1G23A

The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). glucose-1-phosphate complex.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
292
structure length
292
Chain Sequence
KRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
publication title The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (RmlA).
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 95
structure length 292
sequence length 292
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2000-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1g23A00
5I1FA 1INIA 1EYRA 3SXEA 2AM3A 4AYJA 3CGXA 1MP5A 3V8ZA 1ZHJA 1K4VA 1ZJ1A 2XMHA 1EZIA 1HM0A 2P73A 2W0WA 3USRA 1H7EA 2E3DA 1NKHB 3SXCA 4FRQA 4Y64A 5CQPA 3V0PA 4EE5A 2RIXA 4BQHA 1H5SB 1TW1A 1S4OA 5L6VA 2VD4A 4HO3A 1ZJ3A 4B42A 4E1KA 1VGTA 2OEFA 1MP4A 2O1FA 3ST8A 4HO4A 3SXAA 4ECMA 5FTVA 3U2TA 2A8WA 5C8RA 3T7OA 4P02A 3OC9A 2RITA 4B4GA 4JISA 1VGZA 1QGSA 2Y6PA 1H7QA 1JVGA 5C3AA 2AH9A 2P72A 3OKRA 1G9RA 2WAWA 1ON8A 1G3LA 4B2XA 3SX8A 4Y62A 3NGWA 2RJ7A 2ZU8A 1I52A 3O3PA 4FRAA 4EE3A 1WSZA 1W55A 1HM8A 1KWSA 2Z86A 1GQCA 5J49A 4AC3A 3R3IA 1H5RB 1HJLA 3I0DA 1LL3A 1FOAA 1E5KA 2D7RA 1ZIZA 2RJ0A 1INJA 1NWGB 5HS2A 4HO9A 3OAMA 5IFYA 2Y4KA 3V0OA 4D0ZA 4M2BA 2D7IA 4Y6NA 4CJ8A 4FQWA 4D11C 1G2VA 2WGZA 4IRPA 1ZJOA 2FY7A 3IOIA 3U0XA 3I0CA 3K8DA 3RMVA 4DECA 2V0HA 2X5SA 3LW6A 4M4KA 4Y7FA 1FXOA 4Y7TA 3ZLLA 1G95A 1H5SD 1ZDGA 1WT0A 2RIYA 1FR8A 4DE7A 1H7LA 1JVDA 4R7PA 1NHEB 3OH0A 2A8UA 3SXDA 1XHBA 3I0JA 1Z90A 2O1HA 3V0LA 4FREA 4FRHA 1LZ0A 1ON6A 3I0HA 2XWMA 4EEOA 1VH3A 4KPZA 3V8YA 1H7FA 4GBPA 5FYEA 5L6SA 3D8VA 3SPTA 3DK5A 4C2SA 2VSIA 1WT1A 3TZTA 3R2WA 2X5ZA 3ZLKA 1FO9A 1HM9A 1LZ7A 1VGWA 3SX5A 5EJ1A 4KC2A 4JD0A 5CQOA 2YQSA 4M28A 1FGXA 2RJ4A 2OI5A 4HO0A 1VZUA 2D0JA 1OMXA 2GGQA 1ZI4A 2XWNA 2VSHA 1ZI1A 1VGUA 2OEGA 4Y63A 2XWLA 5CMHA 1GX0A 1R7YA 2I7BA 2I5EA 1PZYB 3USQA 3U2UA 4M2AA 5C4EA 4KQLA 3U2XA 3RSBA 4MNDA 2AECA 5IDSA 5DDTA 1VM8A 4IRQA 4MYBA 3PNNA 3U0YA 1HV9A 1H4EA 5C4BA 2I5KA 2RJ8A 1R80A 2ZU9A 2VFZA 4KNRA 3I0IX 2YQCA 5DDVA 3JTJA 2PX7A 1S4NA 3K8EA 4FCUA 2AESA 2RJ6A 4NANA 5CMGX 1LVWA 2YCMA 2YC3A 4CJBA 3V90A 2X60A 2FYBA 1H4DA 1ZI5A 3OH4A 5AJOA 4EEMA 1H5SC 1WVCA 5C38A 1FO8A 1YP2A 1PZTA 4Y6UA 2Y4LA 1S4PA 4HO6A 4EEGA 5FU0A 3SX3A 5C3DA 5CQNX 3Q80A 1G97A 5CMFX 5C47A 3KIAA 4FRDA 4CVHA 1R7TA 3SXBA 1G23A 2RJ9A 2JCKA 2OI6A 3DJ4A 1G93A 1LL0A 4CJCA 4FROA 4HCQA 2YQJA 4L41C 5C4DA 3CKOA 5CQLX 2WVKA 4D48A 1VICA 1H7HA 4AYLA 5EJZA 5C3BA 1FG5N 2VS4A 2FYDB 1H7GA 1TZFA 2WEEA 4YS8A 2YC5A 4G3QA 4HG6A 1ZJ0A 4FRLA 4UEGA 2PGYA 3E26A 3CKJA 2YQHA 1W77A 1GWWA 2WVLA 4KPXA 1ZJ2A 1ZDFA 4KC4A 3T7MA 2UX8A 1R7VA 2RIZA 2V0IA 3I0FA 1V82A 3ZGGA 3CKNA 3ZF8A 3DUVA 2BO7A 1O7QA 1YROB 4K6RA 4NAIA 1MP3A 3ZGFA 4D11A 3RMWA 3EE5A 3F1YA 3PKPA 1LL2A 4FRPA 1V83A 1GX4A 4DDZA 1NMMB 5CQMX 1YP3A 1FR9A 4HO8A 3FWWA 2X65A 2FFVA 1OQMB 1R81A 1FWYA 5C48A 1H4CA 1TVYA 2ICXA 4Y9XA 1O7OA 2BO6A 5C4FA 1ZCVA 5C4CA 1NQIB 4P00A 5CMJA 2P6WA 1GQ9A 2VXLA 3V0NA 1TW5A 4HO5A 4EE4A 4FRBA 4FCEA 2VXMA 4KNXA 4ASJA 2FYAA 2E8BA 3TQDA 2Z87A 5CMIA 2WVMA 4ASYA 4AAWA 3QVBA 2Y4JA 1NF5B 3GUEA 1W57A 2RJ5A 1QWJA 1H7TA 1JYLA 1MC3A 1G0RA 1JYKA 3I0GA 5EIYA 5JQQA 1ZJPA 1ZI3A 1LZIA 2CU2A 2QH5A 1V84A 2BO8A 2AE7A 1G1LA 4Y7GA 3D98A 1OMZA 3U2VA 3I0KA 2AM5A 3BCVA 2AM4A 3N9WA 2GGOA 1FGGA 2FYCB 1XZ6A 5C36A 3IOJA 2APCA 3OH3A 4KXOA 4Y7VA 1JV1A 3CKVA 1LZJA 5AJPA 3Q7UA 4LW6A 3V0MA 1FRWA 1ZCUA 1GA8A 1VPAA 2FFUA 3CKQA 2JCJA 2WE9A 2Q4JA 4LW3A 2ICYA 1QG8A 2V0KA 4HOCA 3PKQA 2ZU7A 1H5SA 2BO4A 2Y4MA 2QKXA 3POLA 3JUKA 4KC1A 5AJNA 1GWVA 4ARWA 1VZXA 3I0LA 3T7NA 1HJJA 3U2WA 4B4MA 4J18A 4G3SA 3BRKX 5C1GA 2AGDA 5IDTA 2O1GA 4B2WA 1IIMA 4G87A 3OH1A 2NXVA 4Y7UA 2JCLA 1R7UA 1VZTA 5FTSA 5C49A 2QGIA 5BXCA 4B5BA 2JCOA 1O0RA 1O23B 4G3PA 1H5TB 2RJ1A 2MZBA 1IINA 1JV3A 3IOHA 4FRMA 5FU8A 4ZDQA 1SS9A 3FOQA 4KRVA 1WT2A 2VS3A 4XWIA 3V91A 5FV9A 2OI7A 1G8OA 4D0TA 2PGVA 5C1HA 2DPWA 1FXJA 2Y7AA 3I0EA 4EVWA 3JUJA 3CU0A 3V0QA 5FUHA 4EEAA 1WT3A 1VH1A 1H5RA 2VS5A 1ZCYA 1H3MA 1R7XA 2PA4A 1FZWA 1R82A 4HO2A 4B3UA 1QGQA 3OH2A 3Q4SA 3SX7A 5C1LA 1YP4A 2W0VA 3F1CA 1H5TA 2YESA 4B4BA 3E25A 1ZCTA 4NAKA 3D5NA 3OGZA 2V0JA 4BMAA 2V0LA 4KT7A 4NALA 3HL3A 2XMEA 3SXGA
chains in the Genus database with same CATH superfamily
5I1FA 1INIA 1EYRA 3SXEA 2AM3A 4AYJA 3CGXA 1MP5A 3V8ZA 1ZHJA 1K4VA 1ZJ1A 2XMHA 1EZIA 1HM0A 2P73A 2W0WA 3USRA 1H7EA 2E3DA 1NKHB 3SXCA 4FIXA 4FRQA 4Y64A 5CQPA 3V0PA 4EE5A 2RIXA 4BQHA 1H5SB 1TW1A 1S4OA 5L6VA 2VD4A 4HO3A 1ZJ3A 4B42A 4E1KA 1VGTA 2OEFA 1MP4A 2O1FA 3ST8A 4HO4A 3SXAA 4ECMA 5FTVA 3U2TA 2A8WA 5C8RA 3T7OA 4P02A 3OC9A 2RITA 4B4GA 4JISA 1VGZA 1QGSA 2Y6PA 1H7QA 1JVGA 5C3AA 2AH9A 2C0NA 2P72A 3OKRA 1G9RA 2WAWA 1ON8A 1G3LA 4B2XA 3SX8A 4Y62A 3NGWA 2RJ7A 2ZU8A 1I52A 3O3PA 4FRAA 4EE3A 1WSZA 1W55A 1HM8A 1KWSA 4Q7CA 2Z86A 1GQCA 5J49A 4AC3A 3R3IA 1H5RB 1HJLA 3I0DA 1LL3A 1FOAA 1E5KA 2D7RA 1ZIZA 2RJ0A 1INJA 1NWGB 5HS2A 4HO9A 3OAMA 5IFYA 2Y4KA 3V0OA 4D0ZA 4M2BA 2D7IA 4Y6NA 4CJ8A 5D92A 4FQWA 4D11C 1G2VA 2WGZA 4IRPA 1ZJOA 2FY7A 3IOIA 3U0XA 3I0CA 3K8DA 3RMVA 4DECA 2V0HA 2X5SA 3LW6A 4M4KA 4Y7FA 1FXOA 4Y7TA 3ZLLA 1G95A 1H5SD 1ZDGA 1WT0A 2RIYA 1FR8A 4DE7A 1H7LA 1JVDA 4R7PA 1NHEB 3OH0A 2A8UA 3SXDA 1XHBA 3I0JA 1Z90A 2O1HA 3V0LA 4FREA 2J0AA 4FRHA 1LZ0A 1ON6A 3I0HA 2XWMA 4EEOA 1VH3A 4KPZA 3V8YA 1H7FA 4GBPA 5FYEA 5L6SA 3D8VA 3SPTA 3DK5A 4C2SA 2VSIA 1WT1A 3TZTA 3R2WA 2X5ZA 3ZLKA 1FO9A 1HM9A 1LZ7A 1VGWA 3SX5A 5EJ1A 4KC2A 4JD0A 5CQOA 2YQSA 4M28A 1FGXA 2RJ4A 2OI5A 4HO0A 1VZUA 2D0JA 1OMXA 2GGQA 1ZI4A 2XWNA 2VSHA 1ZI1A 1VGUA 2OEGA 4Y63A 2XWLA 5CMHA 1GX0A 1R7YA 2I7BA 2I5EA 1PZYB 3USQA 3U2UA 4M2AA 5C4EA 4KQLA 3U2XA 3RSBA 4MNDA 2AECA 5IDSA 5DDTA 1VM8A 4IRQA 4MYBA 3PNNA 3U0YA 1HV9A 1H4EA 5C4BA 2I5KA 2RJ8A 1R80A 2ZU9A 2VFZA 4KNRA 3I0IX 2YQCA 5DDVA 3JTJA 2PX7A 1S4NA 3K8EA 4FCUA 2AESA 2RJ6A 4NANA 5CMGX 1LVWA 2YCMA 2YC3A 4CJBA 3V90A 2X60A 2FYBA 1H4DA 1ZI5A 3OH4A 5AJOA 4EEMA 1H5SC 2J0BA 1WVCA 5C38A 1FO8A 1YP2A 1PZTA 4Y6UA 2Y4LA 1S4PA 4HO6A 4EEGA 5FU0A 3SX3A 5C3DA 5CQNX 3Q80A 1G97A 5CMFX 5C47A 3KIAA 4FRDA 4CVHA 1R7TA 3SXBA 1G23A 2RJ9A 2JCKA 2OI6A 3DJ4A 1G93A 1LL0A 4CJCA 4FROA 4HCQA 2YQJA 4L41C 5C4DA 3CKOA 5CQLX 2WVKA 4D48A 1VICA 1H7HA 4AYLA 5EJZA 5C3BA 1FG5N 2VS4A 2FYDB 1H7GA 1TZFA 2WEEA 4YS8A 2YC5A 4G3QA 4HG6A 1ZJ0A 4FRLA 4UEGA 2PGYA 3E26A 3CKJA 2YQHA 1W77A 1GWWA 2WVLA 4KPXA 1ZJ2A 1ZDFA 4KC4A 3T7MA 2UX8A 1R7VA 2RIZA 2V0IA 3I0FA 1V82A 3ZGGA 3CKNA 3ZF8A 3DUVA 2BO7A 1O7QA 1YROB 4K6RA 4NAIA 1MP3A 3ZGFA 4D11A 3RMWA 3EE5A 3F1YA 3PKPA 1LL2A 4FRPA 1V83A 1GX4A 4DDZA 1NMMB 5CQMX 1YP3A 1FR9A 4HO8A 3FWWA 2X65A 2FFVA 1OQMB 1R81A 1FWYA 5C48A 1H4CA 1TVYA 2ICXA 4Y9XA 1O7OA 2BO6A 5C4FA 1ZCVA 5C4CA 2VK9A 1NQIB 4P00A 5CMJA 2P6WA 1GQ9A 2VXLA 3V0NA 1TW5A 4HO5A 4EE4A 4FRBA 4FCEA 2VXMA 4KNXA 4ASJA 2FYAA 2E8BA 3TQDA 2Z87A 5CMIA 2WVMA 4ASYA 4AAWA 3QVBA 2Y4JA 1NF5B 3GUEA 1W57A 2RJ5A 1QWJA 1H7TA 1JYLA 1MC3A 1G0RA 1JYKA 4O6NA 3I0GA 5EIYA 5JQQA 1ZJPA 1ZI3A 1LZIA 2CU2A 2QH5A 1V84A 2BO8A 2AE7A 1G1LA 4Y7GA 3D98A 1OMZA 3U2VA 3I0KA 2AM5A 3BCVA 2AM4A 3N9WA 2GGOA 1FGGA 2FYCB 1XZ6A 5C36A 3IOJA 2APCA 3OH3A 4KXOA 4Y7VA 1JV1A 3CKVA 1LZJA 4FIYA 5AJPA 3Q7UA 4LW6A 3V0MA 1FRWA 1ZCUA 1GA8A 1VPAA 2FFUA 3CKQA 2JCJA 2WE9A 2Q4JA 4LW3A 2ICYA 1QG8A 2V0KA 4HOCA 3PKQA 2ZU7A 1H5SA 2BO4A 2Y4MA 2QKXA 3POLA 3JUKA 4KC1A 5AJNA 1GWVA 4ARWA 1VZXA 3I0LA 3T7NA 1HJJA 3U2WA 4B4MA 4J18A 4G3SA 3BRKX 5C1GA 2AGDA 5IDTA 2O1GA 4B2WA 1IIMA 4G87A 3OH1A 2NXVA 4Y7UA 2JCLA 1R7UA 1VZTA 5FTSA 5C49A 2QGIA 5BXCA 4B5BA 2JCOA 1O0RA 1O23B 4G3PA 1H5TB 2RJ1A 2MZBA 1IINA 1JV3A 3IOHA 4FRMA 5FU8A 4ZDQA 1SS9A 3FOQA 4KRVA 1WT2A 2VS3A 4XWIA 3V91A 5FV9A 2OI7A 1G8OA 4D0TA 2PGVA 5C1HA 2DPWA 1FXJA 2Y7AA 3I0EA 4EVWA 3JUJA 3CU0A 3V0QA 5FUHA 4EEAA 4O6MA 1WT3A 1VH1A 1H5RA 2VS5A 1ZCYA 1H3MA 1R7XA 2PA4A 5D91A 1FZWA 1R82A 4HO2A 4B3UA 1QGQA 3OH2A 3Q4SA 3SX7A 5C1LA 4MIXA 1YP4A 2W0VA 3F1CA 1H5TA 2YESA 4B4BA 3E25A 1ZCTA 4NAKA 3D5NA 3OGZA 2V0JA 4BMAA 2V0LA 4KT7A 4NALA 3HL3A 2XMEA 3SXGA
chains in the Genus database with same CATH topology
5I1FA 1INIA 1EYRA 3SXEA 2AM3A 4AYJA 3CGXA 1MP5A 3V8ZA 1ZHJA 1K4VA 1ZJ1A 2XMHA 1EZIA 1HM0A 2P73A 2W0WA 3USRA 1H7EA 2E3DA 1NKHB 3SXCA 4FIXA 4FRQA 4Y64A 5CQPA 3V0PA 4EE5A 2RIXA 4BQHA 1H5SB 1TW1A 1S4OA 5L6VA 2VD4A 4HO3A 1ZJ3A 4B42A 4E1KA 1VGTA 2OEFA 1MP4A 2O1FA 3ST8A 4HO4A 3SXAA 4ECMA 5FTVA 3U2TA 2A8WA 5C8RA 3T7OA 4P02A 3OC9A 2RITA 4B4GA 4JISA 1VGZA 1QGSA 2Y6PA 1H7QA 1JVGA 5C3AA 2AH9A 2C0NA 2P72A 3OKRA 1G9RA 2WAWA 1ON8A 1G3LA 4B2XA 3SX8A 4Y62A 3NGWA 2RJ7A 2ZU8A 1I52A 3O3PA 4FRAA 4EE3A 1WSZA 1W55A 1HM8A 1KWSA 4Q7CA 2Z86A 1GQCA 5J49A 4AC3A 3R3IA 1H5RB 1HJLA 3I0DA 1LL3A 1FOAA 1E5KA 2D7RA 1ZIZA 2RJ0A 1INJA 1NWGB 5HS2A 4HO9A 3OAMA 5IFYA 2Y4KA 3V0OA 4D0ZA 4M2BA 2D7IA 4Y6NA 4CJ8A 5D92A 4FQWA 4D11C 1G2VA 2WGZA 4IRPA 1ZJOA 2FY7A 3IOIA 3U0XA 3I0CA 3K8DA 3RMVA 4DECA 2V0HA 2X5SA 3LW6A 4M4KA 4Y7FA 1FXOA 4Y7TA 3ZLLA 1G95A 1H5SD 1ZDGA 1WT0A 2RIYA 1FR8A 4DE7A 1H7LA 1JVDA 4R7PA 1NHEB 3OH0A 2A8UA 3SXDA 1XHBA 3I0JA 1Z90A 2O1HA 3V0LA 4FREA 2J0AA 4FRHA 1LZ0A 1ON6A 3I0HA 2XWMA 4EEOA 1VH3A 4KPZA 3V8YA 1H7FA 4GBPA 5FYEA 5L6SA 3D8VA 3SPTA 3DK5A 4C2SA 2VSIA 1WT1A 3TZTA 3R2WA 2X5ZA 3ZLKA 1FO9A 1HM9A 1LZ7A 1VGWA 3SX5A 5EJ1A 4KC2A 4JD0A 5CQOA 2YQSA 4M28A 1FGXA 2RJ4A 2OI5A 4HO0A 1VZUA 2D0JA 1OMXA 2GGQA 1ZI4A 2XWNA 2VSHA 1ZI1A 1VGUA 2OEGA 4Y63A 2XWLA 5CMHA 1GX0A 1R7YA 2I7BA 2I5EA 1PZYB 3USQA 3U2UA 4M2AA 5C4EA 4KQLA 3U2XA 3RSBA 4MNDA 2AECA 5IDSA 5DDTA 1VM8A 4IRQA 4MYBA 3PNNA 3U0YA 1HV9A 1H4EA 5C4BA 2I5KA 2RJ8A 1R80A 2ZU9A 2VFZA 4KNRA 3I0IX 2YQCA 5DDVA 3JTJA 2PX7A 1S4NA 3K8EA 4FCUA 2AESA 2RJ6A 4NANA 5CMGX 1LVWA 2YCMA 2YC3A 4CJBA 3V90A 2X60A 2FYBA 1H4DA 1ZI5A 3OH4A 5AJOA 4EEMA 1H5SC 2J0BA 1WVCA 5C38A 1FO8A 1YP2A 1PZTA 4Y6UA 2Y4LA 1S4PA 4HO6A 4EEGA 5FU0A 3SX3A 5C3DA 5CQNX 3Q80A 1G97A 5CMFX 5C47A 3KIAA 4FRDA 4CVHA 1R7TA 3SXBA 1G23A 2RJ9A 2JCKA 2OI6A 3DJ4A 1G93A 1LL0A 4CJCA 4FROA 4HCQA 2YQJA 4L41C 5C4DA 3CKOA 5CQLX 2WVKA 4D48A 1VICA 1H7HA 4AYLA 5EJZA 5C3BA 1FG5N 2VS4A 2FYDB 1H7GA 1TZFA 2WEEA 4YS8A 2YC5A 4G3QA 4HG6A 1ZJ0A 4FRLA 4UEGA 2PGYA 3E26A 3CKJA 2YQHA 1W77A 1GWWA 2WVLA 4KPXA 1ZJ2A 1ZDFA 4KC4A 3T7MA 2UX8A 1R7VA 2RIZA 2V0IA 3I0FA 1V82A 3ZGGA 3CKNA 3ZF8A 3DUVA 2BO7A 1O7QA 1YROB 4K6RA 4NAIA 1MP3A 3ZGFA 4D11A 3RMWA 3EE5A 3F1YA 3PKPA 1LL2A 4FRPA 1V83A 1GX4A 4DDZA 1NMMB 5CQMX 1YP3A 1FR9A 4HO8A 3FWWA 2X65A 2FFVA 1OQMB 1R81A 1FWYA 5C48A 1H4CA 1TVYA 2ICXA 4Y9XA 1O7OA 2BO6A 5C4FA 1ZCVA 5C4CA 2VK9A 1NQIB 4P00A 5CMJA 2P6WA 1GQ9A 2VXLA 3V0NA 1TW5A 4HO5A 4EE4A 4FRBA 4FCEA 2VXMA 4KNXA 4ASJA 2FYAA 2E8BA 3TQDA 2Z87A 5CMIA 2WVMA 4ASYA 4AAWA 3QVBA 2Y4JA 1NF5B 3GUEA 1W57A 2RJ5A 1QWJA 1H7TA 1JYLA 1MC3A 1G0RA 1JYKA 4O6NA 3I0GA 5EIYA 5JQQA 1ZJPA 1ZI3A 1LZIA 2CU2A 2QH5A 1V84A 2BO8A 2AE7A 1G1LA 4Y7GA 3D98A 1OMZA 3U2VA 3I0KA 2AM5A 3BCVA 2AM4A 3N9WA 2GGOA 1FGGA 2FYCB 1XZ6A 5C36A 3IOJA 2APCA 3OH3A 4KXOA 4Y7VA 1JV1A 3CKVA 1LZJA 4FIYA 5AJPA 3Q7UA 4LW6A 3V0MA 1FRWA 1ZCUA 1GA8A 1VPAA 2FFUA 3CKQA 2JCJA 2WE9A 2Q4JA 4LW3A 2ICYA 1QG8A 2V0KA 4HOCA 3PKQA 2ZU7A 1H5SA 2BO4A 2Y4MA 2QKXA 3POLA 3JUKA 4KC1A 5AJNA 1GWVA 4ARWA 1VZXA 3I0LA 3T7NA 1HJJA 3U2WA 4B4MA 4J18A 4G3SA 3BRKX 5C1GA 2AGDA 5IDTA 2O1GA 4B2WA 1IIMA 4G87A 3OH1A 2NXVA 4Y7UA 2JCLA 1R7UA 1VZTA 5FTSA 5C49A 2QGIA 5BXCA 4B5BA 2JCOA 1O0RA 1O23B 4G3PA 1H5TB 2RJ1A 2MZBA 1IINA 1JV3A 3IOHA 4FRMA 5FU8A 4ZDQA 1SS9A 3FOQA 4KRVA 1WT2A 2VS3A 4XWIA 3V91A 5FV9A 2OI7A 1G8OA 4D0TA 2PGVA 5C1HA 2DPWA 1FXJA 2Y7AA 3I0EA 4EVWA 3JUJA 3CU0A 3V0QA 5FUHA 4EEAA 4O6MA 1WT3A 1VH1A 1H5RA 2VS5A 1ZCYA 1H3MA 1R7XA 2PA4A 5D91A 1FZWA 1R82A 4HO2A 4B3UA 1QGQA 3OH2A 3Q4SA 3SX7A 5C1LA 4MIXA 1YP4A 2W0VA 3F1CA 1H5TA 2YESA 4B4BA 3E25A 1ZCTA 4NAKA 3D5NA 3OGZA 2V0JA 4BMAA 2V0LA 4KT7A 4NALA 3HL3A 2XMEA 3SXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I1F A;  1INI A;  1EYR A;  3SXE A;  2AM3 A;  4AYJ A;  3CGX A;  1MP5 A;  3V8Z A;  1ZHJ A;  1K4V A;  1ZJ1 A;  2XMH A;  1EZI A;  1HM0 A;  2P73 A;  2W0W A;  3USR A;  1H7E A;  2E3D A;  1NKH B;  3SXC A;  4FRQ A;  4Y64 A;  5CQP A;  3V0P A;  4EE5 A;  2RIX A;  4BQH A;  1H5S B;  1TW1 A;  1S4O A;  5L6V A;  2VD4 A;  4HO3 A;  1ZJ3 A;  4B42 A;  4E1K A;  1VGT A;  2OEF A;  1MP4 A;  2O1F A;  3ST8 A;  4HO4 A;  3SXA A;  4ECM A;  5FTV A;  3U2T A;  2A8W A;  5C8R A;  3T7O A;  4P02 A;  3OC9 A;  2RIT A;  4B4G A;  4JIS A;  1VGZ A;  1QGS A;  2Y6P A;  1H7Q A;  1JVG A;  5C3A A;  2AH9 A;  2P72 A;  3OKR A;  1G9R A;  2WAW A;  1ON8 A;  1G3L A;  4B2X A;  3SX8 A;  4Y62 A;  3NGW A;  2RJ7 A;  2ZU8 A;  1I52 A;  3O3P A;  4FRA A;  4EE3 A;  1WSZ A;  1W55 A;  1HM8 A;  1KWS A;  2Z86 A;  1GQC A;  5J49 A;  4AC3 A;  3R3I A;  1H5R B;  1HJL A;  3I0D A;  1LL3 A;  1FOA A;  1E5K A;  2D7R A;  1ZIZ A;  2RJ0 A;  1INJ A;  1NWG B;  5HS2 A;  4HO9 A;  3OAM A;  5IFY A;  2Y4K A;  3V0O A;  4D0Z A;  4M2B A;  2D7I A;  4Y6N A;  4CJ8 A;  4FQW A;  4D11 C;  1G2V A;  2WGZ A;  4IRP A;  1ZJO A;  2FY7 A;  3IOI A;  3U0X A;  3I0C A;  3K8D A;  3RMV A;  4DEC A;  2V0H A;  2X5S A;  3LW6 A;  4M4K A;  4Y7F A;  1FXO A;  4Y7T A;  3ZLL A;  1G95 A;  1H5S D;  1ZDG A;  1WT0 A;  2RIY A;  1FR8 A;  4DE7 A;  1H7L A;  1JVD A;  4R7P A;  1NHE B;  3OH0 A;  2A8U A;  3SXD A;  1XHB A;  3I0J A;  1Z90 A;  2O1H A;  3V0L A;  4FRE A;  4FRH A;  1LZ0 A;  1ON6 A;  3I0H A;  2XWM A;  4EEO A;  1VH3 A;  4KPZ A;  3V8Y A;  1H7F A;  4GBP A;  5FYE A;  5L6S A;  3D8V A;  3SPT A;  3DK5 A;  4C2S A;  2VSI A;  1WT1 A;  3TZT A;  3R2W A;  2X5Z A;  3ZLK A;  1FO9 A;  1HM9 A;  1LZ7 A;  1VGW A;  3SX5 A;  5EJ1 A;  4KC2 A;  4JD0 A;  5CQO A;  2YQS A;  4M28 A;  1FGX A;  2RJ4 A;  2OI5 A;  4HO0 A;  1VZU A;  2D0J A;  1OMX A;  2GGQ A;  1ZI4 A;  2XWN A;  2VSH A;  1ZI1 A;  1VGU A;  2OEG A;  4Y63 A;  2XWL A;  5CMH A;  1GX0 A;  1R7Y A;  2I7B A;  2I5E A;  1PZY B;  3USQ A;  3U2U A;  4M2A A;  5C4E A;  4KQL A;  3U2X A;  3RSB A;  4MND A;  2AEC A;  5IDS A;  5DDT A;  1VM8 A;  4IRQ A;  4MYB A;  3PNN A;  3U0Y A;  1HV9 A;  1H4E A;  5C4B A;  2I5K A;  2RJ8 A;  1R80 A;  2ZU9 A;  2VFZ A;  4KNR A;  3I0I X;  2YQC A;  5DDV A;  3JTJ A;  2PX7 A;  1S4N A;  3K8E A;  4FCU A;  2AES A;  2RJ6 A;  4NAN A;  5CMG X;  1LVW A;  2YCM A;  2YC3 A;  4CJB A;  3V90 A;  2X60 A;  2FYB A;  1H4D A;  1ZI5 A;  3OH4 A;  5AJO A;  4EEM A;  1H5S C;  1WVC A;  5C38 A;  1FO8 A;  1YP2 A;  1PZT A;  4Y6U A;  2Y4L A;  1S4P A;  4HO6 A;  4EEG A;  5FU0 A;  3SX3 A;  5C3D A;  5CQN X;  3Q80 A;  1G97 A;  5CMF X;  5C47 A;  3KIA A;  4FRD A;  4CVH A;  1R7T A;  3SXB A;  1G23 A;  2RJ9 A;  2JCK A;  2OI6 A;  3DJ4 A;  1G93 A;  1LL0 A;  4CJC A;  4FRO A;  4HCQ A;  2YQJ A;  4L41 C;  5C4D A;  3CKO A;  5CQL X;  2WVK A;  4D48 A;  1VIC A;  1H7H A;  4AYL A;  5EJZ A;  5C3B A;  1FG5 N;  2VS4 A;  2FYD B;  1H7G A;  1TZF A;  2WEE A;  4YS8 A;  2YC5 A;  4G3Q A;  4HG6 A;  1ZJ0 A;  4FRL A;  4UEG A;  2PGY A;  3E26 A;  3CKJ A;  2YQH A;  1W77 A;  1GWW A;  2WVL A;  4KPX A;  1ZJ2 A;  1ZDF A;  4KC4 A;  3T7M A;  2UX8 A;  1R7V A;  2RIZ A;  2V0I A;  3I0F A;  1V82 A;  3ZGG A;  3CKN A;  3ZF8 A;  3DUV A;  2BO7 A;  1O7Q A;  1YRO B;  4K6R A;  4NAI A;  1MP3 A;  3ZGF A;  4D11 A;  3RMW A;  3EE5 A;  3F1Y A;  3PKP A;  1LL2 A;  4FRP A;  1V83 A;  1GX4 A;  4DDZ A;  1NMM B;  5CQM X;  1YP3 A;  1FR9 A;  4HO8 A;  3FWW A;  2X65 A;  2FFV A;  1OQM B;  1R81 A;  1FWY A;  5C48 A;  1H4C A;  1TVY A;  2ICX A;  4Y9X A;  1O7O A;  2BO6 A;  5C4F A;  1ZCV A;  5C4C A;  1NQI B;  4P00 A;  5CMJ A;  2P6W A;  1GQ9 A;  2VXL A;  3V0N A;  1TW5 A;  4HO5 A;  4EE4 A;  4FRB A;  4FCE A;  2VXM A;  4KNX A;  4ASJ A;  2FYA A;  2E8B A;  3TQD A;  2Z87 A;  5CMI A;  2WVM A;  4ASY A;  4AAW A;  3QVB A;  2Y4J A;  1NF5 B;  3GUE A;  1W57 A;  2RJ5 A;  1QWJ A;  1H7T A;  1JYL A;  1MC3 A;  1G0R A;  1JYK A;  3I0G A;  5EIY A;  5JQQ A;  1ZJP A;  1ZI3 A;  1LZI A;  2CU2 A;  2QH5 A;  1V84 A;  2BO8 A;  2AE7 A;  1G1L A;  4Y7G A;  3D98 A;  1OMZ A;  3U2V A;  3I0K A;  2AM5 A;  3BCV A;  2AM4 A;  3N9W A;  2GGO A;  1FGG A;  2FYC B;  1XZ6 A;  5C36 A;  3IOJ A;  2APC A;  3OH3 A;  4KXO A;  4Y7V A;  1JV1 A;  3CKV A;  1LZJ A;  5AJP A;  3Q7U A;  4LW6 A;  3V0M A;  1FRW A;  1ZCU A;  1GA8 A;  1VPA A;  2FFU A;  3CKQ A;  2JCJ A;  2WE9 A;  2Q4J A;  4LW3 A;  2ICY A;  1QG8 A;  2V0K A;  4HOC A;  3PKQ A;  2ZU7 A;  1H5S A;  2BO4 A;  2Y4M A;  2QKX A;  3POL A;  3JUK A;  4KC1 A;  5AJN A;  1GWV A;  4ARW A;  1VZX A;  3I0L A;  3T7N A;  1HJJ A;  3U2W A;  4B4M A;  4J18 A;  4G3S A;  3BRK X;  5C1G A;  2AGD A;  5IDT A;  2O1G A;  4B2W A;  1IIM A;  4G87 A;  3OH1 A;  2NXV A;  4Y7U A;  2JCL A;  1R7U A;  1VZT A;  5FTS A;  5C49 A;  2QGI A;  5BXC A;  4B5B A;  2JCO A;  1O0R A;  1O23 B;  4G3P A;  1H5T B;  2RJ1 A;  2MZB A;  1IIN A;  1JV3 A;  3IOH A;  4FRM A;  5FU8 A;  4ZDQ A;  1SS9 A;  3FOQ A;  4KRV A;  1WT2 A;  2VS3 A;  4XWI A;  3V91 A;  5FV9 A;  2OI7 A;  1G8O A;  4D0T A;  2PGV A;  5C1H A;  2DPW A;  1FXJ A;  2Y7A A;  3I0E A;  4EVW A;  3JUJ A;  3CU0 A;  3V0Q A;  5FUH A;  4EEA A;  1WT3 A;  1VH1 A;  1H5R A;  2VS5 A;  1ZCY A;  1H3M A;  1R7X A;  2PA4 A;  1FZW A;  1R82 A;  4HO2 A;  4B3U A;  1QGQ A;  3OH2 A;  3Q4S A;  3SX7 A;  5C1L A;  1YP4 A;  2W0V A;  3F1C A;  1H5T A;  2YES A;  4B4B A;  3E25 A;  1ZCT A;  4NAK A;  3D5N A;  3OGZ A;  2V0J A;  4BMA A;  2V0L A;  4KT7 A;  4NAL A;  3HL3 A;  2XME A;  3SXG A; 
#chains in the Genus database with same CATH topology
 5I1F A;  1INI A;  1EYR A;  3SXE A;  2AM3 A;  4AYJ A;  3CGX A;  1MP5 A;  3V8Z A;  1ZHJ A;  1K4V A;  1ZJ1 A;  2XMH A;  1EZI A;  1HM0 A;  2P73 A;  2W0W A;  3USR A;  1H7E A;  2E3D A;  1NKH B;  3SXC A;  4FIX A;  4FRQ A;  4Y64 A;  5CQP A;  3V0P A;  4EE5 A;  2RIX A;  4BQH A;  1H5S B;  1TW1 A;  1S4O A;  5L6V A;  2VD4 A;  4HO3 A;  1ZJ3 A;  4B42 A;  4E1K A;  1VGT A;  2OEF A;  1MP4 A;  2O1F A;  3ST8 A;  4HO4 A;  3SXA A;  4ECM A;  5FTV A;  3U2T A;  2A8W A;  5C8R A;  3T7O A;  4P02 A;  3OC9 A;  2RIT A;  4B4G A;  4JIS A;  1VGZ A;  1QGS A;  2Y6P A;  1H7Q A;  1JVG A;  5C3A A;  2AH9 A;  2C0N A;  2P72 A;  3OKR A;  1G9R A;  2WAW A;  1ON8 A;  1G3L A;  4B2X A;  3SX8 A;  4Y62 A;  3NGW A;  2RJ7 A;  2ZU8 A;  1I52 A;  3O3P A;  4FRA A;  4EE3 A;  1WSZ A;  1W55 A;  1HM8 A;  1KWS A;  4Q7C A;  2Z86 A;  1GQC A;  5J49 A;  4AC3 A;  3R3I A;  1H5R B;  1HJL A;  3I0D A;  1LL3 A;  1FOA A;  1E5K A;  2D7R A;  1ZIZ A;  2RJ0 A;  1INJ A;  1NWG B;  5HS2 A;  4HO9 A;  3OAM A;  5IFY A;  2Y4K A;  3V0O A;  4D0Z A;  4M2B A;  2D7I A;  4Y6N A;  4CJ8 A;  5D92 A;  4FQW A;  4D11 C;  1G2V A;  2WGZ A;  4IRP A;  1ZJO A;  2FY7 A;  3IOI A;  3U0X A;  3I0C A;  3K8D A;  3RMV A;  4DEC A;  2V0H A;  2X5S A;  3LW6 A;  4M4K A;  4Y7F A;  1FXO A;  4Y7T A;  3ZLL A;  1G95 A;  1H5S D;  1ZDG A;  1WT0 A;  2RIY A;  1FR8 A;  4DE7 A;  1H7L A;  1JVD A;  4R7P A;  1NHE B;  3OH0 A;  2A8U A;  3SXD A;  1XHB A;  3I0J A;  1Z90 A;  2O1H A;  3V0L A;  4FRE A;  2J0A A;  4FRH A;  1LZ0 A;  1ON6 A;  3I0H A;  2XWM A;  4EEO A;  1VH3 A;  4KPZ A;  3V8Y A;  1H7F A;  4GBP A;  5FYE A;  5L6S A;  3D8V A;  3SPT A;  3DK5 A;  4C2S A;  2VSI A;  1WT1 A;  3TZT A;  3R2W A;  2X5Z A;  3ZLK A;  1FO9 A;  1HM9 A;  1LZ7 A;  1VGW A;  3SX5 A;  5EJ1 A;  4KC2 A;  4JD0 A;  5CQO A;  2YQS A;  4M28 A;  1FGX A;  2RJ4 A;  2OI5 A;  4HO0 A;  1VZU A;  2D0J A;  1OMX A;  2GGQ A;  1ZI4 A;  2XWN A;  2VSH A;  1ZI1 A;  1VGU A;  2OEG A;  4Y63 A;  2XWL A;  5CMH A;  1GX0 A;  1R7Y A;  2I7B A;  2I5E A;  1PZY B;  3USQ A;  3U2U A;  4M2A A;  5C4E A;  4KQL A;  3U2X A;  3RSB A;  4MND A;  2AEC A;  5IDS A;  5DDT A;  1VM8 A;  4IRQ A;  4MYB A;  3PNN A;  3U0Y A;  1HV9 A;  1H4E A;  5C4B A;  2I5K A;  2RJ8 A;  1R80 A;  2ZU9 A;  2VFZ A;  4KNR A;  3I0I X;  2YQC A;  5DDV A;  3JTJ A;  2PX7 A;  1S4N A;  3K8E A;  4FCU A;  2AES A;  2RJ6 A;  4NAN A;  5CMG X;  1LVW A;  2YCM A;  2YC3 A;  4CJB A;  3V90 A;  2X60 A;  2FYB A;  1H4D A;  1ZI5 A;  3OH4 A;  5AJO A;  4EEM A;  1H5S C;  2J0B A;  1WVC A;  5C38 A;  1FO8 A;  1YP2 A;  1PZT A;  4Y6U A;  2Y4L A;  1S4P A;  4HO6 A;  4EEG A;  5FU0 A;  3SX3 A;  5C3D A;  5CQN X;  3Q80 A;  1G97 A;  5CMF X;  5C47 A;  3KIA A;  4FRD A;  4CVH A;  1R7T A;  3SXB A;  1G23 A;  2RJ9 A;  2JCK A;  2OI6 A;  3DJ4 A;  1G93 A;  1LL0 A;  4CJC A;  4FRO A;  4HCQ A;  2YQJ A;  4L41 C;  5C4D A;  3CKO A;  5CQL X;  2WVK A;  4D48 A;  1VIC A;  1H7H A;  4AYL A;  5EJZ A;  5C3B A;  1FG5 N;  2VS4 A;  2FYD B;  1H7G A;  1TZF A;  2WEE A;  4YS8 A;  2YC5 A;  4G3Q A;  4HG6 A;  1ZJ0 A;  4FRL A;  4UEG A;  2PGY A;  3E26 A;  3CKJ A;  2YQH A;  1W77 A;  1GWW A;  2WVL A;  4KPX A;  1ZJ2 A;  1ZDF A;  4KC4 A;  3T7M A;  2UX8 A;  1R7V A;  2RIZ A;  2V0I A;  3I0F A;  1V82 A;  3ZGG A;  3CKN A;  3ZF8 A;  3DUV A;  2BO7 A;  1O7Q A;  1YRO B;  4K6R A;  4NAI A;  1MP3 A;  3ZGF A;  4D11 A;  3RMW A;  3EE5 A;  3F1Y A;  3PKP A;  1LL2 A;  4FRP A;  1V83 A;  1GX4 A;  4DDZ A;  1NMM B;  5CQM X;  1YP3 A;  1FR9 A;  4HO8 A;  3FWW A;  2X65 A;  2FFV A;  1OQM B;  1R81 A;  1FWY A;  5C48 A;  1H4C A;  1TVY A;  2ICX A;  4Y9X A;  1O7O A;  2BO6 A;  5C4F A;  1ZCV A;  5C4C A;  2VK9 A;  1NQI B;  4P00 A;  5CMJ A;  2P6W A;  1GQ9 A;  2VXL A;  3V0N A;  1TW5 A;  4HO5 A;  4EE4 A;  4FRB A;  4FCE A;  2VXM A;  4KNX A;  4ASJ A;  2FYA A;  2E8B A;  3TQD A;  2Z87 A;  5CMI A;  2WVM A;  4ASY A;  4AAW A;  3QVB A;  2Y4J A;  1NF5 B;  3GUE A;  1W57 A;  2RJ5 A;  1QWJ A;  1H7T A;  1JYL A;  1MC3 A;  1G0R A;  1JYK A;  4O6N A;  3I0G A;  5EIY A;  5JQQ A;  1ZJP A;  1ZI3 A;  1LZI A;  2CU2 A;  2QH5 A;  1V84 A;  2BO8 A;  2AE7 A;  1G1L A;  4Y7G A;  3D98 A;  1OMZ A;  3U2V A;  3I0K A;  2AM5 A;  3BCV A;  2AM4 A;  3N9W A;  2GGO A;  1FGG A;  2FYC B;  1XZ6 A;  5C36 A;  3IOJ A;  2APC A;  3OH3 A;  4KXO A;  4Y7V A;  1JV1 A;  3CKV A;  1LZJ A;  4FIY A;  5AJP A;  3Q7U A;  4LW6 A;  3V0M A;  1FRW A;  1ZCU A;  1GA8 A;  1VPA A;  2FFU A;  3CKQ A;  2JCJ A;  2WE9 A;  2Q4J A;  4LW3 A;  2ICY A;  1QG8 A;  2V0K A;  4HOC A;  3PKQ A;  2ZU7 A;  1H5S A;  2BO4 A;  2Y4M A;  2QKX A;  3POL A;  3JUK A;  4KC1 A;  5AJN A;  1GWV A;  4ARW A;  1VZX A;  3I0L A;  3T7N A;  1HJJ A;  3U2W A;  4B4M A;  4J18 A;  4G3S A;  3BRK X;  5C1G A;  2AGD A;  5IDT A;  2O1G A;  4B2W A;  1IIM A;  4G87 A;  3OH1 A;  2NXV A;  4Y7U A;  2JCL A;  1R7U A;  1VZT A;  5FTS A;  5C49 A;  2QGI A;  5BXC A;  4B5B A;  2JCO A;  1O0R A;  1O23 B;  4G3P A;  1H5T B;  2RJ1 A;  2MZB A;  1IIN A;  1JV3 A;  3IOH A;  4FRM A;  5FU8 A;  4ZDQ A;  1SS9 A;  3FOQ A;  4KRV A;  1WT2 A;  2VS3 A;  4XWI A;  3V91 A;  5FV9 A;  2OI7 A;  1G8O A;  4D0T A;  2PGV A;  5C1H A;  2DPW A;  1FXJ A;  2Y7A A;  3I0E A;  4EVW A;  3JUJ A;  3CU0 A;  3V0Q A;  5FUH A;  4EEA A;  4O6M A;  1WT3 A;  1VH1 A;  1H5R A;  2VS5 A;  1ZCY A;  1H3M A;  1R7X A;  2PA4 A;  5D91 A;  1FZW A;  1R82 A;  4HO2 A;  4B3U A;  1QGQ A;  3OH2 A;  3Q4S A;  3SX7 A;  5C1L A;  4MIX A;  1YP4 A;  2W0V A;  3F1C A;  1H5T A;  2YES A;  4B4B A;  3E25 A;  1ZCT A;  4NAK A;  3D5N A;  3OGZ A;  2V0J A;  4BMA A;  2V0L A;  4KT7 A;  4NAL A;  3HL3 A;  2XME A;  3SXG A; 
#chains in the Genus database with same CATH homology
 5I1F A;  1INI A;  1EYR A;  3SXE A;  2AM3 A;  4AYJ A;  3CGX A;  1MP5 A;  3V8Z A;  1ZHJ A;  1K4V A;  1ZJ1 A;  2XMH A;  1EZI A;  1HM0 A;  2P73 A;  2W0W A;  3USR A;  1H7E A;  2E3D A;  1NKH B;  3SXC A;  4FIX A;  4FRQ A;  4Y64 A;  5CQP A;  3V0P A;  4EE5 A;  2RIX A;  4BQH A;  1H5S B;  1TW1 A;  1S4O A;  5L6V A;  2VD4 A;  4HO3 A;  1ZJ3 A;  4B42 A;  4E1K A;  1VGT A;  2OEF A;  1MP4 A;  2O1F A;  3ST8 A;  4HO4 A;  3SXA A;  4ECM A;  5FTV A;  3U2T A;  2A8W A;  5C8R A;  3T7O A;  4P02 A;  3OC9 A;  2RIT A;  4B4G A;  4JIS A;  1VGZ A;  1QGS A;  2Y6P A;  1H7Q A;  1JVG A;  5C3A A;  2AH9 A;  2C0N A;  2P72 A;  3OKR A;  1G9R A;  2WAW A;  1ON8 A;  1G3L A;  4B2X A;  3SX8 A;  4Y62 A;  3NGW A;  2RJ7 A;  2ZU8 A;  1I52 A;  3O3P A;  4FRA A;  4EE3 A;  1WSZ A;  1W55 A;  1HM8 A;  1KWS A;  4Q7C A;  2Z86 A;  1GQC A;  5J49 A;  4AC3 A;  3R3I A;  1H5R B;  1HJL A;  3I0D A;  1LL3 A;  1FOA A;  1E5K A;  2D7R A;  1ZIZ A;  2RJ0 A;  1INJ A;  1NWG B;  5HS2 A;  4HO9 A;  3OAM A;  5IFY A;  2Y4K A;  3V0O A;  4D0Z A;  4M2B A;  2D7I A;  4Y6N A;  4CJ8 A;  5D92 A;  4FQW A;  4D11 C;  1G2V A;  2WGZ A;  4IRP A;  1ZJO A;  2FY7 A;  3IOI A;  3U0X A;  3I0C A;  3K8D A;  3RMV A;  4DEC A;  2V0H A;  2X5S A;  3LW6 A;  4M4K A;  4Y7F A;  1FXO A;  4Y7T A;  3ZLL A;  1G95 A;  1H5S D;  1ZDG A;  1WT0 A;  2RIY A;  1FR8 A;  4DE7 A;  1H7L A;  1JVD A;  4R7P A;  1NHE B;  3OH0 A;  2A8U A;  3SXD A;  1XHB A;  3I0J A;  1Z90 A;  2O1H A;  3V0L A;  4FRE A;  2J0A A;  4FRH A;  1LZ0 A;  1ON6 A;  3I0H A;  2XWM A;  4EEO A;  1VH3 A;  4KPZ A;  3V8Y A;  1H7F A;  4GBP A;  5FYE A;  5L6S A;  3D8V A;  3SPT A;  3DK5 A;  4C2S A;  2VSI A;  1WT1 A;  3TZT A;  3R2W A;  2X5Z A;  3ZLK A;  1FO9 A;  1HM9 A;  1LZ7 A;  1VGW A;  3SX5 A;  5EJ1 A;  4KC2 A;  4JD0 A;  5CQO A;  2YQS A;  4M28 A;  1FGX A;  2RJ4 A;  2OI5 A;  4HO0 A;  1VZU A;  2D0J A;  1OMX A;  2GGQ A;  1ZI4 A;  2XWN A;  2VSH A;  1ZI1 A;  1VGU A;  2OEG A;  4Y63 A;  2XWL A;  5CMH A;  1GX0 A;  1R7Y A;  2I7B A;  2I5E A;  1PZY B;  3USQ A;  3U2U A;  4M2A A;  5C4E A;  4KQL A;  3U2X A;  3RSB A;  4MND A;  2AEC A;  5IDS A;  5DDT A;  1VM8 A;  4IRQ A;  4MYB A;  3PNN A;  3U0Y A;  1HV9 A;  1H4E A;  5C4B A;  2I5K A;  2RJ8 A;  1R80 A;  2ZU9 A;  2VFZ A;  4KNR A;  3I0I X;  2YQC A;  5DDV A;  3JTJ A;  2PX7 A;  1S4N A;  3K8E A;  4FCU A;  2AES A;  2RJ6 A;  4NAN A;  5CMG X;  1LVW A;  2YCM A;  2YC3 A;  4CJB A;  3V90 A;  2X60 A;  2FYB A;  1H4D A;  1ZI5 A;  3OH4 A;  5AJO A;  4EEM A;  1H5S C;  2J0B A;  1WVC A;  5C38 A;  1FO8 A;  1YP2 A;  1PZT A;  4Y6U A;  2Y4L A;  1S4P A;  4HO6 A;  4EEG A;  5FU0 A;  3SX3 A;  5C3D A;  5CQN X;  3Q80 A;  1G97 A;  5CMF X;  5C47 A;  3KIA A;  4FRD A;  4CVH A;  1R7T A;  3SXB A;  1G23 A;  2RJ9 A;  2JCK A;  2OI6 A;  3DJ4 A;  1G93 A;  1LL0 A;  4CJC A;  4FRO A;  4HCQ A;  2YQJ A;  4L41 C;  5C4D A;  3CKO A;  5CQL X;  2WVK A;  4D48 A;  1VIC A;  1H7H A;  4AYL A;  5EJZ A;  5C3B A;  1FG5 N;  2VS4 A;  2FYD B;  1H7G A;  1TZF A;  2WEE A;  4YS8 A;  2YC5 A;  4G3Q A;  4HG6 A;  1ZJ0 A;  4FRL A;  4UEG A;  2PGY A;  3E26 A;  3CKJ A;  2YQH A;  1W77 A;  1GWW A;  2WVL A;  4KPX A;  1ZJ2 A;  1ZDF A;  4KC4 A;  3T7M A;  2UX8 A;  1R7V A;  2RIZ A;  2V0I A;  3I0F A;  1V82 A;  3ZGG A;  3CKN A;  3ZF8 A;  3DUV A;  2BO7 A;  1O7Q A;  1YRO B;  4K6R A;  4NAI A;  1MP3 A;  3ZGF A;  4D11 A;  3RMW A;  3EE5 A;  3F1Y A;  3PKP A;  1LL2 A;  4FRP A;  1V83 A;  1GX4 A;  4DDZ A;  1NMM B;  5CQM X;  1YP3 A;  1FR9 A;  4HO8 A;  3FWW A;  2X65 A;  2FFV A;  1OQM B;  1R81 A;  1FWY A;  5C48 A;  1H4C A;  1TVY A;  2ICX A;  4Y9X A;  1O7O A;  2BO6 A;  5C4F A;  1ZCV A;  5C4C A;  2VK9 A;  1NQI B;  4P00 A;  5CMJ A;  2P6W A;  1GQ9 A;  2VXL A;  3V0N A;  1TW5 A;  4HO5 A;  4EE4 A;  4FRB A;  4FCE A;  2VXM A;  4KNX A;  4ASJ A;  2FYA A;  2E8B A;  3TQD A;  2Z87 A;  5CMI A;  2WVM A;  4ASY A;  4AAW A;  3QVB A;  2Y4J A;  1NF5 B;  3GUE A;  1W57 A;  2RJ5 A;  1QWJ A;  1H7T A;  1JYL A;  1MC3 A;  1G0R A;  1JYK A;  4O6N A;  3I0G A;  5EIY A;  5JQQ A;  1ZJP A;  1ZI3 A;  1LZI A;  2CU2 A;  2QH5 A;  1V84 A;  2BO8 A;  2AE7 A;  1G1L A;  4Y7G A;  3D98 A;  1OMZ A;  3U2V A;  3I0K A;  2AM5 A;  3BCV A;  2AM4 A;  3N9W A;  2GGO A;  1FGG A;  2FYC B;  1XZ6 A;  5C36 A;  3IOJ A;  2APC A;  3OH3 A;  4KXO A;  4Y7V A;  1JV1 A;  3CKV A;  1LZJ A;  4FIY A;  5AJP A;  3Q7U A;  4LW6 A;  3V0M A;  1FRW A;  1ZCU A;  1GA8 A;  1VPA A;  2FFU A;  3CKQ A;  2JCJ A;  2WE9 A;  2Q4J A;  4LW3 A;  2ICY A;  1QG8 A;  2V0K A;  4HOC A;  3PKQ A;  2ZU7 A;  1H5S A;  2BO4 A;  2Y4M A;  2QKX A;  3POL A;  3JUK A;  4KC1 A;  5AJN A;  1GWV A;  4ARW A;  1VZX A;  3I0L A;  3T7N A;  1HJJ A;  3U2W A;  4B4M A;  4J18 A;  4G3S A;  3BRK X;  5C1G A;  2AGD A;  5IDT A;  2O1G A;  4B2W A;  1IIM A;  4G87 A;  3OH1 A;  2NXV A;  4Y7U A;  2JCL A;  1R7U A;  1VZT A;  5FTS A;  5C49 A;  2QGI A;  5BXC A;  4B5B A;  2JCO A;  1O0R A;  1O23 B;  4G3P A;  1H5T B;  2RJ1 A;  2MZB A;  1IIN A;  1JV3 A;  3IOH A;  4FRM A;  5FU8 A;  4ZDQ A;  1SS9 A;  3FOQ A;  4KRV A;  1WT2 A;  2VS3 A;  4XWI A;  3V91 A;  5FV9 A;  2OI7 A;  1G8O A;  4D0T A;  2PGV A;  5C1H A;  2DPW A;  1FXJ A;  2Y7A A;  3I0E A;  4EVW A;  3JUJ A;  3CU0 A;  3V0Q A;  5FUH A;  4EEA A;  4O6M A;  1WT3 A;  1VH1 A;  1H5R A;  2VS5 A;  1ZCY A;  1H3M A;  1R7X A;  2PA4 A;  5D91 A;  1FZW A;  1R82 A;  4HO2 A;  4B3U A;  1QGQ A;  3OH2 A;  3Q4S A;  3SX7 A;  5C1L A;  4MIX A;  1YP4 A;  2W0V A;  3F1C A;  1H5T A;  2YES A;  4B4B A;  3E25 A;  1ZCT A;  4NAK A;  3D5N A;  3OGZ A;  2V0J A;  4BMA A;  2V0L A;  4KT7 A;  4NAL A;  3HL3 A;  2XME A;  3SXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...