1G23A

The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). glucose-1-phosphate complex.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
292
structure length
292
Chain Sequence
KRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
publication title The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (RmlA).
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 95
structure length 292
sequence length 292
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2000-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1g23A00
1LZ0A 3I0GA 5FU0A 1JVDA 2AE7A 2PX7A 5FV9A 3OC9A 1G2VA 1GWVA 1H4CA 1PZTA 4KC2A 2RJ4A 2WAWA 2YQJA 2W0WA 4EEOA 1GX0A 1E5KA 2PGVA 2W0VA 1ZDGA 2RJ0A 2XWNA 1FR8A 3FOQA 2ICYA 1R7YA 5AJOA 3POLA 2RIYA 3SX3A 1ZI4A 2X60A 3I0EA 4KRVA 1H7HA 2RJ1A 1ZJ3A 4K6RA 2OI5A 4HO9A 3CKOA 4Y7VA 1NWGB 4NANA 2P73A 1HM9A 2RJ8A 5CMGX 1ZHJA 1IINA 4IRPA 2BO4A 3I0KA 3SXAA 4C2SA 2FFUA 2OI7A 1WVCA 3U2XA 5I1FA 1V83A 1SS9A 2D7RA 4HO5A 1G97A 2Y7AA 1ZDFA 5C4BA 5CQOA 4FRLA 3N9WA 3D5NA 1H4DA 2ZU8A 4MNDA 2YQHA 2XMHA 1Z90A 4B5BA 3R2WA 5C4FA 2QGIA 1FRWA 2V0IA 4Y7GA 3ZF8A 4D48A 4HO0A 1W55A 3JTJA 1LZ7A 4D11C 2YC3A 3D8VA 4EE3A 4AYLA 1NF5B 3I0DA 4ZDQA 1INIA 3I0FA 1LL2A 2ZU7A 5L6SA 2RIXA 2WVMA 3BRKX 1TVYA 2JCJA 5C38A 3PNNA 1H7GA 2VS3A 4FRMA 2QKXA 2X5ZA 3SX8A 2E3DA 1HM0A 1NQIB 4ECMA 5C49A 1H5SA 4B4BA 2D0JA 5IFYA 4Y6NA 3OH3A 5IDSA 3I0LA 4UEGA 4D0ZA 4ASJA 3OH4A 3RMWA 4M2BA 1TW5A 1FOAA 2VSIA 2ZU9A 3U2UA 1ZI3A 4HOCA 3JUKA 3OKRA 3ZGFA 1VGWA 2VFZA 1ZCVA 2WGZA 1WT2A 3SXEA 2AM4A 1H5RA 5C3BA 2D7IA 2BO7A 1G23A 2ICXA 1OMZA 4HO6A 1OMXA 1JV3A 1LZJA 1NMMB 2V0KA 2I7BA 1ZJ1A 2YESA 2XMEA 3DJ4A 4FRPA 3SXDA 4KQLA 1S4PA 3SXBA 5C1LA 1HJLA 5FYEA 4G3PA 5L6VA 5AJNA 5JQQA 1V82A 1H5SD 1MP4A 3USRA 3V0PA 1VZUA 2JCOA 4DECA 5FTSA 1H5TB 2A8UA 1ZJOA 1VPAA 1VZXA 2RJ6A 1O7QA 1FWYA 4HCQA 2P6WA 1FXJA 1WSZA 5CQMX 1FG5N 2FY7A 2AESA 4EE5A 1VGUA 2A8WA 2AH9A 3SXGA 1WT0A 3ZLLA 5C48A 4MYBA 4Y63A 2YQSA 1QWJA 4CVHA 3Q80A 3TQDA 2FYDB 4FRBA 1G95A 3OGZA 3V0LA 5CQLX 3PKPA 1R80A 1O0RA 3USQA 3Q7UA 1VZTA 4E1KA 3CU0A 3SPTA 4B3UA 1ZJ2A 1H7QA 1VGTA 3CKNA 3T7NA 5IDTA 1YP4A 4B2XA 1ZIZA 2Y4LA 3U2VA 2V0JA 3V90A 1G0RA 3V8YA 5C4EA 2RJ7A 4DDZA 2BO8A 2AM5A 1W57A 3CKJA 3QVBA 1H7EA 4G3SA 2Q4JA 1KWSA 4AAWA 1QG8A 1ZI5A 3LW6A 3NGWA 3K8EA 5C3DA 5C1GA 1O7OA 2APCA 3F1CA 1JVGA 2QH5A 2VD4A 1IIMA 2WVLA 4CJ8A 4G87A 2FYCB 3Q4SA 1R81A 1EYRA 4KC1A 2CU2A 2PA4A 2BO6A 5CMJA 4Y9XA 2WVKA 4FROA 5C36A 1ZI1A 4EVWA 1R7TA 3E26A 5C4CA 3U2WA 4HO2A 4IRQA 3V0MA 5HS2A 4Y6UA 4D0TA 2XWMA 4M4KA 2Y4MA 3RSBA 4FREA 4FQWA 1HJJA 4L41C 3E25A 4LW3A 5EJZA 4FCUA 1ZCTA 4D11A 4FRHA 2Y6PA 1V84A 4KNXA 2RJ5A 4M28A 1GQCA 4AC3A 5AJPA 3KIAA 4M2AA 1ON8A 4FRDA 1LL0A 3IOIA 3OH2A 3U0YA 3FWWA 5C8RA 1R7XA 1GWWA 3RMVA 2WEEA 2O1HA 2OEFA 2P72A 4YS8A 4DE7A 1G9RA 2X65A 2X5SA 1S4NA 4HO4A 1JYKA 1G1LA 3PKQA 4CJBA 4KXOA 5J49A 2RIZA 1YP3A 4Y62A 4B2WA 5CMFX 2V0HA 2Z87A 4NAKA 5CMIA 4ARWA 4P02A 1VH3A 2FYBA 1I52A 1FO8A 4JD0A 4KC4A 1WT3A 4NALA 1H3MA 2VS5A 4KPZA 1FR9A 1LL3A 3R3IA 3OH1A 3U0XA 4ASYA 1MP5A 2VXMA 1G93A 3O3PA 1HV9A 1GQ9A 3EE5A 4R7PA 2VXLA 1YROB 2MZBA 4BQHA 1ON6A 3JUJA 4HO8A 3CKQA 5FU8A 1ZCYA 2XWLA 1FGGA 5FUHA 2O1FA 4XWIA 4Y64A 1FO9A 2YCMA 3I0CA 2PGYA 1QGSA 5EJ1A 1ZJPA 4CJCA 4FCEA 4B4MA 2Y4JA 2OI6A 2RITA 2I5KA 5EIYA 2UX8A 1H4EA 1VICA 3I0JA 3SX7A 3SX5A 3V0QA 3SXCA 3DUVA 1H5SB 1GA8A 5C4DA 2VSHA 3D98A 1K4VA 1VH1A 2DPWA 1G8OA 1ZCUA 2Z86A 4Y7FA 5C47A 4EEGA 4KPXA 1WT1A 4EEAA 3OAMA 3I0HA 3ST8A 3IOJA 4EE4A 1GX4A 5FTVA 3V8ZA 4EEMA 2V0LA 4KT7A 1XHBA 1H5RB 1HM8A 1LZIA 2YQCA 1NKHB 1FZWA 3DK5A 1H7TA 1ZJ0A 3T7MA 4Y7UA 3K8DA 5CMHA 5DDVA 1PZYB 1G3LA 1H5SC 1NHEB 5BXCA 1H5TA 2YC5A 3CKVA 3I0IX 3BCVA 4FRAA 3T7OA 3V0OA 1JYLA 4P00A 3F1YA 1INJA 1JV1A 1YP2A 2GGQA 3CGXA 2RJ9A 1TW1A 1LVWA 1QGQA 2VS4A 2JCLA 4B42A 1EZIA 1R7VA 3V0NA 4GBPA 4FRQA 1MC3A 3ZLKA 2FYAA 4HO3A 1XZ6A 1S4OA 1FGXA 1W77A 3OH0A 5C3AA 3GUEA 2I5EA 5DDTA 2FFVA 1FXOA 1MP3A 4HG6A 3ZGGA 4J18A 3U2TA 5C1HA 5CQNX 1OQMB 1VM8A 5CQPA 3HL3A 4NAIA 2GGOA 1H7LA 2Y4KA 1R7UA 4BMAA 2NXVA 2JCKA 2WE9A 4LW6A 2AECA 2E8BA 1O23B 4Y7TA 1VGZA 4KNRA 4JISA 3IOHA 2AGDA 4B4GA 2AM3A 3V91A 3TZTA 1H7FA 4AYJA 1TZFA 2O1GA 2OEGA 4G3QA 1R82A
chains in the Genus database with same CATH superfamily
1LZ0A 3I0GA 5FU0A 1JVDA 2AE7A 2PX7A 5FV9A 3OC9A 1G2VA 1GWVA 1H4CA 1PZTA 4KC2A 2RJ4A 2WAWA 2YQJA 2W0WA 4EEOA 1GX0A 1E5KA 2PGVA 2W0VA 1ZDGA 2RJ0A 2XWNA 1FR8A 3FOQA 2ICYA 1R7YA 5AJOA 3POLA 2RIYA 2J0BA 3SX3A 1ZI4A 2X60A 3I0EA 4KRVA 1H7HA 2RJ1A 1ZJ3A 4K6RA 2OI5A 4HO9A 3CKOA 4Y7VA 1NWGB 4NANA 2P73A 1HM9A 2RJ8A 5CMGX 1ZHJA 1IINA 4IRPA 2BO4A 3I0KA 3SXAA 4C2SA 2FFUA 2OI7A 1WVCA 3U2XA 5I1FA 1V83A 1SS9A 2D7RA 4HO5A 1G97A 2Y7AA 1ZDFA 5C4BA 5CQOA 4FRLA 3N9WA 3D5NA 1H4DA 2ZU8A 4MNDA 2YQHA 2XMHA 1Z90A 4B5BA 3R2WA 5C4FA 2QGIA 1FRWA 2V0IA 4Y7GA 3ZF8A 4D48A 4HO0A 1W55A 3JTJA 1LZ7A 4D11C 2YC3A 3D8VA 4EE3A 4AYLA 1NF5B 3I0DA 4ZDQA 1INIA 3I0FA 1LL2A 2ZU7A 5L6SA 2RIXA 2WVMA 3BRKX 1TVYA 2VK9A 2JCJA 5C38A 3PNNA 1H7GA 2VS3A 4FRMA 2QKXA 2X5ZA 3SX8A 2E3DA 1HM0A 1NQIB 4ECMA 5C49A 1H5SA 4B4BA 2D0JA 5IFYA 4Y6NA 3OH3A 5IDSA 3I0LA 4UEGA 4D0ZA 4ASJA 3OH4A 3RMWA 4M2BA 1TW5A 1FOAA 2VSIA 2ZU9A 3U2UA 1ZI3A 4HOCA 3JUKA 3OKRA 3ZGFA 1VGWA 2VFZA 1ZCVA 2WGZA 1WT2A 3SXEA 2AM4A 1H5RA 5C3BA 2D7IA 2BO7A 1G23A 2ICXA 1OMZA 4HO6A 1OMXA 1JV3A 1LZJA 1NMMB 2V0KA 2I7BA 1ZJ1A 2YESA 2XMEA 3DJ4A 4FRPA 3SXDA 4KQLA 1S4PA 3SXBA 5C1LA 5D91A 1HJLA 5FYEA 4G3PA 5L6VA 5AJNA 5JQQA 1V82A 1H5SD 1MP4A 3USRA 3V0PA 1VZUA 2JCOA 4DECA 5FTSA 1H5TB 2A8UA 1ZJOA 1VPAA 1VZXA 2RJ6A 1O7QA 1FWYA 4HCQA 2P6WA 1FXJA 1WSZA 5CQMX 1FG5N 2FY7A 2AESA 4EE5A 1VGUA 2A8WA 2AH9A 3SXGA 1WT0A 3ZLLA 5C48A 4MYBA 4Y63A 2YQSA 1QWJA 4CVHA 3Q80A 3TQDA 2FYDB 4FRBA 1G95A 3OGZA 3V0LA 5CQLX 3PKPA 1R80A 1O0RA 3USQA 3Q7UA 1VZTA 4E1KA 3CU0A 3SPTA 4B3UA 1ZJ2A 1H7QA 1VGTA 2J0AA 3CKNA 3T7NA 5IDTA 1YP4A 4B2XA 1ZIZA 2Y4LA 3U2VA 2V0JA 3V90A 1G0RA 3V8YA 5C4EA 2RJ7A 4DDZA 2BO8A 2AM5A 1W57A 3CKJA 3QVBA 1H7EA 4G3SA 2Q4JA 1KWSA 4AAWA 1QG8A 1ZI5A 3LW6A 3NGWA 3K8EA 5C3DA 5C1GA 1O7OA 2APCA 3F1CA 1JVGA 2QH5A 2VD4A 1IIMA 2WVLA 4CJ8A 4G87A 2FYCB 3Q4SA 1R81A 1EYRA 4KC1A 2CU2A 2PA4A 2BO6A 5CMJA 4Y9XA 2WVKA 4FROA 5C36A 1ZI1A 4EVWA 1R7TA 3E26A 5C4CA 3U2WA 4HO2A 4IRQA 3V0MA 5HS2A 4Y6UA 4D0TA 2XWMA 4M4KA 2Y4MA 3RSBA 4FREA 4FQWA 1HJJA 4L41C 3E25A 4LW3A 5EJZA 4FCUA 1ZCTA 4D11A 4FRHA 2Y6PA 1V84A 4KNXA 2RJ5A 4M28A 1GQCA 4O6MA 4AC3A 5AJPA 3KIAA 4M2AA 1ON8A 4FRDA 1LL0A 3IOIA 3OH2A 3U0YA 3FWWA 5C8RA 1R7XA 1GWWA 3RMVA 2WEEA 2O1HA 2OEFA 2P72A 4YS8A 4DE7A 1G9RA 2X65A 2X5SA 1S4NA 4HO4A 1JYKA 5D92A 1G1LA 3PKQA 4CJBA 4KXOA 5J49A 2RIZA 1YP3A 4Y62A 4B2WA 5CMFX 2V0HA 2Z87A 4NAKA 5CMIA 4ARWA 4P02A 1VH3A 2FYBA 1I52A 1FO8A 4JD0A 4FIXA 1WT3A 4KC4A 4NALA 1H3MA 2VS5A 4KPZA 1FR9A 1LL3A 3R3IA 3OH1A 3U0XA 4ASYA 1MP5A 2VXMA 1G93A 4FIYA 3O3PA 2C0NA 1HV9A 1GQ9A 3EE5A 4R7PA 2VXLA 1YROB 2MZBA 4BQHA 1ON6A 3JUJA 4HO8A 3CKQA 5FU8A 1ZCYA 2XWLA 1FGGA 5FUHA 2O1FA 4XWIA 4Y64A 1FO9A 2YCMA 3I0CA 2PGYA 1QGSA 5EJ1A 1ZJPA 4CJCA 4FCEA 4B4MA 2Y4JA 2OI6A 2RITA 2I5KA 5EIYA 2UX8A 1H4EA 1VICA 3I0JA 3SX7A 3SX5A 3V0QA 3SXCA 3DUVA 1H5SB 1GA8A 5C4DA 2VSHA 3D98A 1K4VA 1VH1A 2DPWA 1G8OA 1ZCUA 2Z86A 4Y7FA 5C47A 4EEGA 4KPXA 1WT1A 4EEAA 3OAMA 3I0HA 3ST8A 3IOJA 4EE4A 1GX4A 5FTVA 3V8ZA 4EEMA 2V0LA 4KT7A 1XHBA 1H5RB 1HM8A 1LZIA 2YQCA 1NKHB 1FZWA 3DK5A 1H7TA 1ZJ0A 3T7MA 4Y7UA 3K8DA 5CMHA 5DDVA 1PZYB 1G3LA 1H5SC 1NHEB 5BXCA 1H5TA 2YC5A 3CKVA 3I0IX 3BCVA 4FRAA 3T7OA 3V0OA 1JYLA 4P00A 3F1YA 4MIXA 1INJA 1JV1A 1YP2A 2GGQA 3CGXA 2RJ9A 1TW1A 1LVWA 1QGQA 2VS4A 2JCLA 4B42A 4Q7CA 1EZIA 1R7VA 3V0NA 4GBPA 4FRQA 1MC3A 3ZLKA 2FYAA 4HO3A 1XZ6A 1S4OA 1FGXA 1W77A 3OH0A 5C3AA 3GUEA 2I5EA 5DDTA 2FFVA 1FXOA 1MP3A 4HG6A 3ZGGA 4J18A 3U2TA 5C1HA 5CQNX 1OQMB 1VM8A 5CQPA 3HL3A 4NAIA 2GGOA 1H7LA 2Y4KA 1R7UA 4BMAA 2NXVA 2JCKA 2WE9A 4LW6A 2AECA 2E8BA 1O23B 4Y7TA 1VGZA 4KNRA 4JISA 3IOHA 2AGDA 4B4GA 2AM3A 4O6NA 3V91A 3TZTA 1H7FA 4AYJA 1TZFA 2O1GA 2OEGA 4G3QA 1R82A
chains in the Genus database with same CATH topology
1LZ0A 3I0GA 5FU0A 1JVDA 2AE7A 2PX7A 5FV9A 3OC9A 1G2VA 1GWVA 1H4CA 1PZTA 4KC2A 2RJ4A 2WAWA 2YQJA 2W0WA 4EEOA 1GX0A 1E5KA 2PGVA 2W0VA 1ZDGA 2RJ0A 2XWNA 1FR8A 3FOQA 2ICYA 1R7YA 5AJOA 3POLA 2RIYA 2J0BA 3SX3A 1ZI4A 2X60A 3I0EA 4KRVA 1H7HA 2RJ1A 1ZJ3A 4K6RA 2OI5A 4HO9A 3CKOA 4Y7VA 1NWGB 4NANA 2P73A 1HM9A 2RJ8A 5CMGX 1ZHJA 1IINA 4IRPA 2BO4A 3I0KA 3SXAA 4C2SA 2FFUA 2OI7A 1WVCA 3U2XA 5I1FA 1V83A 1SS9A 2D7RA 4HO5A 1G97A 2Y7AA 1ZDFA 5C4BA 5CQOA 4FRLA 3N9WA 3D5NA 1H4DA 2ZU8A 4MNDA 2YQHA 2XMHA 1Z90A 4B5BA 3R2WA 5C4FA 2QGIA 1FRWA 2V0IA 4Y7GA 3ZF8A 4D48A 4HO0A 1W55A 3JTJA 1LZ7A 4D11C 2YC3A 3D8VA 4EE3A 4AYLA 1NF5B 3I0DA 4ZDQA 1INIA 3I0FA 1LL2A 2ZU7A 5L6SA 2RIXA 2WVMA 3BRKX 1TVYA 2VK9A 2JCJA 5C38A 3PNNA 1H7GA 2VS3A 4FRMA 2QKXA 2X5ZA 3SX8A 2E3DA 1HM0A 1NQIB 4ECMA 5C49A 1H5SA 4B4BA 2D0JA 5IFYA 4Y6NA 3OH3A 5IDSA 3I0LA 4UEGA 4D0ZA 4ASJA 3OH4A 3RMWA 4M2BA 1TW5A 1FOAA 2VSIA 2ZU9A 3U2UA 1ZI3A 4HOCA 3JUKA 3OKRA 3ZGFA 1VGWA 2VFZA 1ZCVA 2WGZA 1WT2A 3SXEA 2AM4A 1H5RA 5C3BA 2D7IA 2BO7A 1G23A 2ICXA 1OMZA 4HO6A 1OMXA 1JV3A 1LZJA 1NMMB 2V0KA 2I7BA 1ZJ1A 2YESA 2XMEA 3DJ4A 4FRPA 3SXDA 4KQLA 1S4PA 3SXBA 5C1LA 5D91A 1HJLA 5FYEA 4G3PA 5L6VA 5AJNA 5JQQA 1V82A 1H5SD 1MP4A 3USRA 3V0PA 1VZUA 2JCOA 4DECA 5FTSA 1H5TB 2A8UA 1ZJOA 1VPAA 1VZXA 2RJ6A 1O7QA 1FWYA 4HCQA 2P6WA 1FXJA 1WSZA 5CQMX 1FG5N 2FY7A 2AESA 4EE5A 1VGUA 2A8WA 2AH9A 3SXGA 1WT0A 3ZLLA 5C48A 4MYBA 4Y63A 2YQSA 1QWJA 4CVHA 3Q80A 3TQDA 2FYDB 4FRBA 1G95A 3OGZA 3V0LA 5CQLX 3PKPA 1R80A 1O0RA 3USQA 3Q7UA 1VZTA 4E1KA 3CU0A 3SPTA 4B3UA 1ZJ2A 1H7QA 1VGTA 2J0AA 3CKNA 3T7NA 5IDTA 1YP4A 4B2XA 1ZIZA 2Y4LA 3U2VA 2V0JA 3V90A 1G0RA 3V8YA 5C4EA 2RJ7A 4DDZA 2BO8A 2AM5A 1W57A 3CKJA 3QVBA 1H7EA 4G3SA 2Q4JA 1KWSA 4AAWA 1QG8A 1ZI5A 3LW6A 3NGWA 3K8EA 5C3DA 5C1GA 1O7OA 2APCA 3F1CA 1JVGA 2QH5A 2VD4A 1IIMA 2WVLA 4CJ8A 4G87A 2FYCB 3Q4SA 1R81A 1EYRA 4KC1A 2CU2A 2PA4A 2BO6A 5CMJA 4Y9XA 2WVKA 4FROA 5C36A 1ZI1A 4EVWA 1R7TA 3E26A 5C4CA 3U2WA 4HO2A 4IRQA 3V0MA 5HS2A 4Y6UA 4D0TA 2XWMA 4M4KA 2Y4MA 3RSBA 4FREA 4FQWA 1HJJA 4L41C 3E25A 4LW3A 5EJZA 4FCUA 1ZCTA 4D11A 4FRHA 2Y6PA 1V84A 4KNXA 2RJ5A 4M28A 1GQCA 4O6MA 4AC3A 5AJPA 3KIAA 4M2AA 1ON8A 4FRDA 1LL0A 3IOIA 3OH2A 3U0YA 3FWWA 5C8RA 1R7XA 1GWWA 3RMVA 2WEEA 2O1HA 2OEFA 2P72A 4YS8A 4DE7A 1G9RA 2X65A 2X5SA 1S4NA 4HO4A 1JYKA 5D92A 1G1LA 3PKQA 4CJBA 4KXOA 5J49A 2RIZA 1YP3A 4Y62A 4B2WA 5CMFX 2V0HA 2Z87A 4NAKA 5CMIA 4ARWA 4P02A 1VH3A 2FYBA 1I52A 1FO8A 4JD0A 4FIXA 1WT3A 4KC4A 4NALA 1H3MA 2VS5A 4KPZA 1FR9A 1LL3A 3R3IA 3OH1A 3U0XA 4ASYA 1MP5A 2VXMA 1G93A 4FIYA 3O3PA 2C0NA 1HV9A 1GQ9A 3EE5A 4R7PA 2VXLA 1YROB 2MZBA 4BQHA 1ON6A 3JUJA 4HO8A 3CKQA 5FU8A 1ZCYA 2XWLA 1FGGA 5FUHA 2O1FA 4XWIA 4Y64A 1FO9A 2YCMA 3I0CA 2PGYA 1QGSA 5EJ1A 1ZJPA 4CJCA 4FCEA 4B4MA 2Y4JA 2OI6A 2RITA 2I5KA 5EIYA 2UX8A 1H4EA 1VICA 3I0JA 3SX7A 3SX5A 3V0QA 3SXCA 3DUVA 1H5SB 1GA8A 5C4DA 2VSHA 3D98A 1K4VA 1VH1A 2DPWA 1G8OA 1ZCUA 2Z86A 4Y7FA 5C47A 4EEGA 4KPXA 1WT1A 4EEAA 3OAMA 3I0HA 3ST8A 3IOJA 4EE4A 1GX4A 5FTVA 3V8ZA 4EEMA 2V0LA 4KT7A 1XHBA 1H5RB 1HM8A 1LZIA 2YQCA 1NKHB 1FZWA 3DK5A 1H7TA 1ZJ0A 3T7MA 4Y7UA 3K8DA 5CMHA 5DDVA 1PZYB 1G3LA 1H5SC 1NHEB 5BXCA 1H5TA 2YC5A 3CKVA 3I0IX 3BCVA 4FRAA 3T7OA 3V0OA 1JYLA 4P00A 3F1YA 4MIXA 1INJA 1JV1A 1YP2A 2GGQA 3CGXA 2RJ9A 1TW1A 1LVWA 1QGQA 2VS4A 2JCLA 4B42A 4Q7CA 1EZIA 1R7VA 3V0NA 4GBPA 4FRQA 1MC3A 3ZLKA 2FYAA 4HO3A 1XZ6A 1S4OA 1FGXA 1W77A 3OH0A 5C3AA 3GUEA 2I5EA 5DDTA 2FFVA 1FXOA 1MP3A 4HG6A 3ZGGA 4J18A 3U2TA 5C1HA 5CQNX 1OQMB 1VM8A 5CQPA 3HL3A 4NAIA 2GGOA 1H7LA 2Y4KA 1R7UA 4BMAA 2NXVA 2JCKA 2WE9A 4LW6A 2AECA 2E8BA 1O23B 4Y7TA 1VGZA 4KNRA 4JISA 3IOHA 2AGDA 4B4GA 2AM3A 4O6NA 3V91A 3TZTA 1H7FA 4AYJA 1TZFA 2O1GA 2OEGA 4G3QA 1R82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LZ0 A;  3I0G A;  5FU0 A;  1JVD A;  2AE7 A;  2PX7 A;  5FV9 A;  3OC9 A;  1G2V A;  1GWV A;  1H4C A;  1PZT A;  4KC2 A;  2RJ4 A;  2WAW A;  2YQJ A;  2W0W A;  4EEO A;  1GX0 A;  1E5K A;  2PGV A;  2W0V A;  1ZDG A;  2RJ0 A;  2XWN A;  1FR8 A;  3FOQ A;  2ICY A;  1R7Y A;  5AJO A;  3POL A;  2RIY A;  3SX3 A;  1ZI4 A;  2X60 A;  3I0E A;  4KRV A;  1H7H A;  2RJ1 A;  1ZJ3 A;  4K6R A;  2OI5 A;  4HO9 A;  3CKO A;  4Y7V A;  1NWG B;  4NAN A;  2P73 A;  1HM9 A;  2RJ8 A;  5CMG X;  1ZHJ A;  1IIN A;  4IRP A;  2BO4 A;  3I0K A;  3SXA A;  4C2S A;  2FFU A;  2OI7 A;  1WVC A;  3U2X A;  5I1F A;  1V83 A;  1SS9 A;  2D7R A;  4HO5 A;  1G97 A;  2Y7A A;  1ZDF A;  5C4B A;  5CQO A;  4FRL A;  3N9W A;  3D5N A;  1H4D A;  2ZU8 A;  4MND A;  2YQH A;  2XMH A;  1Z90 A;  4B5B A;  3R2W A;  5C4F A;  2QGI A;  1FRW A;  2V0I A;  4Y7G A;  3ZF8 A;  4D48 A;  4HO0 A;  1W55 A;  3JTJ A;  1LZ7 A;  4D11 C;  2YC3 A;  3D8V A;  4EE3 A;  4AYL A;  1NF5 B;  3I0D A;  4ZDQ A;  1INI A;  3I0F A;  1LL2 A;  2ZU7 A;  5L6S A;  2RIX A;  2WVM A;  3BRK X;  1TVY A;  2JCJ A;  5C38 A;  3PNN A;  1H7G A;  2VS3 A;  4FRM A;  2QKX A;  2X5Z A;  3SX8 A;  2E3D A;  1HM0 A;  1NQI B;  4ECM A;  5C49 A;  1H5S A;  4B4B A;  2D0J A;  5IFY A;  4Y6N A;  3OH3 A;  5IDS A;  3I0L A;  4UEG A;  4D0Z A;  4ASJ A;  3OH4 A;  3RMW A;  4M2B A;  1TW5 A;  1FOA A;  2VSI A;  2ZU9 A;  3U2U A;  1ZI3 A;  4HOC A;  3JUK A;  3OKR A;  3ZGF A;  1VGW A;  2VFZ A;  1ZCV A;  2WGZ A;  1WT2 A;  3SXE A;  2AM4 A;  1H5R A;  5C3B A;  2D7I A;  2BO7 A;  1G23 A;  2ICX A;  1OMZ A;  4HO6 A;  1OMX A;  1JV3 A;  1LZJ A;  1NMM B;  2V0K A;  2I7B A;  1ZJ1 A;  2YES A;  2XME A;  3DJ4 A;  4FRP A;  3SXD A;  4KQL A;  1S4P A;  3SXB A;  5C1L A;  1HJL A;  5FYE A;  4G3P A;  5L6V A;  5AJN A;  5JQQ A;  1V82 A;  1H5S D;  1MP4 A;  3USR A;  3V0P A;  1VZU A;  2JCO A;  4DEC A;  5FTS A;  1H5T B;  2A8U A;  1ZJO A;  1VPA A;  1VZX A;  2RJ6 A;  1O7Q A;  1FWY A;  4HCQ A;  2P6W A;  1FXJ A;  1WSZ A;  5CQM X;  1FG5 N;  2FY7 A;  2AES A;  4EE5 A;  1VGU A;  2A8W A;  2AH9 A;  3SXG A;  1WT0 A;  3ZLL A;  5C48 A;  4MYB A;  4Y63 A;  2YQS A;  1QWJ A;  4CVH A;  3Q80 A;  3TQD A;  2FYD B;  4FRB A;  1G95 A;  3OGZ A;  3V0L A;  5CQL X;  3PKP A;  1R80 A;  1O0R A;  3USQ A;  3Q7U A;  1VZT A;  4E1K A;  3CU0 A;  3SPT A;  4B3U A;  1ZJ2 A;  1H7Q A;  1VGT A;  3CKN A;  3T7N A;  5IDT A;  1YP4 A;  4B2X A;  1ZIZ A;  2Y4L A;  3U2V A;  2V0J A;  3V90 A;  1G0R A;  3V8Y A;  5C4E A;  2RJ7 A;  4DDZ A;  2BO8 A;  2AM5 A;  1W57 A;  3CKJ A;  3QVB A;  1H7E A;  4G3S A;  2Q4J A;  1KWS A;  4AAW A;  1QG8 A;  1ZI5 A;  3LW6 A;  3NGW A;  3K8E A;  5C3D A;  5C1G A;  1O7O A;  2APC A;  3F1C A;  1JVG A;  2QH5 A;  2VD4 A;  1IIM A;  2WVL A;  4CJ8 A;  4G87 A;  2FYC B;  3Q4S A;  1R81 A;  1EYR A;  4KC1 A;  2CU2 A;  2PA4 A;  2BO6 A;  5CMJ A;  4Y9X A;  2WVK A;  4FRO A;  5C36 A;  1ZI1 A;  4EVW A;  1R7T A;  3E26 A;  5C4C A;  3U2W A;  4HO2 A;  4IRQ A;  3V0M A;  5HS2 A;  4Y6U A;  4D0T A;  2XWM A;  4M4K A;  2Y4M A;  3RSB A;  4FRE A;  4FQW A;  1HJJ A;  4L41 C;  3E25 A;  4LW3 A;  5EJZ A;  4FCU A;  1ZCT A;  4D11 A;  4FRH A;  2Y6P A;  1V84 A;  4KNX A;  2RJ5 A;  4M28 A;  1GQC A;  4AC3 A;  5AJP A;  3KIA A;  4M2A A;  1ON8 A;  4FRD A;  1LL0 A;  3IOI A;  3OH2 A;  3U0Y A;  3FWW A;  5C8R A;  1R7X A;  1GWW A;  3RMV A;  2WEE A;  2O1H A;  2OEF A;  2P72 A;  4YS8 A;  4DE7 A;  1G9R A;  2X65 A;  2X5S A;  1S4N A;  4HO4 A;  1JYK A;  1G1L A;  3PKQ A;  4CJB A;  4KXO A;  5J49 A;  2RIZ A;  1YP3 A;  4Y62 A;  4B2W A;  5CMF X;  2V0H A;  2Z87 A;  4NAK A;  5CMI A;  4ARW A;  4P02 A;  1VH3 A;  2FYB A;  1I52 A;  1FO8 A;  4JD0 A;  4KC4 A;  1WT3 A;  4NAL A;  1H3M A;  2VS5 A;  4KPZ A;  1FR9 A;  1LL3 A;  3R3I A;  3OH1 A;  3U0X A;  4ASY A;  1MP5 A;  2VXM A;  1G93 A;  3O3P A;  1HV9 A;  1GQ9 A;  3EE5 A;  4R7P A;  2VXL A;  1YRO B;  2MZB A;  4BQH A;  1ON6 A;  3JUJ A;  4HO8 A;  3CKQ A;  5FU8 A;  1ZCY A;  2XWL A;  1FGG A;  5FUH A;  2O1F A;  4XWI A;  4Y64 A;  1FO9 A;  2YCM A;  3I0C A;  2PGY A;  1QGS A;  5EJ1 A;  1ZJP A;  4CJC A;  4FCE A;  4B4M A;  2Y4J A;  2OI6 A;  2RIT A;  2I5K A;  5EIY A;  2UX8 A;  1H4E A;  1VIC A;  3I0J A;  3SX7 A;  3SX5 A;  3V0Q A;  3SXC A;  3DUV A;  1H5S B;  1GA8 A;  5C4D A;  2VSH A;  3D98 A;  1K4V A;  1VH1 A;  2DPW A;  1G8O A;  1ZCU A;  2Z86 A;  4Y7F A;  5C47 A;  4EEG A;  4KPX A;  1WT1 A;  4EEA A;  3OAM A;  3I0H A;  3ST8 A;  3IOJ A;  4EE4 A;  1GX4 A;  5FTV A;  3V8Z A;  4EEM A;  2V0L A;  4KT7 A;  1XHB A;  1H5R B;  1HM8 A;  1LZI A;  2YQC A;  1NKH B;  1FZW A;  3DK5 A;  1H7T A;  1ZJ0 A;  3T7M A;  4Y7U A;  3K8D A;  5CMH A;  5DDV A;  1PZY B;  1G3L A;  1H5S C;  1NHE B;  5BXC A;  1H5T A;  2YC5 A;  3CKV A;  3I0I X;  3BCV A;  4FRA A;  3T7O A;  3V0O A;  1JYL A;  4P00 A;  3F1Y A;  1INJ A;  1JV1 A;  1YP2 A;  2GGQ A;  3CGX A;  2RJ9 A;  1TW1 A;  1LVW A;  1QGQ A;  2VS4 A;  2JCL A;  4B42 A;  1EZI A;  1R7V A;  3V0N A;  4GBP A;  4FRQ A;  1MC3 A;  3ZLK A;  2FYA A;  4HO3 A;  1XZ6 A;  1S4O A;  1FGX A;  1W77 A;  3OH0 A;  5C3A A;  3GUE A;  2I5E A;  5DDT A;  2FFV A;  1FXO A;  1MP3 A;  4HG6 A;  3ZGG A;  4J18 A;  3U2T A;  5C1H A;  5CQN X;  1OQM B;  1VM8 A;  5CQP A;  3HL3 A;  4NAI A;  2GGO A;  1H7L A;  2Y4K A;  1R7U A;  4BMA A;  2NXV A;  2JCK A;  2WE9 A;  4LW6 A;  2AEC A;  2E8B A;  1O23 B;  4Y7T A;  1VGZ A;  4KNR A;  4JIS A;  3IOH A;  2AGD A;  4B4G A;  2AM3 A;  3V91 A;  3TZT A;  1H7F A;  4AYJ A;  1TZF A;  2O1G A;  2OEG A;  4G3Q A;  1R82 A; 
#chains in the Genus database with same CATH topology
 1LZ0 A;  3I0G A;  5FU0 A;  1JVD A;  2AE7 A;  2PX7 A;  5FV9 A;  3OC9 A;  1G2V A;  1GWV A;  1H4C A;  1PZT A;  4KC2 A;  2RJ4 A;  2WAW A;  2YQJ A;  2W0W A;  4EEO A;  1GX0 A;  1E5K A;  2PGV A;  2W0V A;  1ZDG A;  2RJ0 A;  2XWN A;  1FR8 A;  3FOQ A;  2ICY A;  1R7Y A;  5AJO A;  3POL A;  2RIY A;  2J0B A;  3SX3 A;  1ZI4 A;  2X60 A;  3I0E A;  4KRV A;  1H7H A;  2RJ1 A;  1ZJ3 A;  4K6R A;  2OI5 A;  4HO9 A;  3CKO A;  4Y7V A;  1NWG B;  4NAN A;  2P73 A;  1HM9 A;  2RJ8 A;  5CMG X;  1ZHJ A;  1IIN A;  4IRP A;  2BO4 A;  3I0K A;  3SXA A;  4C2S A;  2FFU A;  2OI7 A;  1WVC A;  3U2X A;  5I1F A;  1V83 A;  1SS9 A;  2D7R A;  4HO5 A;  1G97 A;  2Y7A A;  1ZDF A;  5C4B A;  5CQO A;  4FRL A;  3N9W A;  3D5N A;  1H4D A;  2ZU8 A;  4MND A;  2YQH A;  2XMH A;  1Z90 A;  4B5B A;  3R2W A;  5C4F A;  2QGI A;  1FRW A;  2V0I A;  4Y7G A;  3ZF8 A;  4D48 A;  4HO0 A;  1W55 A;  3JTJ A;  1LZ7 A;  4D11 C;  2YC3 A;  3D8V A;  4EE3 A;  4AYL A;  1NF5 B;  3I0D A;  4ZDQ A;  1INI A;  3I0F A;  1LL2 A;  2ZU7 A;  5L6S A;  2RIX A;  2WVM A;  3BRK X;  1TVY A;  2VK9 A;  2JCJ A;  5C38 A;  3PNN A;  1H7G A;  2VS3 A;  4FRM A;  2QKX A;  2X5Z A;  3SX8 A;  2E3D A;  1HM0 A;  1NQI B;  4ECM A;  5C49 A;  1H5S A;  4B4B A;  2D0J A;  5IFY A;  4Y6N A;  3OH3 A;  5IDS A;  3I0L A;  4UEG A;  4D0Z A;  4ASJ A;  3OH4 A;  3RMW A;  4M2B A;  1TW5 A;  1FOA A;  2VSI A;  2ZU9 A;  3U2U A;  1ZI3 A;  4HOC A;  3JUK A;  3OKR A;  3ZGF A;  1VGW A;  2VFZ A;  1ZCV A;  2WGZ A;  1WT2 A;  3SXE A;  2AM4 A;  1H5R A;  5C3B A;  2D7I A;  2BO7 A;  1G23 A;  2ICX A;  1OMZ A;  4HO6 A;  1OMX A;  1JV3 A;  1LZJ A;  1NMM B;  2V0K A;  2I7B A;  1ZJ1 A;  2YES A;  2XME A;  3DJ4 A;  4FRP A;  3SXD A;  4KQL A;  1S4P A;  3SXB A;  5C1L A;  5D91 A;  1HJL A;  5FYE A;  4G3P A;  5L6V A;  5AJN A;  5JQQ A;  1V82 A;  1H5S D;  1MP4 A;  3USR A;  3V0P A;  1VZU A;  2JCO A;  4DEC A;  5FTS A;  1H5T B;  2A8U A;  1ZJO A;  1VPA A;  1VZX A;  2RJ6 A;  1O7Q A;  1FWY A;  4HCQ A;  2P6W A;  1FXJ A;  1WSZ A;  5CQM X;  1FG5 N;  2FY7 A;  2AES A;  4EE5 A;  1VGU A;  2A8W A;  2AH9 A;  3SXG A;  1WT0 A;  3ZLL A;  5C48 A;  4MYB A;  4Y63 A;  2YQS A;  1QWJ A;  4CVH A;  3Q80 A;  3TQD A;  2FYD B;  4FRB A;  1G95 A;  3OGZ A;  3V0L A;  5CQL X;  3PKP A;  1R80 A;  1O0R A;  3USQ A;  3Q7U A;  1VZT A;  4E1K A;  3CU0 A;  3SPT A;  4B3U A;  1ZJ2 A;  1H7Q A;  1VGT A;  2J0A A;  3CKN A;  3T7N A;  5IDT A;  1YP4 A;  4B2X A;  1ZIZ A;  2Y4L A;  3U2V A;  2V0J A;  3V90 A;  1G0R A;  3V8Y A;  5C4E A;  2RJ7 A;  4DDZ A;  2BO8 A;  2AM5 A;  1W57 A;  3CKJ A;  3QVB A;  1H7E A;  4G3S A;  2Q4J A;  1KWS A;  4AAW A;  1QG8 A;  1ZI5 A;  3LW6 A;  3NGW A;  3K8E A;  5C3D A;  5C1G A;  1O7O A;  2APC A;  3F1C A;  1JVG A;  2QH5 A;  2VD4 A;  1IIM A;  2WVL A;  4CJ8 A;  4G87 A;  2FYC B;  3Q4S A;  1R81 A;  1EYR A;  4KC1 A;  2CU2 A;  2PA4 A;  2BO6 A;  5CMJ A;  4Y9X A;  2WVK A;  4FRO A;  5C36 A;  1ZI1 A;  4EVW A;  1R7T A;  3E26 A;  5C4C A;  3U2W A;  4HO2 A;  4IRQ A;  3V0M A;  5HS2 A;  4Y6U A;  4D0T A;  2XWM A;  4M4K A;  2Y4M A;  3RSB A;  4FRE A;  4FQW A;  1HJJ A;  4L41 C;  3E25 A;  4LW3 A;  5EJZ A;  4FCU A;  1ZCT A;  4D11 A;  4FRH A;  2Y6P A;  1V84 A;  4KNX A;  2RJ5 A;  4M28 A;  1GQC A;  4O6M A;  4AC3 A;  5AJP A;  3KIA A;  4M2A A;  1ON8 A;  4FRD A;  1LL0 A;  3IOI A;  3OH2 A;  3U0Y A;  3FWW A;  5C8R A;  1R7X A;  1GWW A;  3RMV A;  2WEE A;  2O1H A;  2OEF A;  2P72 A;  4YS8 A;  4DE7 A;  1G9R A;  2X65 A;  2X5S A;  1S4N A;  4HO4 A;  1JYK A;  5D92 A;  1G1L A;  3PKQ A;  4CJB A;  4KXO A;  5J49 A;  2RIZ A;  1YP3 A;  4Y62 A;  4B2W A;  5CMF X;  2V0H A;  2Z87 A;  4NAK A;  5CMI A;  4ARW A;  4P02 A;  1VH3 A;  2FYB A;  1I52 A;  1FO8 A;  4JD0 A;  4FIX A;  1WT3 A;  4KC4 A;  4NAL A;  1H3M A;  2VS5 A;  4KPZ A;  1FR9 A;  1LL3 A;  3R3I A;  3OH1 A;  3U0X A;  4ASY A;  1MP5 A;  2VXM A;  1G93 A;  4FIY A;  3O3P A;  2C0N A;  1HV9 A;  1GQ9 A;  3EE5 A;  4R7P A;  2VXL A;  1YRO B;  2MZB A;  4BQH A;  1ON6 A;  3JUJ A;  4HO8 A;  3CKQ A;  5FU8 A;  1ZCY A;  2XWL A;  1FGG A;  5FUH A;  2O1F A;  4XWI A;  4Y64 A;  1FO9 A;  2YCM A;  3I0C A;  2PGY A;  1QGS A;  5EJ1 A;  1ZJP A;  4CJC A;  4FCE A;  4B4M A;  2Y4J A;  2OI6 A;  2RIT A;  2I5K A;  5EIY A;  2UX8 A;  1H4E A;  1VIC A;  3I0J A;  3SX7 A;  3SX5 A;  3V0Q A;  3SXC A;  3DUV A;  1H5S B;  1GA8 A;  5C4D A;  2VSH A;  3D98 A;  1K4V A;  1VH1 A;  2DPW A;  1G8O A;  1ZCU A;  2Z86 A;  4Y7F A;  5C47 A;  4EEG A;  4KPX A;  1WT1 A;  4EEA A;  3OAM A;  3I0H A;  3ST8 A;  3IOJ A;  4EE4 A;  1GX4 A;  5FTV A;  3V8Z A;  4EEM A;  2V0L A;  4KT7 A;  1XHB A;  1H5R B;  1HM8 A;  1LZI A;  2YQC A;  1NKH B;  1FZW A;  3DK5 A;  1H7T A;  1ZJ0 A;  3T7M A;  4Y7U A;  3K8D A;  5CMH A;  5DDV A;  1PZY B;  1G3L A;  1H5S C;  1NHE B;  5BXC A;  1H5T A;  2YC5 A;  3CKV A;  3I0I X;  3BCV A;  4FRA A;  3T7O A;  3V0O A;  1JYL A;  4P00 A;  3F1Y A;  4MIX A;  1INJ A;  1JV1 A;  1YP2 A;  2GGQ A;  3CGX A;  2RJ9 A;  1TW1 A;  1LVW A;  1QGQ A;  2VS4 A;  2JCL A;  4B42 A;  4Q7C A;  1EZI A;  1R7V A;  3V0N A;  4GBP A;  4FRQ A;  1MC3 A;  3ZLK A;  2FYA A;  4HO3 A;  1XZ6 A;  1S4O A;  1FGX A;  1W77 A;  3OH0 A;  5C3A A;  3GUE A;  2I5E A;  5DDT A;  2FFV A;  1FXO A;  1MP3 A;  4HG6 A;  3ZGG A;  4J18 A;  3U2T A;  5C1H A;  5CQN X;  1OQM B;  1VM8 A;  5CQP A;  3HL3 A;  4NAI A;  2GGO A;  1H7L A;  2Y4K A;  1R7U A;  4BMA A;  2NXV A;  2JCK A;  2WE9 A;  4LW6 A;  2AEC A;  2E8B A;  1O23 B;  4Y7T A;  1VGZ A;  4KNR A;  4JIS A;  3IOH A;  2AGD A;  4B4G A;  2AM3 A;  4O6N A;  3V91 A;  3TZT A;  1H7F A;  4AYJ A;  1TZF A;  2O1G A;  2OEG A;  4G3Q A;  1R82 A; 
#chains in the Genus database with same CATH homology
 1LZ0 A;  3I0G A;  5FU0 A;  1JVD A;  2AE7 A;  2PX7 A;  5FV9 A;  3OC9 A;  1G2V A;  1GWV A;  1H4C A;  1PZT A;  4KC2 A;  2RJ4 A;  2WAW A;  2YQJ A;  2W0W A;  4EEO A;  1GX0 A;  1E5K A;  2PGV A;  2W0V A;  1ZDG A;  2RJ0 A;  2XWN A;  1FR8 A;  3FOQ A;  2ICY A;  1R7Y A;  5AJO A;  3POL A;  2RIY A;  2J0B A;  3SX3 A;  1ZI4 A;  2X60 A;  3I0E A;  4KRV A;  1H7H A;  2RJ1 A;  1ZJ3 A;  4K6R A;  2OI5 A;  4HO9 A;  3CKO A;  4Y7V A;  1NWG B;  4NAN A;  2P73 A;  1HM9 A;  2RJ8 A;  5CMG X;  1ZHJ A;  1IIN A;  4IRP A;  2BO4 A;  3I0K A;  3SXA A;  4C2S A;  2FFU A;  2OI7 A;  1WVC A;  3U2X A;  5I1F A;  1V83 A;  1SS9 A;  2D7R A;  4HO5 A;  1G97 A;  2Y7A A;  1ZDF A;  5C4B A;  5CQO A;  4FRL A;  3N9W A;  3D5N A;  1H4D A;  2ZU8 A;  4MND A;  2YQH A;  2XMH A;  1Z90 A;  4B5B A;  3R2W A;  5C4F A;  2QGI A;  1FRW A;  2V0I A;  4Y7G A;  3ZF8 A;  4D48 A;  4HO0 A;  1W55 A;  3JTJ A;  1LZ7 A;  4D11 C;  2YC3 A;  3D8V A;  4EE3 A;  4AYL A;  1NF5 B;  3I0D A;  4ZDQ A;  1INI A;  3I0F A;  1LL2 A;  2ZU7 A;  5L6S A;  2RIX A;  2WVM A;  3BRK X;  1TVY A;  2VK9 A;  2JCJ A;  5C38 A;  3PNN A;  1H7G A;  2VS3 A;  4FRM A;  2QKX A;  2X5Z A;  3SX8 A;  2E3D A;  1HM0 A;  1NQI B;  4ECM A;  5C49 A;  1H5S A;  4B4B A;  2D0J A;  5IFY A;  4Y6N A;  3OH3 A;  5IDS A;  3I0L A;  4UEG A;  4D0Z A;  4ASJ A;  3OH4 A;  3RMW A;  4M2B A;  1TW5 A;  1FOA A;  2VSI A;  2ZU9 A;  3U2U A;  1ZI3 A;  4HOC A;  3JUK A;  3OKR A;  3ZGF A;  1VGW A;  2VFZ A;  1ZCV A;  2WGZ A;  1WT2 A;  3SXE A;  2AM4 A;  1H5R A;  5C3B A;  2D7I A;  2BO7 A;  1G23 A;  2ICX A;  1OMZ A;  4HO6 A;  1OMX A;  1JV3 A;  1LZJ A;  1NMM B;  2V0K A;  2I7B A;  1ZJ1 A;  2YES A;  2XME A;  3DJ4 A;  4FRP A;  3SXD A;  4KQL A;  1S4P A;  3SXB A;  5C1L A;  5D91 A;  1HJL A;  5FYE A;  4G3P A;  5L6V A;  5AJN A;  5JQQ A;  1V82 A;  1H5S D;  1MP4 A;  3USR A;  3V0P A;  1VZU A;  2JCO A;  4DEC A;  5FTS A;  1H5T B;  2A8U A;  1ZJO A;  1VPA A;  1VZX A;  2RJ6 A;  1O7Q A;  1FWY A;  4HCQ A;  2P6W A;  1FXJ A;  1WSZ A;  5CQM X;  1FG5 N;  2FY7 A;  2AES A;  4EE5 A;  1VGU A;  2A8W A;  2AH9 A;  3SXG A;  1WT0 A;  3ZLL A;  5C48 A;  4MYB A;  4Y63 A;  2YQS A;  1QWJ A;  4CVH A;  3Q80 A;  3TQD A;  2FYD B;  4FRB A;  1G95 A;  3OGZ A;  3V0L A;  5CQL X;  3PKP A;  1R80 A;  1O0R A;  3USQ A;  3Q7U A;  1VZT A;  4E1K A;  3CU0 A;  3SPT A;  4B3U A;  1ZJ2 A;  1H7Q A;  1VGT A;  2J0A A;  3CKN A;  3T7N A;  5IDT A;  1YP4 A;  4B2X A;  1ZIZ A;  2Y4L A;  3U2V A;  2V0J A;  3V90 A;  1G0R A;  3V8Y A;  5C4E A;  2RJ7 A;  4DDZ A;  2BO8 A;  2AM5 A;  1W57 A;  3CKJ A;  3QVB A;  1H7E A;  4G3S A;  2Q4J A;  1KWS A;  4AAW A;  1QG8 A;  1ZI5 A;  3LW6 A;  3NGW A;  3K8E A;  5C3D A;  5C1G A;  1O7O A;  2APC A;  3F1C A;  1JVG A;  2QH5 A;  2VD4 A;  1IIM A;  2WVL A;  4CJ8 A;  4G87 A;  2FYC B;  3Q4S A;  1R81 A;  1EYR A;  4KC1 A;  2CU2 A;  2PA4 A;  2BO6 A;  5CMJ A;  4Y9X A;  2WVK A;  4FRO A;  5C36 A;  1ZI1 A;  4EVW A;  1R7T A;  3E26 A;  5C4C A;  3U2W A;  4HO2 A;  4IRQ A;  3V0M A;  5HS2 A;  4Y6U A;  4D0T A;  2XWM A;  4M4K A;  2Y4M A;  3RSB A;  4FRE A;  4FQW A;  1HJJ A;  4L41 C;  3E25 A;  4LW3 A;  5EJZ A;  4FCU A;  1ZCT A;  4D11 A;  4FRH A;  2Y6P A;  1V84 A;  4KNX A;  2RJ5 A;  4M28 A;  1GQC A;  4O6M A;  4AC3 A;  5AJP A;  3KIA A;  4M2A A;  1ON8 A;  4FRD A;  1LL0 A;  3IOI A;  3OH2 A;  3U0Y A;  3FWW A;  5C8R A;  1R7X A;  1GWW A;  3RMV A;  2WEE A;  2O1H A;  2OEF A;  2P72 A;  4YS8 A;  4DE7 A;  1G9R A;  2X65 A;  2X5S A;  1S4N A;  4HO4 A;  1JYK A;  5D92 A;  1G1L A;  3PKQ A;  4CJB A;  4KXO A;  5J49 A;  2RIZ A;  1YP3 A;  4Y62 A;  4B2W A;  5CMF X;  2V0H A;  2Z87 A;  4NAK A;  5CMI A;  4ARW A;  4P02 A;  1VH3 A;  2FYB A;  1I52 A;  1FO8 A;  4JD0 A;  4FIX A;  1WT3 A;  4KC4 A;  4NAL A;  1H3M A;  2VS5 A;  4KPZ A;  1FR9 A;  1LL3 A;  3R3I A;  3OH1 A;  3U0X A;  4ASY A;  1MP5 A;  2VXM A;  1G93 A;  4FIY A;  3O3P A;  2C0N A;  1HV9 A;  1GQ9 A;  3EE5 A;  4R7P A;  2VXL A;  1YRO B;  2MZB A;  4BQH A;  1ON6 A;  3JUJ A;  4HO8 A;  3CKQ A;  5FU8 A;  1ZCY A;  2XWL A;  1FGG A;  5FUH A;  2O1F A;  4XWI A;  4Y64 A;  1FO9 A;  2YCM A;  3I0C A;  2PGY A;  1QGS A;  5EJ1 A;  1ZJP A;  4CJC A;  4FCE A;  4B4M A;  2Y4J A;  2OI6 A;  2RIT A;  2I5K A;  5EIY A;  2UX8 A;  1H4E A;  1VIC A;  3I0J A;  3SX7 A;  3SX5 A;  3V0Q A;  3SXC A;  3DUV A;  1H5S B;  1GA8 A;  5C4D A;  2VSH A;  3D98 A;  1K4V A;  1VH1 A;  2DPW A;  1G8O A;  1ZCU A;  2Z86 A;  4Y7F A;  5C47 A;  4EEG A;  4KPX A;  1WT1 A;  4EEA A;  3OAM A;  3I0H A;  3ST8 A;  3IOJ A;  4EE4 A;  1GX4 A;  5FTV A;  3V8Z A;  4EEM A;  2V0L A;  4KT7 A;  1XHB A;  1H5R B;  1HM8 A;  1LZI A;  2YQC A;  1NKH B;  1FZW A;  3DK5 A;  1H7T A;  1ZJ0 A;  3T7M A;  4Y7U A;  3K8D A;  5CMH A;  5DDV A;  1PZY B;  1G3L A;  1H5S C;  1NHE B;  5BXC A;  1H5T A;  2YC5 A;  3CKV A;  3I0I X;  3BCV A;  4FRA A;  3T7O A;  3V0O A;  1JYL A;  4P00 A;  3F1Y A;  4MIX A;  1INJ A;  1JV1 A;  1YP2 A;  2GGQ A;  3CGX A;  2RJ9 A;  1TW1 A;  1LVW A;  1QGQ A;  2VS4 A;  2JCL A;  4B42 A;  4Q7C A;  1EZI A;  1R7V A;  3V0N A;  4GBP A;  4FRQ A;  1MC3 A;  3ZLK A;  2FYA A;  4HO3 A;  1XZ6 A;  1S4O A;  1FGX A;  1W77 A;  3OH0 A;  5C3A A;  3GUE A;  2I5E A;  5DDT A;  2FFV A;  1FXO A;  1MP3 A;  4HG6 A;  3ZGG A;  4J18 A;  3U2T A;  5C1H A;  5CQN X;  1OQM B;  1VM8 A;  5CQP A;  3HL3 A;  4NAI A;  2GGO A;  1H7L A;  2Y4K A;  1R7U A;  4BMA A;  2NXV A;  2JCK A;  2WE9 A;  4LW6 A;  2AEC A;  2E8B A;  1O23 B;  4Y7T A;  1VGZ A;  4KNR A;  4JIS A;  3IOH A;  2AGD A;  4B4G A;  2AM3 A;  4O6N A;  3V91 A;  3TZT A;  1H7F A;  4AYJ A;  1TZF A;  2O1G A;  2OEG A;  4G3Q A;  1R82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...