2O36A 4DD8A 2I47A 3O64A 1XFVA 1JAQA 3KRYA 1ZP5A 3HY9A 2OW2A 1KUKA 2DW1A 1I1IP 3F17A 1ATLA 3HYGA 3TVCA 2YB9A 4WKEA 1SLMA 1K7GA 3G5CA 2DDFA 4WZVA 1MMQA 2OY2A 1JH1A 1EUBA 3AYKA 4ZR5A 3AYUA 2POJA 5BOYA 3EDGA 1UMSA 1KUIA 3F16A 4GR8A 3OHOA 5I2ZA 1AKLA 1BQQM 4GQLA 2DDYA 2J0TA 5B5OA 5I3MA 1SATA 1XUDA 3DWBA 2OW1A 5D2BA 2CLTA 1KUFA 3LUMA 3B2ZA 4H2EA 4ON1A 5D1SA 2OVZA 4JP4A 3EDIA 3N2VA 3DSLA 4PKWA 1IABA 2FV9A 1B8YA 4HX3A 3E8RA 1OM6A 1G05A 2D1OA 4JIJA 2DW0A 1IAGA 1SLNA 4H84A 2E2DA 2Z2DA 3DNGA 1JIZA 4AIGA 1R54A 4JA1A 1EAKA 3CKIA 1QICA 3WV2A 5CUHA 2XS3A 5L7FA 3L0VA 2HU6A 5I4OA 2K2GA 1D7XA 1ROSA 2JT6A 3TS4A 1HTDA 3VI1A 3TT4A 2V4BA 2QPJA 3ZXHA 3VTGA 3EWJA 2X3AA 3KWVC 4FU4A 5LABA 5D1TA 1KUHA 3KECA 4G9LA 4H30A 2X3BA 4L6TA 4L63A 2TCLA 4WKIA 3DPFA 1D8FA 3K7LA 2OW0A 2DW2A 1JAOA 1GE5A 1PWQA 3LQBA 3GBOA 5JMYA 1K7IA 2ERQA 4FVLA 1HOVA 3WV3A 1OMJA 3MA2A 1BM6A 1RMZA 3HDAP 1G12A 1YCMA 4GWMA 1OO9A 1Y8JA 2X3CA 1KAPP 1SU3A 3DPEA 3EDZA 1QUAA 4I35A 3ELMA 1DMTA 3LJTA 1PWVA 4H3XA 2W15A 1CGFA 1PWUA 3ZUKA 3LEAA 1A86A 1IAEA 4QKZA 4G0DA 2CKIA 5D7WA 3LILA 5BPAA 1ND1A 4GR0A 2OZRA 4A7BA 1CIZA 3K7NA 1CXVA 3N2UA 1D8MA 2O3EA 2OXWA 1O0QA 2OY4A 1IAAA 3F19A 5CZMA 1BQOA 3HBUP 2WO9A 1R1HA 3LQ0A 1D5JA 1IACA 1YP1A 1SRPA 3LMCA 1ASTA 1QIBA 1FM1A 3P1VA 5I43A 3LIRA 1BZSA 3HY7A 1JJ9A 3I7GA 5H8XA 2MLSA 2KRJA 2K9CA 2AIGP 4PKUA 1JANA 1USNA 3NX7A 3HB2P 4WK7A 2RJQA 456CA 3RTSA 4A3WA 2JNPA 1PWWA 2MZHA 4GUYA 3KEJA 5D1UA 3B8ZA 3Q2GA 1CAQA 4JPAA 1C7KA 966CA 5CXAA 1RM8A 2Y6CA 2WO8A 4H1QA 4IUWA 830CA 3I7IA 1UEAA 4XM6A 2W13A 1GKCA 1I76A 5I0LA 1BKCI 3L0TA 4IJOA 3HDBA 1UTZA 3EDHA 3ZVSA 4XM7A 4DPEA 4H82A 4FXYP 3OHLA 1B3DA 3KHIA 1GE6A 2MZIA 1CQRA 1BSWA 3USNA 3Q2HA 1G4KA 1CK7A 2W14A 2E3XA 1WNIA 4R3VA 1XURA 4GF1A 3O2XA 1XFWA 2OW9A 3G42A 1IADA 1AF0A 1YOUA 1O0TA 1BIWA 1R1JA 3LIKA 1XFXA 1XFZA 3SHIA 3P24A 3WV1A 4J4MA 3LJZA 1OS9A 2MLRA 3F18A 1MNCA 2JSDA 3EHYA 5BOTA 2OVXA 1C8TA 1Z3JA 1KBCA 3LUNA 1FLSA 4EFSA 1C3IA 5I12A 1BUDA 2RJPA 5D3CA 2XS4A 1S4BP 2J83A 2L0RA 3BA0A 3TSKA 1PWPA 1JIWP 4AYKA 3F1AA 2YIGA 4H49A 1OS2A 1YQYA 3U1RA 1HV5A 1Y93A 4H76A 3UVCA 3LKAA 1HFSA 1G9KA 4XCTA 3LK8A 1GXDA 1K7QA 4DV8A 1R55A 1HFCA 1R1IA 1A85A 4XBHA 4PKRA 1GO7P 1QJJA 2JIHA
chains in the Genus database with same CATH superfamily
1AYKA 1ZTQA 1CGLA 2EROA 1EB6A 2D1NA 4PKTA 3V96B 1BKCE 4FXQA 1ZXVA 1KUGA 1BUVM 1Y0VA 1XFUA 2JT5A 2AYKA 2Y6DA 4WF6A 4I03A 3DL1A 3DTEA 4GWNA 3LGPA 3KEKA 1OM8A 1BKCA 1JAPA 1J7NA 2A8HA 1OM7A 4AXQA 4PKSA 4PKVA 1QJIA 3F15A 1MMRA 1SMPA 1FBLA 2ERPA 2USNA 5B5PA 3AIGA 1ZS0A 1GO8P 1UMTA 1I73A 2WOAA 2OXZA 3EHXA 1XM5A 1H71P 4JQGA 2YUFA 3KMEA 3DTIA 1G49A 4DF9A 1MMBA 3HBVP 1JKYA 2PJTA 1GKDA 2OI0A 1XUCA 4HMAA 1CGEA 3RTTA 2N8RA 5L79A 2MZEA 1DTHA 4L19A 4Q1LA 4AUOA 2FV5A 2W0DA 1HY7A 4IN9A 1GE7A 1MMPA 1XFYA 1QIAA 4XM8A 3KMCA 2W12A 4CTHA 4GR3A 3LE9A 1UTTA 1JK3A 2X7MA 1OZ9A 2OXUA 4PKQA 2SRTA 1ZXCA 1L6JA 4ILWD 3B92A 3LJGA 1Q3AA 1ZVXA 2O36A 4DD8A 2I47A 3O64A 3DTKA 1XFVA 1JAQA 3KRYA 1ZP5A 3HY9A 2OW2A 1KUKA 2DW1A 1I1IP 3F17A 1ATLA 3HYGA 3TVCA 2YB9A 4WKEA 1SLMA 1K7GA 3G5CA 2DDFA 4WZVA 1MMQA 2OY2A 1JH1A 1EUBA 3AYKA 4ZR5A 3AYUA 2POJA 5BOYA 3EDGA 1UMSA 1KUIA 3F16A 4GR8A 3OHOA 5I2ZA 1AKLA 1BQQM 4GQLA 2DDYA 2J0TA 5B5OA 5I3MA 1SATA 1XUDA 3DWBA 2OW1A 5D2BA 2CLTA 1KUFA 3LUMA 3B2ZA 4H2EA 4ON1A 5D1SA 2OVZA 4JP4A 3EDIA 3N2VA 3DSLA 4PKWA 1IABA 2FV9A 1B8YA 4HX3A 3E8RA 1OM6A 1G05A 2D1OA 4JIJA 2DW0A 1IAGA 1SLNA 4H84A 2E2DA 2Z2DA 3DNGA 1JIZA 4AIGA 1R54A 1TVIA 4JA1A 1EAKA 3CKIA 1QICA 3WV2A 5CUHA 2XS3A 5L7FA 3L0VA 2HU6A 5I4OA 2K2GA 1D7XA 1ROSA 2JT6A 3TS4A 1HTDA 3VI1A 3TT4A 2V4BA 2QPJA 3ZXHA 4L7AA 3VTGA 3EWJA 2X3AA 3KWVC 4FU4A 5LABA 5D1TA 1KUHA 3KECA 4G9LA 4H30A 2X3BA 4L6TA 4L63A 2TCLA 4WKIA 3DPFA 1D8FA 3K7LA 2OW0A 2DW2A 1JAOA 1GE5A 1PWQA 3LQBA 3GBOA 5JMYA 1K7IA 2ERQA 4FVLA 1HOVA 3WV3A 1OMJA 3MA2A 1BM6A 1RMZA 3HDAP 1G12A 1YCMA 4GWMA 1OO9A 1Y8JA 2X3CA 1KAPP 1SU3A 3DPEA 3EDZA 1QUAA 4I35A 3ELMA 1DMTA 3LJTA 1PWVA 4H3XA 2W15A 1CGFA 1PWUA 3ZUKA 3LEAA 1A86A 1IAEA 4QKZA 4G0DA 2CKIA 5D7WA 3LILA 5BPAA 1ND1A 4GR0A 2OZRA 4A7BA 1CIZA 3K7NA 1CXVA 3N2UA 1D8MA 2O3EA 2OXWA 1O0QA 2OY4A 1IAAA 3F19A 5CZMA 1BQOA 3HBUP 2WO9A 1R1HA 3LQ0A 1D5JA 1IACA 1YP1A 1SRPA 3LMCA 1ASTA 1QIBA 1FM1A 3P1VA 5I43A 3LIRA 1BZSA 3HY7A 1JJ9A 3I7GA 5H8XA 2MLSA 2KRJA 2K9CA 2AIGP 4PKUA 1JANA 1USNA 3NX7A 3HB2P 4WK7A 2RJQA 456CA 3RTSA 4A3WA 2JNPA 1PWWA 2MZHA 4GUYA 3KEJA 5D1UA 3B8ZA 3Q2GA 1CAQA 4JPAA 1C7KA 966CA 5CXAA 1RM8A 2Y6CA 2WO8A 4H1QA 4IUWA 830CA 3I7IA 1UEAA 4XM6A 2W13A 1GKCA 1I76A 5I0LA 1BKCI 3L0TA 4IJOA 3HDBA 1UTZA 3EDHA 3ZVSA 4XM7A 4DPEA 4H82A 4FXYP 3OHLA 1B3DA 3KHIA 1GE6A 2MZIA 1CQRA 1BSWA 3USNA 3Q2HA 1G4KA 1CK7A 2W14A 2E3XA 1WNIA 4R3VA 1XURA 4GF1A 3O2XA 1XFWA 2OW9A 3G42A 1IADA 1AF0A 1YOUA 1O0TA 1BIWA 1R1JA 3LIKA 1XFXA 1XFZA 3SHIA 3P24A 3WV1A 4J4MA 3LJZA 1OS9A 2MLRA 3F18A 1MNCA 2JSDA 3EHYA 5BOTA 2OVXA 1C8TA 1Z3JA 1KBCA 3LUNA 1FLSA 4EFSA 1C3IA 5I12A 1BUDA 2RJPA 5D3CA 2XS4A 1S4BP 2J83A 2L0RA 3BA0A 3TSKA 1PWPA 1JIWP 4AYKA 3F1AA 2YIGA 4H49A 1OS2A 1YQYA 3U1RA 1HV5A 1Y93A 4H76A 3UVCA 3LKAA 1HFSA 1G9KA 4XCTA 3LK8A 1GXDA 1K7QA 4DV8A 1R55A 1HFCA 1R1IA 1A85A 1XAXA 4XBHA 4PKRA 1GO7P 1QJJA 2JIHA
chains in the Genus database with same CATH topology
1AYKA 1ZTQA 1CGLA 2EROA 1EB6A 2D1NA 4PKTA 3V96B 1BKCE 4FXQA 1ZXVA 1KUGA 1BUVM 1Y0VA 1XFUA 2JT5A 2AYKA 2Y6DA 4WF6A 4I03A 3DL1A 3DTEA 4GWNA 3LGPA 3KEKA 1OM8A 1BKCA 1JAPA 1J7NA 2A8HA 1OM7A 4AXQA 4PKSA 4PKVA 1QJIA 3F15A 1MMRA 1SMPA 1FBLA 2ERPA 2USNA 5B5PA 3AIGA 1ZS0A 1GO8P 1UMTA 1I73A 2WOAA 2OXZA 3EHXA 1H71P 4JQGA 2YUFA 3KMEA 3DTIA 1G49A 4DF9A 1MMBA 3HBVP 1JKYA 2PJTA 1GKDA 2OI0A 1XUCA 4HMAA 1CGEA 3RTTA 2N8RA 5L79A 2MZEA 1DTHA 4L19A 4Q1LA 4AUOA 2FV5A 2W0DA 1HY7A 4IN9A 1GE7A 1MMPA 1XFYA 1QIAA 4XM8A 3KMCA 2W12A 4CTHA 4GR3A 3LE9A 1UTTA 1JK3A 2X7MA 2OXUA 4PKQA 2SRTA 1ZXCA 1L6JA 4ILWD 3B92A 3LJGA 1Q3AA 1ZVXA 2O36A 4DD8A 2I47A 3O64A 3DTKA 1XFVA 1JAQA 3KRYA 1ZP5A 3HY9A 2OW2A 1KUKA 2DW1A 1I1IP 3F17A 1ATLA 3HYGA 3TVCA 2YB9A 4WKEA 1SLMA 1K7GA 3G5CA 2DDFA 4WZVA 1MMQA 2OY2A 1JH1A 1EUBA 3AYKA 4ZR5A 3AYUA 2POJA 5BOYA 3EDGA 1UMSA 1KUIA 3F16A 4GR8A 3OHOA 5I2ZA 1AKLA 1BQQM 4GQLA 2DDYA 2J0TA 5B5OA 5I3MA 1SATA 1XUDA 3DWBA 2OW1A 5D2BA 2CLTA 1KUFA 3LUMA 3B2ZA 4H2EA 4ON1A 5D1SA 2OVZA 4JP4A 3EDIA 3N2VA 3DSLA 4PKWA 1IABA 2FV9A 1B8YA 4HX3A 3E8RA 1OM6A 1G05A 2D1OA 4JIJA 2DW0A 1IAGA 1SLNA 4H84A 2E2DA 2Z2DA 3DNGA 1JIZA 4AIGA 1R54A 4JA1A 1EAKA 3CKIA 1QICA 3WV2A 5CUHA 2XS3A 5L7FA 3L0VA 2HU6A 5I4OA 2K2GA 1D7XA 1ROSA 2JT6A 3TS4A 1HTDA 3VI1A 3TT4A 2V4BA 2QPJA 3ZXHA 4L7AA 3VTGA 3EWJA 2X3AA 3KWVC 4FU4A 5LABA 5D1TA 1KUHA 3KECA 4G9LA 4H30A 2X3BA 4L6TA 4L63A 2TCLA 4WKIA 3DPFA 1D8FA 3K7LA 2OW0A 2DW2A 1JAOA 1GE5A 1PWQA 3LQBA 3GBOA 5JMYA 1K7IA 2ERQA 4FVLA 1HOVA 3WV3A 1OMJA 3MA2A 1BM6A 1RMZA 3HDAP 1G12A 1YCMA 4GWMA 1OO9A 1Y8JA 2X3CA 1KAPP 1SU3A 3DPEA 3EDZA 1QUAA 4I35A 3ELMA 1DMTA 3LJTA 1PWVA 4H3XA 2W15A 1CGFA 1PWUA 3ZUKA 3LEAA 1A86A 1IAEA 4QKZA 4G0DA 2CKIA 5D7WA 3LILA 5BPAA 1ND1A 4GR0A 2OZRA 4A7BA 1CIZA 3K7NA 1CXVA 3N2UA 1D8MA 2O3EA 2OXWA 1O0QA 2OY4A 1IAAA 3F19A 5CZMA 1BQOA 3HBUP 2WO9A 1R1HA 3LQ0A 1D5JA 1IACA 1YP1A 1SRPA 3LMCA 1ASTA 1QIBA 1FM1A 3P1VA 5I43A 3LIRA 1BZSA 3HY7A 1JJ9A 3I7GA 5H8XA 2MLSA 2KRJA 2K9CA 2AIGP 4PKUA 1JANA 1USNA 3NX7A 3HB2P 4WK7A 2RJQA 456CA 3RTSA 4A3WA 2JNPA 1PWWA 2MZHA 4GUYA 3KEJA 5D1UA 3B8ZA 3Q2GA 1CAQA 4JPAA 1C7KA 966CA 5CXAA 1RM8A 2Y6CA 2WO8A 4H1QA 4IUWA 830CA 3I7IA 1UEAA 4XM6A 2W13A 1GKCA 1I76A 5I0LA 1BKCI 3L0TA 4IJOA 3HDBA 1UTZA 3EDHA 3ZVSA 4XM7A 4DPEA 4H82A 4FXYP 3OHLA 1B3DA 3KHIA 1GE6A 2MZIA 1CQRA 1BSWA 3USNA 3Q2HA 1G4KA 1CK7A 2W14A 2E3XA 1WNIA 4R3VA 1XURA 4GF1A 3O2XA 1XFWA 2OW9A 3G42A 1IADA 1AF0A 1YOUA 1O0TA 1BIWA 1R1JA 3LIKA 1XFXA 1XFZA 3SHIA 3P24A 3WV1A 4J4MA 3LJZA 1OS9A 2MLRA 3F18A 1MNCA 2JSDA 3EHYA 5BOTA 2OVXA 1C8TA 1Z3JA 1KBCA 3LUNA 1FLSA 4EFSA 1C3IA 5I12A 1BUDA 2RJPA 5D3CA 2XS4A 1S4BP 2J83A 2L0RA 3BA0A 3TSKA 1PWPA 1JIWP 4AYKA 3F1AA 2YIGA 4H49A 1OS2A 1YQYA 3U1RA 1HV5A 1Y93A 4H76A 3UVCA 3LKAA 1HFSA 1G9KA 4XCTA 3LK8A 1GXDA 1K7QA 4DV8A 1R55A 1HFCA 1R1IA 1A85A 4XBHA 4PKRA 1GO7P 1QJJA 2JIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AYK A;  1ZTQ A;  1CGL A;  2ERO A;  1EB6 A;  2D1N A;  4PKT A;  3V96 B;  1BKC E;  4FXQ A;  1ZXV A;  1KUG A;  1BUV M;  1Y0V A;  1XFU A;  2JT5 A;  2AYK A;  2Y6D A;  4WF6 A;  4I03 A;  3DL1 A;  4GWN A;  3LGP A;  3KEK A;  1OM8 A;  1BKC A;  1JAP A;  1J7N A;  2A8H A;  1OM7 A;  4AXQ A;  4PKS A;  4PKV A;  1QJI A;  3F15 A;  1MMR A;  1SMP A;  1FBL A;  2ERP A;  2USN A;  5B5P A;  3AIG A;  1ZS0 A;  1GO8 P;  1UMT A;  1I73 A;  2WOA A;  2OXZ A;  3EHX A;  1H71 P;  4JQG A;  3KME A;  1G49 A;  4DF9 A;  1MMB A;  3HBV P;  1JKY A;  2PJT A;  1GKD A;  2OI0 A;  1XUC A;  4HMA A;  1CGE A;  3RTT A;  2N8R A;  5L79 A;  2MZE A;  1DTH A;  4L19 A;  4Q1L A;  4AUO A;  2FV5 A;  2W0D A;  1HY7 A;  4IN9 A;  1GE7 A;  1MMP A;  1XFY A;  1QIA A;  4XM8 A;  3KMC A;  2W12 A;  4CTH A;  4GR3 A;  3LE9 A;  1UTT A;  1JK3 A;  2X7M A;  2OXU A;  4PKQ A;  2SRT A;  1ZXC A;  1L6J A;  4ILW D;  3B92 A;  3LJG A;  1Q3A A;  1ZVX A;  2O36 A;  4DD8 A;  2I47 A;  3O64 A;  1XFV A;  1JAQ A;  3KRY A;  1ZP5 A;  3HY9 A;  2OW2 A;  1KUK A;  2DW1 A;  1I1I P;  3F17 A;  1ATL A;  3HYG A;  3TVC A;  2YB9 A;  4WKE A;  1SLM A;  1K7G A;  3G5C A;  2DDF A;  4WZV A;  1MMQ A;  2OY2 A;  1JH1 A;  1EUB A;  3AYK A;  4ZR5 A;  3AYU A;  2POJ A;  5BOY A;  3EDG A;  1UMS A;  1KUI A;  3F16 A;  4GR8 A;  3OHO A;  5I2Z A;  1AKL A;  1BQQ M;  4GQL A;  2DDY A;  2J0T A;  5B5O A;  5I3M A;  1SAT A;  1XUD A;  3DWB A;  2OW1 A;  5D2B A;  2CLT A;  1KUF A;  3LUM A;  3B2Z A;  4H2E A;  4ON1 A;  5D1S A;  2OVZ A;  4JP4 A;  3EDI A;  3N2V A;  3DSL A;  4PKW A;  1IAB A;  2FV9 A;  1B8Y A;  4HX3 A;  3E8R A;  1OM6 A;  1G05 A;  2D1O A;  4JIJ A;  2DW0 A;  1IAG A;  1SLN A;  4H84 A;  2E2D A;  2Z2D A;  3DNG A;  1JIZ A;  4AIG A;  1R54 A;  4JA1 A;  1EAK A;  3CKI A;  1QIC A;  3WV2 A;  5CUH A;  2XS3 A;  5L7F A;  3L0V A;  2HU6 A;  5I4O A;  2K2G A;  1D7X A;  1ROS A;  2JT6 A;  3TS4 A;  1HTD A;  3VI1 A;  3TT4 A;  2V4B A;  2QPJ A;  3ZXH A;  3VTG A;  3EWJ A;  2X3A A;  3KWV C;  4FU4 A;  5LAB A;  5D1T A;  1KUH A;  3KEC A;  4G9L A;  4H30 A;  2X3B A;  4L6T A;  4L63 A;  2TCL A;  4WKI A;  3DPF A;  1D8F A;  3K7L A;  2OW0 A;  2DW2 A;  1JAO A;  1GE5 A;  1PWQ A;  3LQB A;  3GBO A;  5JMY A;  1K7I A;  2ERQ A;  4FVL A;  1HOV A;  3WV3 A;  1OMJ A;  3MA2 A;  1BM6 A;  1RMZ A;  3HDA P;  1G12 A;  1YCM A;  4GWM A;  1OO9 A;  1Y8J A;  2X3C A;  1KAP P;  1SU3 A;  3DPE A;  3EDZ A;  1QUA A;  4I35 A;  3ELM A;  1DMT A;  3LJT A;  1PWV A;  4H3X A;  2W15 A;  1CGF A;  1PWU A;  3ZUK A;  3LEA A;  1A86 A;  1IAE A;  4QKZ A;  4G0D A;  2CKI A;  5D7W A;  3LIL A;  5BPA A;  1ND1 A;  4GR0 A;  2OZR A;  4A7B A;  1CIZ A;  3K7N A;  1CXV A;  3N2U A;  1D8M A;  2O3E A;  2OXW A;  1O0Q A;  2OY4 A;  1IAA A;  3F19 A;  5CZM A;  1BQO A;  3HBU P;  2WO9 A;  1R1H A;  3LQ0 A;  1D5J A;  1IAC A;  1YP1 A;  1SRP A;  3LMC A;  1AST A;  1QIB A;  1FM1 A;  3P1V A;  5I43 A;  3LIR A;  1BZS A;  3HY7 A;  1JJ9 A;  3I7G A;  5H8X A;  2MLS A;  2KRJ A;  2K9C A;  2AIG P;  4PKU A;  1JAN A;  1USN A;  3NX7 A;  3HB2 P;  4WK7 A;  2RJQ A;  456C A;  3RTS A;  4A3W A;  2JNP A;  1PWW A;  2MZH A;  4GUY A;  3KEJ A;  5D1U A;  3B8Z A;  3Q2G A;  1CAQ A;  4JPA A;  1C7K A;  966C A;  5CXA A;  1RM8 A;  2Y6C A;  2WO8 A;  4H1Q A;  4IUW A;  830C A;  3I7I A;  1UEA A;  4XM6 A;  2W13 A;  1GKC A;  1I76 A;  5I0L A;  1BKC I;  3L0T A;  4IJO A;  3HDB A;  1UTZ A;  3EDH A;  3ZVS A;  4XM7 A;  4DPE A;  4H82 A;  4FXY P;  3OHL A;  1B3D A;  3KHI A;  1GE6 A;  2MZI A;  1CQR A;  1BSW A;  3USN A;  3Q2H A;  1G4K A;  1CK7 A;  2W14 A;  2E3X A;  1WNI A;  4R3V A;  1XUR A;  4GF1 A;  3O2X A;  1XFW A;  2OW9 A;  3G42 A;  1IAD A;  1AF0 A;  1YOU A;  1O0T A;  1BIW A;  1R1J A;  3LIK A;  1XFX A;  1XFZ A;  3SHI A;  3P24 A;  3WV1 A;  4J4M A;  3LJZ A;  1OS9 A;  2MLR A;  3F18 A;  1MNC A;  2JSD A;  3EHY A;  5BOT A;  2OVX A;  1C8T A;  1Z3J A;  1KBC A;  3LUN A;  1FLS A;  4EFS A;  1C3I A;  5I12 A;  1BUD A;  2RJP A;  5D3C A;  2XS4 A;  1S4B P;  2J83 A;  2L0R A;  3BA0 A;  3TSK A;  1PWP A;  1JIW P;  4AYK A;  3F1A A;  2YIG A;  4H49 A;  1OS2 A;  1YQY A;  3U1R A;  1HV5 A;  1Y93 A;  4H76 A;  3UVC A;  3LKA A;  1HFS A;  1G9K A;  4XCT A;  3LK8 A;  1GXD A;  1K7Q A;  4DV8 A;  1R55 A;  1HFC A;  1R1I A;  1A85 A;  4XBH A;  4PKR A;  1GO7 P;  1QJJ A;  2JIH A; 
#chains in the Genus database with same CATH topology
 1AYK A;  1ZTQ A;  1CGL A;  2ERO A;  1EB6 A;  2D1N A;  4PKT A;  3V96 B;  1BKC E;  4FXQ A;  1ZXV A;  1KUG A;  1BUV M;  1Y0V A;  1XFU A;  2JT5 A;  2AYK A;  2Y6D A;  4WF6 A;  4I03 A;  3DL1 A;  3DTE A;  4GWN A;  3LGP A;  3KEK A;  1OM8 A;  1BKC A;  1JAP A;  1J7N A;  2A8H A;  1OM7 A;  4AXQ A;  4PKS A;  4PKV A;  1QJI A;  3F15 A;  1MMR A;  1SMP A;  1FBL A;  2ERP A;  2USN A;  5B5P A;  3AIG A;  1ZS0 A;  1GO8 P;  1UMT A;  1I73 A;  2WOA A;  2OXZ A;  3EHX A;  1XM5 A;  1H71 P;  4JQG A;  2YUF A;  3KME A;  3DTI A;  1G49 A;  4DF9 A;  1MMB A;  3HBV P;  1JKY A;  2PJT A;  1GKD A;  2OI0 A;  1XUC A;  4HMA A;  1CGE A;  3RTT A;  2N8R A;  5L79 A;  2MZE A;  1DTH A;  4L19 A;  4Q1L A;  4AUO A;  2FV5 A;  2W0D A;  1HY7 A;  4IN9 A;  1GE7 A;  1MMP A;  1XFY A;  1QIA A;  4XM8 A;  3KMC A;  2W12 A;  4CTH A;  4GR3 A;  3LE9 A;  1UTT A;  1JK3 A;  2X7M A;  1OZ9 A;  2OXU A;  4PKQ A;  2SRT A;  1ZXC A;  1L6J A;  4ILW D;  3B92 A;  3LJG A;  1Q3A A;  1ZVX A;  2O36 A;  4DD8 A;  2I47 A;  3O64 A;  3DTK A;  1XFV A;  1JAQ A;  3KRY A;  1ZP5 A;  3HY9 A;  2OW2 A;  1KUK A;  2DW1 A;  1I1I P;  3F17 A;  1ATL A;  3HYG A;  3TVC A;  2YB9 A;  4WKE A;  1SLM A;  1K7G A;  3G5C A;  2DDF A;  4WZV A;  1MMQ A;  2OY2 A;  1JH1 A;  1EUB A;  3AYK A;  4ZR5 A;  3AYU A;  2POJ A;  5BOY A;  3EDG A;  1UMS A;  1KUI A;  3F16 A;  4GR8 A;  3OHO A;  5I2Z A;  1AKL A;  1BQQ M;  4GQL A;  2DDY A;  2J0T A;  5B5O A;  5I3M A;  1SAT A;  1XUD A;  3DWB A;  2OW1 A;  5D2B A;  2CLT A;  1KUF A;  3LUM A;  3B2Z A;  4H2E A;  4ON1 A;  5D1S A;  2OVZ A;  4JP4 A;  3EDI A;  3N2V A;  3DSL A;  4PKW A;  1IAB A;  2FV9 A;  1B8Y A;  4HX3 A;  3E8R A;  1OM6 A;  1G05 A;  2D1O A;  4JIJ A;  2DW0 A;  1IAG A;  1SLN A;  4H84 A;  2E2D A;  2Z2D A;  3DNG A;  1JIZ A;  4AIG A;  1R54 A;  1TVI A;  4JA1 A;  1EAK A;  3CKI A;  1QIC A;  3WV2 A;  5CUH A;  2XS3 A;  5L7F A;  3L0V A;  2HU6 A;  5I4O A;  2K2G A;  1D7X A;  1ROS A;  2JT6 A;  3TS4 A;  1HTD A;  3VI1 A;  3TT4 A;  2V4B A;  2QPJ A;  3ZXH A;  4L7A A;  3VTG A;  3EWJ A;  2X3A A;  3KWV C;  4FU4 A;  5LAB A;  5D1T A;  1KUH A;  3KEC A;  4G9L A;  4H30 A;  2X3B A;  4L6T A;  4L63 A;  2TCL A;  4WKI A;  3DPF A;  1D8F A;  3K7L A;  2OW0 A;  2DW2 A;  1JAO A;  1GE5 A;  1PWQ A;  3LQB A;  3GBO A;  5JMY A;  1K7I A;  2ERQ A;  4FVL A;  1HOV A;  3WV3 A;  1OMJ A;  3MA2 A;  1BM6 A;  1RMZ A;  3HDA P;  1G12 A;  1YCM A;  4GWM A;  1OO9 A;  1Y8J A;  2X3C A;  1KAP P;  1SU3 A;  3DPE A;  3EDZ A;  1QUA A;  4I35 A;  3ELM A;  1DMT A;  3LJT A;  1PWV A;  4H3X A;  2W15 A;  1CGF A;  1PWU A;  3ZUK A;  3LEA A;  1A86 A;  1IAE A;  4QKZ A;  4G0D A;  2CKI A;  5D7W A;  3LIL A;  5BPA A;  1ND1 A;  4GR0 A;  2OZR A;  4A7B A;  1CIZ A;  3K7N A;  1CXV A;  3N2U A;  1D8M A;  2O3E A;  2OXW A;  1O0Q A;  2OY4 A;  1IAA A;  3F19 A;  5CZM A;  1BQO A;  3HBU P;  2WO9 A;  1R1H A;  3LQ0 A;  1D5J A;  1IAC A;  1YP1 A;  1SRP A;  3LMC A;  1AST A;  1QIB A;  1FM1 A;  3P1V A;  5I43 A;  3LIR A;  1BZS A;  3HY7 A;  1JJ9 A;  3I7G A;  5H8X A;  2MLS A;  2KRJ A;  2K9C A;  2AIG P;  4PKU A;  1JAN A;  1USN A;  3NX7 A;  3HB2 P;  4WK7 A;  2RJQ A;  456C A;  3RTS A;  4A3W A;  2JNP A;  1PWW A;  2MZH A;  4GUY A;  3KEJ A;  5D1U A;  3B8Z A;  3Q2G A;  1CAQ A;  4JPA A;  1C7K A;  966C A;  5CXA A;  1RM8 A;  2Y6C A;  2WO8 A;  4H1Q A;  4IUW A;  830C A;  3I7I A;  1UEA A;  4XM6 A;  2W13 A;  1GKC A;  1I76 A;  5I0L A;  1BKC I;  3L0T A;  4IJO A;  3HDB A;  1UTZ A;  3EDH A;  3ZVS A;  4XM7 A;  4DPE A;  4H82 A;  4FXY P;  3OHL A;  1B3D A;  3KHI A;  1GE6 A;  2MZI A;  1CQR A;  1BSW A;  3USN A;  3Q2H A;  1G4K A;  1CK7 A;  2W14 A;  2E3X A;  1WNI A;  4R3V A;  1XUR A;  4GF1 A;  3O2X A;  1XFW A;  2OW9 A;  3G42 A;  1IAD A;  1AF0 A;  1YOU A;  1O0T A;  1BIW A;  1R1J A;  3LIK A;  1XFX A;  1XFZ A;  3SHI A;  3P24 A;  3WV1 A;  4J4M A;  3LJZ A;  1OS9 A;  2MLR A;  3F18 A;  1MNC A;  2JSD A;  3EHY A;  5BOT A;  2OVX A;  1C8T A;  1Z3J A;  1KBC A;  3LUN A;  1FLS A;  4EFS A;  1C3I A;  5I12 A;  1BUD A;  2RJP A;  5D3C A;  2XS4 A;  1S4B P;  2J83 A;  2L0R A;  3BA0 A;  3TSK A;  1PWP A;  1JIW P;  4AYK A;  3F1A A;  2YIG A;  4H49 A;  1OS2 A;  1YQY A;  3U1R A;  1HV5 A;  1Y93 A;  4H76 A;  3UVC A;  3LKA A;  1HFS A;  1G9K A;  4XCT A;  3LK8 A;  1GXD A;  1K7Q A;  4DV8 A;  1R55 A;  1HFC A;  1R1I A;  1A85 A;  1XAX A;  4XBH A;  4PKR A;  1GO7 P;  1QJJ A;  2JIH A; 
#chains in the Genus database with same CATH homology
 1AYK A;  1ZTQ A;  1CGL A;  2ERO A;  1EB6 A;  2D1N A;  4PKT A;  3V96 B;  1BKC E;  4FXQ A;  1ZXV A;  1KUG A;  1BUV M;  1Y0V A;  1XFU A;  2JT5 A;  2AYK A;  2Y6D A;  4WF6 A;  4I03 A;  3DL1 A;  3DTE A;  4GWN A;  3LGP A;  3KEK A;  1OM8 A;  1BKC A;  1JAP A;  1J7N A;  2A8H A;  1OM7 A;  4AXQ A;  4PKS A;  4PKV A;  1QJI A;  3F15 A;  1MMR A;  1SMP A;  1FBL A;  2ERP A;  2USN A;  5B5P A;  3AIG A;  1ZS0 A;  1GO8 P;  1UMT A;  1I73 A;  2WOA A;  2OXZ A;  3EHX A;  1H71 P;  4JQG A;  2YUF A;  3KME A;  3DTI A;  1G49 A;  4DF9 A;  1MMB A;  3HBV P;  1JKY A;  2PJT A;  1GKD A;  2OI0 A;  1XUC A;  4HMA A;  1CGE A;  3RTT A;  2N8R A;  5L79 A;  2MZE A;  1DTH A;  4L19 A;  4Q1L A;  4AUO A;  2FV5 A;  2W0D A;  1HY7 A;  4IN9 A;  1GE7 A;  1MMP A;  1XFY A;  1QIA A;  4XM8 A;  3KMC A;  2W12 A;  4CTH A;  4GR3 A;  3LE9 A;  1UTT A;  1JK3 A;  2X7M A;  2OXU A;  4PKQ A;  2SRT A;  1ZXC A;  1L6J A;  4ILW D;  3B92 A;  3LJG A;  1Q3A A;  1ZVX A;  2O36 A;  4DD8 A;  2I47 A;  3O64 A;  3DTK A;  1XFV A;  1JAQ A;  3KRY A;  1ZP5 A;  3HY9 A;  2OW2 A;  1KUK A;  2DW1 A;  1I1I P;  3F17 A;  1ATL A;  3HYG A;  3TVC A;  2YB9 A;  4WKE A;  1SLM A;  1K7G A;  3G5C A;  2DDF A;  4WZV A;  1MMQ A;  2OY2 A;  1JH1 A;  1EUB A;  3AYK A;  4ZR5 A;  3AYU A;  2POJ A;  5BOY A;  3EDG A;  1UMS A;  1KUI A;  3F16 A;  4GR8 A;  3OHO A;  5I2Z A;  1AKL A;  1BQQ M;  4GQL A;  2DDY A;  2J0T A;  5B5O A;  5I3M A;  1SAT A;  1XUD A;  3DWB A;  2OW1 A;  5D2B A;  2CLT A;  1KUF A;  3LUM A;  3B2Z A;  4H2E A;  4ON1 A;  5D1S A;  2OVZ A;  4JP4 A;  3EDI A;  3N2V A;  3DSL A;  4PKW A;  1IAB A;  2FV9 A;  1B8Y A;  4HX3 A;  3E8R A;  1OM6 A;  1G05 A;  2D1O A;  4JIJ A;  2DW0 A;  1IAG A;  1SLN A;  4H84 A;  2E2D A;  2Z2D A;  3DNG A;  1JIZ A;  4AIG A;  1R54 A;  4JA1 A;  1EAK A;  3CKI A;  1QIC A;  3WV2 A;  5CUH A;  2XS3 A;  5L7F A;  3L0V A;  2HU6 A;  5I4O A;  2K2G A;  1D7X A;  1ROS A;  2JT6 A;  3TS4 A;  1HTD A;  3VI1 A;  3TT4 A;  2V4B A;  2QPJ A;  3ZXH A;  4L7A A;  3VTG A;  3EWJ A;  2X3A A;  3KWV C;  4FU4 A;  5LAB A;  5D1T A;  1KUH A;  3KEC A;  4G9L A;  4H30 A;  2X3B A;  4L6T A;  4L63 A;  2TCL A;  4WKI A;  3DPF A;  1D8F A;  3K7L A;  2OW0 A;  2DW2 A;  1JAO A;  1GE5 A;  1PWQ A;  3LQB A;  3GBO A;  5JMY A;  1K7I A;  2ERQ A;  4FVL A;  1HOV A;  3WV3 A;  1OMJ A;  3MA2 A;  1BM6 A;  1RMZ A;  3HDA P;  1G12 A;  1YCM A;  4GWM A;  1OO9 A;  1Y8J A;  2X3C A;  1KAP P;  1SU3 A;  3DPE A;  3EDZ A;  1QUA A;  4I35 A;  3ELM A;  1DMT A;  3LJT A;  1PWV A;  4H3X A;  2W15 A;  1CGF A;  1PWU A;  3ZUK A;  3LEA A;  1A86 A;  1IAE A;  4QKZ A;  4G0D A;  2CKI A;  5D7W A;  3LIL A;  5BPA A;  1ND1 A;  4GR0 A;  2OZR A;  4A7B A;  1CIZ A;  3K7N A;  1CXV A;  3N2U A;  1D8M A;  2O3E A;  2OXW A;  1O0Q A;  2OY4 A;  1IAA A;  3F19 A;  5CZM A;  1BQO A;  3HBU P;  2WO9 A;  1R1H A;  3LQ0 A;  1D5J A;  1IAC A;  1YP1 A;  1SRP A;  3LMC A;  1AST A;  1QIB A;  1FM1 A;  3P1V A;  5I43 A;  3LIR A;  1BZS A;  3HY7 A;  1JJ9 A;  3I7G A;  5H8X A;  2MLS A;  2KRJ A;  2K9C A;  2AIG P;  4PKU A;  1JAN A;  1USN A;  3NX7 A;  3HB2 P;  4WK7 A;  2RJQ A;  456C A;  3RTS A;  4A3W A;  2JNP A;  1PWW A;  2MZH A;  4GUY A;  3KEJ A;  5D1U A;  3B8Z A;  3Q2G A;  1CAQ A;  4JPA A;  1C7K A;  966C A;  5CXA A;  1RM8 A;  2Y6C A;  2WO8 A;  4H1Q A;  4IUW A;  830C A;  3I7I A;  1UEA A;  4XM6 A;  2W13 A;  1GKC A;  1I76 A;  5I0L A;  1BKC I;  3L0T A;  4IJO A;  3HDB A;  1UTZ A;  3EDH A;  3ZVS A;  4XM7 A;  4DPE A;  4H82 A;  4FXY P;  3OHL A;  1B3D A;  3KHI A;  1GE6 A;  2MZI A;  1CQR A;  1BSW A;  3USN A;  3Q2H A;  1G4K A;  1CK7 A;  2W14 A;  2E3X A;  1WNI A;  4R3V A;  1XUR A;  4GF1 A;  3O2X A;  1XFW A;  2OW9 A;  3G42 A;  1IAD A;  1AF0 A;  1YOU A;  1O0T A;  1BIW A;  1R1J A;  3LIK A;  1XFX A;  1XFZ A;  3SHI A;  3P24 A;  3WV1 A;  4J4M A;  3LJZ A;  1OS9 A;  2MLR A;  3F18 A;  1MNC A;  2JSD A;  3EHY A;  5BOT A;  2OVX A;  1C8T A;  1Z3J A;  1KBC A;  3LUN A;  1FLS A;  4EFS A;  1C3I A;  5I12 A;  1BUD A;  2RJP A;  5D3C A;  2XS4 A;  1S4B P;  2J83 A;  2L0R A;  3BA0 A;  3TSK A;  1PWP A;  1JIW P;  4AYK A;  3F1A A;  2YIG A;  4H49 A;  1OS2 A;  1YQY A;  3U1R A;  1HV5 A;  1Y93 A;  4H76 A;  3UVC A;  3LKA A;  1HFS A;  1G9K A;  4XCT A;  3LK8 A;  1GXD A;  1K7Q A;  4DV8 A;  1R55 A;  1HFC A;  1R1I A;  1A85 A;  4XBH A;  4PKR A;  1GO7 P;  1QJJ A;  2JIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...