1G18A

Reca-adp-alf4 complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
327
structure length
310
Chain Sequence
QTPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMHVGLQARLMSQALRKMTGALNNSGTTAIFINQLTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCLAPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECA PROTEIN
publication title Crystal structures of Mycobacterium tuberculosis RecA and its complex with ADP-AlF(4): implications for decreased ATPase activity and molecular aggregation
pubmed doi rcsb
molecule tags Hydrolase
total genus 81
structure length 310
sequence length 327
ec nomenclature ec 3.1.-.-:
pdb deposition date 2000-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 1g18A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g18A01
4GNKA 2IXFA 3LQQA 5FPHA 3EZ2A 3SC3A 2HT1A 4G01B 2PMDA 1GNRA 5ANRB 5KU1A 1ESNA 5FL7D 4B74A 1DG1G 3O8CA 1GNPA 3BORA 4GP7A 1T3SA 1P75A 2IF0A 2NOAA 3KKQA 4ZDKA 3HU3A 5D3MA 3PUZA 2DFNA 3IGFA 3BERA 4UJ5A 2W00A 1E0AA 3NC1C 5G3ZA 1XCPA 5G41A 2ZJZA 1IN6A 1EXMA 3AUYA 1CULC 4Q1AA 4WZBE 5HE9A 4Z8YA 3KQUA 2J9RA 2Z0MA 4YXWD 4YMWA 4RD0A 1ZM9A 2P6RA 3CRMA 2DYKA 2H1LA 2OLKA 1E99A 4YQFA 2OV2A 4GI7A 2D06A 4M1KA 2Q3MA 1M7HA 5CJ2A 3Q85A 5FOTA 4EKDA 4POAA 3CRVA 2QTVB 1P2UA 3GJ4A 3QBVA 2H57A 2CXXA 4AD8A 1W36B 4DIDA 4I99A 2VBCA 1Z28A 4HDQB 5FPTA 5KTYA 4XWOA 4O2LA 4YDSA 5H1YA 2OM2A 2C98A 2TMKA 3IHWA 2RGNA 2NG1A 2QMUA 4WXPA 5E95A 3RLFA 3I5XA 4JVLA 3TUZC 3R8FA 1ZCAA 4MQBA 2C9CA 5FPYA 3WMFA 4P33A 4B3XA 1WCV1 4LC0A 1E4YA 4CZ2A 1KDOA 3F8TA 4EFNA 1D9ZA 3D8BA 3P32A 4B2PA 1N0VC 2DFTA 1JJ7A 2ORVA 1US8A 5DH9A 5KNBA 4O3MA 1VG9B 4URVR 1WE2A 2CDNA 3R9WA 3CLVA 1R0ZA 2GESA 2GAAA 1PZNA 4W5JA 2NO1A 3WHKA 2XAUA 2ZVQX 1XJCA 4PR0A 2B7BA 4QL3A 5C46F 1XPOA 5KNCA 4U00A 1ZNZA 2QY9A 1EFRD 3B60A 4JIMA 2R44A 4RFVA 5DIFA 4UNRA 4RZ2A 3ZJYA 2PZEA 3EZ6A 3LDAA 3EIQA 3GLHB 3R7WB 5J4KA 1AK2A 3VKGA 2CL6X 5CIQA 4EQ6A 5BN5A 3RANA 4IFBA 1XEXA 3SHWA 3LLMA 2GXSA 4R9UC 1G3IA 2HJVA 2GEDA 1Z0IA 2OAP1 1G7CA 3SJCA 5D3QA 121PA 5FTLA 2BJVA 1F48A 3CNOA 3RRNA 2ZAMA 4FINA 3JZMA 1J99A 4Q01A 5FUWA 1M2OB 4I1OA 5DISB 2J7PD 3TLXA 3FKQA 3V00A 4CEHB 1G64A 1IHUA 4QBFA 1FUKA 5CM9C 3WP0A 4OL0A 4A0FA 1ZNXA 3KJEA 3OEHA 4LK2A 4QGHA 2W6ID 3TR5A 1Z29A 4B3FX 4LYJA 5FTNA 4A8JC 1JB1A 4QNMA 4AK9A 3THXA 3GFPA 5G3YA 2G0TA 2FSGA 2QSZA 4Y0VA 1IONA 1OIXA 4MGKR 4LJ6A 4MYHA 1P2SA 1E9EA 2PX3A 2WAYA 2P6UA 1M7BA 1EESA 1P6XA 3C16C 1KJYA 4CT4B 4UNQA 5GJCA 2WBLC 1T4GA 4PQRA 1KI7A 2QT0A 4B34A 721PA 4LYFA 3EWSA 2A5FA 1L4UA 4Q4AA 4R71A 4GMDA 1G20E 1F2TB 2CLCX 1GAJA 1OYWA 3TAUA 1JPNA 2J0SA 2QAGA 2P3SA 2QU8A 3UXMA 3CRQA 4BFWA 4KI0A 1Z0FA 2J3EA 4BPBA 3IHLA 3U4QA 3TK1A 1EFUA 2ZI4A 1L4YA 3IEUA 5JLJA 1J8MF 4HYYA 3TQFA 4Q7JB 1H8EA 3KQLA 2ODEA 2OCYC 3U3RA 2MMGA 1GP2A 1HH4A 2OZEA 3P20A 1NP6A 2AXNA 1OHHA 2YNMA 3DPUA 1ZC3A 3G82C 3GD7A 3RWOA 2XSZA 3C7KA 5HZHA 3EZ7A 3FTQA 1XXHE 2RGEA 4C9BA 4U7DA 3OAAD 3LBHA 1JJVA 5BN4A 5FBRB 1QHSA 1E98A 3PR1A 5L3RA 4HATA 4TN1A 3A1VA 1AGRA 1E1QA 2VIIA 3MFYA 5JBQA 1T8TA 2H8KA 3NBZC 4ZDJA 3Q7PA 2VYFA 4XSHA 2IS1A 2V7QD 3U3OA 3FYHA 3L8ZA 3O8BA 2O8FB 3X1ZA 2GEUA 3ZVRA 2ZI9A 4C3ZA 1RRCA 4HUTA 2JLSA 1UKEA 1P73A 1TU4A 2A7QA 2B7CA 4RSGA 2ZEJA 4M1OA 4MKGA 2ZR9A 5C4MA 3E1SA 2QAGC 1XEWY 4TMZA 4LJYA 1M1YE 2J0UB 4FXPA 3K0AA 4TT3A 2KI5A 2YWFA 5HZKA 2F3RA 3DMDA 1RKBA 2YC2C 1N25A 4RD3A 4ZPXA 4UKDA 4RCZA 4GOKA 4H9GA 4TLEA 4Q4LA 5JFGA 2OO7A 1EX7A 1II9A 2QPOA 3AP1A 4UQOA 5KPDA 1N6LA 2VPPA 4JT2A 3CO5A 3O8RA 2JIZA 1TQ2A 3IUYA 1WXQA 2QMOA 4D0NA 4M22A 3K9NA 1O87A 4NTZA 2J5XA 2FEOA 2YC4C 1W36C 4GDFA 5DI3B 3GLGB 1GUAA 2ZYUX 3W6OA 1G7RA 2FPLA 4DSUA 4X8OA 1YZQA 3MRSA 2QORA 3QKTA 3T5GA 4F4IA 1B23P 4WXRA 3WMGA 2IHYA 4JMPA 4TZ6A 5K8LA 3KB2A 4NONA 2FSFA 3FFBA 2O8BB 2RHDA 2JCSA 3ZZ0A 1OV4A 1KY3A 1E2LA 3KX2A 2CVFA 1M74A 4ZI2A 1X8JA 4EIWA 1NLFA 2ZTSA 3GLIB 1BYUA 1SKQA 1WP9A 2YWEA 4A4DA 4YMUA 5JI3E 1XRJA 4RZUA 1O3YA 4S35A 1M8PA 1NLZA 1FNNA 3KJHA 1II8A 5H70A 1YZTA 1XMSA 1NVXQ 2I1VB 3AF1A 3O47A 4EJSB 2F9LA 2VO1A 5FUXA 1EFCA 3B8HA 3QEOA 4XTRA 2VLIA 3DVLA 3S1AA 5KSZA 1KO4A 2O52A 4V03A 1M6NA 2BMJA 2GF9A 3AVTA 2L0XA 2OXRA 2YOHA 1G6HA 1E2GA 4DEYA 2ZRDA 4TL9A 1KZGB 1E2HA 3W9YA 1DVRA 3WYAA 2QGNA 5FL3A 2B8WA 3VKHA 2ZREA 1NF3A 4ON9A 2NMVA 2K5UA 1I2MA 1BMFA 4PO1A 4ZO4A 5K8TA 1Z47A 5KHOC 1RE0A 3SQWA 1AA3A 1XU4A 2QPTA 1SQ5A 5EQTA 1ESMA 3KFVA 2Q9BA 1XWIA 3TVTA 3OZXA 4M2LA 1PVOA 4PAQA 3RWMB 1U98A 5F3WB 1AA9A 3I61A 4GMXA 1E1RD 3RS4A 2YVUA 3AF2A 3CIOA 2VF7A 4NP6A 1TMKA 1GL7A 1W49A 1MKYA 4NMMA 4A2PA 4C0BA 1N6KA 3VR6A 3IKJA 1A2BA 2G88A 3UMFA 2BDTA 4IEIA 3GJ5A 2W0SA 1X6VA 1SVMA 5EXPA 4B47A 2H17A 1KI6A 3BFVA 1A1VA 1ZD1A 2G77B 1AQUA 3WRXC 1CXZA 2J41A 4KXFB 1W0JA 5BQ5A 2J46A 4NCIA 1AZTA 4RFSB 2Q6TA 1NL3A 1TF5A 2AXPA 4M4SA 1Q1ZA 1LTQA 4JKYA 2FG5A 1QHGA 5E3HA 4NZYA 3KDSE 3A58B 3VHLB 1H8HD 2G0NA 1E2NA 2IYQA 2IS2A 2VTKA 1Y3AA 5KDLA 3C14C 4LPSA 1G8YA 3DOFA 2OG2A 4V0LA 2VHQA 2SHKA 1QG2A 1SXJB 5CLQA 2VP0A 3W6NA 4BFXA 4KLNA 2A5YB 3GJ6A 3EPHA 2CK3A 2FZLA 2XTNA 4DLVA 2OFWA 3CH5A 1ZW6A 1FX0B 2QL6A 5FTJA 2FEMA 3FKSD 1ZVQA 3AKDA 5EE3A 2WSSD 2RB4A 4PC6A 4GSYA 1E9RA 2YINC 1TTTA 4C0JA 3VQTA 2ZRKA 1BKDR 1FQKA 1N5LA 4M21A 4OK5A 1CRQA 2ATVA 1VCOA 1W4BA 2ZS7A 3GLIA 5KUTA 4JBYA 2WJJA 5BYJA 4Z51A 1DADA 1NVUQ 2HLDA 4EJSA 3FHCB 2JJ2D 1U8AA 3AF0A 1AKEA 2R6DA 2PMKA 2XZPA 4K46A 4DLYA 4LSGA 1R7RA 1KGDA 2CJWB 1NRJB 1VHTA 4JVMA 3EG5A 2BWJA 4D80A 1WA5A 2OILA 2WMNB 4JL5A 2C2HA 2GVDC 1AM4D 4D4JA 4JLMA 3M1IA 2C8VA 4EPVA 1FMJA 3TQCA 3ADBA 1D2MA 4PPNA 2C95A 3PUWA 3WBKA 1NY6A 3RSOA 3K0FA 3KJIA 1XFAA 4KU4A 3ZLJA 4HZIA 2GRJA 3GLFE 3L8YA 4LJ9A 1G16A 3LFUA 2G1KA 2QZ4A 5AJWA 5DO9A 5LPNA 2A9KA 4CYMA 4PSVA 1QZXA 2BEJA 2P5TB 3P1JA 1VG1A 1NN0A 4M9ZA 1GWNA 4UXHA 4QOSA 3VAAA 3CPEA 2FFAA 3K0CA 4ASUD 1Q44A 3QF7A 1W0KD 5J4LA 3Q9LA 1GRRA 1W7AA 2FA9A 3AQ4A 1HEIA 1QRAA 3L43A 1TAGA 4PSKA 1E96A 5HTKA 1LB1B 3BJIC 4ACBA 3L82B 3NBYC 1HY3A 4Q03A 4EJSC 1KSHA 1ZCBA 2GK7A 1ZUIA 4IOJA 2AD5A 2XITA 3B1ZA 2QBYA 4OQMA 4DUGA 4Q02A 3MSXA 2ZJYA 5E7JA 4DCVA 3UPUA 1W4RA 1W48A 4NYJQ 3SYNA 2IUSA 3KXLA 3C5HA 2C03A 1OH7A 3FMPB 4V0KA 1UKZA 4CW7A 1OXVA 2NPFA 4D6PA 5EJEA 1N0WA 4DB4A 1NVVR 2DWQA 3F0TA 2NQ2C 1DAIA 1KKLA 1SKYE 4EPYA 2W2VA 1DAKA 1AGPA 1LV7A 1P4SA 2C04A 3TR0A 3FPAA 2BEKA 1YR8A 4B48A 4RZXA 2EFEB 1IXSB 3BC1A 3K9HA 4Z1MD 1E2KA 1AKYA 3UWOA 5HR5A 4IOLA 3CPHA 1Z2AA 4F38A 4NYJR 2Z4SA 1S3SA 3TVDA 2CNWA 1TQDA 4R2HA 1JAHA 3QJYA 3QVVA 1FX0A 5EUMA 4DCNA 2JDIA 5KSOA 1E9DA 1EFTA 2ZSDA 1H65A 3EC2A 4W5WA 4IRUB 4MGIR 2WKRA 4C4PA 4ZDIA 3THWA 1G41A 1OH8A 4ERNA 3KQKA 5JJIA 2ERXA 1IXZA 4K81B 4BLRA 1Z6YA 4IJMA 1QBKC 2B92A 4IDPA 3WP1B 4RKEA 4RD4A 1YR9A 2OXCA 2BMFA 2EFCB 2EU8A 4OJKA 1GIAA 4NU0A 4CF7A 1K6MA 5FOWA 4NBSA 4DZZA 4P31A 2ZRPA 5JZVA 1Z0KA 3K8YA 1ZC4A 4V02A 1HE8B 4C7OA 3RS7A 2RMKA 5FOUA 2VQSA 4LJ7A 3WY9A 1KIMA 1Z06A 4I4LA 4RD1A 2ZRLA 3ZGXA 4IVQA 2WWFA 4KBGA 3RC8A 2IYXA 2IT1A 3PENA 4ARZA 1VYUA 4OI1A 4BECA 1UAAA 2QRZA 3RC3A 5L3QA 1DO0A 4DLSA 3ICEA 4HLQB 1XXHA 1RW4A 2V4ZA 4JLJA 5AJVB 2DR3A 2QUZA 2AX4A 2AFIE 2ZANA 1N2CE 5D3MB 1N6OA 3QE0A 4A0GA 1MRSA 1ZMXA 2PCLA 2FFHA 5AUOB 1VYTA 3GLHE 4KFRA 4BLPA 5KO2A 3CR7A 2VEDA 3K09C 2XX3A 1EWRA 4ACAA 3WBJA 3QSYA 3VX4A 1Q1EA 1P2TA 2P5SA 2QEQA 2XOKD 3CZQA 3TUJC 2QE7D 3QUSA 3LAWA 3FGNA 4G5SA 4LGMA 2DFKB 2GXQA 4LV5B 3K9LA 3UIEA 1R5OA 3BK7A 3LA6A 1G8FA 2XJ9A 3QXJA 2P67A 4QM6A 1W5TA 2EVWX 3HJNA 2QM7A 1G3RA 1KKMA 3FB4A 2WKPA 4TYWA 3LO5A 5TARA 5EP3A 1WMSA 2ZIAA 4Q1BA 4PQYA 3UKDA 1T5LA 2OBNA 4EPWA 5FPKA 5LDDC 4TMWA 1FW6A 1P62B 1SZPA 3DMNA 4NDZA 4OBEA 4I1VA 1AS2A 1NNEA 3LW8A 1NSFA 2E87A 3W90A 5CK4A 1N6PA 5HE8A 2IW3A 1EFRA 1N6NA 1DPFA 3TMKA 1E9BA 2ZSFA 5EE0A 2Q9AA 5SZHB 1TEVA 1US8B 2YKGA 1YR6A 4R98A 1KMQA 4RVCA 1Q22A 3IQWA 4DVGA 1IBRA 2Q0HA 3THYA 3BH6A 1COWD 1OKKD 2O0JA 5JCPA 2ZU0C 2OSBA 4PSAA 2ODNA 4JYCA 1SGWA 1U9IC 3OIVA 4LPKA 4BE7B 4N0EA 3CONA 4O2RA 1S0UA 1SVWA 5DHFA 3SE0A 3GJ8A 1VIYA 4P4SA 5FBQB 3G0HA 2J7PA 2XZLA 1YVDA 5J4VA 1XTJA 4EQ6B 4US2R 4MRRA 4JVNA 2HXYA 1G8GA 2W6IA 3ETLA 1XEXB 1G4AE 1S1CA 5KOYA 1WDTA 2R8RA 1MO6A 3EAQA 5UKDA 3VR1A 1ZNWA 4NCKA 4ABYA 3K70C 1XJQA 4Q19A 5E4FA 2V9PA 3JVVA 2IUUA 5JEDA 1G5TA 5DHAA 4GP6A 3LD9A 4TZ0A 1XB2A 2Q3FA 4EFLA 4JS0A 1AS3A 2OHFA 2JLVA 1P7CA 4FN5A 1CU1A 4O0MA 2ZU6A 1SXJD 2QMHA 2QRNA 2VSXA 1WQ1R 2BVNA 3QY0A 4DIEA 3THXB 1VIAA 1RZ3A 4NCNA 1ZUHA 2DBYA 5EZ5A 3W5IA 3I8XA 1DO2A 3NH6A 1FOEB 3QIAA 4TSFD 4CIDA 4JT4A 5SZKB 2OEPA 3T35A 2ZRNA 5KSYA 1XD2A 1QHNA 2IXGA 2X2EA 4KYUA 4X8MA 2X8AA 4G3XA 4PXAA 1AQYA 2R6GA 2QN6A 4Q4AB 1YHNA 2W83A 4C0AC 3U7EB 1UFQA 4OYHA 2G1JA 3U3MA 2QAGB 2A78A 1AIPA 2EW1A 3GLGE 5ELXA 4B71A 1D6JA 3FVQA 5LD2C 3OAAA 3C8UA 3U4QB 3W8NA 3NC0C 1II0A 1XZQA 2ORIA 3A1SA 2ZAOA 1DAHA 5HKKA 3LX8A 4B3BA 2QP9X 2QI9C 3AH8A 3QXSA 2AFHE 4CVNA 1MO3A 4EPRA 3ZD6A 2F6RA 4U5XA 2V7QA 3B1YA 3RNLA 4I81A 4HEJA 4D4KA 4TQAA 4OQFA 2XJ4A 4B32A 2PJZA 1SHZA 3U7GA 4QNRA 3SJAA 3QVUA 2X77A 4DKXA 3HR7A 2YV5A 3A4LA 3H0KA 4ZKDA 4DDWA 1UKYA 3K0SA 5FOSA 1ZNYA 2C96A 5GJVC 2R6AA 1MH1A 3AV0B 3EC1A 1E0JA 1GL9B 2A5DA 1XP8A 1KSGA 5DE3A 5B64A 1SVOA 3ZVNA 4ZIRA 2JJ1D 2PT5A 2JA1A 3F5FA 4V0NA 5C1BA 4K8OA 3UG6A 4EUNA 2F1HA 2BBSA 2IEZA 1Q1QA 3U3JA 2HUPA 4NYMQ 4D0GA 4RKFA 4A0HA 4NHOA 5SZJA 4AIIA 1KAOA 1G1MA 1FQJA 3OF5A 4U02A 4YMSA 3T06B 3SZRA 5IK2D 1JAIA 3K0AB 2ZJBA 5AUQA 4PPFA 8OHMA 2FV8A 2FPMA 3PCRB 3SEAA 4QJ4A 4P4UA 1XTRA 4GL2A 5AR1A 4JL8A 5GJBA 1OFHA 2OCPA 1U0LA 3HPQA 3QXXA 1Z08A 1TUEA 4KHZA 5CYOA 4MRPA 1G17A 2AR7A 2CCJA 4DLUA 4OI2A 4IXMA 4NYMR 1TF2A 1IQPA 2H16A 4BFVA 2IYWA 4LJ4A 1VYVA 5HPYB 1UDXA 2AKAB 3DHWC 2E9SA 1XD8A 2RGNC 3AP3A 3QG5A 4DHEA 2GF0A 3CNLA 1IY0A 4OQNA 4NPHA 4PHFA 4QC2A 2WM9B 2IYZA 3MAAC 4WOPA 1CJUC 4LBVA 1E2JA 1HQCA 3EASA 3NEYA 3MJRA 1UM8A 2XB2A 4KYIB 1DTSA 3GPLA 1XPUA 1II8B 2ONJA 3KTAA 3S1AB 2HT6A 1FL9A 3J81k 3B82A 1XNJA 1JXOA 2ZXUA 1IJEA 4GT1A 2GA8A 4II7A 1Z22A 4TYPA 4A15A 3DM5A 3CZPA 5CDFE 5EZ6B 3TW8B 2CL0X 1TU3A 5A0FA 2XNSA 3TW4A 2JASA 1X1SA 4PC7A 1W2HA 1SXJE 4M9XA 2P6NA 3BS4A 3U60B 1AJEA 3MWLA 4Z8XA 2P2LA 4OHZA 3IIKA 2H92A 2EQBA 3D7MA 3KQNA 4XD7D 2IYTA 1YZLA 5J47A 2XB4A 1TNDA 1IXRC 1NJFA 2PL3A 4JL6A 5JWHA 4XOIA 1P9WA 4EAQA 3UWKA 3Q5DA 2WZQA 5AJXA 4PO9A 221PA 4LBZA 1Z6TA 1G21E 2REXB 3SYLA 3ZVLA 3TBKA 3SI7A 3L0PA 1VECA 3BRWD 1R5NA 2AWOA 4LHYA 2F1IA 1CR1A 2IUTA 4B6FA 1E69A 1HURA 2DB3A 2OESA 5J5CA 1I4LD 1KDTA 1SVKA 1H8HA 4Q9HA 3VR4A 2ZJOA 1TADA 1ZD8A 1RYFA 3AKCA 3PXGA 5KSPA 4US1R 2O8EA 3BAFA 4YLGA 2OAQ1 4FCVA 1S1MA 1KI6B 2R6FA 1XDBA 2BOVA 1RRPA 3BIFA 3QQ5A 3JVUA 2VHTA 1C1YA 1T0HB 3V4FA 4L5BA 3TSZA 1Z83A 1KI3A 1CIPA 1UF9A 3EZ9A 1IN4A 1JQJC 4C0QC 5HCIA 3I73A 2WSSA 3MLEA 3U61B 1DAFA 1EG7A 5C4GB 3CM0A 2IX3A 2JATA 1KI4A 2E1RA 2IYUA 1GDDA 1E79D 4UXJA 1VCIA 5FUYA 2GCOB 4B44A 2C9OA 1PUIA 2FGKA 1G8HA 4O25A 4WVFA 2NGRA 2ECKA 3HU1A 1G291 2PH1A 2J1LA 4HZUA 1YZNA 2ZSAA 4E22A 5JS8A 1W46A 4DXAA 2JJ2A 2WTUA 4HSEA 4LBYA 4BFSA 5EP4A 5F98A 5FOVA 1KO7A 4Q9JA 4B35A 3I4LA 1S3GA 1OIWA 1OFUX 1MABA 2JAQA 5FI1B 5JS7A 3A4MA 1NBME 4P0TA 1T6NA 4OHYA 521PA 3FOZA 2ONKA 2CHQA 2ZRGA 1F2UA 4IVPA 1E94E 2DY1A 2QMEA 2AD1A 5LB4A 2UVQA 4PC3A 2O0KA 4Q7LA 1D5CA 3CWZA 4YMTA 4AYXA 4Q1DA 1RYHA 4B75A 1NY5A 4NL4H 2GBLA 2GZDA 2OCAA 2C5LA 4M1SA 4UNNA 1Q3HA 4XVRA 1MT0A 2IYSA 1G5PA 2QENA 3EIHA 4MA4A 2PEZA 4XH9B 4BUJA 3DKVA 2RGDA 5TY0A 1XTKA 4MDFA 2F7SA 3A8TA 4MRVA 4PANA 3PUVA 3CPJB 1OB2A 2RCNA 1DEKA 1ZIPA 2WIBA 5A4JA 5GJWC 3OEED 4ASUA 4FWTA 1W0KA 3PJRA 3Q72A 2D7CA 3K0FB 2IXEA 3NIBA 4DC9A 3MWJA 5JJLA 3FHOA 3OFNA 2RH5A 1HYQA 1U2RA 1S9HA 3T5DA 1ZD9A 1JQLB 1T3HA 4FCTA 4M1MA 1CJTC 2X2FA 1SVSA 3DM9B 4MRSA 2C9YA 4BRWA 2JLRA 4UJ3A 1N3BA 2WHXA 2ZYVX 3SDZA 1G7TA 4G5QA 2ZRIA 4URYR 3SOPA 1EFHA 4BFYA 3CBQA 4IDOA 4V0ME 2NPIA 3TKLA 1XPRA 3GCGA 4QHYA 4QJ5A 1Z0JA 3RAPR 3EPJA 2OBMA 2O8CB 2OLJA 1QHYA 1UJ2A 3OEHD 5DI9A 3A37A 4M9QA 1FP7A 4HAWA 4DSOA 2ZS9A 3DL0A 3SJZA 3AB3A 3KXIA 1TL7C 1GTVA 3DZ8A 2GWHA 3A1TA 2N46A 3CRW1 2WOJA 4KODA 1M7GA 4KSCA 2FGJA 1P5ZB 1ZIOA 5FUVA 1MV5A 3AVYA 5B30A 5DYGA 4HUQA 2QBYB 1JR6A 3WNBA 2W2XA 4Z1MA 4I1UA 3TAHA 2GVZC 4TYQA 4JLOA 4EPXA 4QJ3A 2ZR0A 4XSGA 1KMHA 1NMYA 3CW2A 3B1VA 3LV8A 3LWNA 3U44A 1YZUA 2A30A 3ZZTA 1TQ6A 1VG0B 1R0XA 3N70A 2VP9A 4L9SA 3FHTA 5L8VA 4BWYA 4JJKA 4DLRA 2F1RA 2W58A 5FTKA 1VCNA 3U5ZB 1XCMA 3QKUA 2GZHA 4Q4JA 4PZZA 1SVIA 2Y8EA 1F60A 5DYIA 4A2WA 2CL7X 1VCMA 3RS3A 2GCOA 4FWIB 1I4DD 1W36D 5JHGB 4JLVA 4PHGA 4DSTA 1OHHD 2F3TA 1P3JA 4EFMA 5JWRA 3QKRA 2XSZD 2IBMA 1PLJA 2HJGA 2ZITA 1XEWX 3R8CA 3THWB 4Q1EA 1DS6A 2VHJA 4OJQA 5FBLB 4MYTA 1X3SA 4TQ9A 4WAUA 2EWWA 1G9XA 2UZIR 4XJXA 2QP3A 4PAOA 2VSFA 3MWYW 2QAJA 5CB6A 1DELA 4AC9A 2FNAA 5JRZA 1WRBA 2B21A 4H1UA 4DCUA 3LVQE 2GKSA 1ZBDA 2QM8A 4PX9A 3B5JA 2VF8A 2PBRA 2BCJQ 2OFXA 1JR3D 4C7OB 2B8TA 3ZDQA 4DJTA 5DSZA 1IM2A 1IJFA 1E6CA 2W6JD 5TB5A 1VHLA 2FU5C 4BLTA 1S9DA 3AUXA 4TL8A 4OKSA 1LF5A 1UEIA 3ZS9A 1Z8FA 4KITB 3D3QA 3QPUA 4IOKA 4JLNA 4CEIA 2AL7A 5IF9A 1KI2A 4ARZB 2G83A 3IPXA 3U6BA 1KY2A 3TIFA 2ZSBA 2IWRA 2QP4A 4A82A 5L3QB 5KDDA 1QVAA 1CJKC 1RJ9A 2XTZA 1MR3F 3H1TA 1X86B 1TQ4A 2F9MA 1XXHB 1E2DA 1OJLA 3E70C 3ZZUA 5KNDA 5EXSA 3CNNA 4TMKA 3NEJA 1OH6A 4I1SA 2ZM5A 2BV3A 1NN3A 2R6CA 3OIUA 4IW3B 1KO8A 2BM1A 2WPDA 2GCNA 4D4LA 3B7GA 1FPMA 3EZFA 5DN6A 2O8CA 4AURA 1KNXA 4E09A 4OK3A 1HE1C 3U2QA 1NVVQ 1KNQA 2HXSA 5JRJA 1LY1A 5CM8B 2MSDB 2ZPTX 2DWPA 2AWNA 2OFOA 2ZI6A 1KI9A 4G1UC 3QKSB 3KKMA 421PA 2XNDA 1XEFA 4M1YA 4GOJA 2LKCA 2ORWA 1TX4B 5M04A 4XWAA 4F4CA 3BOSA 3D31A 1COWA 1DG3A 4H1VA 3K70B 2BCGY 4DB2A 4D81A 2XXAA 2REOA 2Z5FA 1TF7A 3C4JA 1JBKA 5IHPA 5KPJA 1HTWA 4QGFA 2WWGA 3B85A 3MJHA 1GILA 4B6EA 3CWQA 4QBIA 1E9CA 2R65A 3EPLA 1GITA 1Z6GA 1U0JA 4IXNA 1IY1A 4A36A 3VNUA 2FOLA 4DBLC 1GFIA 1YZGA 4QBHA 3AEZA 5FR1A 2ZJ2A 3THYB 3MD0A 4FW9A 2CHVA 5EXXA 1ZYUA 3BE4A 4QM7A 4YMVA 3FMOB 5IDVA 2GJ9A 4LC1A 3UANA 1J90A 3V9PA 3K0CC 4N0DA 5SZIA 3HWSA 2VH5R 1E2QA 1YRAA 1KO1A 4A9AA 2GJAA 5AJZA 5JI2E 4P4SB 3T1TA 2R9VA 4WZAE 3SN6A 3VU9A 2GHIA 3K0EA 1R6BX 5B58C 3TGPA 4RD2A 1KK1A 5KYKA 1KOFA 4JLKA 4Q1FA 2LKDA 5LD2B 3ASZA 3KXKA 3MUFA 1GG2A 1QHIA 1W0JD 3X1DA 2D2FA 4G5RA 3GQBA 4IFEA 3VX3A 3AVOA 3L2OB 3IEVA 5FL7A 4TSFA 3BWDD 2EYUA 1NI3A 4Q9LA 2WJVA 5CK5A 4Q00A 4MKFA 1HA3A 2WWYA 1DOAA 3H84A 4QFMA 2ZJ5A 3LVRE 3RRMA 3DEFA 3MMPA 4KFUA 1BH2A 1KSJA 4LYAA 5LB2A 4YXWA 4UNPA 4Q9IA 4PFSA 4L4UA 2VSOA 2ZJ8A 3KL4A 5F2EA 4DEXA 1GKYA 1DAGA 1JR3E 2CK3D 4KSBA 3OHMA 1OXSC 2WV9A 3GEHA 1XD2B 2WOOA 3TH5A 2O5VA 4URUR 4BFTA 4BLOA 4AI6A 4Q4HA 5BW8A 3OE7D 2ATXA 2FFQA 4ZCMA 1YQTA 2WVJA 2R62A 2IEYA 1G5RA 3GP8A 2YOGA 3HYTA 4AKGA 2PT7A 4XWKA 5EP1A 4HLUA 4JLPA 1R4AA 1R10A 1YKSA 3MWKA 1T0JB 5EXTA 3L0OA 5AUNB 3U7FB 1Z07A 3T1VA 2GXAA 4L8GA 1SVLA 3QKSA 2UKDA 4R7ZA 4LV6A 5BN3A 1N6HA 2V3CC 2ZQ5A 3GEEA 3EA0A 3PIRA 3X1YA 3CX8A 4GBMA 4JSYA 3RHFA 4MKHA 5JCZA 1YU9A 4A1FA 2NO6A 1GOTA 2CHGA 4CRWB 4DDTA 2VHCA 2CVHA 3EARA 3U7HB 1OFTA 1J2JA 4GRAA 4HLCA 5IK2A 2AK2A 4LY6A 1FNMA 2PJRA 2FWRA 4D2IA 2BHRA 3EXAA 3VMFA 1QDEA 3WHLA 3NDPA 3M4YA 2PX0A 4C0HA 2XGJA 3KJGA 3ZQ6A 1ZJ6A 4X8LA 4ZIRB 4B3GA 1Z6AA 1KYIA 2D2EA 2UZ3A 1UBCA 3SJBA 1NSTA 2WJHA 3QG1A 2Z43A 1E3MA 4LV8B 4WZ6A 1ZM4A 1AN0A 1D2EA 3LNCA 2IC5A 4PPQA 1OT3A 1AZSC 2CCGA 2I1QA 3GJ0A 1E0SA 2NZJA 1PUJA 1GVNB 5EP2A 5AJYA 4HB2A 4QBGB 2AKYA 1TEXA 2ZETA 1Z5ZA 1SHKA 1DBSA 1OFIA 4HAUA 5B2ZA 1NKSA 3PITA 4DUGD 5AK0A 4MGZR 3C41J 3ECCA 2BKEA 4C2TA 1KJZA 1VDZA 4MGYR 4RCYA 5JEEA 2RHMA 4LRWA 1OW3B 4LX0A 4RZ3A 1KAGA 2P0EA 3ZS8A 1XX6A 5K8UA 4DCSA 2MSCB 4XTCS 1XD9A 1JECA 4HB0A 3DO6A 4BASA 4URXR 1P60A 4QHTA 1YR7A 2F43A 3QOFA 4G5GA 3SNHA 4OHVA 4KJZA 1KTVA 3UMSA 1IN8A 3PUYA 1GKIA 1NMXA 1SULA 2NZ8A 3GFTA 2O8DB 4QKQA 2ZS8A 3VKWA 4L9WA 5L3SB 3ND8A 1F3OA 4M1WA 4ZCLA 4XD7A 2OUKA 3NHAA 3KTAB 4DRZA 4TQUS 5GVSA 1CJMA 1GRNA 2GILA 2JDID 1K5GA 3SBDA 3T1OA 3SBEA 3VR3A 4BFZA 1Z2CA 5FH9A 1GM5A 4BEJA 2FPKA 4A6XA 4D26A 3LX5A 2A3RA 2ZUBA 5LBIA 2HDNB 1ODFA 3A1WA 3AKEA 5FI0B 5AUPB 3C5CA 3AKYA 1B0UA 4ZKEA 4HI0E 1G19A 1R0YA 1CR4A 3A6PC 3KKNA 5JSZA 4FMDF 3ZIAD 5DGXA 4BZQA 4CDGA 3AVWA 1A4RA 3KQHA 1OXXK 1SKYB 2BM0A 3A4NA 3H86A 3EIEA 1LS1A 3LY5A 2WJYA 3KZ1E 2IL1A 5FBVB 1YRBA 3NG1A 1KK2A 3KUCA 3W34A 2AHOA 4LYHA 4ZDWA 3GLIE 2FMXA 4PZYA 5CB8A 4Q7MB 4IOMA 1E2PA 2ANBA 3P26A 3LXRA 3RYTC 3X1XA 4M53A 4Q7KA 2CEAA 1L2TA 3WMEA 1Q21A 1QHHA 3WYFA 4Q5IA 3UG7A 1KI8A 1Z3IX 2N42A 2A5GA 4NCHA 4BLSA 1D8TA 4TMVA 2GJ8A 4DT1A 4PC2A 3U3KA 3VFDA 2O8EB 2BC9A 1LF0A 2G3YA 2VA8A 1E79A 4P3YA 4OQXA 4QXAA 2ZJAA 4M0LA 1EK0A 4BFUA 2KJQA 2RAPA 1P9NA 2IHBA 5C2JB 1W4CA 3E5HA 2J0VA 2JGNA 2C77A 3C15C 2V1UA 5EE5B 2XZOA 3HP1A 2BBWA 4PC1A 3MCAA 3B78A 3O8DA 4B76A 1D9XA 1UBFA 4D4MA 1L7VC 1X8LA 2DPXA 3P4XA 4TLDA 4FI3C 2OCBA 4OHWA 5J4HA 3EPKA 1Q0UA 2HCBA 3LBIA 1WB9A 1GKUB 4LZZA 1HT2E 2QPAA 1V43A 5IRCD 1ZUNB 1UBGA 3EWAA 3LRPA 3TSOA 1NBMD 4A8JA 2GNOA 4A6PA 3RS5A 1XZPA 4HZUB 4LJ5A 3WXMA 3K70D 3IILA 4Q47A 3CH4B 4HDOB 2WKQA 3Q7QA 1JEDA 5CJPA 6Q21A 1RIFA 2F55A 3SS8A 5JWOA 3GLFA 4F7WA 1MABB 1E9SA 1DAEA 3R9XA 3HU2A 2J59A 4LHWA 2B6HA 4JVSB 1PJRA 1ETUA 4FMCF 1F2UB 2YWHA 2Z4RA 3OEEA 1NG1A 1W2GA 2IS4A 1Q57A 2O8DA 3UMRA 2CE7A 1CKEA 2HF9A 3E2IA 3EW9A 1R5BA 1UKVY 3IIMA 3TSWA 1RVDA 4AG6A 5L3SA 2LWIA 3CX7A 3WNDA 2CMKA 2ZRFA 2ZYWX 4RY2A 3KFXA 1ELOA 4XVUA 3EA5A 4P4TA 1NVWQ 4IHQA 3RS2A 4B73A 4E03A 2BJWA 4LOAA 5KDOA 2QTFA 5JHHB 4PQFA 2GTPA 1S96A 2V6JA 3OIYA 4Q9KA 2QQEA 4JKIA 2GCPA 3N2EA 4BRUA 2EFHB 5JJKA 3DKPA 4QGGA 4P32A 3PEYA 1G18A 4KCGA 5TVKA 1U0HC 2CCKA 1VTKA 4IDQA 4KBFA 3PVSA 4CT5A 2OE2A 1E1RA 2QROA 4OK6A 4A92A 5FR2A 4DLZA 1J70A 1J8YF 5DLQC 4MUBA 4DLWA 1G3QA 3T34A 1N0UA 2PZFA 3L0SA 3NXSA 821PA 3PG5A 1CJVC 1S2MA 4G5OA 1KSFX 3KKPA 3R20A 3W3AA 1DE0A 1Z63A 2GEVA 3IBYA 3LLUA 4B3DA 2JLXA 1VG8A 1K5DA 1RRGA 1OH5A 2JLYA 2PEYA 1RPZA 2ODBA 3AM1A 2IYYA 3HYRA 4TL6A 4TLBA 3ZD7A 4TL7A 4JLAA 3CRRA 3NBFA 3UK6A 4DDVA 5J4YA 2FSIA 2OT3B 4AKIA 4HUQB 3QEJA 2FDCA 1IY2A 1LS6A 3RSLA 2G6BA 4URZR 4TTRA 3QBTA 1IOZA 1KMHB 3U44B 2X1VA 2ZE8A 1E2EA 1GSIA 4PPGA 2HF8A 3BB3A 4WW0A 3JZAA 5E7IA 3OIWA 1CP2A 4WIAA 3K1JA 3I72A 4KFTA 2BKUA 3CUEF 3FKSA 3Q8XB 3B9QA 4HAVA 4Y0AA 4KV9A 3AGQA 3BFXA 1U81A 3B9PA 1HQYE 1KO5A 1XF9A 3Q3JB 3SFVA 5HKKD 2KB0A 1JPJA 3AVPA 3NWJA 4C0KA 1P2VA 4Q4JB 3ZQJA 2MSEB 1W44A 4AWXA 2ERYA 4JJZA 2ANCA 2WJIA 1U8YA 1JALA 1Z0DA 2BMDA 4FD2A 1T91A 4HAZA 3DZDA 1HV8A 3QKRB 4TTPA 2W2TA 1JR3A 1VPLA 2CBZA 3AVQA 1E9FA 1LVGA 1OXUA 3H2YA 4FMDB 1NJGA 2W6JA 3Q5EA 1IN7A 1C4OA 4M1TA 4HAXA 3ND9A 2BIFA 2ZI7A 4Q66C 1PLLA 2D74A 3AF4A 1KDPA 3GLHA 5FPSA 3R7WA 4DLXA 1E0KA 1KJWA 1XTIA 4YC7A 2RGGA 4F92B 1OIVA 1N5JA 2IYVA 2YYZA 4JYBA 4MRNA 2JLUA 1HUQA 3CF2A 1R0WA 5CYPA 2XTMA 3RRYA 3NDBB 3ASYA 1NIPA 4LHZA 1GRQA 2AK3A 1XMIA 2KE5A 2NIPA 2DHRA 5F9FA 1U94A 1Z6XA 4MH0R 3PQCA 2HV8A 4CEIB 4PAMA 4AG5A 4CEHA 2HYIC 1PV4A 1CS4C 4ZV4A 2BBTA 4S2EA 4LHVA 1E2FA 3CB4A 1DAMA 1TPZA 2WMOB 1RJ9B 3DDCA 2QT1A 2WWIA 5C18A 1XCGB 1WF3A 2WJGA 5GVRA 3ADCA 4BQSA 3B1WA 2PLRA 4Q21A 4GZMA 1IAQA 2A5JA 1ZU4A 1MRNA 1MO5A 3X1WA 1Q1BA 3G5UA 5EE1A 5BYKA 2Z6VA 4IEEA 1A5TA 3IO3A 4UNSA 2Q3HA 2D62A 1NN1A 3M0EA 4IVRA 4NE2A 4EPTA 2R2AA 5FTMA 1F2TA 1N5IA 4DDUA 3UATA 1OSNA 4LJ8A 2FH5B 2DCUA 3I1FA 2GJKA 1BOFA 3AVXA 5CIWA 2HYDA 5TMPA 2ZROA 5GADl 5AWFC 3HDTA 1VKJA 4MITA 3VTKA 4E07A 1WBBA 4LWZA 2GBLC 3TRFA 1NIJA 3NHBA 1L8QA 1U8ZA 1BO6A 2IK8A 3SR0A 3HPRA 2ZE6A 3VHXA 1QG4A 1A82A 3BFKA 1S8FA 3QPWA 4ZI3A 1YE8A 3LXXA 4FMCB 4CEJB 2RGXA 3LH5A 5FOXA 2H18A 2XXAB 3L0IB 2X19A 4KO8A 4AYWA 1E2IA 3CR8A 3BD9A 4TLAA 3RDPA 1CLUA 3REGA 3M6AA 4TWZA 2VRWA 3SQXA 2IYRA 1H8ED 1FP6A 4DSNA 3FDIA 2C78A 2CE2X 2RGCA 3I3SR 4FCWA 2J0QA 2O8FA 4LHXA 3SFZA 2ZRMA 2HEIA 2ASEA 1KK3A 2ZUCA 4KFSA 2VP5A 1UADA 4L15A 1PLKA 1CEEA 4N3NA 3CF6R 2EYQA 2ZRCA 4R2IA 4YONB 3K53A 4W7SA 4MDEA 1FUUA 2FFBA 4MUAA 2EFDB 5JMTA 2J0UA 2VP2A 4X8HA 3WNCA 4ESVA 4RD6A 4CGZA 1JNYA 3NH9A 2VP4A 3VU9B 1E1QD 4Q18A 1JXMA 3PEUA 4JLDA 2GDJA 1XJ0A 3IBGA 3MGCA 1R2QA 1NN5A 3T61A 3W5JA 2NO9A 3PUXA 3T1QA 3FE2A 3NVAA 4NYIQ 5DI3A 3GLGA 1LFDB 3GEIA 4PTLA 2PZGA 1F5NA 3CX6A 5TV2A 2C99A 3N2IA 3NTUA 3ZH9B 2XEXA 4JSTA 4TT3D 3FFAA 3ONWA 2WAXA 3THOA 4D25A 3OE7A 2O8BA 4IDNA 1JEEA 1RC8A 4NH0A 2GK6A 3BH7A 2J7KA 2ZR7A 3QENA 3B13B 4L16A 3TNFA 1G6OA 2JIZD 3AP2A 1CR0A 3T12A 2GAOA 2V1XA 2EWVA 2XOKA 4GPTA 1Q20A 2ZE7A 4HDCA 2QE7A 4A0RA 4NYIR 4C2UA 3F3YA 1A7JA 2CLSA 1R8SA 2KSQA 1P72A 2JLQA 2ZVPX 4ZCIA 5K8IA 2BBOA 4AKEA 4Q4HB 4WA7A 1UBEA 4B43A 3I8SA 3RRZA 1UEJA 4ESHA 5FBWB 4XIGS 1GNQA 2DFLA 5A5GA 1S4QA 4BZPA 5P21A 1ZM7A 4OQLA 1W1WA 1ZRHA 3I92A 5G40A 5L3VA 1OB5A 3VR5A 4MYUA 2V6IA 4PHTA 1XBTA 4D82A 3AVUA 3I5YA 1G3UA 2MMCA 1UPTA 2JJ8A 1NKTA 3SHFA 1F6BA 2D7DA 3FMFA 4Q48A 3AVVA 4WBSA 2LCFA 4YDHB 4TTQA 1BIFA 1MOZA 3AGPA 4AKHA 4Z54A 1OPXA 3NBXX 1OKKA 1D2NA 2V8OA 4JLBA 1FTNA 4TMXA 4OHXA 1ZAKA 4CEJA 2GETA 4KVAA 1N5KA 2V54A 3OFND 3SU8A 3I62A 1K8RA 4M9SA 1BMFD 1NMZA 4V0OA 1EX6A 1W5SA 4D0LB 4Q1CA 1QHXA 3GJ7A 3QNUA 3W8RA 4B2LA 2YWGA 4BGDA 1KK0A 3R9IA 2J87A 1ZINA 3K9GA 1QF9A 4IKEA 1Z0AA 2HCJB 5HCNA 2QTHA 3MG9A 1KDRA 3AF3A 4OI0A 1I2DA 4RFSA 4F4JA 2WWXA 3PFIA 4OI4A 4BLQA 1YZKA 3EX7C 2WSMA 4LUCA 3IIJA 2OBLA 3LBNA 1GZSA 2ZYTX 1V5WA 2GJSA 2FX3A 2J45A 3H4MA 1R8QA 3KB1A 1AS0A 2G9NA 3REFA 2FF7A 4ITRC 5CDFA 3VR2A 2ODWA 3BXZA 3PEWA 1W4AA 4TMTA 1LNZA 2W0MA 1UDWA 4NCJA 2I4IA 1QVRA 1SXJA 2ZUDA 2NTYC 3RVBA 2FZ4A 1W47A 3X2SA 4B3CA 1OLOA 5J40A 1XMVA 3N5CA 5E7MA 1G7SA 4TYNA 2I3BA 3TUIC 4AY2A 2FJUA 4HB4A 5IT5A 2NO7A 4PO8A 1CRPA 1E32A 3B1XA 2GXUA 2RGBA 1VMAA 2QG6A 2F43B 3RS0A 3IQXA 3K09A 1U90A 1BS1A 3A36A 2FE4A 4MKIA 1RRFA 2QNRA 3QXCA 3KKOA 3BBPA 2JLZA 3SYKA 1C9KA 3T15A 3TE6A 1G8PA 3IO5A 4ILEA 2KBFA 4LDJA 1WBDA 2ZI5A 4TYYA 3ZIAA 1FTSA 2IS6A 3QF4B 3HR8A 1T5IA 4PHHA 4QHSA 5G53C 2ZRBA 2IA5A 1M34E 1Y63A 2H5EA 2Q21A 3BB1A 3W6PA 1X8KA 4J0QA 1N6RA 2QQ0A 5CLLA 1JI0A 5TXGA 4A2QA 5H8WA 2CJWA 3CKLA 3D6TB 2VHUA 4GZLA 3BGWA 4HB3A 3A1UA 3PEVA 1Q3TA 4C30A 2A2ZA 1YJ5A 1XTSA 2RKOA 4KVGA 4LI0A 1FMLA 1N6IA 1OYYA 3B2EA 1DARA 1OF1A 2V55B 3QPVA 3P4YA 5JSZB 1NG9A 1FFHA 2YZ2A 1SXJC 4DCTA 2HLDD 3ICQB 3GFOA 4KAXA 1GL6A 4LBWA 4QGAA 4UXIA 2P65A 2JEOA 3WRYC 3LW7A 2PLFA 3RABA 2REBA 4GOXA 4N1AA 3KUDA 2ZRAA 1BYIA 2JJ1A 2O0HA 1ZM2A 1ZP6A 2CLDX 3QXHA 2Z83A 1T8UA 4DWJA 1Q12A 3IPYA 4KLZA 4F93B 3LQRA 3FWYA 5EUQB 4M8NE 1U9IA 1CR2A 4US0R 4FIDA 2VP6A 1MO4A 1NLYA 1KZ7B 3B6EA 1QHHB 1XTQA 3FMIA 3W3ZB 4MYCA 3ZYCA 2ZI3A 2Q9CA 1E4VA 4PZLA 4QRHA 2VL7A 2QGZA 3I32A 4TLCA 4DT1B 1ZM3A 1I4TD 1FZQA 1X1RA 4JBXA 4E5UA 2NO0A 4C0LA 1HT1E 5DNYB 4GFDA 4DLTA 1J7KA 4LJAA 4JZKA 2WPDD 3OESA 1NBMA 3WYGA 4B33A 3U6KA 2KBEA 1ZU5A 3DOEA 4FMBB 4HAYA 2AN9A 2YOFA 2IWHA 1EWQA 5DN6D 1ANKA 3NKVA 1P9RA 2WIAA 4EDHA 1KHTA 2FN4A 3VNVA 4IDHA 5TDHA 1XMJA 2ZE5A 2YHSA 4BEBA 4HLUC 1OE0A 1KI1A 2F1JA 3CF0A 5EE9A 621PA 3ZVMA 1OXTA 3BH0A 2XNDD 2IF2A 1EGAA 1IN5A 3PV0A 1G3MA 2WWWA 2D4HA 4A8JB 1G4UR 5B57C 2BMEA 5H68A 1T3LA 3IDQA 5BWMA 5F9HA 4LCBA 1LW7A 3ADDA 5CITA 3BB4A 4QG7A 3QI2A 2GZAA 3GMTA 4AYTA 1E9AA 3ADKA 4F91B 3GJXC 4JBWA 4RJLA 4BZXA 2JLWA 1CBUA 2QSYA 1T9HA 3GLFB 1CF4A 1E2MA 1P61B 2H7VA 2DWOA 2ZRHA 5FFMA 4V0MA 1U99A 1RFLA 2D3WA 2EFGA 2ZRJA 3GJ3A 2KWIA 1ONBA 2YJTD 2PCJA 2CNWD 4XVQA 2FSHA 4C0SA 2ZSEA 3QF4A 4NKRA 1A2KC 2RGAA 5BXQC 4HLDA 3TJZA 3P27A 2N1BA 4G0NA 4W9MC 2QA5A 1TUIA 2WWHA 4URWR 4W5HA 1CTQA 2IYLD 2WICA 5JECA 4B2IA 3V4RA
chains in the Genus database with same CATH superfamily
4H0CA 5ERGB 4GNKA 2CMDA 4IIFA 4HYEA 1A5BB 2MYTA 5FPHA 4ZK2A 2HT1A 4HX5A 3FNFA 4CQJA 3GARA 2VUUA 2QZSA 1GNRA 3WV4A 1KC1A 4MPRA 3QU7A 4B74A 1DG1G 3BK2A 4IPTA 1NYTA 1P75A 1HDCA 1T3SA 3PGJA 2Q0SA 4B7AA 3BERA 1ZXBA 5FUMA 4YEDA 5ALZA 2HSWA 3FPLA 2ZJFA 4A16A 2Q0XA 1XMOB 2PGAA 1IN6A 3AUYA 3M6UA 3S81A 2VYNA 4Z8YA 2IV2X 3I9OA 4CJXA 3LOPA 4KGDA 4RD0A 4GUDA 1XQ9A 1JFLA 2QZJA 1HORA 5HJ5A 2P6RA 5LMZA 3HJCA 3P2IA 1E99A 2CLKB 4W1SA 1MV8A 2ZTUA 1R4NB 3M3PA 2JC3A 3JXEA 4MDYA 3V9AA 2Q4EA 4M1KA 1JQDA 2Q4OA 4FK8A 4EVRA 4DV1B 1M7HA 3NRJA 4M7RA 2XA1A 3HSSA 1NI5A 4ZOAA 3VO9A 3UFBA 2YBDA 3CRVA 2ZYHA 2YWRA 3S40A 1GUYA 2CXXA 2JARA 1NRXA 2REQA 1FYVA 3E35A 3W9BA 4GX2A 2VBCA 4E51A 5KTYA 4IS2A 3W1EA 1RMYA 3I01A 2CJFA 4M1ZA 4DHWA 2O8VA 3LSYA 1GTMA 4WXPA 1A8QA 1HLPA 1XFDA 2NACA 4RHUA 1EH5A 4AUMA 4J4HA 3Q4GA 4JVLA 1N36B 3TE7A 4CKWA 3WMFA 4MQBA 5FPYA 1C0LA 1MEOA 5LMNB 1WCV1 3OUTA 1KDOA 3EXHA 1D9ZA 3P32A 3V2HA 1N0VC 2CKMA 2DFTA 2ORVA 1US8A 2EP7A 4MVXA 5DYWA 4KWCA 3M89A 4R1PA 3V1MA 4URVR 3CN7A 3R9WA 1U2GA 1C81A 1KPIA 3E22B 3GC6A 1R0ZA 1RSZA 4L0CA 4AZSA 2GESA 2R5FA 3N0TA 2P9CA 2XUHA 1A5ZA 1PZEA 1R8YA 4WTOA 2OPHA 1U3DA 1JV2B 4BNDB 1XJCA 1T43A 1VJGA 4RQAA 3LZCA 3UW1A 2TMDA 4QL3A 5KU7A 4I4NA 2B20A 1O54A 4U00A 1T3TA 4AN4A 1N2CB 3VISA 1EFRD 1H2YA 1QMGA 3KJQA 4I50B 2R47A 1ARZA 2R7MA 1M54A 4BO3A 4UNRA 1Y7IA 4QARA 2OSVA 4DKJA 4ARCA 1BEEA 5J4KA 1Z2PX 1V8OA 3AR5A 3UCXA 4ZGBA 3FSEA 4IR7A 5CIQA 3QU5A 4IIXA 3UGKA 1S8OA 1YZVA 1QR6A 1ZLXA 4HDSA 4MEAA 1P4HA 5BN5A 2P41A 4J0CA 3RANA 1V25A 3DPIA 3F46A 4F21A 4WV3A 1AX9A 4YAJA 4B6OA 3VKUA 1G3IA 4K2HA 3FH0A 5C31A 5LWQA 3WSTA 2AMLA 2FWBA 2BTQA 5LQMA 3CUSA 4N5MA 3HBNA 1U7TA 2ZAMA 3DLAA 1J99A 1ZRSA 2X58A 3D3WB 4PXSA 5D5HA 5AW3A 5I7FA 4CXMA 4I1OA 5DISB 2J7PD 3TLXA 3V00A 3T9FA 3ZW8A 4CEHB 4MKZA 4XFDA 1Q0QA 3GGJA 4OL0A 5KNCH 4A0FA 1UBLS 2ISQA 1ZNXA 3ONNA 3NOVA 4DQDA 1EGMB 1L9XA 1Z15A 2FSVA 4QNMA 4AK9A 3THXA 1Y5IA 4S1PA 2G0TA 4JYPA 3I52A 4FDTA 4FE4A 4TTJA 2XVYA 4JB3A 2Y1FA 4X6UA 1SA0A 4Y0VA 2Q7OE 1IONA 3G02A 4K3VA 4CG0A 1XWWA 5ALYA 2CBXA 5LYJB 1E9EA 3E3AA 1BMQA 2JEYA 4U9HS 4PYIA 3UTCA 3WWOA 3EBOA 1BH6A 1XYGA 3C16C 3R6WA 1JSRA 2ZIGA 4LDRA 3OZAA 3TTTA 1CUEA 2QT0A 1DQSA 1FC0A 2RHLA 4KWTA 4YT8A 1HDRA 1CUVA 4PEVA 3RU2A 5LKRA 3CNEA 1JLSA 9MHTA 2EG9A 1QRSA 4ZOCA 3QUTA 3WHPA 1NJ1A 3OQ1A 5CEFA 3MVEA 1R74A 2G04A 3ELBA 1KY4A 3PK0A 4TV9A 3SYRA 3AETA 3UXMA 4CR7A 1FFGA 4O2AB 2QTGA 4YX9A 2ADOA 4RIEA 1Z0FA 4ZI7B 2V74B 3CVJA 1HI9A 2XH8A 1XTTA 1BA3A 3K96A 5C8VA 5JLJA 3TQFA 3KQLA 1MAVA 1DO8A 1NV9A 2RGWA 3U3RA 2PH5A 3M2TA 1XA0A 3PNSA 3AFIA 2J8ZA 1I51A 5TNXA 1NP6A 4JT8A 1QG0A 1OHHA 3SNKA 4CL8A 1SHJA 4FZJA 4JB8A 5LKAA 1O8CA 4LFAB 1ZC3A 3OWHA 1I7PA 2H1VA 2XSZA 3HTXA 3EZ7A 1CETA 1Z82A 1U5BA 2RGEA 1R6AA 1JJVA 3RRJA 3EULA 2J6BA 3WOHA 4G86A 3SR3A 2OK8A 3PR1A 4HATA 2ZJ1A 4EGAA 4D6YA 4HVCA 3RK0A 3MFYA 5KCZA 2ECQA 2FY8A 3CKYA 4KXQA 2O8NA 4M8IA 1ISJA 1ONPA 3B89A 4F84A 2WA1A 1JLLB 4BZZA 2V7QD 3G79A 3FYHA 4XJVA 2AZXA 3X1ZA 2GEUA 3PUIA 3RH0A 2K7ZA 5ALMA 4C3ZA 1ULSA 4D02A 3TRHA 1HX7A 2XB6A 2JLSA 1UDRA 1TU4A 1UK8A 2BFOA 1M8FA 2B7CA 3BKXA 4GXRA 2ZEJA 4M1OA 1H2FA 4M37A 4MKGA 4O4HA 1L5KA 3E1SA 3JWEA 1XF1A 2FZKA 2QAGC 4MV1A 3Q3VA 1XEWY 4GAEA 3VYSB 1M1YE 2J0UB 2Q7XA 4ZO9A 1ZAYA 3L4KA 4LIPD 3LCJA 2GTIA 5KYWB 4BC1A 1EUYA 1HGXA 1I3KA 4OLJA 4AMUA 3MIZA 1U8FO 2VDNB 2YY5A 4H9GA 2CGEA 4O63O 2QPOA 1EX7A 2BI7A 4Q4LA 4TS1A 4UQOA 4YWHA 2XRYA 2WWVD 3VBCA 3CO5A 3S8EA 3O8RA 2X42A 3F5SA 2QMOA 4XM0A 1OAKA 3DWEX 3O4VA 1O87A 2DFPA 4WUVA 5YASA 3O9VA 1UDCA 1MOQA 3GLGB 4LVUA 3W6OA 4ZCQA 3WK6A 2VPYA 5B2EA 4Y6OA 4X8OA 3MRSA 4F4IA 3QKTA 1B23P 1SEPA 5K0FA 3L7YA 1JS1X 5JMOA 4TZ6A 1U8EA 2O8BB 2RHDA 1OD6A 1HTBA 4G1CA 4M7PA 4Q3KA 2JCSA 5T41A 5BO5A 4CODB 2IUFA 5A1TA 2PGNA 1UFRA 2BKLA 4U3JA 1KY3A 3RIXA 5L45A 2C2XA 5HS4A 1EA5A 2ZTSA 3AEKB 1SKQA 2R6HA 2YWEA 3IP5A 3NWEA 5TF0A 3CVVA 3KUXA 2HU2A 5K4HA 3O2QB 1WUYA 4CCSA 3IUEA 3P8ZA 1M8PA 4S35A 4DADA 5BORA 2NT4A 1II8A 2Y99A 1D6SA 3OCYA 1YZTA 2YFYA 2I1VB 1F5SA 3O47A 2JFGA 3ROKA 1TT5A 5KSZA 3IE0A 3LKDA 3N8GA 2VLIA 3D3EA 4IX1A 4WEOA 1MFPA 3RYHB 5SV2A 4N7BA 4V03A 2XNKA 3OKFA 3TQOA 5TSDA 3A4YA 4BVGA 4DEYA 2AEFA 4HGNA 4XJSA 4LCJA 2ID8A 4TL9A 1WXXA 1F4LA 5ICGA 3D0QA 2QGNA 5FL3A 3ZIDA 3HXOA 2YZMA 4PNZA 3KO8A 2Q62A 2IBSA 2MTBA 4EZEA 1ZKDA 4RY8A 2Y0EA 3ZWBA 5CDYA 2H00A 2R3SA 1NNLA 2JIMA 4RS4A 3PCXA 1I2MA 3NAZA 2P5YA 1JDJA 1WSWA 1V8ZA 3N8HA 5K8TA 1KIFA 4KLCA 5KHOC 4ME6A 1XMPA 1K89A 3SQWA 3Q7EA 1AA3A 3R75A 2WUWE 1C8BA 1QFYA 2RC6A 2YQZA 3EODA 4XQ0A 4YJ2A 5B1HA 4MV8A 3HVUA 2JH8A 1PYGA 2KM1A 3KFVA 4F60A 4WKNA 5H3CA 1QRRA 2V97A 4RZSA 2OCDA 2QI9F 4TXMA 4ZC1A 4F5DA 4H59A 5LQRA 4RO0A 1AZLA 4D6XA 1GL7A 3TLKA 1MKYA 3Q3IA 5I9MA 1NKVA 3FZGA 1LKZA 3GZTB 2ESRA 3BA1A 2C82A 3MJSA 4OLBA 1A2BA 2G88A 1TTQB 3G5TA 4IEIA 5L7TA 3GJ5A 2VJOA 3DBHB 3QKWA 4K87A 4B47A 5AVJA 4E4RA 1AQLA 2RI6A 5SY4A 2PKXA 3WGYA 3HB0A 3TBFA 5B3AA 2DAPA 2J41A 5BQ5A 4O4JA 5AHKA 3B8EA 1JEAA 2Q5OA 3L8HA 2Q6TA 3G68A 1CSEE 2BI4A 2AXPA 3UNXA 4PZDA 1HZZA 4FR5A 4A3SA 1X8XA 2VRCD 5DNDA 2E6KA 1FMTA 4NZYA 1EP3B 2YZNA 1O1YA 4D8YA 1U80A 3LUPA 3A58B 3VHLB 1LDMA 2KS6A 1QQAA 4NAUA 2G0NA 1YJAA 4DW8A 2IS2A 3IAS1 2VNHA 3IURA 1Y3AA 4U63A 5KDLA 1N7HA 2VH1A 4ZZ0A 3FCUB 4JP1A 4X44A 5ALLA 3KYDB 3ORRA 1HG0A 1PDWA 3ORFA 3RR2A 2NAPA 3VR6H 3W6NA 1DC6A 4ZI5A 4KLNA 4N6OA 3HKEB 1NUQA 4YCLA 3OURA 1CUAA 2XTNA 3IVAA 3KRTA 3JQ9A 5D5QA 1GJRA 5B7NA 1PG2A 2GN9A 5FTJA 2FEMA 4MWTA 1ZVQA 3LKZA 1K2WA 4TUYA 4AG3A 2WSSD 1RWWA 2C9DA 4KW7A 4X93A 4HDNB 2PGOA 3PPWA 2C5AA 2WA2A 4GSYA 1LSSA 1E9RA 4OGKA 2H54A 5CJJA 2I9KA 2WYOA 2ZRKA 1H4SA 1Q6ZA 1CRQA 3ZWXA 4LDQA 1K6JA 5L6LB 1E1CA 4JJ8A 3CEAA 5PNTA 4BE4A 7GPBA 5BYJA 2NVUA 4I4TF 4MUHA 2W9XA 3WYBA 5DM70 1DADA 1NVUQ 4AO6A 2N47A 2HLDA 3OECA 2O9JA 2J08A 5JAOA 7MHTA 3KM0A 2O3JA 3KUUA 1AKEA 5FWAA 3BPSA 3IL2A 4X84A 4MWEA 5IJ0A 3MT8A 4TV8F 4LXXA 1VHTA 1I0LA 1VFNA 3EG5A 1XU7A 2Z8XA 2C2HA 6YASA 5JVDA 2YWDA 2ZYRA 4QSMA 4DA7A 3KYBA 3VRHA 1SUEA 2YL2A 2NYRA 3I83A 4UUPA 5BSRA 1BD4A 2RG1A 7AT1A 1D2MA 3CUTA 2C95A 4MR7A 1XDUA 2F2TA 2HA3A 1GTRA 3V2UA 2DCMA 4IIJA 3OQJA 4G85A 2LW7A 4CE6A 3TKAA 1W6UA 1XFAA 4D3XA 1Q1GA 1YQ9A 2C2ZA 2NT3A 3HCFA 3NTVA 4IIEA 4N6NA 3NORA 2EZ8A 4RE5A 4RYDA 3ZLJA 1PQPA 4D56A 1PHRA 4ML3A 3JYOA 4DSAA 2HFKA 5JD6A 3AJRA 2PUWA 3H83A 3USCS 3K0KA 1X9GA 3ICCA 3JVDA 4J0KA 4CYMA 4NOLA 1LPNA 1SHTX 3P1JA 1AF7A 3WWYA 4LWOA 3F6SA 1GWNA 4J4TA 2BFBA 9LDTA 2HWXA 3EA4A 4J7UA 3QW4B 3CZ5A 1KRHA 3QWFA 1PJ4A 3OF3A 1W7AA 1QYCA 1AK1A 1HEIA 3L43A 3VZSA 1JVSA 1BQ4A 1A8IA 1H2BA 4PSKA 2B2CA 4QYIB 3TVYA 2QD2A 3BJIC 5DDIP 3D4OA 5BV8A 1QP4A 13PKA 2XBUA 3BZBA 5LP1A 1KSHA 1LQ2A 2C9BA 4YHBA 5DJ5A 4CL2A 4IOJA 2HDHA 4AWBA 2DQSA 3DOJA 4X61A 5C7YA 2J5QA 3MTDA 4C4YA 3G2NA 8LDHA 4OQMA 5TMDA 4BV8A 2PGLA 2QN8A 4MV4A 3UPUA 3IOMA 2Z2IA 2PL5A 1RKQA 2C2YA 2IEDA 2C03A 3B9RA 4RXMA 1OH7A 4PYQA 2JGKA 3FMPB 2X9VA 4K05A 4WX2B 1KDVA 2FN3A 4D6PA 4UBKA 1VPTA 3UW3A 3A2KA 2XT6A 4KQMA 3QTLA 2Y4OA 4V1CI 4FGSA 1RAHA 3IB3A 3MUOA 3SZLA 4MV7A 4OQPA 2P1DA 2W2VA 3D0RA 1MHPA 4NBNA 5D1HA 1P4SA 3OCZA 2GEBA 4FFBB 3LUKA 5TGZA 3FPAA 5T3YA 5TQVA 1Q17A 3QMMA 4RZXA 5BR4A 5JCJD 1ML4A 3AERA 1IXSB 1T8WA 1AA6A 1AKYA 3NHKA 1LX6A 2OG1A 3LJKA 5HR5A 1XZKA 3L7IA 1EP1B 3ZLVA 1HE4A 4F38A 1JHRA 5I4IA 3HH8A 1FTQA 3ZWCA 3ZWQA 4H1WA 1S3SA 2VAPA 3KCQA 5DCLA 1E63A 2CNWA 2V8BA 2C94A 1SBNE 1SZCA 1JYEA 2Y1LA 1JAHA 5EUMA 3QVVA 2YR0A 4MP8A 4KQEA 5KSOA 2HJHA 4YACA 1G42A 4C4PA 1M10A 3THWA 1Z25A 1G41A 2ORED 4ERNA 3KQKA 5JJIA 4N5HX 1IXZA 1JFSA 5LQAA 1CC1S 3DE3X 5E8RA 2B92A 4YNBA 3WP1B 1V7PC 4RD4A 1YR9A 3F6CA 2EX4A 4RKEA 4MP6A 2AJBA 2LGJA 1O77A 5EJ5A 2M98A 3QOWA 1GAWA 3H1FA 5DXAA 4G23A 4NBSA 2A0YA 2QRQA 2ZRPA 2D59A 1EJ2A 1Z0KA 3K8YA 5HILA 5KQMA 3CX4A 4UBIA 2NAFA 5DOVA 3VPAA 3NWBA 1EX9A 4K9MA 1V35A 3WY9A 2I22A 1GUDA 2EEPA 4RD1A 1J22A 3ROZA 1Z5WA 1SUDA 3QZUA 1E7RA 3MT0A 1V2HE 3R3XA 2IYXA 2COUA 2G80A 4JUIA 3V5NA 1GCIA 1SG0A 3PU6A 3RGGA 4Q9AA 1IVYA 3OY2A 4B85A 3PPYA 1VKOA 1JHAA 2ICAA 3GRFA 2Y92A 4UU1A 4BKQA 4D9HA 4GS5A 5L3QA 2BEUB 2BM8A 3ECSA 3SEZA 3O4HA 1Q7BA 1RWXA 3ICEA 3ITKA 2PT6A 2OGZA 1BX1A 3L8EA 2PXAA 2B36A 4B4WA 3N58A 1U4OA 5AJVB 2DR3A 2AX4A 2AFIE 1ORDA 4R1QA 5D3MB 4A0GA 4D9FA 2WPNA 3W8DA 1SR8A 1WUTA 5AUOB 4J16C 4D8UA 4WJLA 4ZODA 3NRBA 1E5LA 1GADO 1V9SA 1XJWA 3GLHE 4KFRA 2W2LD 4OMFG 3Q11A 3UUFA 3VZDA 3K09C 5HX7A 5ARDA 4KKXB 4PG8A 4RDHA 1Z2EA 1Q1EA 5MFPA 2RCYA 1IVNA 3C3AA 5TC4A 2CXSA 2F8LA 2C7PA 3GL9A 3EJ6A 3DZIA 1GHTA 1Y89A 2AIRA 2QE7D 4LGMA 3FGNA 3TSYA 1U0TA 1JDBC 2DFKB 1CVLA 1OX4A 3NDJA 4LXYA 3LA6A 3SOOA 2P67A 5EIOA 1M2FA 2JHAA 1DLJA 1UOOA 1G3RA 1PJLA 3BXHA 3FB4A 2WKPA 5ECWA 3NOOA 3Q8WA 2XV1A 1SC4A 5TARA 3FR8A 2WVAA 4L76A 2ZIAA 4Q1BA 4PQYA 2RSLA 3UKDA 5EPUA 4RU1A 4WLEA 1SPBS 4RTSA 5IJWA 3SJ7A 1LLCA 4QJIA 2R25B 3U49A 1GQQA 3K1ZA 1D5WA 3BWCA 2FZ5A 4EEKA 3SC4A 5CK4A 3G7NA 1B00A 2FMUA 1TMYA 1N6PA 1KJIA 4FE7A 5A4FS 4EHJA 4C03A 4A6DA 5ALRA 4NARA 1QC5B 2P77A 1C9MA 3H0EA 1R12A 5IDYA 2D1FA 4BO5A 5CLHA 4R98A 4GO1A 3IQWA 4B84A 4E1BA 2Q0HA 1COWD 1OKKD 3L1KA 2QVZX 3D7KA 2NYAA 2ZU0C 2OSBA 4PSAA 1ZUWA 3A3OA 3IQZA 1C8KA 3WL4A 4AN0A 3R2JA 1UC9A 4BE7B 3E5RA 4N0EA 4TMYA 5FEMA 4G9BA 5HFAA 4EUFA 4P0PB 1XDGA 5J2UB 1Y6QA 4DR7B 1C1DA 4W8GA 4ARSA 2C7GA 1TD9A 1K8XB 1WDLA 4AMBA 5KYGA 3NBQA 1Y5NA 3FW1A 5B1IA 1A7KA 1PI3A 3FZEA 3R0IA 4MRRA 5EL0A 4JVNA 1R4MB 4P36A 2QTRA 4XYBA 3WL5A 3QV1A 1O5IA 4LGYA 2EKLA 3ETLA 1XEXB 1HFKA 3LE8A 2G09A 1JKMA 3EVGA 3S5UA 1GCUA 3G0CA 3QVXA 5KOYA 5T4EA 4LOKA 2ADMA 1I32A 2XADA 5UKDA 3R5XA 2VCEA 3VR1A 1ZNWA 5JZSA 4M0MA 1KY5A 2CLHB 3G0IA 3KTOA 1FK8A 2V9PA 4CHTA 3R74A 2INGX 1NHWA 2W2KB 3SGLA 5JEDA 4AP9A 4E08A 1G5TA 1S02A 1VB3A 3QU4A 1W93A 4XPZA 2OMKA 1MHTA 3O90A 1CY4A 1K4MA 3NYRA 1QBGA 1Y6RA 2VAWA 3NNNA 1LXCA 4JS0A 1TO1E 1OOEA 1F2DA 1P7CA 2ES4A 1CPYA 1CU1A 2YICA 3KLMX 2ZU6A 4BKOA 5BSFA 5KQRA 2GBPA 2MSKA 3N9IA 3C39A 1Z75A 2DBYA 2ZSUA 2RAUA 5AJHA 3TYXA 2M32A 3W5IA 4D3ZA 4WBNB 4BX2A 1FOEB 4HGZA 4OP3A 4ZRDA 5EJ6A 2W6MA 3INRA 4R54A 1U1CA 2X2EA 1XELA 1TQ8A 4MUMA 4YT2A 3ZOKA 3OLXA 1S6YA 2X8AA 3BQMB 3ESZA 4YMLA 3HUTA 2QN6A 2AOWA 4RSHA 2IODA 2PBLA 5J1TB 3SYMA 5FNVF 2XCRB 3U7EB 5LJLA 4OYHA 2C92A 3KZMA 1P1IA 2JH3A 5C7IO 3MHTA 3CX3A 3G0OA 3PJGA 3PRKE 4YQYA 3H0CA 4NMWA 2V59A 3C8UA 2FJPA 5T4FA 3U4QB 3NC0C 1C9DB 3LMKA 3PTAA 1ULAA 2ZAOA 4D9CA 2I8LA 4B3BA 4LZLA 2I2BA 3R7BA 1YASA 2AFHE 3NUZA 2EZTA 4ES6A 5ALOA 5HTOA 1A2QA 3RNLA 1PHPA 1Z9BA 4W5OA 4HEJA 2NV0A 4OQFA 1I9GA 2IOFK 2GFIA 2XJ4A 1M2NA 3N2NA 1KYTA 2ZRQA 3AILA 4PZ0A 2A7XA 3HR7A 2XMDA 2R8PA 4KBYA 5DIZA 2OYCA 4ZKDA 2QZPA 4DDWA 3ONDA 5KHAA 2BGLA 3KEOA 2C54A 1YTUA 1L7EA 3KSUA 1ULZA 3DE4X 2O4CA 4UM8B 2R6AA 4H1TA 2P0YA 1N75A 2Q9UA 2G1UA 1MZVA 3TSAA 3MCWA 4UCWA 1NX9A 5FD8A 1GDHA 1SVOA 5DBHX 4Z0TA 3PC8C 5K6AA 4BDTA 2PT5A 2JA1A 3F5FA 1AUPA 2X8LA 4WI1A 3SZOA 3JAWA 5KYXA 3K9WA 5C1BA 5LC1A 4PYRA 3UG6A 2GERA 4ENTA 1QRTA 2UVPB 1Q1QA 4H17A 3L3BA 4RQTA 3IV6A 4KAFA 5DSXA 2CEKA 3WKDA 2CLIB 4G8CA 2NZXA 2RARA 2X23A 4DMLA 2VHYA 1U3UA 4NHOA 4AIIA 2VSYA 2I91A 1DKMA 3N8IA 1PQWA 4FD3A 3NX4A 5AI9A 5ULLA 1TD1A 3K0AB 2JK0A 3A1DA 2VP3A 3NEPX 8OHMA 3PGLA 4FFWA 5JSKA 3GFSA 4RWZA 3PCRB 4QJ4A 2C8LA 1HNNA 2OOKA 1GGNA 5LDGA 4TZTA 2I2FA 1GD1O 2WU3A 4D9KA 2TECE 4WKGA 4RK5A 2OCPA 3ZX4A 2Z8YA 4LA4A 3A05A 1IM5A 5CMLA 3RTBA 2AR7A 1X1BA 4DLUA 4WESB 2AMVA 3IDOA 3DHEA 1AD2A 4ATNA 1TF2A 2H16A 4GSKA 2B25A 3VOTA 4P58A 5I7SA 4LJ4A 1GSAA 1VYVA 5HPYB 4G1FA 4XRRA 1UDXA 1AF4A 2UYGA 1CUIA 1XD8A 2D1RA 4CUKA 3JR7A 3PIDA 5ALFA 1Q74A 2CY0A 2IDJA 3HHPA 3V7FA 1YQQA 2FW7A 2IJGX 4OQNA 4QC2A 5FX2A 2Z2KA 3LY7A 4TOIA 3W06A 2X1HA 4KUHA 1ESZA 4LBVA 3JALB 4HH4A 3EXHC 2QRKA 1R64A 1V7ZA 2V6FA 3MJRA 3SVZA 2X0RA 1ZD3A 3OA0A 4K1LA 1P8AA 5F73A 5IU6A 3L1IA 2HBZA 3RIYA 1O9BA 3UEOA 1EE2A 3B3FA 4OB7A 2J3JA 3VNBA 5FAKA 1UXIA 3FOEC 2QT9A 1RACA 3ZY6A 4HQFA 4YCDA 4E15A 1OI3A 3S1AB 4E2YA 1FL9A 3J81k 4L08A 1M73E 2W6ZA 3DBOB 4YCAA 5LZ4A 3D6JA 1TIBA 3MJVA 3SX0A 3HCDA 2GA8A 2YV3A 1JMKC 4TYPA 4YCJA 3DM5A 3FDXA 3L6EA 4GEGA 1AGYA 3SY8A 3TD2A 4ZN6A 7ABPA 2D0DA 1TU3A 3H1AA 3TW4A 1J25A 4YS6A 5DX1A 4Q4DA 3KZCA 3ZWDA 3Q98A 3TZEA 3H9BA 5JJBA 1DAPA 3LCVB 4PC7A 4CT0A 1DC7A 1JFVA 1SXJE 4F97A 1FXUA 2XODA 2FI1A 2W37A 4NV0A 2P6NA 4BFLA 4YRBA 3U60B 1HYEA 2P2LA 4Z8XA 3IIKA 2E3JA 1VPVA 2AOUB 2BT4A 2IYTA 4UVEA 1YZLA 2HKIA 4BLUA 1DKRA 2O2SA 5L40A 1IXRC 1KFKB 1LTHR 1NXVA 4E12A 4XUGB 3MLAA 2PL3A 5KVVA 2QMQA 5JWHA 2LXNA 3TRJA 4XOIA 1NXSA 4G1EB 1DC4A 5EMJA 1R6VA 1VRWA 3K35A 3O26A 3Q5DA 5KTKA 5AJXA 4PO9A 3OH8A 1YVPA 4LDNA 4YIHA 5C34B 3SYLA 3HGQA 4W63A 1DU4A 2LD4A 4IWNA 4PYJA 2XTAA 3GT4A 3FPFA 2AWOA 1ISSA 2EJBA 1CR1A 5I48A 5JV5A 1WEHA 2IUTA 4OM8A 2J30A 3GJQA 4P4LA 2FSVC 4B6FA 1UH5A 5TT0A 2ZBPA 4H31A 6PFKA 2ZDHA 1WO8A 2P9JA 5A7HA 1WM1A 2X15A 3OX1A 2CZQA 3LOQA 4LE0A 4M86A 4W9NA 1DL5A 5JLAA 4D92A 1BXRB 1TE2A 5BVGB 1A9YA 3I09A 1RVV1 1S2IA 4MQFB 4B0OA 2OCKA 1M1NB 3EGXB 1XDBA 2BOVA 3ABSB 4NK5A 3N2ZB 3VBEA 4ZHQF 2EHDA 2HF7A 1C3LA 1N78A 4UAJA 1YACA 4NE9A 3CRNA 4L5BA 3SXUB 3WGZA 4MCIA 1J49A 2NYVA 3O2NA 1P0IA 1GZVA 3EYAA 1QVVA 3LDUA 1ZJ5A 1QYXA 2PZJA 4MR9B 5DK6A 1XKLA 5HCIA 4AJOA 4C0QC 5A2QA 3ANTA 3DNFA 1M34A 1YDGA 5C5EA 2WTAA 4XPIA 2TYSB 2E1RA 4M0KA 3HBFA 2I7TA 1GDDA 2P9GA 2PO5A 4XYEA 3U9SA 2RHTA 2GCOB 2HDWA 2C9OA 1G8HA 4ENPA 4WVFA 5BSHA 4RVFA 4R81A 3JZFA 1Y6ZA 1I6WA 1AHPA 1I6KA 1F51E 3RFUA 1NLMA 1KHHA 1A97A 2D1YA 2PDAA 4DYHA 1YT5A 2H52A 2NNWB 4P9NA 4DXAA 2JJ2A 2WTUA 3I5AA 4BXOA 2B1IA 3KP1A 1FSFA 4BFSA 4J9VA 5F98A 1KO7A 3WFZA 1S3GA 3DAYA 1OFUX 2HLNA 3ROFA 1MABA 1PTKA 4HVLA 3EISA 3RYIB 4C2BA 2AXEA 1ZGCA 1CE8A 2AI2A 3HVJA 3ID6C 4W1QA 5CNIA 4D5GA 4P3NA 3KBOA 3LX6A 4P0TA 1T6NA 5AH0A 5FCDA 1U28A 3RC9A 3TOXA 2NXWA 4DIUA 5LQNA 3CFYA 4RH0A 5HFNA 1F2UA 5CA1B 2NU6B 3GLQA 1EP9A 2WINI 2QN9A 1E94E 4OB6A 3H3FA 3P2OA 2AD1A 5K3BA 1JG4A 5LB4A 1DJQA 1D5CA 4OSOA 3V2GA 5HGXA 4B75A 4RZHA 1U1IA 3GDFA 4QYSA 4ZU1X 1KZ9A 2GZDA 5KNCD 1V5FA 1XHEA 1Q3HA 4CG3A 4INOA 1MT0A 2C4WA 1Y4AE 1TKRA 1PFUA 1YCHA 2JNWA 4BUJA 3PL1A 2JK1A 3V8MA 1XTKA 2WAAA 2J9FA 3DE5X 1ZHHA 3TW0A 1CZUA 4HN4B 4WK2B 3REOA 5ALVA 2W93A 4DPKA 4CTMA 6ADHA 1DEKA 4XAQA 3PRJA 2WIBA 2APJA 3LT0A 3OEED 2OHHA 3VU1A 2A14A 1W0KA 3ETDA 3FWZA 3QY9A 4LSMA 2D7CA 2VF4X 3NIBA 4P54A 1PT6A 4DC9A 2HJSA 3C1OA 1NOKA 2VJPA 5EXEA 3U4HA 1JQLB 1T3HA 3OIFA 1QK5A 2QD5A 1XXLA 1CJTC 4MRSA 1QM5A 2C9YA 4C29A 2JA2A 1D4FA 3AESB 3BK1A 1EI9A 2WHXA 4Y2QA 4DMFA 5LZ5A 2Y67A 4OHFA 5JAHA 4G5QA 4URYR 3SOPA 4IHJF 3PXEA 1XYYA 4QEDA 4UUBA 2WHPB 3MMSA 1GPH1 3CBQA 4IDOA 4PRLA 3TKLA 4U7GA 5BQPA 6GPBA 1HE2A 4JHXA 4QJ5A 2DT5A 1FU8A 2X8JB 3L46A 1CNEA 1GPLA 4MAMA 3D2BA 1W9HA 4GQIA 2FPXA 3EGDB 2CFCA 4OFBA 3E84A 3WR5A 3T1NA 4DSOA 2UYYA 2ZS9A 3F78A 1T5TA 2Z98A 3WLEA 1U1FA 4ID3A 2GWHA 4KSCA 4U4AA 4B6QA 2WOJA 3P9SA 1M7GA 3IQGX 5LP6B 2GZMA 1RRKA 4NNOA 4NZOA 3LZ6A 1MV5A 1KDYA 4HY3A 4MS4A 4XQGA 3T0GA 5KOIA 2QBYB 3WNBA 3I2FA 4ZVLA 4YPOA 2W2XA 4QULA 5CM2Z 2YWBA 2N9UA 4OJYA 3WK7A 1HETA 3NJ8A 4EPXA 1GTSA 1EDZA 1P0CA 1P0PA 3IBSA 3LWNA 4FEYA 1XLWA 4W7IA 4C7BA 5IDXA 1SY7A 2CHFA 1YR2A 3OTWA 1KOGA 2L17A 2F62A 5EMHA 3RCBA 1C2TA 1KEZA 4HXYA 5FA8A 3K1AA 1U31A 4BE9A 4IH1A 4MJLA 2H2DA 3ZHVA 4CM8B 2O2HA 4UULA 1OLXB 1IZ0A 3PVCA 4IS3A 3G2LA 4BU0A 5NLLA 2Z2ZA 1VCNA 1V1JA 4IDDA 1H93A 1XCMA 1QE0A 1EM6A 1ZWLA 3WBFA 1E66A 2Z9BA 4MW2A 2WT9A 1VCMA 5EVJA 4FWIB 4DZTA 5JHGB 4QIHA 3RIEA 4J0EA 4JLVA 4YUYA 4PY2A 2F3TA 3EZLA 1Y4ZA 2LTAA 1KC3A 4CKBA 2IBMA 2V4UA 3GI1A 1P4RA 2HJGA 1T9AA 1R50A 2YZGA 4FW8A 4WOKA 4JBNA 1GV1A 1S4MA 1CUHA 2VHJA 2HA2A 1X3SA 4KMMA 2UZIR 5JT1A 4QE3A 4E30A 4G26A 4XJXA 4WY5A 4Z3DA 3MWYW 4PBSA 5JW6A 5IUJC 1GO2A 4AC9A 1G20B 2FNAA 4NOMA 1NC1A 1WRBA 3DKRA 4DIKA 5BSGA 5DEOA 8AT1A 3IMFA 4MVJE 2GKSA 2H9IA 3LC2O 1PS0A 4YGYA 4UE2A 4HGQA 2OFXA 1JHQA 3KDPA 4FOOA 4IMRA 3FTPA 4ZXPA 1SC6A 1UBSB 3F5MA 1IM2A 5BSUA 1HZZC 2W6JD 1Q0RA 4K2AA 4BVAA 4BLTA 5DU2A 1KVUA 1F0PA 1NJ2A 1Z8FA 1G5QA 4CEIA 4IOKA 1MJGM 3I64A 1I0IA 4HYTA 5IF9A 2XCTB 1Y3IA 2E89A 2XMZA 3TIFA 4A82A 2QP4A 4EITA 5CFRA 3BFJA 5KDDA 4NJMA 4I9GA 1RJ9A 5HM6A 1QO0A 3H1TA 1VBKA 1X86B 3COPA 3ROMA 1UK9A 1SB9A 4N4AA 4MWDA 3KPUA 4D9IA 5JZOA 2IE0A 2CXTA 3RF7A 2UU9B 2N75A 3W5DA 2WQZA 1T4CA 4GR4A 5KNDA 4P7BA 2HLHA 3JQ9C 4UFPA 4K26A 2BV3A 4YRTA 2R6CA 5DTRA 4R8RA 4QUIA 1JL3A 3DDSA 3UT5A 2OQVA 4ZEVA 2BM1A 2WPDA 4L85A 2DZDA 3QLVA 3L93A 4RKWA 2FPSA 3B7GA 3WB2A 3DWIA 3EZFA 5DN6A 2PPLA 4ZT2A 4EB6B 2IH5A 4G65A 1J0XO 4BNYA 4ZPJA 1Q6YA 4OK3A 4QFDA 2IQ5A 2NU8B 5CXXA 1DOZA 2RHOA 1VGRA 5CM8B 4UBMA 2MSDB 3N6RA 3A32A 3A1FA 4DL9A 1C9JA 2H06A 1XN4A 4FBLA 4EELA 1E8DA 2HH9A 3OZTA 4IDBA 3KSDO 4G1UC 3QKSB 1HXHA 3DL7A 3LCCA 1B73A 1IUPA 2ATEA 5HQ3B 4E5DA 3TLGB 2LKCA 3TLYA 3ZGYA 5FWYA 2P9BA 5JASA 5I6DA 1BE6A 5M04A 4I8DA 5T6MA 5HKOA 2YY7A 4OCZA 1DG3A 2UZ1B 4FSHA 4XUDA 3K70B 4AY5A 3HGTA 4Z7JA 2OO5A 2NV6A 1UOEA 4YRPA 2KPOA 2P11A 3U4AA 4UFNA 3HY3A 1JBKA 3N76A 3DQZA 4D7AA 1HTWA 2ZXFA 2AG5A 3B85A 4MR8B 4QGFA 4RPHA 3B3AA 2WEKA 4B6EA 5IUNC 4JVOA 3HKDA 2Q6KA 3NRCA 3F4BA 1E1YA 1RM0A 2R65A 1YVRA 1Z6GA 3WLQA 1JG2A 1WIWA 1WB4A 2DFDA 3A6GA 4WCFB 5E2IA 5EJFA 4DBLC 1YZGA 5CDTA 1CD5A 2H07A 3KXPA 1EMDA 2ZJ2A 4QUAA 2KYRA 3IHKA 2CHVA 3DCIA 3MD0A 5EXXA 3UWDA 3ZHOA 4YMVA 1EK6A 3H8VA 5IARA 1R27A 1M8GA 4CLOA 4WQMA 3A2MA 1A69A 3OICA 4MS1A 4GX1A 2C4VA 1H6DA 4RPIA 5KAPA 4E2WA 4P53A 3HWSA 2VH5R 4IYJA 1WLYA 4KO4S 1FYEA 1L3IA 3JPYA 2OZKA 2A0WA 1JX6A 4F4HA 5JI2E 5DM2A 3OFKA 4P4SB 5AOAA 1L4KA 5EUBA 1F2VA 4LFCB 3QYJA 4CLRA 3D1LA 1UOPA 5ESXA 3VU9A 4CQMD 5JYCA 1L7QA 4FPXA 2VYQA 1JSZA 4RD2A 1KK1A 3VOSA 3W2EA 1SKAA 4Q1FA 4BNKA 1W1UA 5CA0A 2GFHA 4TRNA 4J3FA 1W0JD 1ZGJA 4DMHA 1V6AA 2D2FA 1SH7A 1Q5PA 1TKBA 3KQTA 4TSFA 4RDXA 2H1FA 3QV2A 2VHEA 2CXPA 4DFDA 3VO8A 4CCWA 2EIXA 1EUCB 4AW9A 1YVUA 5GM1A 3H84A 3I58A 2WWYA 2ZJ5A 3LVRE 3DEFA 1YNOA 3MMPA 5EQFA 5TIIA 3OX4A 5T7BA 2BGIA 1VHQA 3TQQA 3T54A 3SIXA 3R8XA 3E15A 4RKQA 2W6PA 3LU1A 4GUAA 4L4UA 3KL4A 4YP1A