1G2FC

Structure of a cys2his2 zinc finger/tata box complex (tatazf;clone #6)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
89
structure length
89
Chain Sequence
MERPYACPVESCDRRFSQKTNLDTHIRIHTGQKPFQCRICMRNFSQQASLNAHIRTHTGEKPFACDICGRKFATLHTRTRHTKIHLRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Beyond the "recognition code": structures of two Cys2His2 zinc finger/TATA box complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords 5'-D(*GP*AP*CP*GP*CP*TP*AP*TP*AP*AP*AP*AP*GP*GP*AP*G)-3'
total genus 25
structure length 89
sequence length 89
chains with identical sequence F
ec nomenclature
pdb deposition date 2000-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1g2fC02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1g2fC01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1g2fC03
4F2JC 3MHHC 1KJKA 1A1FA 1AAYA 2EN3A 2EM0A 2EPXA 2EOMA 1JK2A 2EMFA 2EN7A 5KL4A 2YRHA 2EM7A 4IJDA 1YUJA 2WCC3 1LLMC 1X5WA 4R2AA 2VRDA 2YTEA 2EOEA 2E72A 4R2SA 4R2PA 2ELZA 2DLQA 2YTQA 1X6FA 1F2IG 2JP9A 2ENHA 2DLKA 2EMCA 2EOXA 2I13A 2EPAA 2EM9A 2HGHA 2LT7A 1X6EA 2YTFA 4WSGA 5KL3A 3UK3C 1UN6B 2NABA 2MKNA 2EMYA 2YSPA 1A1KA 2DMIA 2EMHA 4X9JA 1DGCA 3M99B 2EOJA 1A1JA 2CTDA 2WBSA 1YUIA 2BB8A 2EOQA 4R2QA 2YTOA 1B69A 2EMLA 1JK1A 1RMDA 2ELYA 2EN4A 3VHTB 2ADRA 2M9AA 1NCSA 2EN1A 2LO3A 4R2DA 2EMKA 1ZR9A 2EOSA 2EL4A 2WBTA 2EOIA 2JPAA 2EMGA 2EOHA 2GLIA 2EM6A 1MEYC 4F6NA 1WJPA 3MHSC 1TF3A 2EM5A 2R1FA 4R2RA 2RSIA 2EN2A 2YTNA 2LV2A 2YRKA 1X3CA 5KL2A 4GZNC 2EL5A 2EOFA 2EOYA 3EPHA 2YU5A 2EORA 2D9HA 2EJ4A 4R2CA 1BBOA 2EPZA 2EMIA 1G2FC 4F6MA 2CSHA 2CT1A 2ENAA 2EQ0A 2EMWA 2EPUA 2YTDA 2MDGA 2J7JA 2YU8A 4M9VC 1UBDC 1ZAAC 2EMXA 2LVHA 2YTGA 2YSOA 2YRMA 2EE8A 2EOZA 2EMZA 3EPJA 1A1IA 2RPCA 2YTJA 1BB8A 5KL5A 2YTPA 2EM2A 2EQ1A 2MKDA 2DRPA 4FK5C 2LCEA 2EMBA 2EPRA 2EPCA 2YTIA 5KL6A 2EOOA 1YSAC 2EM3A 1TN9A 2DGCA 2A25A 2EM8A 2ENCA 3EPKA 2EPPA 2EMAA 4IS1C 2GHFA 4R2EA 2EN8A 5KL7A 1A1HA 2EM4A 2EQ3A 2WBUA 2PRTA 1G2DC 3EPLA 2EP3A 2EL6A 1ZU1A 1X6HA 1P47A 1TF6A 2EN6A 1Z1BA 1A1GA 1A1LA
chains in the Genus database with same CATH superfamily
3MHHC 1KJKA 4BMJA 5T6JA 3L00A 1YYOA 2EMFA 2M4IA 2L8TA 2V87A 2L2NA 1SFEA 4BCAA 2EOEA 1BBGA 4JYAE 5AASA 4O43A 4K0KE 2EPKX 2JP9A 2UUBE 3KZZA 2EWLA 1PJSA 4O24A 2IHR1 2YTFA 1UN6B 4ZYGA 1WHQA 1ZBTA 2RSMA 3C4BA 5IV8B 2JR1A 4X66E 1DGCA 2UUCE 2N8XA 4LFBE 2VQEE 1HR0E 1X49A 1B69A 2EMLA 4DV5E 2ADRA 1UILA 5A6JA 1WHNA 3T1YE 5A69A 3C6KA 3LMLA 4R2DA 3C6MA 3ADLA 3HPZA 2EOSA 2Q8UA 1STUA 2G7HA 2L92A 4DR4E 2EOIA 2B9DA 4DV6E 3ECRA 1MEYC 4LF9E 1YPNA 4N4RB 2L6MA 2R1FA 3J7Yp 4DV7E 3OTOE 2EL5A 4X8WA 2EOFA 2EOYA 2V8QB 1RQ0A 4JI5E 2M1SA 4KZSA 4GKJE 1FKAE 2EPZA 3HTXA 4WFTA 4X62E 2K7IA 2CT1A 4NZVA 2EMWA 2YTDA 2YU8A 3BGHA 4OOGC 1PDAA 4M30A 4DR2E 4B3RE 4ZYDA 1UBDC 5FLXC 2YTGA 4HEIA 2JY9A 2EPNA 3F6GA 1A1IA 2RTXA 5KL5A 1IQSA 2YTPA 4BHBA 2EM2A 3THOB 1IQOA 5IT9C 5LMUE 1N36E 4FK5C 2NUFA 2RS6A 1N3GA 2LUPB 1N34E 2N3HA 2EM3A 1TN9A 2MC6A 2EPPA 1XMOE 2EMAA 1GTKA 4R2EA 3JU0A 3IWCA 4WYQB 2WBUA 1G2DC 1HNXE 2YWQA 1P47A 1X6HA 2HJJA 5AE2A 3AUZA 1A1GA 2KOUA 3IWBA 1A1LA 4L5NC 2LTRA 2EOMA 1JK2A 2EN7A 1EH6A 5KL4A 2N3GA 4JI6E 4YY3E 3J81C 4WXCA 4F9BB 4LF5E 2UUAE 1LLMC 2RQLA 4LFCE 1X5WA 2YTEA 4R2SA 1XNQE 1YFHA 1DQ3A 2JVAA 1F2IG 5CFFE 2ENHA 4J8ZA 2EOXA 2I13A 1T4LB 2EPAA 2EPMX 1X6EA 4WSGA 3VYYA 2E5LE 1EH8A 2F8BA 3ZOQB 3F6HA 4BC7A 2EMHA 3ADIA 2LE2A 2EOJA 2FTXB 4DR7E 1A1JA 2CTDA 2WBSA 3FIGA 1NCSA 4WPYA 4DR1E 3OMLA 2H36X 4ZYHA 2EOHA 1QU6A 3C4TA 1EH7A 3MHSC 4B3ME 5LMNE 4RHBB 4YHHE 2L2MA 4DV0E 2LV2A 1DI2A 2LJHA 2YRKA 4JI7E 2JXPA 5KL2A 2JOBA 2YU5A 1BBOA 3RMPA 2CSHA 4WX9A 2ENAA 1AH5A 2EPUA 2J7JA 3KWRA 4ZYEA 2LVHA 1ZBQA 2HC5A 2YSOA 2YRMA 3JAMC 2EOZA 2EMZA 3EPJA 2UU9E 1BB8A 4LF7E 1GQEA 3J7AG 3JTZA 5A6KA 4JI8E 2EQ1A 2DRPA 2EPRA 4DKKA 3THNA 1YSAC 4OX9E 1WXRA 2A25A 2M7QA 4IS1C 5KL7A 4RH8A 4NXNE 2PRTA 3EPLA 4DV4E 1ZU1A 4P78A 2VF1A 1TF6A 2EN6A 5AC4A 4LU9A 5AE1A 4MLVA 1A1FA 2EN3A 2EM0A 4DR3E 4JI3E 2DMYA 3BIDA 1T38A 4JI0E 2EZ6A 2ODRC 2LBSB 1YUJA 3IWDA 2YPNA 2WCC3 3BF2A 1N32E 2VQFE 2VRDA 1J5EE 2E72A 3ADJA 2DLQA 1IBKE 1I94E 2YTQA 2HHHE 2LRSA 2DLKA 2EMCA 2LJUA 2LT7A 2K4VA 2HGHA 5IXMB 1YYWA 1N33E 1IMUA 4L8NA 3UK3C 4B3TE 1QNTA 4NHRA 2NABA 4DV3E 1PJQA 2YSPA 3KZYA 4X9JA 2RS7A 3M99B 1XNRE 2I9IA 1YUIA 2EOQA 4JV5E 2YTOA 2F4VE 1RMDA 2MC5A 5LLQA 1HNZE 2EN1A 5A6AA 4GEQB 4DV1E 2EMKA 3HPSA 1ZR9A 3H09A 1UHZA 2EMGA 2EM6A 1KYQA 4F6NA 3AV0A 2YZTA 4R2RA 1WRJA 3DJWA 3LLHA 5ADZA 5IWAE 2DIXA 2GPIA 2E1MA 4F9CB 3P1XA 4GZNC 4LFAE 4LF4E 2D9HA 4R2CA 2JOXA 4DMIA 1T4NA 4JI4E 3TQMA 4F9AB 4KHPE 2EMXA 2EE8A 2YTJA 1XMQE 2L2KB 1RC7A 2LCEA 4O4KA 2EMBA 2UXBE 2EPCA 4Q35B 4BHCA 1FJGE 4TUGA 5KL6A 2FGGA 2V86A 1YZ9A 4R8OA 2DB2A 2EN8A 4Q28A 2CPNA 3VK6A 5DNYA 2BBGA 5TSEA 1A1HA 2EM4A 2EQ3A 3HXLA 2EP3A 4X65E 1MGTA 4HTGA 4M9VC 4F2JC 1AAYA 5LL6R 2EPXA 4KWYA 2MDRA 2EM7A 2YRHA 4IJDA 2V83A 1T39A 2VE7C 1X47A 3J80C 3ADGA 4R2AA 4R2PA 2DSYA 2ELZA 2V85A 2NUEA 1X6FA 1EKZA 2L33A 4BS9A 2EM9A 2V89A 5KL3A 2L3CA 1PJTA 2MKNA 1GZ6A 2EMYA 4AQYE 1A1KA 2DMIA 4F54A 3QG5C 4LTYA 4JI2E 1L4SA 2L3JA 2KHXA 5BR8E 2BB8A 4R2QA 2B3TB 4DR5E 3EQ1A 4MLQA 1JK1A 4X64E 2ELYA 2EN4A 3VHTB 2M9AA 4DUZE 1X48A 2JWOA 1J26A 5AE3A 2LO3A 3MSWA 2EL4A 2WBTA 4JI1E 5A6BD 2R76A 2JPAA 5F3WA 2GLIA 1WJPA 2B7VA 1NEIA 1TF3A 2EM5A 3VYXA 1O0WA 1YYKA 2RSIA 2EN2A 5A6BA 2YTNA 3DF6A 4BBYA 4NXME 1X3CA 2YT4A 5AC5A 2WZOA 4R03A 3BBGA 1HNWE 3EPHA 2KONA 4DR6E 2EORA 2EJ4A 2NA2A 5A2QC 2ODRD 2EMIA 1G2FC 4F6MA 4M2ZA 4TUIA 4O5GA 2UXCE 4WSPA 2EQ0A 2MDGA 4I8OA 2JYAA 1ZAAC 2LUQA 4DV2E 2RPCA 2ZM6E 4BC9A 2MKDA 2EPOA 1SR9A 2B7TA 2YTIA 2EOOA 2EPLX 4LF8E 1IBLE 2LTSA 2DGCA 2EM8A 4B3SE 2ENCA 3EPKA 4M0VA 1PKPA 3T1HE 2FV4B 2GHFA 4P7DA 2V88A 2LMZA 3K6QA 2NUGA 4GKKE 2UXDE 4DUYE 2EL6A 1IBME 4WXDA 4LF6E 3HQ1A 1T4OA 1Z1BA
chains in the Genus database with same CATH topology
4F2JC 3MHHC 1KJKA 1A1FA 1AAYA 2EN3A 2EM0A 2EPXA 2EOMA 1JK2A 2EMFA 2EN7A 5KL4A 2YRHA 2EM7A 4IJDA 1YUJA 2WCC3 1LLMC 1X5WA 4R2AA 2VRDA 2YTEA 2EOEA 2E72A 4R2SA 4R2PA 2ELZA 2DLQA 2YTQA 1X6FA 1F2IG 2JP9A 2ENHA 2DLKA 2EMCA 2EOXA 2I13A 2EPAA 2EM9A 2HGHA 2LT7A 1X6EA 2YTFA 4WSGA 5KL3A 3UK3C 1UN6B 2NABA 2MKNA 2EMYA 2YSPA 1A1KA 2DMIA 2EMHA 4X9JA 1DGCA 3M99B 2EOJA 1A1JA 2CTDA 2WBSA 1YUIA 2BB8A 2EOQA 4R2QA 2YTOA 1B69A 2EMLA 1JK1A 1RMDA 2ELYA 2EN4A 3VHTB 2ADRA 2M9AA 1NCSA 2EN1A 2LO3A 4R2DA 2EMKA 1ZR9A 2EOSA 2EL4A 2WBTA 2EOIA 2JPAA 2EMGA 2EOHA 2GLIA 2EM6A 1MEYC 4F6NA 1WJPA 3MHSC 1TF3A 2EM5A 2R1FA 4R2RA 2RSIA 2EN2A 2YTNA 2LV2A 2YRKA 1X3CA 5KL2A 4GZNC 2EL5A 2EOFA 2EOYA 3EPHA 2YU5A 2EORA 2D9HA 2EJ4A 4R2CA 1BBOA 2EPZA 2EMIA 1G2FC 4F6MA 2CSHA 2CT1A 2ENAA 2EQ0A 2EMWA 2EPUA 2YTDA 2MDGA 2J7JA 2YU8A 4M9VC 1UBDC 1ZAAC 2EMXA 2LVHA 2YTGA 2YSOA 2YRMA 2EE8A 2EOZA 2EMZA 3EPJA 1A1IA 2RPCA 2YTJA 1BB8A 5KL5A 2YTPA 2EM2A 2EQ1A 2MKDA 2DRPA 4FK5C 2LCEA 2EMBA 2EPRA 2EPCA 2YTIA 5KL6A 2EOOA 1YSAC 2EM3A 1TN9A 2DGCA 2A25A 2EM8A 2ENCA 3EPKA 2EPPA 2EMAA 4IS1C 2GHFA 4R2EA 2EN8A 5KL7A 1A1HA 2EM4A 2EQ3A 2WBUA 2PRTA 1G2DC 3EPLA 2EP3A 2EL6A 1ZU1A 1X6HA 1P47A 1TF6A 2EN6A 1Z1BA 1A1GA 1A1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F2J C;  3MHH C;  1KJK A;  1A1F A;  1AAY A;  2EN3 A;  2EM0 A;  2EPX A;  2EOM A;  1JK2 A;  2EMF A;  2EN7 A;  5KL4 A;  2YRH A;  2EM7 A;  4IJD A;  1YUJ A;  2WCC 3;  1LLM C;  1X5W A;  4R2A A;  2VRD A;  2YTE A;  2EOE A;  2E72 A;  4R2S A;  4R2P A;  2ELZ A;  2DLQ A;  2YTQ A;  1X6F A;  1F2I G;  2JP9 A;  2ENH A;  2DLK A;  2EMC A;  2EOX A;  2I13 A;  2EPA A;  2EM9 A;  2HGH A;  2LT7 A;  1X6E A;  2YTF A;  4WSG A;  5KL3 A;  3UK3 C;  1UN6 B;  2NAB A;  2MKN A;  2EMY A;  2YSP A;  1A1K A;  2DMI A;  2EMH A;  4X9J A;  1DGC A;  3M99 B;  2EOJ A;  1A1J A;  2CTD A;  2WBS A;  1YUI A;  2BB8 A;  2EOQ A;  4R2Q A;  2YTO A;  1B69 A;  2EML A;  1JK1 A;  1RMD A;  2ELY A;  2EN4 A;  3VHT B;  2ADR A;  2M9A A;  1NCS A;  2EN1 A;  2LO3 A;  4R2D A;  2EMK A;  1ZR9 A;  2EOS A;  2EL4 A;  2WBT A;  2EOI A;  2JPA A;  2EMG A;  2EOH A;  2GLI A;  2EM6 A;  1MEY C;  4F6N A;  1WJP A;  3MHS C;  1TF3 A;  2EM5 A;  2R1F A;  4R2R A;  2RSI A;  2EN2 A;  2YTN A;  2LV2 A;  2YRK A;  1X3C A;  5KL2 A;  4GZN C;  2EL5 A;  2EOF A;  2EOY A;  3EPH A;  2YU5 A;  2EOR A;  2D9H A;  2EJ4 A;  4R2C A;  1BBO A;  2EPZ A;  2EMI A;  1G2F C;  4F6M A;  2CSH A;  2CT1 A;  2ENA A;  2EQ0 A;  2EMW A;  2EPU A;  2YTD A;  2MDG A;  2J7J A;  2YU8 A;  4M9V C;  1UBD C;  1ZAA C;  2EMX A;  2LVH A;  2YTG A;  2YSO A;  2YRM A;  2EE8 A;  2EOZ A;  2EMZ A;  3EPJ A;  1A1I A;  2RPC A;  2YTJ A;  1BB8 A;  5KL5 A;  2YTP A;  2EM2 A;  2EQ1 A;  2MKD A;  2DRP A;  4FK5 C;  2LCE A;  2EMB A;  2EPR A;  2EPC A;  2YTI A;  5KL6 A;  2EOO A;  1YSA C;  2EM3 A;  1TN9 A;  2DGC A;  2A25 A;  2EM8 A;  2ENC A;  3EPK A;  2EPP A;  2EMA A;  4IS1 C;  2GHF A;  4R2E A;  2EN8 A;  5KL7 A;  1A1H A;  2EM4 A;  2EQ3 A;  2WBU A;  2PRT A;  1G2D C;  3EPL A;  2EP3 A;  2EL6 A;  1ZU1 A;  1X6H A;  1P47 A;  1TF6 A;  2EN6 A;  1Z1B A;  1A1G A;  1A1L A; 
#chains in the Genus database with same CATH topology
 3MHH C;  1KJK A;  4BMJ A;  5T6J A;  3L00 A;  1YYO A;  2EMF A;  2M4I A;  2L8T A;  2V87 A;  2L2N A;  1SFE A;  4BCA A;  2EOE A;  1BBG A;  4JYA E;  5AAS A;  4O43 A;  4K0K E;  2EPK X;  2JP9 A;  2UUB E;  3KZZ A;  2EWL A;  1PJS A;  4O24 A;  2IHR 1;  2YTF A;  1UN6 B;  4ZYG A;  1WHQ A;  1ZBT A;  2RSM A;  3C4B A;  5IV8 B;  2JR1 A;  4X66 E;  1DGC A;  2UUC E;  2N8X A;  4LFB E;  2VQE E;  1HR0 E;  1X49 A;  1B69 A;  2EML A;  4DV5 E;  2ADR A;  1UIL A;  5A6J A;  1WHN A;  3T1Y E;  5A69 A;  3C6K A;  3LML A;  4R2D A;  3C6M A;  3ADL A;  3HPZ A;  2EOS A;  2Q8U A;  1STU A;  2G7H A;  2L92 A;  4DR4 E;  2EOI A;  2B9D A;  4DV6 E;  3ECR A;  1MEY C;  4LF9 E;  1YPN A;  4N4R B;  2L6M A;  2R1F A;  3J7Y p;  4DV7 E;  3OTO E;  2EL5 A;  4X8W A;  2EOF A;  2EOY A;  2V8Q B;  1RQ0 A;  4JI5 E;  2M1S A;  4KZS A;  4GKJ E;  1FKA E;  2EPZ A;  3HTX A;  4WFT A;  4X62 E;  2K7I A;  2CT1 A;  4NZV A;  2EMW A;  2YTD A;  2YU8 A;  3BGH A;  4OOG C;  1PDA A;  4M30 A;  4DR2 E;  4B3R E;  4ZYD A;  1UBD C;  5FLX C;  2YTG A;  4HEI A;  2JY9 A;  2EPN A;  3F6G A;  1A1I A;  2RTX A;  5KL5 A;  1IQS A;  2YTP A;  4BHB A;  2EM2 A;  3THO B;  1IQO A;  5IT9 C;  5LMU E;  1N36 E;  4FK5 C;  2NUF A;  2RS6 A;  1N3G A;  2LUP B;  1N34 E;  2N3H A;  2EM3 A;  1TN9 A;  2MC6 A;  2EPP A;  1XMO E;  2EMA A;  1GTK A;  4R2E A;  3JU0 A;  3IWC A;  4WYQ B;  2WBU A;  1G2D C;  1HNX E;  2YWQ A;  1P47 A;  1X6H A;  2HJJ A;  5AE2 A;  3AUZ A;  1A1G A;  2KOU A;  3IWB A;  1A1L A;  4L5N C;  2LTR A;  2EOM A;  1JK2 A;  2EN7 A;  1EH6 A;  5KL4 A;  2N3G A;  4JI6 E;  4YY3 E;  3J81 C;  4WXC A;  4F9B B;  4LF5 E;  2UUA E;  1LLM C;  2RQL A;  4LFC E;  1X5W A;  2YTE A;  4R2S A;  1XNQ E;  1YFH A;  1DQ3 A;  2JVA A;  1F2I G;  5CFF E;  2ENH A;  4J8Z A;  2EOX A;  2I13 A;  1T4L B;  2EPA A;  2EPM X;  1X6E A;  4WSG A;  3VYY A;  2E5L E;  1EH8 A;  2F8B A;  3ZOQ B;  3F6H A;  4BC7 A;  2EMH A;  3ADI A;  2LE2 A;  2EOJ A;  2FTX B;  4DR7 E;  1A1J A;  2CTD A;  2WBS A;  3FIG A;  1NCS A;  4WPY A;  4DR1 E;  3OML A;  2H36 X;  4ZYH A;  2EOH A;  1QU6 A;  3C4T A;  1EH7 A;  3MHS C;  4B3M E;  5LMN E;  4RHB B;  4YHH E;  2L2M A;  4DV0 E;  2LV2 A;  1DI2 A;  2LJH A;  2YRK A;  4JI7 E;  2JXP A;  5KL2 A;  2JOB A;  2YU5 A;  1BBO A;  3RMP A;  2CSH A;  4WX9 A;  2ENA A;  1AH5 A;  2EPU A;  2J7J A;  3KWR A;  4ZYE A;  2LVH A;  1ZBQ A;  2HC5 A;  2YSO A;  2YRM A;  3JAM C;  2EOZ A;  2EMZ A;  3EPJ A;  2UU9 E;  1BB8 A;  4LF7 E;  1GQE A;  3J7A G;  3JTZ A;  5A6K A;  4JI8 E;  2EQ1 A;  2DRP A;  2EPR A;  4DKK A;  3THN A;  1YSA C;  4OX9 E;  1WXR A;  2A25 A;  2M7Q A;  4IS1 C;  5KL7 A;  4RH8 A;  4NXN E;  2PRT A;  3EPL A;  4DV4 E;  1ZU1 A;  4P78 A;  2VF1 A;  1TF6 A;  2EN6 A;  5AC4 A;  4LU9 A;  5AE1 A;  4MLV A;  1A1F A;  2EN3 A;  2EM0 A;  4DR3 E;  4JI3 E;  2DMY A;  3BID A;  1T38 A;  4JI0 E;  2EZ6 A;  2ODR C;  2LBS B;  1YUJ A;  3IWD A;  2YPN A;  2WCC 3;  3BF2 A;  1N32 E;  2VQF E;  2VRD A;  1J5E E;  2E72 A;  3ADJ A;  2DLQ A;  1IBK E;  1I94 E;  2YTQ A;  2HHH E;  2LRS A;  2DLK A;  2EMC A;  2LJU A;  2LT7 A;  2K4V A;  2HGH A;  5IXM B;  1YYW A;  1N33 E;  1IMU A;  4L8N A;  3UK3 C;  4B3T E;  1QNT A;  4NHR A;  2NAB A;  4DV3 E;  1PJQ A;  2YSP A;  3KZY A;  4X9J A;  2RS7 A;  3M99 B;  1XNR E;  2I9I A;  1YUI A;  2EOQ A;  4JV5 E;  2YTO A;  2F4V E;  1RMD A;  2MC5 A;  5LLQ A;  1HNZ E;  2EN1 A;  5A6A A;  4GEQ B;  4DV1 E;  2EMK A;  3HPS A;  1ZR9 A;  3H09 A;  1UHZ A;  2EMG A;  2EM6 A;  1KYQ A;  4F6N A;  3AV0 A;  2YZT A;  4R2R A;  1WRJ A;  3DJW A;  3LLH A;  5ADZ A;  5IWA E;  2DIX A;  2GPI A;  2E1M A;  4F9C B;  3P1X A;  4GZN C;  4LFA E;  4LF4 E;  2D9H A;  4R2C A;  2JOX A;  4DMI A;  1T4N A;  4JI4 E;  3TQM A;  4F9A B;  4KHP E;  2EMX A;  2EE8 A;  2YTJ A;  1XMQ E;  2L2K B;  1RC7 A;  2LCE A;  4O4K A;  2EMB A;  2UXB E;  2EPC A;  4Q35 B;  4BHC A;  1FJG E;  4TUG A;  5KL6 A;  2FGG A;  2V86 A;  1YZ9 A;  4R8O A;  2DB2 A;  2EN8 A;  4Q28 A;  2CPN A;  3VK6 A;  5DNY A;  2BBG A;  5TSE A;  1A1H A;  2EM4 A;  2EQ3 A;  3HXL A;  2EP3 A;  4X65 E;  1MGT A;  4HTG A;  4M9V C;  4F2J C;  1AAY A;  5LL6 R;  2EPX A;  4KWY A;  2MDR A;  2EM7 A;  2YRH A;  4IJD A;  2V83 A;  1T39 A;  2VE7 C;  1X47 A;  3J80 C;  3ADG A;  4R2A A;  4R2P A;  2DSY A;  2ELZ A;  2V85 A;  2NUE A;  1X6F A;  1EKZ A;  2L33 A;  4BS9 A;  2EM9 A;  2V89 A;  5KL3 A;  2L3C A;  1PJT A;  2MKN A;  1GZ6 A;  2EMY A;  4AQY E;  1A1K A;  2DMI A;  4F54 A;  3QG5 C;  4LTY A;  4JI2 E;  1L4S A;  2L3J A;  2KHX A;  5BR8 E;  2BB8 A;  4R2Q A;  2B3T B;  4DR5 E;  3EQ1 A;  4MLQ A;  1JK1 A;  4X64 E;  2ELY A;  2EN4 A;  3VHT B;  2M9A A;  4DUZ E;  1X48 A;  2JWO A;  1J26 A;  5AE3 A;  2LO3 A;  3MSW A;  2EL4 A;  2WBT A;  4JI1 E;  5A6B D;  2R76 A;  2JPA A;  5F3W A;  2GLI A;  1WJP A;  2B7V A;  1NEI A;  1TF3 A;  2EM5 A;  3VYX A;  1O0W A;  1YYK A;  2RSI A;  2EN2 A;  5A6B A;  2YTN A;  3DF6 A;  4BBY A;  4NXM E;  1X3C A;  2YT4 A;  5AC5 A;  2WZO A;  4R03 A;  3BBG A;  1HNW E;  3EPH A;  2KON A;  4DR6 E;  2EOR A;  2EJ4 A;  2NA2 A;  5A2Q C;  2ODR D;  2EMI A;  1G2F C;  4F6M A;  4M2Z A;  4TUI A;  4O5G A;  2UXC E;  4WSP A;  2EQ0 A;  2MDG A;  4I8O A;  2JYA A;  1ZAA C;  2LUQ A;  4DV2 E;  2RPC A;  2ZM6 E;  4BC9 A;  2MKD A;  2EPO A;  1SR9 A;  2B7T A;  2YTI A;  2EOO A;  2EPL X;  4LF8 E;  1IBL E;  2LTS A;  2DGC A;  2EM8 A;  4B3S E;  2ENC A;  3EPK A;  4M0V A;  1PKP A;  3T1H E;  2FV4 B;  2GHF A;  4P7D A;  2V88 A;  2LMZ A;  3K6Q A;  2NUG A;  4GKK E;  2UXD E;  4DUY E;  2EL6 A;  1IBM E;  4WXD A;  4LF6 E;  3HQ1 A;  1T4O A;  1Z1B A; 
#chains in the Genus database with same CATH homology
 4F2J C;  3MHH C;  1KJK A;  1A1F A;  1AAY A;  2EN3 A;  2EM0 A;  2EPX A;  2EOM A;  1JK2 A;  2EMF A;  2EN7 A;  5KL4 A;  2YRH A;  2EM7 A;  4IJD A;  1YUJ A;  2WCC 3;  1LLM C;  1X5W A;  4R2A A;  2VRD A;  2YTE A;  2EOE A;  2E72 A;  4R2S A;  4R2P A;  2ELZ A;  2DLQ A;  2YTQ A;  1X6F A;  1F2I G;  2JP9 A;  2ENH A;  2DLK A;  2EMC A;  2EOX A;  2I13 A;  2EPA A;  2EM9 A;  2HGH A;  2LT7 A;  1X6E A;  2YTF A;  4WSG A;  5KL3 A;  3UK3 C;  1UN6 B;  2NAB A;  2MKN A;  2EMY A;  2YSP A;  1A1K A;  2DMI A;  2EMH A;  4X9J A;  1DGC A;  3M99 B;  2EOJ A;  1A1J A;  2CTD A;  2WBS A;  1YUI A;  2BB8 A;  2EOQ A;  4R2Q A;  2YTO A;  1B69 A;  2EML A;  1JK1 A;  1RMD A;  2ELY A;  2EN4 A;  3VHT B;  2ADR A;  2M9A A;  1NCS A;  2EN1 A;  2LO3 A;  4R2D A;  2EMK A;  1ZR9 A;  2EOS A;  2EL4 A;  2WBT A;  2EOI A;  2JPA A;  2EMG A;  2EOH A;  2GLI A;  2EM6 A;  1MEY C;  4F6N A;  1WJP A;  3MHS C;  1TF3 A;  2EM5 A;  2R1F A;  4R2R A;  2RSI A;  2EN2 A;  2YTN A;  2LV2 A;  2YRK A;  1X3C A;  5KL2 A;  4GZN C;  2EL5 A;  2EOF A;  2EOY A;  3EPH A;  2YU5 A;  2EOR A;  2D9H A;  2EJ4 A;  4R2C A;  1BBO A;  2EPZ A;  2EMI A;  1G2F C;  4F6M A;  2CSH A;  2CT1 A;  2ENA A;  2EQ0 A;  2EMW A;  2EPU A;  2YTD A;  2MDG A;  2J7J A;  2YU8 A;  4M9V C;  1UBD C;  1ZAA C;  2EMX A;  2LVH A;  2YTG A;  2YSO A;  2YRM A;  2EE8 A;  2EOZ A;  2EMZ A;  3EPJ A;  1A1I A;  2RPC A;  2YTJ A;  1BB8 A;  5KL5 A;  2YTP A;  2EM2 A;  2EQ1 A;  2MKD A;  2DRP A;  4FK5 C;  2LCE A;  2EMB A;  2EPR A;  2EPC A;  2YTI A;  5KL6 A;  2EOO A;  1YSA C;  2EM3 A;  1TN9 A;  2DGC A;  2A25 A;  2EM8 A;  2ENC A;  3EPK A;  2EPP A;  2EMA A;  4IS1 C;  2GHF A;  4R2E A;  2EN8 A;  5KL7 A;  1A1H A;  2EM4 A;  2EQ3 A;  2WBU A;  2PRT A;  1G2D C;  3EPL A;  2EP3 A;  2EL6 A;  1ZU1 A;  1X6H A;  1P47 A;  1TF6 A;  2EN6 A;  1Z1B A;  1A1G A;  1A1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...