1G2FC

Structure of a cys2his2 zinc finger/tata box complex (tatazf;clone #6)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
89
structure length
89
Chain Sequence
MERPYACPVESCDRRFSQKTNLDTHIRIHTGQKPFQCRICMRNFSQQASLNAHIRTHTGEKPFACDICGRKFATLHTRTRHTKIHLRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*GP*AP*CP*GP*CP*TP*AP*TP*AP*AP*AP*AP*GP*GP*AP*G)-3'
publication title Beyond the "recognition code": structures of two Cys2His2 zinc finger/TATA box complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 25
structure length 89
sequence length 89
chains with identical sequence F
ec nomenclature
pdb deposition date 2000-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1g2fC02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1g2fC01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1g2fC03
2EN7A 2EM5A 4R2PA 4GZNC 1YSAC 1TF6A 2I13A 2EN3A 2EE8A 2EMHA 2EM3A 2EM7A 1Z1BA 5KL5A 1B69A 4FK5C 2YRMA 4WSGA 2YTNA 2WBSA 2EMKA 3MHHC 2YTJA 2EPCA 2EMAA 2A25A 2EPRA 2EORA 2EOJA 2EOMA 2J7JA 2EOHA 4R2EA 1DGCA 2WBUA 2EMYA 2DMIA 1UBDC 1JK1A 2E72A 1X6EA 4F2JC 1A1KA 4M9VC 1LLMC 2MDGA 2LV2A 2EPUA 2EM9A 2CSHA 1X5WA 2EMWA 2EPPA 1UN6B 1X6FA 5KL7A 2ELYA 2EOSA 1A1IA 2EMZA 2YSOA 4R2CA 2EM4A 2EJ4A 2LCEA 3EPHA 1BB8A 2WCC3 1TF3A 1A1FA 1WJPA 2EPAA 1NCSA 1BBOA 1ZU1A 2D9HA 2CT1A 3VHTB 4IS1C 2EPZA 2EN4A 2EMFA 3EPKA 1A1GA 2M9AA 4R2AA 2EQ0A 2EMGA 2YU5A 2VRDA 1TN9A 2YSPA 5KL6A 1ZAAC 2YTDA 2EMLA 1JK2A 1ZR9A 2EPXA 2R1FA 3UK3C 2WBTA 1G2FC 1YUJA 2GLIA 2YRHA 2ENAA 4R2QA 2JP9A 2CTDA 2EOQA 3EPLA 2EOOA 2EQ1A 4R2RA 2EOYA 2YRKA 3M99B 3EPJA 2EN8A 2EMXA 2LT7A 2GHFA 2HGHA 2EOFA 3MHSC 2YTIA 2ELZA 2MKDA 2EL6A 2ENHA 4X9JA 1RMDA 2BB8A 2EMCA 2YTEA 2YTFA 2LVHA 4IJDA 5KL2A 1MEYC 2NABA 2EQ3A 1YUIA 2EL4A 2EM2A 2YTGA 2EOEA 1KJKA 1P47A 2EM8A 4F6NA 1G2DC 2EN2A 2EMIA 2DLQA 2PRTA 2YTQA 4F6MA 5KL4A 2DRPA 2JPAA 1X3CA 2RPCA 2EL5A 2EOXA 1F2IG 5KL3A 2MKNA 2YTOA 1A1HA 2EP3A 2EN1A 2EOZA 1A1LA 2RSIA 1X6HA 2YU8A 2EN6A 2EM0A 4R2DA 2DLKA 2DGCA 2EM6A 1AAYA 2EMBA 2YTPA 2ADRA 2LO3A 2EOIA 2ENCA 4R2SA 1A1JA
chains in the Genus database with same CATH superfamily
1O0WA 4GZNC 1YSAC 1TF6A 1GQEA 4R03A 4JI3E 4LFAE 4WFTA 3F6GA 4WXCA 3OMLA 2R76A 2V8QB 2EPNA 2JOXA 4GEQB 4DR5E 2YTJA 4HEIA 2EOMA 2J7JA 4L5NC 3J7Yp 2EOHA 2WBUA 3C4TA 4GKJE 1NEIA 4X66E 5A6KA 1UBDC 3EQ1A 2E72A 1X6EA 2KHXA 5AE1A 4WXDA 1LLMC 2JWOA 2EPUA 4NXNE 2CSHA 1X6FA 5KL7A 1XNRE 2EOSA 3THNA 2EMZA 2NUFA 2LCEA 3EPHA 4LTYA 4GKKE 2WCC3 1HNWE 2HJJA 5T6JA 4L8NA 4P7DA 1XNQE 2JR1A 1FKAE 4JI8E 4K0KE 2EMGA 2EPMX 4DV1E 1WHNA 4JI1E 4LF7E 1ZBTA 5AE3A 3C6KA 1JK2A 2EPXA 2R1FA 2GPIA 2B7TA 3IWCA 4R2QA 4JI0E 2N3GA 3AUZA 3ECRA 2YPNA 4B3TE 4JV5E 4R2RA 2E1MA 4N4RB 2YRKA 4DV7E 3EPJA 5AASA 4NHRA 2K7IA 3MHSC 4ZYEA 2MKDA 4LF5E 4X9JA 2JXPA 4DR6E 1RMDA 2BB8A 2RQLA 2EMCA 2EZ6A 2VQEE 2M4IA 5A6JA 2NABA 1EKZA 2M7QA 1YUIA 2YTGA 2K4VA 2EOEA 3RMPA 4KZSA 3LMLA 5A2QC 4KHPE 2EMIA 4F6MA 2NUEA 2YTQA 4JYAE 2JY9A 1HNZE 5KL3A 4BCAA 5IXMB 4LF6E 3HXLA 2BBGA 5IWAE 4HTGA 2EPKX 1EH7A 4MLQA 2V88A 3BF2A 2EM6A 2Q8UA 3T1HE 1AAYA 2ENCA 4R2SA 2EN7A 2EM5A 4R2PA 2I13A 1QNTA 2EN3A 2V89A 2EMHA 3VYYA 2EM3A 2EM7A 2RS7A 4FK5C 5DNYA 1RC7A 2YTNA 1YZ9A 3JTZA 2WBSA 1EH8A 4DV0E 2ODRC 2EPCA 2HC5A 4ZYHA 2EMAA 1YFHA 2EOJA 4R8OA 5A6BD 1KYQA 2UUBE 4X8WA 3HPZA 1JK1A 1GZ6A 2LJHA 5AE2A 2EM9A 1X5WA 2EWLA 2EPPA 2N8XA 2JOBA 1A1IA 1T38A 2ODRD 4DMIA 1TF3A 2RS6A 4M0VA 3OTOE 1QU6A 2EPAA 2V83A 1BBOA 1ZU1A 3VHTB 3IWDA 4AQYE 2N3HA 5FLXC 3EPKA 4X64E 3KZZA 2V87A 5LMNE 2VF1A 3H09A 2EMLA 2UXDE 2DMYA 3JU0A 1G2FC 4B3ME 2YRHA 3HQ1A 4JI2E 1L4SA 1AH5A 3C4BA 3BIDA 1N3GA 3M99B 2EN8A 1IBME 2EMXA 4WX9A 2GHFA 4DV2E 1FJGE 5TSEA 2G7HA 1EH6A 1STUA 3BGHA 3K6QA 5AC4A 4X62E 2YTEA 2YTFA 5KL2A 4IJDA 3VK6A 2DSYA 3TQMA 2NUGA 1WHQA 1PJTA 4J8ZA 1P47A 2EN2A 2PRTA 2DRPA 5KL4A 2B9DA 2DIXA 2IHR1 4RH8A 4I8OA 2LTSA 4NZVA 1BBGA 1X47A 1DI2A 3ADJA 4DR2E 2YWQA 2LTRA 2EN1A 1A1LA 2B3TB 5AC5A 1UILA 2YU8A 4R2DA 1PKPA 2DLKA 2DGCA 2EMBA 2JVAA 2LO3A 2EOIA 1T4OA 1A1HA 1SR9A 1A1JA 5IV8B 2MC6A 4MLVA 4TUIA 2L2NA 4X65E 1B69A 4WSGA 4F9BB 3F6HA 3HTXA 2YZTA 2H36X 2MDRA 3QG5C 2A25A 1I94E 4BS9A 4O43A 1YYOA 1DGCA 2EMYA 3J81C 3T1YE 2DMIA 2EPLX 4M30A 2V86A 1IMUA 4F2JC 4WYQB 3J80C 2LV2A 4DV5E 2EMWA 4LFCE 1UN6B 2YT4A 2LE2A 3DF6A 2L92A 4OOGC 4LF9E 4LF8E 2RSMA 1BB8A 4DKKA 2L3CA 4BHCA 1WJPA 3IWBA 2NA2A 3FIGA 2WZOA 2D9HA 4IS1C 3JAMC 3P1XA 2FV4B 2UUCE 2EMFA 1A1GA 2F4VE 2EQ0A 4DV3E 1X49A 4LFBE 2F8BA 1ZAAC 1IQOA 4JI4E 2RTXA 4F9AB 3C6MA 3UK3C 2GLIA 2ENAA 4DUYE 2JP9A 2EOQA 3EPLA 4Q35B 2LMZA 1IQSA 4JI7E 2YTIA 2EL6A 2L6MA 1DQ3A 5BR8E 3HPSA 5CFFE 4DR3E 1MEYC 1T39A 2UXBE 2EQ3A 2LRSA 2EL4A 2EM8A 1HNXE 3ADGA 1YYKA 2KOUA 2JPAA 2M1SA 4LF4E 4OX9E 2EL5A 2EOXA 1F2IG 3L00A 4B3SE 2YTOA 4KWYA 2EP3A 4BBYA 2FGGA 1X6HA 3AV0A 2EM0A 2EPOA 4P78A 4DR1E 2YTPA 2ADRA 1PDAA 1XMOE 2VQFE 1HR0E 2L3JA 2EE8A 4F9CB 1J26A 2LJUA 1SFEA 5LLQA 5LL6R 5KL5A 1Z1BA 4B3RE 2YRMA 4YHHE 4F54A 4O24A 2UUAE 4DV4E 5F3WA 2EMKA 1WRJA 3MHHC 4Q28A 4JI6E 4BHBA 2EORA 2EPRA 4R2EA 3ADLA 1PJQA 2L2MA 4JI5E 4BC9A 1WXRA 2ZM6E 2LUQA 1A1KA 1GTKA 4M9VC 2MDGA 3ADIA 1ZBQA 2LUPB 2E5LE 2ELYA 2YSOA 1N32E 4R2CA 2EM4A 2EJ4A 4RHBB 2L2KB 4DR4E 3LLHA 1A1FA 3KWRA 1NCSA 2CT1A 2EPZA 2EN4A 5IT9C 2M9AA 4R2AA 4LU9A 1YPNA 2YU5A 2VRDA 2KONA 1N36E 1TN9A 2YSPA 5KL6A 1X48A 2YTDA 1N33E 1ZR9A 2WBTA 5A6AA 2UU9E 1YUJA 2B7VA 4BMJA 3VYXA 1J5EE 4ZYGA 1N34E 5ADZA 1T4LB 4BC7A 2L8TA 4WPYA 2CTDA 4ZYDA 2VE7C 2EOOA 2EQ1A 2EOYA 3THOB 2LT7A 2HGHA 2EOFA 2JYAA 4DR7E 2ELZA 2ENHA 4DUZE 1MGTA 2UXCE 4NXME 1XMQE 2LVHA 1T4NA 2DB2A 2EM2A 1KJKA 4O4KA 5LMUE 4WSPA 1UHZA 3MSWA 4F6NA 4M2ZA 1G2DC 5A6BA 3J7AG 2DLQA 2FTXB 4TUGA 1PJSA 1X3CA 1YYWA 2RPCA 4DV6E 2V85A 3KZYA 2LBSB 4YY3E 2MKNA 2L33A 2MC5A 5A69A 2HHHE 2I9IA 2EOZA 2RSIA 3ZOQB 1IBKE 2EN6A 1IBLE 1RQ0A 3DJWA 3BBGA 2CPNA 4O5GA
chains in the Genus database with same CATH topology
2EN7A 2EM5A 4R2PA 4GZNC 1YSAC 1TF6A 2I13A 2EN3A 2EE8A 2EMHA 2EM3A 2EM7A 1Z1BA 5KL5A 1B69A 4FK5C 2YRMA 4WSGA 2YTNA 2WBSA 2EMKA 3MHHC 2YTJA 2EPCA 2EMAA 2A25A 2EPRA 2EORA 2EOJA 2EOMA 2J7JA 2EOHA 4R2EA 1DGCA 2WBUA 2EMYA 2DMIA 1UBDC 1JK1A 2E72A 1X6EA 4F2JC 1A1KA 4M9VC 1LLMC 2MDGA 2LV2A 2EPUA 2EM9A 2CSHA 1X5WA 2EMWA 2EPPA 1UN6B 1X6FA 5KL7A 2ELYA 2EOSA 1A1IA 2EMZA 2YSOA 4R2CA 2EM4A 2EJ4A 2LCEA 3EPHA 1BB8A 2WCC3 1TF3A 1A1FA 1WJPA 2EPAA 1NCSA 1BBOA 1ZU1A 2D9HA 2CT1A 3VHTB 4IS1C 2EPZA 2EN4A 2EMFA 3EPKA 1A1GA 2M9AA 4R2AA 2EQ0A 2EMGA 2YU5A 2VRDA 1TN9A 2YSPA 5KL6A 1ZAAC 2YTDA 2EMLA 1JK2A 1ZR9A 2EPXA 2R1FA 3UK3C 2WBTA 1G2FC 1YUJA 2GLIA 2YRHA 2ENAA 4R2QA 2JP9A 2CTDA 2EOQA 3EPLA 2EOOA 2EQ1A 4R2RA 2EOYA 2YRKA 3M99B 3EPJA 2EN8A 2EMXA 2LT7A 2GHFA 2HGHA 2EOFA 3MHSC 2YTIA 2ELZA 2MKDA 2EL6A 2ENHA 4X9JA 1RMDA 2BB8A 2EMCA 2YTEA 2YTFA 2LVHA 4IJDA 5KL2A 1MEYC 2NABA 2EQ3A 1YUIA 2EL4A 2EM2A 2YTGA 2EOEA 1KJKA 1P47A 2EM8A 4F6NA 1G2DC 2EN2A 2EMIA 2DLQA 2PRTA 2YTQA 4F6MA 5KL4A 2DRPA 2JPAA 1X3CA 2RPCA 2EL5A 2EOXA 1F2IG 5KL3A 2MKNA 2YTOA 1A1HA 2EP3A 2EN1A 2EOZA 1A1LA 2RSIA 1X6HA 2YU8A 2EN6A 2EM0A 4R2DA 2DLKA 2DGCA 2EM6A 1AAYA 2EMBA 2YTPA 2ADRA 2LO3A 2EOIA 2ENCA 4R2SA 1A1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN7 A;  2EM5 A;  4R2P A;  4GZN C;  1YSA C;  1TF6 A;  2I13 A;  2EN3 A;  2EE8 A;  2EMH A;  2EM3 A;  2EM7 A;  1Z1B A;  5KL5 A;  1B69 A;  4FK5 C;  2YRM A;  4WSG A;  2YTN A;  2WBS A;  2EMK A;  3MHH C;  2YTJ A;  2EPC A;  2EMA A;  2A25 A;  2EPR A;  2EOR A;  2EOJ A;  2EOM A;  2J7J A;  2EOH A;  4R2E A;  1DGC A;  2WBU A;  2EMY A;  2DMI A;  1UBD C;  1JK1 A;  2E72 A;  1X6E A;  4F2J C;  1A1K A;  4M9V C;  1LLM C;  2MDG A;  2LV2 A;  2EPU A;  2EM9 A;  2CSH A;  1X5W A;  2EMW A;  2EPP A;  1UN6 B;  1X6F A;  5KL7 A;  2ELY A;  2EOS A;  1A1I A;  2EMZ A;  2YSO A;  4R2C A;  2EM4 A;  2EJ4 A;  2LCE A;  3EPH A;  1BB8 A;  2WCC 3;  1TF3 A;  1A1F A;  1WJP A;  2EPA A;  1NCS A;  1BBO A;  1ZU1 A;  2D9H A;  2CT1 A;  3VHT B;  4IS1 C;  2EPZ A;  2EN4 A;  2EMF A;  3EPK A;  1A1G A;  2M9A A;  4R2A A;  2EQ0 A;  2EMG A;  2YU5 A;  2VRD A;  1TN9 A;  2YSP A;  5KL6 A;  1ZAA C;  2YTD A;  2EML A;  1JK2 A;  1ZR9 A;  2EPX A;  2R1F A;  3UK3 C;  2WBT A;  1G2F C;  1YUJ A;  2GLI A;  2YRH A;  2ENA A;  4R2Q A;  2JP9 A;  2CTD A;  2EOQ A;  3EPL A;  2EOO A;  2EQ1 A;  4R2R A;  2EOY A;  2YRK A;  3M99 B;  3EPJ A;  2EN8 A;  2EMX A;  2LT7 A;  2GHF A;  2HGH A;  2EOF A;  3MHS C;  2YTI A;  2ELZ A;  2MKD A;  2EL6 A;  2ENH A;  4X9J A;  1RMD A;  2BB8 A;  2EMC A;  2YTE A;  2YTF A;  2LVH A;  4IJD A;  5KL2 A;  1MEY C;  2NAB A;  2EQ3 A;  1YUI A;  2EL4 A;  2EM2 A;  2YTG A;  2EOE A;  1KJK A;  1P47 A;  2EM8 A;  4F6N A;  1G2D C;  2EN2 A;  2EMI A;  2DLQ A;  2PRT A;  2YTQ A;  4F6M A;  5KL4 A;  2DRP A;  2JPA A;  1X3C A;  2RPC A;  2EL5 A;  2EOX A;  1F2I G;  5KL3 A;  2MKN A;  2YTO A;  1A1H A;  2EP3 A;  2EN1 A;  2EOZ A;  1A1L A;  2RSI A;  1X6H A;  2YU8 A;  2EN6 A;  2EM0 A;  4R2D A;  2DLK A;  2DGC A;  2EM6 A;  1AAY A;  2EMB A;  2YTP A;  2ADR A;  2LO3 A;  2EOI A;  2ENC A;  4R2S A;  1A1J A; 
#chains in the Genus database with same CATH topology
 1O0W A;  4GZN C;  1YSA C;  1TF6 A;  1GQE A;  4R03 A;  4JI3 E;  4LFA E;  4WFT A;  3F6G A;  4WXC A;  3OML A;  2R76 A;  2V8Q B;  2EPN A;  2JOX A;  4GEQ B;  4DR5 E;  2YTJ A;  4HEI A;  2EOM A;  2J7J A;  4L5N C;  3J7Y p;  2EOH A;  2WBU A;  3C4T A;  4GKJ E;  1NEI A;  4X66 E;  5A6K A;  1UBD C;  3EQ1 A;  2E72 A;  1X6E A;  2KHX A;  5AE1 A;  4WXD A;  1LLM C;  2JWO A;  2EPU A;  4NXN E;  2CSH A;  1X6F A;  5KL7 A;  1XNR E;  2EOS A;  3THN A;  2EMZ A;  2NUF A;  2LCE A;  3EPH A;  4LTY A;  4GKK E;  2WCC 3;  1HNW E;  2HJJ A;  5T6J A;  4L8N A;  4P7D A;  1XNQ E;  2JR1 A;  1FKA E;  4JI8 E;  4K0K E;  2EMG A;  2EPM X;  4DV1 E;  1WHN A;  4JI1 E;  4LF7 E;  1ZBT A;  5AE3 A;  3C6K A;  1JK2 A;  2EPX A;  2R1F A;  2GPI A;  2B7T A;  3IWC A;  4R2Q A;  4JI0 E;  2N3G A;  3AUZ A;  3ECR A;  2YPN A;  4B3T E;  4JV5 E;  4R2R A;  2E1M A;  4N4R B;  2YRK A;  4DV7 E;  3EPJ A;  5AAS A;  4NHR A;  2K7I A;  3MHS C;  4ZYE A;  2MKD A;  4LF5 E;  4X9J A;  2JXP A;  4DR6 E;  1RMD A;  2BB8 A;  2RQL A;  2EMC A;  2EZ6 A;  2VQE E;  2M4I A;  5A6J A;  2NAB A;  1EKZ A;  2M7Q A;  1YUI A;  2YTG A;  2K4V A;  2EOE A;  3RMP A;  4KZS A;  3LML A;  5A2Q C;  4KHP E;  2EMI A;  4F6M A;  2NUE A;  2YTQ A;  4JYA E;  2JY9 A;  1HNZ E;  5KL3 A;  4BCA A;  5IXM B;  4LF6 E;  3HXL A;  2BBG A;  5IWA E;  4HTG A;  2EPK X;  1EH7 A;  4MLQ A;  2V88 A;  3BF2 A;  2EM6 A;  2Q8U A;  3T1H E;  1AAY A;  2ENC A;  4R2S A;  2EN7 A;  2EM5 A;  4R2P A;  2I13 A;  1QNT A;  2EN3 A;  2V89 A;  2EMH A;  3VYY A;  2EM3 A;  2EM7 A;  2RS7 A;  4FK5 C;  5DNY A;  1RC7 A;  2YTN A;  1YZ9 A;  3JTZ A;  2WBS A;  1EH8 A;  4DV0 E;  2ODR C;  2EPC A;  2HC5 A;  4ZYH A;  2EMA A;  1YFH A;  2EOJ A;  4R8O A;  5A6B D;  1KYQ A;  2UUB E;  4X8W A;  3HPZ A;  1JK1 A;  1GZ6 A;  2LJH A;  5AE2 A;  2EM9 A;  1X5W A;  2EWL A;  2EPP A;  2N8X A;  2JOB A;  1A1I A;  1T38 A;  2ODR D;  4DMI A;  1TF3 A;  2RS6 A;  4M0V A;  3OTO E;  1QU6 A;  2EPA A;  2V83 A;  1BBO A;  1ZU1 A;  3VHT B;  3IWD A;  4AQY E;  2N3H A;  5FLX C;  3EPK A;  4X64 E;  3KZZ A;  2V87 A;  5LMN E;  2VF1 A;  3H09 A;  2EML A;  2UXD E;  2DMY A;  3JU0 A;  1G2F C;  4B3M E;  2YRH A;  3HQ1 A;  4JI2 E;  1L4S A;  1AH5 A;  3C4B A;  3BID A;  1N3G A;  3M99 B;  2EN8 A;  1IBM E;  2EMX A;  4WX9 A;  2GHF A;  4DV2 E;  1FJG E;  5TSE A;  2G7H A;  1EH6 A;  1STU A;  3BGH A;  3K6Q A;  5AC4 A;  4X62 E;  2YTE A;  2YTF A;  5KL2 A;  4IJD A;  3VK6 A;  2DSY A;  3TQM A;  2NUG A;  1WHQ A;  1PJT A;  4J8Z A;  1P47 A;  2EN2 A;  2PRT A;  2DRP A;  5KL4 A;  2B9D A;  2DIX A;  2IHR 1;  4RH8 A;  4I8O A;  2LTS A;  4NZV A;  1BBG A;  1X47 A;  1DI2 A;  3ADJ A;  4DR2 E;  2YWQ A;  2LTR A;  2EN1 A;  1A1L A;  2B3T B;  5AC5 A;  1UIL A;  2YU8 A;  4R2D A;  1PKP A;  2DLK A;  2DGC A;  2EMB A;  2JVA A;  2LO3 A;  2EOI A;  1T4O A;  1A1H A;  1SR9 A;  1A1J A;  5IV8 B;  2MC6 A;  4MLV A;  4TUI A;  2L2N A;  4X65 E;  1B69 A;  4WSG A;  4F9B B;  3F6H A;  3HTX A;  2YZT A;  2H36 X;  2MDR A;  3QG5 C;  2A25 A;  1I94 E;  4BS9 A;  4O43 A;  1YYO A;  1DGC A;  2EMY A;  3J81 C;  3T1Y E;  2DMI A;  2EPL X;  4M30 A;  2V86 A;  1IMU A;  4F2J C;  4WYQ B;  3J80 C;  2LV2 A;  4DV5 E;  2EMW A;  4LFC E;  1UN6 B;  2YT4 A;  2LE2 A;  3DF6 A;  2L92 A;  4OOG C;  4LF9 E;  4LF8 E;  2RSM A;  1BB8 A;  4DKK A;  2L3C A;  4BHC A;  1WJP A;  3IWB A;  2NA2 A;  3FIG A;  2WZO A;  2D9H A;  4IS1 C;  3JAM C;  3P1X A;  2FV4 B;  2UUC E;  2EMF A;  1A1G A;  2F4V E;  2EQ0 A;  4DV3 E;  1X49 A;  4LFB E;  2F8B A;  1ZAA C;  1IQO A;  4JI4 E;  2RTX A;  4F9A B;  3C6M A;  3UK3 C;  2GLI A;  2ENA A;  4DUY E;  2JP9 A;  2EOQ A;  3EPL A;  4Q35 B;  2LMZ A;  1IQS A;  4JI7 E;  2YTI A;  2EL6 A;  2L6M A;  1DQ3 A;  5BR8 E;  3HPS A;  5CFF E;  4DR3 E;  1MEY C;  1T39 A;  2UXB E;  2EQ3 A;  2LRS A;  2EL4 A;  2EM8 A;  1HNX E;  3ADG A;  1YYK A;  2KOU A;  2JPA A;  2M1S A;  4LF4 E;  4OX9 E;  2EL5 A;  2EOX A;  1F2I G;  3L00 A;  4B3S E;  2YTO A;  4KWY A;  2EP3 A;  4BBY A;  2FGG A;  1X6H A;  3AV0 A;  2EM0 A;  2EPO A;  4P78 A;  4DR1 E;  2YTP A;  2ADR A;  1PDA A;  1XMO E;  2VQF E;  1HR0 E;  2L3J A;  2EE8 A;  4F9C B;  1J26 A;  2LJU A;  1SFE A;  5LLQ A;  5LL6 R;  5KL5 A;  1Z1B A;  4B3R E;  2YRM A;  4YHH E;  4F54 A;  4O24 A;  2UUA E;  4DV4 E;  5F3W A;  2EMK A;  1WRJ A;  3MHH C;  4Q28 A;  4JI6 E;  4BHB A;  2EOR A;  2EPR A;  4R2E A;  3ADL A;  1PJQ A;  2L2M A;  4JI5 E;  4BC9 A;  1WXR A;  2ZM6 E;  2LUQ A;  1A1K A;  1GTK A;  4M9V C;  2MDG A;  3ADI A;  1ZBQ A;  2LUP B;  2E5L E;  2ELY A;  2YSO A;  1N32 E;  4R2C A;  2EM4 A;  2EJ4 A;  4RHB B;  2L2K B;  4DR4 E;  3LLH A;  1A1F A;  3KWR A;  1NCS A;  2CT1 A;  2EPZ A;  2EN4 A;  5IT9 C;  2M9A A;  4R2A A;  4LU9 A;  1YPN A;  2YU5 A;  2VRD A;  2KON A;  1N36 E;  1TN9 A;  2YSP A;  5KL6 A;  1X48 A;  2YTD A;  1N33 E;  1ZR9 A;  2WBT A;  5A6A A;  2UU9 E;  1YUJ A;  2B7V A;  4BMJ A;  3VYX A;  1J5E E;  4ZYG A;  1N34 E;  5ADZ A;  1T4L B;  4BC7 A;  2L8T A;  4WPY A;  2CTD A;  4ZYD A;  2VE7 C;  2EOO A;  2EQ1 A;  2EOY A;  3THO B;  2LT7 A;  2HGH A;  2EOF A;  2JYA A;  4DR7 E;  2ELZ A;  2ENH A;  4DUZ E;  1MGT A;  2UXC E;  4NXM E;  1XMQ E;  2LVH A;  1T4N A;  2DB2 A;  2EM2 A;  1KJK A;  4O4K A;  5LMU E;  4WSP A;  1UHZ A;  3MSW A;  4F6N A;  4M2Z A;  1G2D C;  5A6B A;  3J7A G;  2DLQ A;  2FTX B;  4TUG A;  1PJS A;  1X3C A;  1YYW A;  2RPC A;  4DV6 E;  2V85 A;  3KZY A;  2LBS B;  4YY3 E;  2MKN A;  2L33 A;  2MC5 A;  5A69 A;  2HHH E;  2I9I A;  2EOZ A;  2RSI A;  3ZOQ B;  1IBK E;  2EN6 A;  1IBL E;  1RQ0 A;  3DJW A;  3BBG A;  2CPN A;  4O5G A; 
#chains in the Genus database with same CATH homology
 2EN7 A;  2EM5 A;  4R2P A;  4GZN C;  1YSA C;  1TF6 A;  2I13 A;  2EN3 A;  2EE8 A;  2EMH A;  2EM3 A;  2EM7 A;  1Z1B A;  5KL5 A;  1B69 A;  4FK5 C;  2YRM A;  4WSG A;  2YTN A;  2WBS A;  2EMK A;  3MHH C;  2YTJ A;  2EPC A;  2EMA A;  2A25 A;  2EPR A;  2EOR A;  2EOJ A;  2EOM A;  2J7J A;  2EOH A;  4R2E A;  1DGC A;  2WBU A;  2EMY A;  2DMI A;  1UBD C;  1JK1 A;  2E72 A;  1X6E A;  4F2J C;  1A1K A;  4M9V C;  1LLM C;  2MDG A;  2LV2 A;  2EPU A;  2EM9 A;  2CSH A;  1X5W A;  2EMW A;  2EPP A;  1UN6 B;  1X6F A;  5KL7 A;  2ELY A;  2EOS A;  1A1I A;  2EMZ A;  2YSO A;  4R2C A;  2EM4 A;  2EJ4 A;  2LCE A;  3EPH A;  1BB8 A;  2WCC 3;  1TF3 A;  1A1F A;  1WJP A;  2EPA A;  1NCS A;  1BBO A;  1ZU1 A;  2D9H A;  2CT1 A;  3VHT B;  4IS1 C;  2EPZ A;  2EN4 A;  2EMF A;  3EPK A;  1A1G A;  2M9A A;  4R2A A;  2EQ0 A;  2EMG A;  2YU5 A;  2VRD A;  1TN9 A;  2YSP A;  5KL6 A;  1ZAA C;  2YTD A;  2EML A;  1JK2 A;  1ZR9 A;  2EPX A;  2R1F A;  3UK3 C;  2WBT A;  1G2F C;  1YUJ A;  2GLI A;  2YRH A;  2ENA A;  4R2Q A;  2JP9 A;  2CTD A;  2EOQ A;  3EPL A;  2EOO A;  2EQ1 A;  4R2R A;  2EOY A;  2YRK A;  3M99 B;  3EPJ A;  2EN8 A;  2EMX A;  2LT7 A;  2GHF A;  2HGH A;  2EOF A;  3MHS C;  2YTI A;  2ELZ A;  2MKD A;  2EL6 A;  2ENH A;  4X9J A;  1RMD A;  2BB8 A;  2EMC A;  2YTE A;  2YTF A;  2LVH A;  4IJD A;  5KL2 A;  1MEY C;  2NAB A;  2EQ3 A;  1YUI A;  2EL4 A;  2EM2 A;  2YTG A;  2EOE A;  1KJK A;  1P47 A;  2EM8 A;  4F6N A;  1G2D C;  2EN2 A;  2EMI A;  2DLQ A;  2PRT A;  2YTQ A;  4F6M A;  5KL4 A;  2DRP A;  2JPA A;  1X3C A;  2RPC A;  2EL5 A;  2EOX A;  1F2I G;  5KL3 A;  2MKN A;  2YTO A;  1A1H A;  2EP3 A;  2EN1 A;  2EOZ A;  1A1L A;  2RSI A;  1X6H A;  2YU8 A;  2EN6 A;  2EM0 A;  4R2D A;  2DLK A;  2DGC A;  2EM6 A;  1AAY A;  2EMB A;  2YTP A;  2ADR A;  2LO3 A;  2EOI A;  2ENC A;  4R2S A;  1A1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...