1G2FC

Structure of a cys2his2 zinc finger/tata box complex (tatazf;clone #6)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
89
structure length
89
Chain Sequence
b'MERPYACPVESCDRRFSQKTNLDTHIRIHTGQKPFQCRICMRNFSQQASLNAHIRTHTGEKPFACDICGRKFATLHTRTRHTKIHLRQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*GP*AP*CP*GP*CP*TP*AP*TP*AP*AP*AP*AP*GP*GP*AP*G)-3'
publication title Beyond the "recognition code": structures of two Cys2His2 zinc finger/TATA box complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 25
structure length 89
sequence length 89
chains with identical sequence F
ec nomenclature
pdb deposition date 2000-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1g2fC02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1g2fC01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1g2fC03
1RMDA 2E72A 5KL4A 2ENAA 2EOYA 1UN6B 2EL6A 4R2PA 2MDGA 2EN7A 2EOJA 2YSPA 2EN2A 5KL6A 2YTOA 2MKNA 2YTIA 5KL3A 2GHFA 2BB8A 2YRHA 2YTPA 2EP3A 2EM2A 1MEYC 2ELYA 2YTGA 1B69A 2ENCA 4F6MA 2M9AA 1ZR9A 2EORA 4IJDA 2WBUA 2YTNA 2EM5A 2EMBA 4R2QA 4F2JC 2EOQA 2LT7A 1Z1BA 2EMLA 2EM9A 2EM3A 1G2DC 1X6EA 2YTFA 2DLKA 2EOHA 3EPJA 2LVHA 4R2SA 2ELZA 2CSHA 2EMYA 2EN6A 1X6HA 2EE8A 2WBSA 1YUIA 2NABA 2ENHA 2CTDA 2EQ1A 2YRMA 1P47A 2EM6A 2MKDA 2CT1A 3EPLA 1A1GA 2EM0A 1JK1A 2RSIA 1TF3A 4IS1C 1A1HA 2EMZA 1TN9A 2VRDA 1UBDC 2EOMA 2EOSA 1A1LA 2YTQA 2EOFA 1BB8A 4R2EA 2EM7A 2EMWA 4F6NA 2YTDA 2EM8A 5KL7A 4R2DA 1TF6A 2A25A 2J7JA 2EJ4A 2EQ3A 2GLIA 2EMGA 1X5WA 1WJPA 2HGHA 1YUJA 2EMKA 1A1IA 2JPAA 3EPKA 2EPXA 2EOXA 2EOIA 2YRKA 3M99B 1A1FA 2EPPA 2I13A 2EOEA 3VHTB 1A1JA 2ADRA 2DGCA 2EPCA 4WSGA 3EPHA 2EMIA 2YU5A 2EN8A 2EL4A 2LV2A 1JK2A 3MHSC 3UK3C 2EN3A 4M9VC 1G2FC 2EMHA 4GZNC 2EPAA 1X6FA 2LCEA 2EMXA 2EOZA 2DLQA 4R2AA 2EOOA 2EMCA 1ZAAC 2YU8A 2RPCA 2YTEA 2DMIA 4FK5C 2D9HA 2R1FA 2EPUA 1ZU1A 2EL5A 2YSOA 1KJKA 1X3CA 2EMAA 5KL5A 2LO3A 3MHHC 2WCC3 2EPZA 1F2IG 2EMFA 1BBOA 2EN1A 5KL2A 4R2CA 4R2RA 4X9JA 1A1KA 2WBTA 2EPRA 1YSAC 2YTJA 2PRTA 2JP9A 2EM4A 2EQ0A 2EN4A 1LLMC 1DGCA 1NCSA 1AAYA 2DRPA
chains in the Genus database with same CATH superfamily
1RMDA 5IWAE 4ZYGA 1GQEA 2EL6A 4KHPE 4LU9A 2EN2A 2MKNA 2GHFA 1DQ3A 2YTPA 4GEQB 1PJQA 2K4VA 4NXME 4DUYE 1HNWE 4WX9A 1IBKE 2F8BA 3C4TA 5F3WA 4O5GA 4F2JC 3RMPA 2LT7A 2EMLA 2EM9A 4L8NA 2VF1A 4BBYA 5T6JA 2UUBE 3VYXA 2EOHA 2V83A 2JY9A 4R2SA 2CSHA 2WBSA 2RS7A 3ADJA 1T4LB 3T1HE 2EQ1A 4JI6E 2JVAA 4ZYEA 4NZVA 2CT1A 2EZ6A 2RTXA 5A2QC 1JK1A 4O43A 1TF3A 4WSPA 2EMZA 3JU0A 5CFFE 4BS9A 2L92A 2EOMA 2EOSA 4K0KE 2ZM6E 2ODRC 4RH8A 4DV0E 4MLQA 2L2NA 3C6MA 4JV5E 1TF6A 1GZ6A 4R2DA 1BBGA 2J7JA 2HHHE 1IMUA 1WJPA 4LFAE 4DR6E 3BIDA 1YUJA 5AE1A 3EPKA 4YHHE 1HNZE 4TUIA 2EOEA 2EPOA 3VHTB 2LRSA 2NUGA 5A6JA 2EL4A 4Q28A 2GPIA 2EWLA 4Q35B 1YYWA 2EMHA 4GZNC 3VK6A 2EOZA 2DLQA 3J7AG 2L6MA 5LL6R 2YTEA 3J81C 5FLXC 4FK5C 2V8QB 2BBGA 1RQ0A 1X3CA 5KL5A 1L4SA 4DV2E 4LF6E 4LFBE 2UXBE 2EN1A 2WBTA 2L33A 4X64E 1WHQA 2EN4A 4GKJE 2DRPA 4ZYHA 2E72A 5KL4A 2ENAA 2L2MA 4OX9E 4DKKA 3JAMC 3MSWA 1STUA 4R2PA 2B7TA 5KL3A 4BMJA 2YRHA 2EP3A 2EM2A 2N3GA 2B9DA 2ELYA 4JI8E 2YTGA 2UXDE 4F9CB 2L3JA 1EKZA 2G7HA 3L00A 2M9AA 1GTKA 2DIXA 1ZR9A 2K7IA 2LUQA 4IJDA 4LF7E 2WBUA 2YTNA 4R03A 1X49A 2EPLX 2LJUA 1QNTA 1AH5A 2EM3A 2L8TA 4KWYA 2YTFA 1T39A 1N34E 5BR8E 2LTRA 1N3GA 1PJTA 2EN6A 4R8OA 1X6HA 2M7QA 2EE8A 3IWBA 2NABA 4NXNE 1P47A 2EM6A 2NA2A 2EM0A 2FTXB 2JR1A 2HC5A 2MC5A 4M30A 1UBDC 2VQFE 2KONA 1A1LA 2IHR1 3LMLA 3BGHA 1BB8A 4AQYE 4R2EA 4JI1E 2EM7A 4F6NA 4LF9E 2YTDA 2EM8A 1N36E 3DF6A 4BCAA 4F9AB 5LLQA 4WXCA 1X47A 4JI3E 2JPAA 5AE3A 5AASA 2EPXA 2EOXA 3M99B 2E5LE 2EPPA 2I13A 1YZ9A 1A1JA 2ADRA 2DGCA 1JK2A 3MHSC 4B3RE 3UK3C 2EN3A 1RC7A 4DV6E 2EMCA 1ZAAC 3THNA 2DMIA 4M2ZA 3AV0A 4O24A 5AC4A 3HPZA 3ECRA 1KJKA 4YY3E 2EMAA 4LFCE 2LE2A 4DV3E 4DV7E 2EPZA 2R76A 2UU9E 3F6GA 1T4NA 1BBOA 5KL2A 4R2RA 1A1KA 5A69A 2EPRA 3LLHA 1YFHA 2V88A 2PRTA 2JP9A 2EQ0A 4N4RB 2JWOA 2KHXA 4WFTA 1DGCA 1AAYA 4DV4E 4DR1E 2VQEE 2MC6A 4DR5E 1UN6B 3THOB 2EN7A 2H36X 5AE2A 1HR0E 1NEIA 5KL6A 2UXCE 2YTIA 1T38A 1O0WA 2VE7C 4X8WA 2BB8A 1ZBQA 1XMOE 1WRJA 1YYOA 1B69A 2ENCA 4F6MA 3BBGA 4B3TE 2EORA 2F4VE 4DR3E 1Z1BA 4R2QA 2EOQA 2I9IA 5A6KA 3VYYA 1N33E 2LTSA 1X6EA 1EH7A 1QU6A 4BHBA 2LVHA 2ELZA 3IWDA 2L3CA 1XNQE 1YUIA 3J80C 5IT9C 2MDRA 3ADLA 2MKDA 3F6HA 3EPLA 4DUZE 4DR2E 1A1GA 4HEIA 2JXPA 4J8ZA 4IS1C 4I8OA 3K6QA 2UUAE 1TN9A 4L5NC 2LJHA 2Q8UA 2EOFA 3IWCA 4F9BB 1IQSA 2EMWA 2LMZA 2LBSB 4JI7E 2EJ4A 2B3TB 2EQ3A 4B3ME 4M0VA 1T4OA 2HGHA 2EMKA 4X66E 2KOUA 1A1FA 1X48A 1FKAE 4DR7E 2EPCA 5TSEA 4WSGA 2EMIA 2EN8A 1ZBTA 4DV5E 4JI2E 2LV2A 3HQ1A 4JYAE 2EPNA 5A6BA 1G2FC 2LUPB 2EPAA 2LCEA 2UUCE 2EOOA 2HJJA 2YU8A 1IQOA 2RPCA 2DMYA 2D9HA 1ZU1A 5AC5A 3OTOE 4GKKE 3OMLA 2EL5A 2YSOA 5ADZA 2V87A 4P7DA 2LO3A 1F2IG 1YYKA 3H09A 1I94E 4LF5E 4TUGA 4R2CA 2JOBA 1YSAC 4DMIA 4JI0E 1UHZA 4KZSA 4ZYDA 1WHNA 4X65E 4BHCA 3DJWA 2EOYA 2WZOA 2MDGA 2EOJA 2YSPA 2YTOA 4HTGA 2L2KB 1MEYC 2ODRD 4O4KA 1PDAA 1PKPA 2EPMX 2M4IA 2E1MA 2FV4B 4RHBB 1FJGE 2DB2A 4DR4E 1SFEA 4BC7A 2EM5A 2EMBA 4LF4E 3ADGA 2N3HA 5A6BD 1G2DC 2DLKA 4WYQB 3EPJA 1N32E 1YPNA 2EMYA 2FGGA 2JYAA 1SR9A 3C4BA 1XNRE 3ADIA 2ENHA 2YWQA 1EH8A 2CTDA 2YRMA 4P78A 3TQMA 1EH6A 5LMNE 4WXDA 1KYQA 1HNXE 4X62E 1WXRA 2RSIA 1J5EE 1A1HA 2N8XA 2VRDA 5A6AA 2EPKX 2B7VA 4B3SE 1DI2A 2NUEA 2V85A 2RS6A 3BF2A 2YTQA 3KWRA 3AUZA 5KL7A 4LF8E 3FIGA 3HPSA 2A25A 1J26A 3J7Yp 5IV8B 2GLIA 2EMGA 1X5WA 4F54A 4JI4E 5DNYA 1IBLE 1A1IA 4BC9A 2EOIA 2YRKA 4MLVA 1XMQE 2RSMA 3JTZA 4JI5E 3EPHA 3T1YE 2YU5A 2M1SA 3HXLA 3ZOQB 2NUFA 1MGTA 4M9VC 3HTXA 2DSYA 2JOXA 1X6FA 2YPNA 2EMXA 3QG5C 4R2AA 3P1XA 3EQ1A 1PJSA 5IXMB 2R1FA 2YZTA 2EPUA 2V89A 3MHHC 4LTYA 2WCC3 4DV1E 2RQLA 2CPNA 2EMFA 4WPYA 4OOGC 5LMUE 4X9JA 3KZYA 2YTJA 1IBME 2EM4A 3C6KA 2YT4A 1UILA 1LLMC 1NCSA 3KZZA 4NHRA 2V86A
chains in the Genus database with same CATH topology
1RMDA 2E72A 5KL4A 2ENAA 2EOYA 1UN6B 2EL6A 4R2PA 2MDGA 2EN7A 2EOJA 2YSPA 2EN2A 5KL6A 2YTOA 2MKNA 2YTIA 5KL3A 2GHFA 2BB8A 2YRHA 2YTPA 2EP3A 2EM2A 1MEYC 2ELYA 2YTGA 1B69A 2ENCA 4F6MA 2M9AA 1ZR9A 2EORA 4IJDA 2WBUA 2YTNA 2EM5A 2EMBA 4R2QA 4F2JC 2EOQA 2LT7A 1Z1BA 2EMLA 2EM9A 2EM3A 1G2DC 1X6EA 2YTFA 2DLKA 2EOHA 3EPJA 2LVHA 4R2SA 2ELZA 2CSHA 2EMYA 2EN6A 1X6HA 2EE8A 2WBSA 1YUIA 2NABA 2ENHA 2CTDA 2EQ1A 2YRMA 1P47A 2EM6A 2MKDA 2CT1A 3EPLA 1A1GA 2EM0A 1JK1A 2RSIA 1TF3A 4IS1C 1A1HA 2EMZA 1TN9A 2VRDA 1UBDC 2EOMA 2EOSA 1A1LA 2YTQA 2EOFA 1BB8A 4R2EA 2EM7A 2EMWA 4F6NA 2YTDA 2EM8A 5KL7A 4R2DA 1TF6A 2A25A 2J7JA 2EJ4A 2EQ3A 2GLIA 2EMGA 1X5WA 1WJPA 2HGHA 1YUJA 2EMKA 1A1IA 2JPAA 3EPKA 2EPXA 2EOXA 2EOIA 2YRKA 3M99B 1A1FA 2EPPA 2I13A 2EOEA 3VHTB 1A1JA 2ADRA 2DGCA 2EPCA 4WSGA 3EPHA 2EMIA 2YU5A 2EN8A 2EL4A 2LV2A 1JK2A 3MHSC 3UK3C 2EN3A 4M9VC 1G2FC 2EMHA 4GZNC 2EPAA 1X6FA 2LCEA 2EMXA 2EOZA 2DLQA 4R2AA 2EOOA 2EMCA 1ZAAC 2YU8A 2RPCA 2YTEA 2DMIA 4FK5C 2D9HA 2R1FA 2EPUA 1ZU1A 2EL5A 2YSOA 1KJKA 1X3CA 2EMAA 5KL5A 2LO3A 3MHHC 2WCC3 2EPZA 1F2IG 2EMFA 1BBOA 2EN1A 5KL2A 4R2CA 4R2RA 4X9JA 1A1KA 2WBTA 2EPRA 1YSAC 2YTJA 2PRTA 2JP9A 2EM4A 2EQ0A 2EN4A 1LLMC 1DGCA 1NCSA 1AAYA 2DRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RMD A;  2E72 A;  5KL4 A;  2ENA A;  2EOY A;  1UN6 B;  2EL6 A;  4R2P A;  2MDG A;  2EN7 A;  2EOJ A;  2YSP A;  2EN2 A;  5KL6 A;  2YTO A;  2MKN A;  2YTI A;  5KL3 A;  2GHF A;  2BB8 A;  2YRH A;  2YTP A;  2EP3 A;  2EM2 A;  1MEY C;  2ELY A;  2YTG A;  1B69 A;  2ENC A;  4F6M A;  2M9A A;  1ZR9 A;  2EOR A;  4IJD A;  2WBU A;  2YTN A;  2EM5 A;  2EMB A;  4R2Q A;  4F2J C;  2EOQ A;  2LT7 A;  1Z1B A;  2EML A;  2EM9 A;  2EM3 A;  1G2D C;  1X6E A;  2YTF A;  2DLK A;  2EOH A;  3EPJ A;  2LVH A;  4R2S A;  2ELZ A;  2CSH A;  2EMY A;  2EN6 A;  1X6H A;  2EE8 A;  2WBS A;  1YUI A;  2NAB A;  2ENH A;  2CTD A;  2EQ1 A;  2YRM A;  1P47 A;  2EM6 A;  2MKD A;  2CT1 A;  3EPL A;  1A1G A;  2EM0 A;  1JK1 A;  2RSI A;  1TF3 A;  4IS1 C;  1A1H A;  2EMZ A;  1TN9 A;  2VRD A;  1UBD C;  2EOM A;  2EOS A;  1A1L A;  2YTQ A;  2EOF A;  1BB8 A;  4R2E A;  2EM7 A;  2EMW A;  4F6N A;  2YTD A;  2EM8 A;  5KL7 A;  4R2D A;  1TF6 A;  2A25 A;  2J7J A;  2EJ4 A;  2EQ3 A;  2GLI A;  2EMG A;  1X5W A;  1WJP A;  2HGH A;  1YUJ A;  2EMK A;  1A1I A;  2JPA A;  3EPK A;  2EPX A;  2EOX A;  2EOI A;  2YRK A;  3M99 B;  1A1F A;  2EPP A;  2I13 A;  2EOE A;  3VHT B;  1A1J A;  2ADR A;  2DGC A;  2EPC A;  4WSG A;  3EPH A;  2EMI A;  2YU5 A;  2EN8 A;  2EL4 A;  2LV2 A;  1JK2 A;  3MHS C;  3UK3 C;  2EN3 A;  4M9V C;  1G2F C;  2EMH A;  4GZN C;  2EPA A;  1X6F A;  2LCE A;  2EMX A;  2EOZ A;  2DLQ A;  4R2A A;  2EOO A;  2EMC A;  1ZAA C;  2YU8 A;  2RPC A;  2YTE A;  2DMI A;  4FK5 C;  2D9H A;  2R1F A;  2EPU A;  1ZU1 A;  2EL5 A;  2YSO A;  1KJK A;  1X3C A;  2EMA A;  5KL5 A;  2LO3 A;  3MHH C;  2WCC 3;  2EPZ A;  1F2I G;  2EMF A;  1BBO A;  2EN1 A;  5KL2 A;  4R2C A;  4R2R A;  4X9J A;  1A1K A;  2WBT A;  2EPR A;  1YSA C;  2YTJ A;  2PRT A;  2JP9 A;  2EM4 A;  2EQ0 A;  2EN4 A;  1LLM C;  1DGC A;  1NCS A;  1AAY A;  2DRP A; 
#chains in the Genus database with same CATH topology
 1RMD A;  5IWA E;  4ZYG A;  1GQE A;  2EL6 A;  4KHP E;  4LU9 A;  2EN2 A;  2MKN A;  2GHF A;  1DQ3 A;  2YTP A;  4GEQ B;  1PJQ A;  2K4V A;  4NXM E;  4DUY E;  1HNW E;  4WX9 A;  1IBK E;  2F8B A;  3C4T A;  5F3W A;  4O5G A;  4F2J C;  3RMP A;  2LT7 A;  2EML A;  2EM9 A;  4L8N A;  2VF1 A;  4BBY A;  5T6J A;  2UUB E;  3VYX A;  2EOH A;  2V83 A;  2JY9 A;  4R2S A;  2CSH A;  2WBS A;  2RS7 A;  3ADJ A;  1T4L B;  3T1H E;  2EQ1 A;  4JI6 E;  2JVA A;  4ZYE A;  4NZV A;  2CT1 A;  2EZ6 A;  2RTX A;  5A2Q C;  1JK1 A;  4O43 A;  1TF3 A;  4WSP A;  2EMZ A;  3JU0 A;  5CFF E;  4BS9 A;  2L92 A;  2EOM A;  2EOS A;  4K0K E;  2ZM6 E;  2ODR C;  4RH8 A;  4DV0 E;  4MLQ A;  2L2N A;  3C6M A;  4JV5 E;  1TF6 A;  1GZ6 A;  4R2D A;  1BBG A;  2J7J A;  2HHH E;  1IMU A;  1WJP A;  4LFA E;  4DR6 E;  3BID A;  1YUJ A;  5AE1 A;  3EPK A;  4YHH E;  1HNZ E;  4TUI A;  2EOE A;  2EPO A;  3VHT B;  2LRS A;  2NUG A;  5A6J A;  2EL4 A;  4Q28 A;  2GPI A;  2EWL A;  4Q35 B;  1YYW A;  2EMH A;  4GZN C;  3VK6 A;  2EOZ A;  2DLQ A;  3J7A G;  2L6M A;  5LL6 R;  2YTE A;  3J81 C;  5FLX C;  4FK5 C;  2V8Q B;  2BBG A;  1RQ0 A;  1X3C A;  5KL5 A;  1L4S A;  4DV2 E;  4LF6 E;  4LFB E;  2UXB E;  2EN1 A;  2WBT A;  2L33 A;  4X64 E;  1WHQ A;  2EN4 A;  4GKJ E;  2DRP A;  4ZYH A;  2E72 A;  5KL4 A;  2ENA A;  2L2M A;  4OX9 E;  4DKK A;  3JAM C;  3MSW A;  1STU A;  4R2P A;  2B7T A;  5KL3 A;  4BMJ A;  2YRH A;  2EP3 A;  2EM2 A;  2N3G A;  2B9D A;  2ELY A;  4JI8 E;  2YTG A;  2UXD E;  4F9C B;  2L3J A;  1EKZ A;  2G7H A;  3L00 A;  2M9A A;  1GTK A;  2DIX A;  1ZR9 A;  2K7I A;  2LUQ A;  4IJD A;  4LF7 E;  2WBU A;  2YTN A;  4R03 A;  1X49 A;  2EPL X;  2LJU A;  1QNT A;  1AH5 A;  2EM3 A;  2L8T A;  4KWY A;  2YTF A;  1T39 A;  1N34 E;  5BR8 E;  2LTR A;  1N3G A;  1PJT A;  2EN6 A;  4R8O A;  1X6H A;  2M7Q A;  2EE8 A;  3IWB A;  2NAB A;  4NXN E;  1P47 A;  2EM6 A;  2NA2 A;  2EM0 A;  2FTX B;  2JR1 A;  2HC5 A;  2MC5 A;  4M30 A;  1UBD C;  2VQF E;  2KON A;  1A1L A;  2IHR 1;  3LML A;  3BGH A;  1BB8 A;  4AQY E;  4R2E A;  4JI1 E;  2EM7 A;  4F6N A;  4LF9 E;  2YTD A;  2EM8 A;  1N36 E;  3DF6 A;  4BCA A;  4F9A B;  5LLQ A;  4WXC A;  1X47 A;  4JI3 E;  2JPA A;  5AE3 A;  5AAS A;  2EPX A;  2EOX A;  3M99 B;  2E5L E;  2EPP A;  2I13 A;  1YZ9 A;  1A1J A;  2ADR A;  2DGC A;  1JK2 A;  3MHS C;  4B3R E;  3UK3 C;  2EN3 A;  1RC7 A;  4DV6 E;  2EMC A;  1ZAA C;  3THN A;  2DMI A;  4M2Z A;  3AV0 A;  4O24 A;  5AC4 A;  3HPZ A;  3ECR A;  1KJK A;  4YY3 E;  2EMA A;  4LFC E;  2LE2 A;  4DV3 E;  4DV7 E;  2EPZ A;  2R76 A;  2UU9 E;  3F6G A;  1T4N A;  1BBO A;  5KL2 A;  4R2R A;  1A1K A;  5A69 A;  2EPR A;  3LLH A;  1YFH A;  2V88 A;  2PRT A;  2JP9 A;  2EQ0 A;  4N4R B;  2JWO A;  2KHX A;  4WFT A;  1DGC A;  1AAY A;  4DV4 E;  4DR1 E;  2VQE E;  2MC6 A;  4DR5 E;  1UN6 B;  3THO B;  2EN7 A;  2H36 X;  5AE2 A;  1HR0 E;  1NEI A;  5KL6 A;  2UXC E;  2YTI A;  1T38 A;  1O0W A;  2VE7 C;  4X8W A;  2BB8 A;  1ZBQ A;  1XMO E;  1WRJ A;  1YYO A;  1B69 A;  2ENC A;  4F6M A;  3BBG A;  4B3T E;  2EOR A;  2F4V E;  4DR3 E;  1Z1B A;  4R2Q A;  2EOQ A;  2I9I A;  5A6K A;  3VYY A;  1N33 E;  2LTS A;  1X6E A;  1EH7 A;  1QU6 A;  4BHB A;  2LVH A;  2ELZ A;  3IWD A;  2L3C A;  1XNQ E;  1YUI A;  3J80 C;  5IT9 C;  2MDR A;  3ADL A;  2MKD A;  3F6H A;  3EPL A;  4DUZ E;  4DR2 E;  1A1G A;  4HEI A;  2JXP A;  4J8Z A;  4IS1 C;  4I8O A;  3K6Q A;  2UUA E;  1TN9 A;  4L5N C;  2LJH A;  2Q8U A;  2EOF A;  3IWC A;  4F9B B;  1IQS A;  2EMW A;  2LMZ A;  2LBS B;  4JI7 E;  2EJ4 A;  2B3T B;  2EQ3 A;  4B3M E;  4M0V A;  1T4O A;  2HGH A;  2EMK A;  4X66 E;  2KOU A;  1A1F A;  1X48 A;  1FKA E;  4DR7 E;  2EPC A;  5TSE A;  4WSG A;  2EMI A;  2EN8 A;  1ZBT A;  4DV5 E;  4JI2 E;  2LV2 A;  3HQ1 A;  4JYA E;  2EPN A;  5A6B A;  1G2F C;  2LUP B;  2EPA A;  2LCE A;  2UUC E;  2EOO A;  2HJJ A;  2YU8 A;  1IQO A;  2RPC A;  2DMY A;  2D9H A;  1ZU1 A;  5AC5 A;  3OTO E;  4GKK E;  3OML A;  2EL5 A;  2YSO A;  5ADZ A;  2V87 A;  4P7D A;  2LO3 A;  1F2I G;  1YYK A;  3H09 A;  1I94 E;  4LF5 E;  4TUG A;  4R2C A;  2JOB A;  1YSA C;  4DMI A;  4JI0 E;  1UHZ A;  4KZS A;  4ZYD A;  1WHN A;  4X65 E;  4BHC A;  3DJW A;  2EOY A;  2WZO A;  2MDG A;  2EOJ A;  2YSP A;  2YTO A;  4HTG A;  2L2K B;  1MEY C;  2ODR D;  4O4K A;  1PDA A;  1PKP A;  2EPM X;  2M4I A;  2E1M A;  2FV4 B;  4RHB B;  1FJG E;  2DB2 A;  4DR4 E;  1SFE A;  4BC7 A;  2EM5 A;  2EMB A;  4LF4 E;  3ADG A;  2N3H A;  5A6B D;  1G2D C;  2DLK A;  4WYQ B;  3EPJ A;  1N32 E;  1YPN A;  2EMY A;  2FGG A;  2JYA A;  1SR9 A;  3C4B A;  1XNR E;  3ADI A;  2ENH A;  2YWQ A;  1EH8 A;  2CTD A;  2YRM A;  4P78 A;  3TQM A;  1EH6 A;  5LMN E;  4WXD A;  1KYQ A;  1HNX E;  4X62 E;  1WXR A;  2RSI A;  1J5E E;  1A1H A;  2N8X A;  2VRD A;  5A6A A;  2EPK X;  2B7V A;  4B3S E;  1DI2 A;  2NUE A;  2V85 A;  2RS6 A;  3BF2 A;  2YTQ A;  3KWR A;  3AUZ A;  5KL7 A;  4LF8 E;  3FIG A;  3HPS A;  2A25 A;  1J26 A;  3J7Y p;  5IV8 B;  2GLI A;  2EMG A;  1X5W A;  4F54 A;  4JI4 E;  5DNY A;  1IBL E;  1A1I A;  4BC9 A;  2EOI A;  2YRK A;  4MLV A;  1XMQ E;  2RSM A;  3JTZ A;  4JI5 E;  3EPH A;  3T1Y E;  2YU5 A;  2M1S A;  3HXL A;  3ZOQ B;  2NUF A;  1MGT A;  4M9V C;  3HTX A;  2DSY A;  2JOX A;  1X6F A;  2YPN A;  2EMX A;  3QG5 C;  4R2A A;  3P1X A;  3EQ1 A;  1PJS A;  5IXM B;  2R1F A;  2YZT A;  2EPU A;  2V89 A;  3MHH C;  4LTY A;  2WCC 3;  4DV1 E;  2RQL A;  2CPN A;  2EMF A;  4WPY A;  4OOG C;  5LMU E;  4X9J A;  3KZY A;  2YTJ A;  1IBM E;  2EM4 A;  3C6K A;  2YT4 A;  1UIL A;  1LLM C;  1NCS A;  3KZZ A;  4NHR A;  2V86 A; 
#chains in the Genus database with same CATH homology
 1RMD A;  2E72 A;  5KL4 A;  2ENA A;  2EOY A;  1UN6 B;  2EL6 A;  4R2P A;  2MDG A;  2EN7 A;  2EOJ A;  2YSP A;  2EN2 A;  5KL6 A;  2YTO A;  2MKN A;  2YTI A;  5KL3 A;  2GHF A;  2BB8 A;  2YRH A;  2YTP A;  2EP3 A;  2EM2 A;  1MEY C;  2ELY A;  2YTG A;  1B69 A;  2ENC A;  4F6M A;  2M9A A;  1ZR9 A;  2EOR A;  4IJD A;  2WBU A;  2YTN A;  2EM5 A;  2EMB A;  4R2Q A;  4F2J C;  2EOQ A;  2LT7 A;  1Z1B A;  2EML A;  2EM9 A;  2EM3 A;  1G2D C;  1X6E A;  2YTF A;  2DLK A;  2EOH A;  3EPJ A;  2LVH A;  4R2S A;  2ELZ A;  2CSH A;  2EMY A;  2EN6 A;  1X6H A;  2EE8 A;  2WBS A;  1YUI A;  2NAB A;  2ENH A;  2CTD A;  2EQ1 A;  2YRM A;  1P47 A;  2EM6 A;  2MKD A;  2CT1 A;  3EPL A;  1A1G A;  2EM0 A;  1JK1 A;  2RSI A;  1TF3 A;  4IS1 C;  1A1H A;  2EMZ A;  1TN9 A;  2VRD A;  1UBD C;  2EOM A;  2EOS A;  1A1L A;  2YTQ A;  2EOF A;  1BB8 A;  4R2E A;  2EM7 A;  2EMW A;  4F6N A;  2YTD A;  2EM8 A;  5KL7 A;  4R2D A;  1TF6 A;  2A25 A;  2J7J A;  2EJ4 A;  2EQ3 A;  2GLI A;  2EMG A;  1X5W A;  1WJP A;  2HGH A;  1YUJ A;  2EMK A;  1A1I A;  2JPA A;  3EPK A;  2EPX A;  2EOX A;  2EOI A;  2YRK A;  3M99 B;  1A1F A;  2EPP A;  2I13 A;  2EOE A;  3VHT B;  1A1J A;  2ADR A;  2DGC A;  2EPC A;  4WSG A;  3EPH A;  2EMI A;  2YU5 A;  2EN8 A;  2EL4 A;  2LV2 A;  1JK2 A;  3MHS C;  3UK3 C;  2EN3 A;  4M9V C;  1G2F C;  2EMH A;  4GZN C;  2EPA A;  1X6F A;  2LCE A;  2EMX A;  2EOZ A;  2DLQ A;  4R2A A;  2EOO A;  2EMC A;  1ZAA C;  2YU8 A;  2RPC A;  2YTE A;  2DMI A;  4FK5 C;  2D9H A;  2R1F A;  2EPU A;  1ZU1 A;  2EL5 A;  2YSO A;  1KJK A;  1X3C A;  2EMA A;  5KL5 A;  2LO3 A;  3MHH C;  2WCC 3;  2EPZ A;  1F2I G;  2EMF A;  1BBO A;  2EN1 A;  5KL2 A;  4R2C A;  4R2R A;  4X9J A;  1A1K A;  2WBT A;  2EPR A;  1YSA C;  2YTJ A;  2PRT A;  2JP9 A;  2EM4 A;  2EQ0 A;  2EN4 A;  1LLM C;  1DGC A;  1NCS A;  1AAY A;  2DRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...