1G2IA

Crystal structure of a novel intracellular protease from pyrococcus horikoshii at 2 a resolution
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
166
Chain Sequence
MKVLFLTANEFEDVELIYPYHRLKEEGHEVYIASFERGTITGKHGYSVKVDLTFDKVNPEEFDALVLPGGRAPERVRLNEKAVSIARKMFSEGKPVASICHGPQILISAGVLRGRKGTSYPGIKDDMINAGVEWVDAEVVVDGNWVSSRVPADLYAWMREFVKLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an intracellular protease from Pyrococcus horikoshii at 2-A resolution.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
molecule keywords PROTEASE I
total genus 54
structure length 166
sequence length 166
chains with identical sequence B, C
ec nomenclature ec 3.5.1.124: Protein deglycase.
pdb deposition date 2000-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1g2iA00
4BIMA 3P9RA 4WINA 1KXJA 2NV2B 4ENWA 1KWGA 1VCMA 3VU3A 3MGKA 3R74A 2VPIA 4LGYA 4D1YA 2ZUUA 3F71A 1OX4A 4Y1EA 4AUEA 1FYEA 4B5KA 1PE0A 1P81A 2VRNA 4LRUA 1R9GA 3NOQA 1T3TA 3L4EA 3PQ4A 3FSEA 3L3BA 1VCNA 4ZDJA 2R1TA 3EN0A 1CS0B 3NORA 3P9SA 2A9VA 4BFLA 1KEEB 3BHNA 2AB0A 4Y1GA 1ONSA 3RHTA 4B2YA 3ZJ5A 1JDBC 4UOQA 3TTYA 4N12A 3EWNA 1IZYA 4GE3A 3UJNA 3NOVA 1K9VF 1U9CA 4L95C 1P7YA 3UOWA 4QYTA 3ZR4B 1VCOA 3UGJA 1C30B 4L8WB 4I46A 4UZSA 4AULA 3PQ6A 4QYXA 5BV2P 3L7NA 4P36A 4UNIA 1O1YA 3MIIA 4K2HA 2ZUSA 1QF7A 1OI4A 3CYFA 1KA9H 4RKWA 4I4NA 4PXYA 2YWCA 2NV0A 1N57A 1CF9A 3BWEA 4L8FA 4P35A 1M6VB 3B3AA 5SYAA 4JQSA 5SY9A 1GGFA 2ISSD 1SOAA 2ABWA 4BTEA 3TTTA 4L7QA 4ENQA 3PQ8A 3SF8A 4GUDA 2FEXA 2VXOA 4L78A 1P5FA 4P2GA 5SY4A 3B36A 4MTCA 2YWDA 3B38A 3GRAA 1PDWA 1P80A 1C3OB 1J42A 2AD5A 2D7JA 3F5DA 3PQ7A 2R1TB 1S1MA 1OX6A 1GPWB 4ZDKA 1OY1A 2R1VB 2XF2A 4P5PA 5LIRA 4ZDIA 3PQ3A 1G2IA 1T36B 3PQ5A 4OJYA 3CY6A 3M3PA 4AUNA 1P7ZA 3SOZA 3L18A 3EFEA 2W7TA 4R7GA 3TQIA 2YWJA 2LXNA 5K4AA 4GE0A 4UCFA 3TTSA 1I7QB 1QWSA 2OR3A 2VDJA 4ENSA 3CZ9A 4ENTA 1IZZA 4Y1RA 1GGKA 4ADSG 1QVWA 4S0ZA 4MGHA 4MNTA 2WJZB 3R76A 1KWKA 4Y1FA 3EJ6A 1PDVA 3UK7A 1QVZA 3OT1A 4N0MA 2VKTA 4B31A 4B7AA 1I7SB 2V4UA 4Y0NA 3NOOA 3SF8B 1CE8B 4L8YA 3D54D 1L9XA 1OX5A 3NVAA 3TTXA 4E5VA 1BXRB 3P9PA 4OGFA 3ER6A 1OX4B 2H2WA 3R75A 4UOZA 1SY7A 4ENUA 2R1UA 1A9XB 4RKYA 1GGJA 2R1VA 4XLLA 4AJ9A 4ENRA 1Q7RA 4OIFA 1JVNA 2GK3A 1IPHA 2RK6A 3CNEA 3KKLA 2YWBA 2GHRA 1WL8A 3P9QA 4WXYB 1GG9A 4ZGGA 3TTVA 2ZUVA 5JZOA 4ENVA 3EZGA 3FIJA 1FY2A 3N7TA 3CZAA 4OFWA 5IP5A 1I1QB 5SY6A 4OQ4A 1GPMA 3NONA 1Q2UA 1T0BA 4Y1RB 5E9AA 3WFZA 5JZMA 3PQ2A 4B40A 3TTUA 4E08A 5DFAA 1GGEA 3ZJ4A 2ZUWA 4AUMA 2RK3A 1QVVA 2ZUTA 4I2NA 1PV2A 4HCJA 4OGGA 2RK4A 3TTWA 1GGHA 4ENPA 3UMMA 1QDLB 3OT1B 2IUFA 1VHQA 4P34A 1UCFA
chains in the Genus database with same CATH superfamily
1QYVA 4EG7A 4ZODA 1FX0A 5EXDA 3NS7A 4TLBA 3NT5A 5FV4A 1WIWA 2FPOA 2YOGA 4WDRA 1Y6FA 1GY8A 2KPOA 5HMMA 4JV5B 3AHEA 3NKVA 4EW1A 1QP8A 5M34A 4QUKA 1LZKA 1UFOA 4KWTA 5SICE 4A8JC 1PJTA 2NTYC 2OBBA 4TV9A 1MAVA 2BWJA 2BJVA 2R5NA 3W05A 1TZCA 1NI3A 3DKIA 3HABA 3IAM6 5KNCD 4D8VA 3MRVA 1OXXK 3CNLA 1G98A 3P9SA 2ZSIA 4A8HA 2W2NA 1AU9A 2NSLA 4EHLA 2OZLA 3N8DA 1IULA 1E4VA 2QIOA 2P30A 2HWWA 4NBKA 5E6SB 3ZWDA 1CIPA 1M2FA 4WX2B 4P82A 2DFKB 5FX2A 3ZUGA 3ILYA 4GGMX 3HY6A 1MIOB 4AD8A 1FE8A 3MOIA 5MF6A 1NIJA 2ZWOA 4CUJA 1CY2A 1Q74A 5CBPB 5CYFA 4C5CA 3IDZA 3DEYX 4KO8A 2NYUA 2X2FA 1NF3A 3PC2A 1BQ3A 1BRTA 1FLNA 4LN1A 4MV8A 2WOOA 2JLBA 3EGVA 2ZBPA 4KO4S 1KAMA 1RXCA 4PC6A 4E7OA 2GBGA 1I9CA 2BSXA 3VOBA 1X3LA 4TT8A 4E4TA 1TMKA 2C97A 3QBDA 4UTPA 1AURA 2ECKA 3A6FA 4AJIA 2XD9A 4JJ8A 4DHWA 4BZPA 3JRWA 1PLLA 4E6PA 4JI2B 3QVMA 2WJJA 5LXTA 2PMKA 1YMVA 3N0RA 1KIFA 3MELA 2BM1A 3VR4A 2OAP1 3QX8A 3LW7A 2JHGA 2X86A 4W4TA 5EJGA 5TLSA 5L7YA 5IDQA 2LGJA 1FBTA 1U8EA 3O4IA 4GMHA 3GW8A 1VIDA 3S2YA 3UUEA 4UASA 1CR2A 1W8DA 4YJ3B 5COQA 1OI3A 4HX9A 4ZDIA 3L6EA 4EGAA 4FR0A 1SB9A 4B7XA 1M1NA 4YONB 4FINA 1V6CA 1PAUA 2Y77A 4B9AA 5C35A 3FWHA 2XOXA 2I6GA 2JEZA 1UM9A 1CSEE 1T2EA 2IEBA 2ZJAA 3AEYA 1E9RA 2C4HA 1YS7A 1UBCA 1S8NA 3ABSB 1EM6A 1T2DA 3LT5A 3MD0A 4S1WA 4JYMA 1JIUA 2H7YA 3PUIA 4QDUA 1N5IA 3CN7A 4A9AA 3W4JA 1NXQA 1QIMA 1ND5A 1ZWKA 4YMWA 4MVJA 4LBWA 3OZXA 4F21A 1EYZA 3H1EA 3H2SA 1MJ5A 4F38A 1MTOA 5AXCA 1P62B 2VH5R 3SYTA 3N0TA 3MQ2A 1N0UA 4MKXA 5G0WA 2R1UA 1PX2A 4YXWD 2IKSA 2WJYA 4PGGA 4ACBA 3TW0A 1I0IA 4KBFA 4QM7A 4DDUA 1OFTA 2RK6A 3FKJA 1IUOA 2ONJA 2RGDA 1SRRA 1U65A 1E3DA 1JLLB 4JI5B 3GWZA 4W9NA 2L42A 1Q1EA 2OD9A 5ITSA 1XA0A 1CP3A 2XMDA 4P33A 5LWQA 4MLCA 4OP2A 4YN3A 4Y2RA 2ZBUA 4YO7A 4WW0A 3DT9A 2NG1A 3OO0A 2GQ0A 4FSHA 3REGA 4KDCA 5KZMB 1RZRD 2HT6A 4L76A 1LPBB 2AMVA 3RREA 1N6HA 2QAIA 5JJBA 3NQ41 4C29A 2VA8A 3GOHA 3GQBA 1PEKE 5TPWA 1KK2A 3MZ0A 4PY2A 2OHOA 5EP2A 5B36A 4KWHA 3N2KA 3O2QB 1R00A 2J8ZA 2W83A 3OQBA 4KXFB 3RSZA 5JD5A 4G0WA 1SPBS 1MRSA 3CG0A 2YJNA 4H3HB 4GXNA 5H02A 3EWAA 1FTSA 2ADOA 5SYMA 2WG2A 4CL3A 2H4XA 3ZZTA 5EMHA 1UOPA 1G5HA 2N1MA 3QU9A 1IAQA 3U39A 4DJTA 1ZS9A 2QN3A 4PPQA 2P27A 3IBFA 2YIDA 4GBJA 5BSWA 3BORA 4MYCA 3VO9A 3I6BA 1GNTA 1ADGA 3HM9A 2QXTA 4MWEA 3QFTA 5IHXA 4RQTA 3IEVA 2CE2X 3W9UA 2Q5FA 2VYFA 2O1XA 2DFTA 3I6QA 2CSUA 4GYWA 2MT9A 5GZ1A 4ARIA 1PFUA 2FSSA 4EFMA 3EBOA 1IJBA 4DNQA 4W1PA 1DKNA 2I2AA 1K86A 4MV0A 5I9MA 1EXVA 2HBRA 3M7IA 4P08A 4WN3A 3T1YB 3ESDA 1FU7A 1GKUB 4UDXX 5KUTA 3K4QA 1A04A 2DM6A 3MCUA 4TM7A 3RU7A 3W9BA 2HCRA 1KZYC 2W0SA 5K5EA 4M9RA 1JMVA 2PDAA 1TAHA 4LCEA 3ZXUB 5JFTA 1DUVG 1ATIA 4D97A 1GSHA 1RM3A 3DE7X 2X22A 5F21A 4RORA 1XNGA 3CCBA 1F20A 1OBFO 1JECA 3T12A 4A1OA 2B25A 1O08A 2AX4A 1OTYA 3C7TA 3KUXA 1P6UA 3BHIA 4U2GA 4ZAGA 3UWKA 1JR4A 1Y5RA 2V0CA 1BWPA 1YJCA 3PJGA 3PNMA 3JYHA 1F3LA 2JFHA 4L73A 4X1YB 4D02A 1W7AA 1IHPA 4HEHA 4G89A 1FDRA 4DLPA 1P1HA 1TMOA 3P2OA 1MZPA 2X4DA 1UEJA 1XZPA 2JIZA 4RKWA 2JKVA 5T8KA 3CJQA 5LD2C 4HVAA 1C8LA 2WVGA 3PHIA 1CS4C 4H4DA 1OV4A 3IJ5A 3O4VA 5EZSA 1MPTA 2H4HA 1A97A 3EZLA 3MILA 4HAIA 4JNCA 4YJGB 2OK8A 1RE0A 3QVJA 1BX1A 2IQ5A 2JBAB 3CLUD 3D8NA 4A2QA 1I1NA 4ENTA 1SVWA 1W59A 1OYWA 2I4MA 3BD9A 5CT5A 1EX9A 3KDSE 2HXYA 4Q3AA 4C7OA 2PWAA 1X1SA 1GPAA 1H8HD 2ZB7A 1QP7A 3QUSA 3IUEA 3NHPA 4ZRNA 1E8NA 2G72A 2GKSA 5C7LO 4HRVA 1VPDA 1UPCA 2W2KB 3LI2A 1L9XA 1YL7A 2XGGA 4MXDA 1XL0A 2J6IA 1UP4A 3ZGYA 1KBQA 2FN3A 5CR9A 3R8FA 3TPCA 3N70A 2JLRA 2VJLA 3M0EA 4X1YA 3MGBA 3GFVA 3REQB 4C4ZA 4CMEA 4RKYA 3I5UA 2VP9A 2O48X 1RWXA 3C70A 4IQ4A 4CQMD 2NUTB 3WWZA 2P4UA 3D31A 2FOLA 3A4NA 5BQXA 5BSVA 2CB9A 4HBZA 4ZAZA 1GG9A 1VIAA 1YK0A 3L7MA 3NB0A 1UBNA 4I1VA 4J1TC 4D9EA 1R27A 4R71A 1LZLA 1YBMA 1M8KA 1F4LA 4J0IA 1UODA 4R8KA 2OL4A 3ABOB 3L8HA 3R8XA 1PBNA 2PBZA 3BJIC 1DKUA 5CXSA 1N8NA 3TRDA 3N76A 1VE5A 5CXXA 4EMBA 3QZUA 4XD7A 4JJZA 2Q3JA 1KWGA 1YAHA 5DV9A 4NPCA 1EE2A 1SVKA 3A3YA 1T1JA 5CM8B 1PFGA 4N3BA 1AHHA 2A0UA 4K87A 4WA8A 3S0JA 5BR1A 3KQTA 4V02A 3EZ7A 1G6KA 3IAS6 3ITKA 4IM7A 5EOVA 3TK1A 2EX0A 4FFVA 5ITZB 1ZO8A 1DO8A 3MRXA 4HZUB 5E6UA 1XQWA 3RIMA 2W2MA 3TEFA 1JSXA 1KP2A 3HY3A 1SXHA 3JR7A 5AO9A 3ZDYB 4ZIRA 4JR0A 5KNDA 4ZANA 4AUEA 5JISA 4DA6A 3AR3A 3IBTA 1NJFA 1DJQA 2ZITA 3PCXA 2I3BA 2R84A 3EA4A 3TXYA 2FLVA 1DQZA 3IUMA 4J3NA 3VPBA 1BWSA 1U4NA 3PG5A 4IJ5A 5DIFA 1W4RA 4IVNA 4J2HA 5IJ0A 1X77A 2OZEA 4LHXA 4FTWA 1UQRA 4HFJA 4LJ9A 5ILOA 3DWEX 1UK6A 4OLJA 4KMRA 1USUA 3LV8A 1NAHA 4K9NA 4PVDA 5CLIA 3N8IA 3TSCA 4HWOA 5J9FA 3KJHA 2BMEA 1VJ0A 1SXQA 2PWPA 3H4VA 3CGGA 3GR6A 1F1BA 2J0UB 1TI7A 2E5FA 2XYPA 5FPQA 3GLGB 4IHJA 1KO1A 5JO9A 4TLEA 1E9DA 1MNQA 4FGKA 2ZRJA 3NYQA 5K4HA 5A03A 1E6WA 1VHJA 3VPXA 1NQTA 3CLRC 2PLWA 3TFQA 4ZDKA 1RYMA 1KSGA 4Q9DA 5DYWA 2VDLB 2GNOA 3ADBA 4XYBA 3ROKA 4C1NA 3ZLJA 4FDAA 1XEAA 1ZQ9A 5LKRA 1V47A 2PJDA 1QOQB 2X5OA 2CXXA 5DYYA 3DPSA 2AGVA 5A3VA 1ZONA 3GYBA 1U0FA 1ZG3A 2MIIA 4Z4IA 3RVRA 3T1NA 2L82A 1G20A 2QJOA 4LGCA 5PNTA 2DX7A 4GYKA 1Y37A 3USES 3MB5A 4BNMA 1Z35A 4BWGA 4DMRA 5I9NA 5JR3A 3EJ6A 3M3DA 2UU9B 2Q3MA 3EIOA 1Z6TA 4RELA 1SXJA 1SVIA 3N8HA 1UXIA 4LVCA 1TU3A 1EK0A 1XJWA 2R8BA 4HLUA 3ZE2B 1AA6A 3U4HA 3EPHA 2VBGA 5IH3A 4AKIA 1UR5A 3BVPA 1LQ2A 4WZBA 1K7EB 2KMLA 3QE2A 4JJGA 5LZ8A 3RS5A 2F9LA 5AW3A 1ZEMA 4M86A 4X92A 1LRLA 2DC1A 1L4FA 2QA5A 1NAIA 3IPAA 2FPPB 4KEAA 2IYTA 3QWBA 1WS6A 1UBLS 3F5QA 1M5RA 4WIAA 1HZZC 2BC9A 2XJ9A 1Q5PA 2VZ0A 2FSGA 1MQ8B 5FOWA 3LBYA 4AI6A 2C2HA 2PH7A 4E2WA 2QT1A 2K87A 2O0JA 4HAZA 4DA7A 1IC6A 1KJZA 4ZARA 1JA0A 2QLNA 4R2LA 4FMDB 1QHSA 5EWLA 1CR1A 3PQ2A 1K6IA 3D0OA 3E48A 3LPMA 3C24A 2ATEA 3EIEA 6AT1A 3DULA 1E20A 1SVOA 1KI6B 3NT4A 4MWGA 3X43A 4C78A 3Q3JB 5I9BA 4D9KA 1KI8A 3B2EA 1ZITA 1RRMA 2NU9A 3HPRA 3LFUA 1E2IA 2X0FA 5AXAA 3GAMA 4XD2A 5K8IA 1OXMA 1U1IA 3DGEC 3MHTA 2Q45A 3NT2A 7REQB 2AZ4A 4M0UA 4AKTA 3I9NA 1KEZA 1Z5UA 5T6MA 5EE9A 3CVWA 2ZUDA 1G3QA 4D45A 3C5CA 3NEJA 3MT9A 1C2TA 4ZVSA 4D9CA 1YZ3A 1RC0A 2JFFA 3ITNA 4NHOA 1MOZA 3TXAA 1E5DA 4IJVA 5EYPB 3EZFA 2Z4TA 4IDBA 1SOWA 3Q12A 4KVFA 4KSCA 5FLXA 1U0BB 1WVIA 4DEVA 5JCOC 3ROGA 4J0HA 2VHQA 5JS8A 1YOBA 1R1DA 2WF8A 3NBMA 2YZ2A 4I4LA 4E11A 2OORA 2IWRA 4LIPD 4BAUA 5AVTA 2CFSA 3KT6A 4H35A 3FTDA 4DF3A 2BDUA 2XIJA 3L7DA 1G42A 1PKEA 1WUTA 3CF0A 5DXFA 5TGTA 5A5DA 4AZSA 3VR5A 2N75A 3LQFA 4Z9AA 3SNHA 4B7UA 1U2DC 3U48A 1W2GA 2ZRCA 3GX1A 4KRGA 3R3UA 5EQJB 4LHVA 5HIIA 3I04M 3O2SB 3IP6A 5KU1A 2P9YA 3FCYA 3OUUA 4O4JF 4MINA 2PT9A 3S3TA 3OZDA 2JK1A 5JAQA 4C2AA 1R5JA 3NTXA 1KGSA 3QSYA 3TNDA 3ROFA 2G83A 4KDFA 4PGHA 1E1RD 1QV6A 2E55A 1S3IA 2GPTA 3S70A 3ODGA 4U1RA 2VH2A 1DG3A 1M9NA 1J2JA 3L0BA 3U7FB 2R60A 3FCEA 3JQDA 3V1LA 1EVJA 1NQUA 1Y98A 4J9VA 5HZGA 1VZ3A 2GXAA 1BWQA 2Z2IA 4QNRA 4RS3A 4XZ3A 3LUGA 1DC3A 3LYUA 2Q7DA 3C3XA 3KAQA 2AZXA 4GQAA 3NLLA 1U3GA 3FYUA 2AC7A 3WMRA 3ZGVA 1SEPA 4BQEA 5AVKA 3AERA 1X1AA 2EG9A 2EKPA 2HNKA 3JWIA 2DHRA 1CX9B 3JQAD 5H82A 5K8UA 3UV7A 1O95D 1EVKA 1KAEA 1YS6A 1IVNA 2PZBA 4I4IA 5FBVB 1XYYA 1NRXA 3AR2A 3M6MD 2G82A 2IDJA 4Q7JB 3QPVA 2NVUA 2PGXA 4OGWA 4YRZA 1XU9A 2IYEA 1Z8DA 3H5RA 4OMDA 4ED9A 2WFLB 2YW2A 1E7WA 3HUEA 1LLFA 2ORVA 4Q3EA 1K98A 4U2CA 421PA 4A1FA 5K0BA 2O0KA 1ODKA 1LI4A 1UBGA 4XX1A 3O82A 4N5HX 1JU3A 3HBMA 4PNHA 4QFBA 1P0IA 4GXTA 4RHXA 5AVYA 3IHLA 2H1HA 1I01A 1U7OA 3N2GB 2G4CA 3PNKA 1Z4IA 4DNPA 4INOA 1P8AA 1ZKMA 2JDIA 2C5EA 3STHA 3EF0A 5K8LA 3MGCA 4TOIA 1BU5A 2C7RA 3PDHA 2H63A 4LJSA 4JBLA 1DX4A 5GIPE 3HH8A 3S1LA 5F7XA 1BEUB 2O0MA 2OV6A 4O0MA 3OLWA 2YCBA 2J31A 5GV8A 2C4VA 3F8TA 1Z6GA 5D3KA 4ABTA 5I48A 1I4WA 4YDHB 5CVDA 1KVSA 1W1WA 3FGNA 3H9CA 1ZCJA 4HHEA 1EVEA 3C98A 3WDKA 4IIHA 4CI0B 5KVQA 4QHYA 1MCZA 4EW3A 1GLVA 3B89A 8MHTA 2YBEA 4YCLA 4PCUA 1L4GA 5KVAA 4R8VA 2IV2X 4B09A 3G2QA 1LPMA 3FUVA 3GEMA 1V1RA 2VSYA 3GJTA 3BB1A 1CNEA 2Q1UA 2ZPUA 1TFUA 3WLSA 3MWLA 1XZJA 4ES6A 2IYUA 5K3EA 1YHYA 3TZQA 2J30A 4YJHA 4E5YA 3VC7A 1QPZA 2JI6A 4OSPA 2JC3A 3SJAA 3ANNA 3UW1A 4MLPA 3T4EA 2QY9A 4DV1B 1FP4A 3HA7A 2PKXA 2WFAA 4AK9A 3C39A 1B6SA 1KI7A 4JC4A 1MO5A 4OBWA 2MINB 3SZUA 5TT1A 3A27A 2YY7A 1KQPA 1JHZA 4B8ZA 3UGQA 1F0KA 4MUAA 1R6TA 2HCTA 2WV9A 3VTFA 4FI3F 3B82A 2ACWA 2H0AA 4ZGWA 3GT0A 3M9XA 3C1UA 2V3CC 1X39A 4D9FA 3PJRA 4KACA 1BW9A 1ZRSA 1ZD1A 3G68A 4YRRA 3ICCA 1SBYA 3KYDA 3LHDA 4D46A 1HO3A 2PUVA 3AR5A 2QN6A 4GAEA 4L9SA 4PSCA 4XYMA 1J5EB 2Z6UA 4MARA 4BN4A 1U3DA 5DOVA 3O2NA 6ABPA 2JCVA 2FMKA 3T7RA 1W46A 2OCLA 2QRMA 4KN8A 3K0AA 3ZK7A 2YXLA 3TLKA 4B71A 1TZBA 2W42A 1LPNA 1I0LA 5K0SA 2PGOA 4OFZA 4Y8VA 1BMFD 1IEWA 1NVDA 2PX2A 4UUAA 3GLQA 3WRYA 1YD7A 3G2NA 3KPYA 1YZNA 3DUFB 5HDQA 1U2PA 1K8RA 5SZJA 5FUQA 4KQEA 2NSJA 3RSGA 1R0XA 1MEEA 3HKEB 1SZPA 2I03A 1JU4A 2ORYA 4Y9TA 3TTSA 4AXXA 3U13A 1FS5A 5F7ZA 2EARA 2V7XA 2RARA 2ET6A 4J2OA 4MAMA 2VWQA 3OAAD 1DP4A 3CX4A 1HDOA 2Q5LA 3H75A 3R4VA 4HAUA 4K9LA 4POAA 3SMVA 1W36D 1XPUA 4ZQGA 4F6RB 2W6ID 5C5EA 2LNDA 3H1GA 2DWOA 4D9JA 4B31A 3L5KA 4N5LA 4UHHA 3MTAA 2GZ1A 2PG3A 5LMNB 3V6LA 2G76A 5EA2A 1Y6QA 1JZSA 1BJKA 1XLTA 3JPYA 3DCNA 1V37A 2ECOA 4RPHA 2XA9A 2EG5A 3DMDA 2IYAA 3ER9A 3HYTA 4FX2A 2QN9A 3IPYA 3IO5A 2V7TA 4Q66C 4EYSA 1EBFA 1ZMRA 2Q7XA 5IAAA 1L5QA 4MW9A 4BO6A 1E5QA 3BJEA 3CNEA 3RAPR 1NW5A 1WCWA 2C8JA 1BMFA 4BRUA 1QBGA 1NNSA 1SK8A 3KX2A 5AWFC 5FNVF 1N2ZA 3QTBA 3UAXA 1R5BA 3DOCA 1V1JA 2OD7A 3AFNA 4QRDA 3MMXA 4M7PA 1JT9A 3CUSA 3D02A 5GP1A 3OY7A 4LDQA 4WFJA 4CF5A 3KE9A 1V71A 1QOPB 2JH3A 2V4MA 1HDZA 1UBMS 4OD0A 1S2LA 5DX1A 4YRJA 4YRLA 4QDXA 4RSGA 5G0UA 1Q6ZA 1VA5A 2IW1A 2QJRA 3H5OA 4RTPA 1G21A 3RS9A 3EB9A 4F5YA 4YI5A 1SGWA 4ZCSA 3MWJA 3N2YA 4HEJA 3O8BA 4EOGA 4HUJA 4C06A 1RRVA 1MORA 3WLEA 3P9CA 2FN9A 4GR4A 3DQQA 4HGZA 5DGCA 4ZVQA 3PITA 1JSLA 3TL6A 3EQ2A 1AQIA 2EAUA 4HOYA 4XYEA 2OEPA 2WU4A 4QC2A 4O4IA 1J7KA 5AESA 4P4SA 2VSFA 4Y2PA 4PZYA 1DG9A 4NFSA 3LUBA 2NZ2A 2CLLB 4BVJA 5TGZA 4EAAA 1E0KA 1JLLA 1G6OA 3EPKA 3MJSA 3B1XA 3WKCA 1UJBA 1JTFA 3O9VA 5EIFA 4DA8A 3KSBC 3EODA 1FNBA 3AQ4A 5IYZF 2WSLA 3PVZA 2C2YA 2VDVE 4ERXA 1Z25A 2IYQA 4JKIA 4MIKA 3IS3A 2G6TA 1PUXA 3WDLA 2JI9A 1LRJA 3BM5A 1KJ9A 1ZOSA 2QI9C 5COAA 1TD9A 3V1YA 1GFWA 1T0IA 4UNIA 4EP1A 4MDFA 2Z30A 2O6LA 3P7MA 1YOVA 5TPWB 2VT6A 3K1TA 3G89A 4CMIB 1CEEA 4LC1A 2HCJB 2EGGA 3Q6NA 4DT1A 3O8CA 2ZS7A 3CURA 2AMLA 3GRRA 4B3MB 2CJWA 4FYWA 4HO1X 4KR2A 3NEYA 3AXTA 1P1KA 4Y9UA 2ZXFA 1R4MA 1U5BB 4KIWA 1ND6A 3QHPA 4GWLA 4IV8A 2BV3A 2CL5A 1L4EA 2GAOA 5CHEA 5CK4A 5FT9A 1T5HX 2A4MA 4EB3A 3L1IA 4TUYA 221PA 1SR8A 4HAWA 3EVZA 3HR4A 5JSZA 1C3EA 4IINA 5F1KA 5ALYA 4FB5A 5HQ3A 4N3GA 3SY8A 2WD8A 5AJYA 4F2HA 3PWZA 5HQTA 4FNGA 3O8QA 4WY8A 1WMDA 1H05A 1HZJA 1ZA2A 3FBWA 4ZCLA 1QP0A 4B0OA 2VJKA 4HPWA 5EE5B 3X1JA 3CPSA 2VBCA 3DVAB 2VYVD 1CHNA 2C4WA 1ADFA 2V3WA 3EIFA 2XB6A 3I62A 1TO1E 4RYLA 3HS3A 1Y3HA 4X60A 4LOHA 3K0HA 4JXZA 1X2BA 5I5GA 2WJPA 3CW8X 2G0AA 1B8NA 1Y6JA 1YVUA 3C6XA 3M4JA 1GPNA 3O94A 2B1IA 2NT4A 1IPEA 2XDQA 3EZXA 3M33A 3R9XB 4DEXA 3FRHA 4IHJF 2O8NA 3SJCA 3TLAA 1KYWA 2O14A 1L8LA 4IFTA 1RLOA 3PR3A 3VSDA 2J0EA 3AUSA 1ABBA 2P4SA 1AZLA 2CD7A 4QDOA 1U5BA 4QU0A 4C2UA 1H4SA 1WMSA 2BLNA 4MUYA 4OB8A 1N7HA 3VAAA 4UBKA 5BR7A 4RA6A 4PF1A 3ZNPA 1NQXA 3B1FA 2BTQB 2PTHA 3DMTA 4X6UA 1QC5A 1BFKA 4TL8A 4Z0PA 4F2GA 1WWKA 2J3KA 1DOHA 4W8GA 2ZDQA 5D1HA 4HAYA 5JRJA 1X7DA 2CNWA 3LT4A 2IXBA 2HF2A 9LDTA 5M29A 1R7RA 1F8UA 2WHPA 4HH1A 2ODEA 4DLXA 1OH6A 4A6PA 4PZCA 3EW9A 4KPGA 5JG7A 4PC2A 4V0NA 4C4RA 5J5VA 3AKYA 4IIBA 2CXRA 4L4UA 5E6RA 3WYEA 2P40A 2MMCA 2ZI4A 3SHOA 5AKHA 3BZBA 3EVFA 3AL3A 4G1VA 4EENA 5BXYA 4HCJA 4BVKA 1BD3A 2GWRA 1M34B 4C6SA 5CDGA 3GZNB 4U9UA 1DOAA 2APJA 4PC1A 1C9NA 3I34X 4IS2A 2KJQA 1OU4A 2Y93A 4QU9A 4X9XA 4REMA 4RV9A 2PFKA 1S6YA 4DUGA 1A9QA 4CMEC 3QHQA 3K1YA 3NC0C 3HG7A 4BFUA 3U9TA 2FFQA 5CDUA 1GM5A 3STXA 2I91A 4NAHA 4EUKA 4RYDA 5CJ2A 1YGYA 2Z9CA 4MUMA 1BAPA 1E8MA 2QRVA 3HRKA 3Q3IA 4JASB 4Z0NA 1WP4A 4DLZA 2A1TS 2PYIA 5ALVA 1H4VB 5DP1A 4I6EA 2P1DA 3GVPA 4IDFA 1HT1E 4WECA 2E37A 1K2VN 3V8NA 4F4IA 1C7QA 1HDGO 1HOTA 3BQNB 3WHKA 2DLNA 5LQDA 4RMGA 2XYQA 1DT5A 3BXGA 4AICA 1O58A 2ZDHA 1EFKA 1X1RA 4D0NA 5BUQA 4Y7CA 4RLQA 5EJ8A 3K8QA 4KQWA 3L6BA 2O4UX 2YFQA 3AWDA 4IV5A 4QRIA 3ZIDA 3WAJA 4CF7A 1N92A 4PZZA 3BB3A 1X7WB 2EIXA 2O0LA 1AKWA 3OCJA 1SU7A 4NARA 1IY2A 1WHSA 3A70A 3W6NA 1GR0A 1MX1A 1BCRA 5DTQA 3AHHA 4IF4A 5EFOA 5L3RA 3RYTC 1RLMA 3EQ7A 4QEDA 2AR0A 3I3OA 4NS4A 4TTQA 3MWGA 1NNI1 2A1TR 2CFOA 1ANKA 2FN7A 2ZRFA 1SU8A 2AFRA 3K6SA 3FCOA 3P4YA 1J9EA 2FUCA 3BFXA 1JFLA 1QE5A 3H0EA 5ALNA 5DNAA 3W2FA 3W9SA 4BBAA 4CLRB 4DJDC 2V03A 4ZI7A 5CITA 2RGUA 2FOIA 2P79A 2XUZA 1XRSB 1F12A 4M0DA 1JKXA 3IJRA 3HSSA 1MG5A 5BN3B 3M6WA 5FNVB 4C7XA 4Y6LA 3ZQ6A 5IJ0B 2D59A 5K4AA 3EASA 4YRMA 3T0FA 3IVAA 4MHSA 4WHMA 1QWSA 5EMMA 4C4XA 3GPIA 4JZKA 4MCJA 3CRQA 3HBJA 1N3YA 3BCRA 1XNRB 1N2CB 1VLHA 1XQYA 4OGKA 1Y1SA 1QK4A 3OLZA 3F1KA 4MR9A 4O8ZA 2I9KA 2WQ7A 5C1BA 3D1LA 3T4PA 3TZHA 5HFNA 5DM2A 3G85A 1NJGA 2UZ4A 3D3JA 1KKLA 1O7JA 2XRFA 4NE7A 4RV4A 3W3AH 3RRZA 3DMNA 2JGRA 1T5DX 1QYDA 1X3SA 2ZROA 3Q7IA 3ZCUA 5EJ9A 2DBQA 4HZGA 3RS3A 3CVUA 1JNYA 1JUDA 1GGJA 3B1KA 5H70A 5KQMA 1Z7WA 5EUQB 1Y5NA 4CLRA 5F4BA 1M2EA 1LH0A 2WWWA 4H59A 4ER0A 2BE9A 1ZD8A 1YJXA 1VJGA 4MS3A 1KL7A 1PL0A 4NJMA 5JVDF 4PBRA 1IVSA 5TSDA 1WXQA 3H5AA 3PJDA 1FY2A 1KO4A 3OFNA 3BE5A 5EQDA 4A03A 3X1MA 2PAFA 1HMPA 1ATZA 4F72A 1G20B 5FYQA 2F1RA 5CCDA 4BQNA 1E6UA 3DOUA 2B83A 1HKUA 5IS2A 3H04A 2OCPA 3ZTWA 3U61B 1D2AA 4H6WA 2BGKA 3ZW8A 2ZYTX 3D6TB 3EVCA 1NRWA 3NWBA 4KXYA 1F2TA 2G5PA 3C7AA 5BSEA 1BHQ1 1LW6E 2IEZA 3I28A 1E6MA 1NF2A 1RQRA 4HDQB 4OATA 2YQ5A 2RHTA 4N3CA 3QUBA 1N9ZA 3CZPA 3WGHA 2YHAA 2JHPA 1G3UA 4O2AF 2HOQA 2IXGA 4W5HA 5KNLA 3L7KA 1KP9A 2R4TA 1LX6A 2GJAA 1QTNA 5KYUB 2FZEA 2IXFA 3MOGA 3GLVA 1O95A 3IURA 3NBZC 4UAGA 1D6MA 3TRJA 3VSAA 3FSEA 4Y98A 2DUWA 4REOA 1P44A 1DTWA 5L7WA 2XB4A 3OKAA 5G3ZA 4WEQA 4D74A 3GFRA 1N36B 2GKGA 1TEXA 4X20A 2ERXA 3ZV3A 3B6EA 4C7VA 1VLQA 4M8KA 4NATA 2VHCA 4DREA 3GQVA 4RVNA 1ZDMA 3MXOA 4GE3A 3U9SA 3WYDA 1CJSA 1TMGE 2GESA 1PJ2A 2QM0A 2VCYA 3ZX5A 5EWLB 4BQQA 4EB0A 4C07A 1R3UA 4QWMA 3V1MA 1MUUA 5BN5B 3U81A 3X1WA 1LTQA 5AM2A 1YA6A 5CCEA 3JR3A 1B73A 2EQ5A 4KQ9A 1ECGA 4ODIA 1UZAA 2GYYA 3WV5A 2N9UA 2WG0A 3IJPA 4PHCA 4RGVA 1P1CA 3LPCA 3G2IA 3B3GA 3IYLW 2RMKA 2H2FA 3OTOB 3EXAA 4QUJA 3JQGB 7REQA 1E3IA 1KYYA 3CF2A 5FD8A 3KZXA 1GQSA 3DP7A 3DHWC 2IOFK 3IC5A 5FAXA 2IU6A 3H42B 2AG0A 1SUCA 2LIVA 1O87A 2QUJA 3PQ7A 5EJ5A 2PPLA 1K9SA 4CKEB 1HDIA 2R1VB 2XF2A 4HSGA 3IRVA 2Z4SA 4ALKA 3I6ZA 3OTQA 4RD4A 5CJJA 3VZSA 4XA8A 1R0KA 2BFAA 5EXEA 3TCKA 5E7MA 4KLNA 2GCIA 5JEEA 1H0SA 5BN5A 1B00A 3FOEC 3A6PC 3KPWA 4DCUA 1ZL0A 1U94A 5A6SA 5AXDA 2QAGB 4R1UA 4TKUB 3FOWA 1HT0A 3QE0A 4JB2A 3FYDA 3HUTA 1VJCA 3DB2A 1XCMA 5AW8A 3F97A 3LHSA 4EHFA 3I6IA 1XAHA 1AGNA 1I4EB 4S1NA 5DASA 1H0KA 2I2WA 1P1IA 4N3AA 1MMFB 1QORA 2C3MA 4BXOA 4YUZA 3C6MA 2DLCX 1OX5A 4CDRA 4QZVA 3HFJA 4E5VA 4F56A 3CVVA 4FEGA 3H9GA 2YXPX 3EGDA 4DJFC 1T4GA 4X91A 4A2WA 2LVBA 3PXEA 1KQOA 4GRIA 4TZTA 3ZE6A 1L4UA 3SWWA 3G0HA 4WADA 2J4DA 5CG2A 2QAGC 3QPDA 3OQMA 4UDNA 2XKJE 2QL5A 3KR1A 4U9IS 5DCYA 4ZAVA 3O4GA 4YRAA 1DMRA 1OZAA 5K7SA 1PG2A 3OF5A 1SELA 4CCYA 4OHBA 1L5GB 3IAFA 4CF4A 1MU0A 3P26A 2YNMC 3KB1A 2J9RA 2ODPA 3I0NA 1JQLB 3E6AA 4NG5A 1BDHA 2E49A 4LXUA 5JCXA 3GJ8A 5B5SA 1BN7A 1KAHA 2ZUTA 4GI1A 1EB8A 3GA5A 3MRTA 9MHTA 4D5EA 1Y8CA 1BFUA 4ISBA 1GCOA 4BKUA 3TFWA 1NW8A 2WFLA 1NUAA 4BHTA 4D8YA 5K0TA 1EA7A 3FOFC 2YUIA 3C5EA 4LQ4A 3OZRA 1I2DA 3KHKA 4E3WA 3AESA 1GQQA 1UT6A 3BB4A 3LY7A 1HFWA 4GMDA 4E7PA 4H1VA 4QAQA 1RXSA 3DBOB 1P4HA 1ZUNB 3C3PA 2NYAA 4EHIA 4LXTA 1FQWA 1TIPA 3TZKA 1GPLA 4M9CA 4KQ1A 2BKUA 2HQSA 1CS0B 1LFDB 1SUWA 2XMZA 1F51E 2AB0A 3ADPA 3JZMA 4AJNA 4NL4H 4B4UA 4UOQA 2PS0A 1VL2A 4KQIA 3EBPA 1GUFA 1HKHA 4KMOA 2XQIA 3O4RA 3OH8A 4HP8A 2DPHA 4BFWA 2X1HA 1Y3DE 1UDCA 3LQYA 5BW6B 3D7NA 4DDTA 3U16A 4B7CA 4BX2A 2Q3DA 3QIVA 1Z5ZA 4F7DA 3ZGOA 5C4GB 2WYHA 5JMTA 1SQFA 3I01M 1F38A 4F85A 3FTFA 4LX8A 3CT6A 2PSHA 2GPYA 4D2IA 3FCXA 4MR8A 4CV1A 3L6CA 4EYGA 5DBGA 1NULA 2RHLA 3PGKA 3VR2A 3JYOA 1XZDA 1YQ9A 4DCVA 2IIVA 1WKBA 3AJDA 3LLVA 3KSUA 4GUDA 4HVCA 5FTWA 1O3YA 2DKOA 2HBQA 4MW0A 4JYCA 1NQ5A 3NNDA 5E4JA 4LZOA 3F2IA 3D3NA 1W96A 4OXRA 3RK0A 3U3MA 5F2KA 4B3CA 3ADKA 4RDXA 3ABIA 4AJKA 4URXR 3IP7A 4KYUA 5IT0A 1QRSA 4ZHSA 5B58C 3C2QA 1T1EA 2CLEB 3LPLA 4JMLA 1JNXX 2JFOA 1A7JA 2POQX 4KC0A 4HXFB 2AOTB 4W6QA 4DCNA 2OKCA 1M6YA 1HM5A 4UVHA 1C30A 2WP0A 2BGWA 2X3FA 4RFSB 2QQEA 4H16A 2PH3A 4NIMA 4JBIA 4Q9KA 4R83A 2FSVC 1SHUX 1XJQA 4QASA 1L5FA 1TJ5A 4IMJB 1SWWA 4G3XA 4FIDA 4BN5A 3LP5A 3NDIA 1FNMA 2Q62A 5G1OA 3WMGA 4Q4LA 4TPKA 1P17A 3RTEA 1POWA 1SXJE 1E9FA 3GL9A 4IGKA 4QQRA 5FUYA 3V3TA 4C0XA 4DPKA 4UOEA 2FCAA 2HEGA 2C1XA 1EFPA 2XMGA 3FLMA 4M88A 1IZ9A 2X6RA 4KCGA 3UWMA 1HQYE 4LGVA 2GRUA 4UU0A 2X1LA 3A1WA 3AFHA 4U3JA 4DSOA 1DADA 1H8ED 2JIOA 2B4QA 1KDPA 5JMWA 2WB2A 3FG9A 3A3OA 1T9GS 6REQA 2OGUA 5KAMA 2BH9A 3TD2A 2OQ2A 1VECA 5T67A 4C4YA 1H6BA 4MGZR 1OFVA 2NGRA 1BX3A 3GJRA 2VS1A 3NHFA 1DLJA 1NYRA 1QYCA 1VYTA 2IZ6A 1H0HA 2CBZA 2PKRA 2R86A 5EKSA 2BCJQ 1R8YA 1VGVA 4DIUA 2RG7A 2B2CA 4CQMA 1GPUA 3M1IA 2A1UB 1M1XB 5YASA 2GJSA 2ODAA 4RZ2A 4Z4FA 4ACAA 4ZCIA 1JTEA 1I13A 4F6RA 3DMFA 4EAQA 4JCCA 3BAFA 1RYFA 1D1PA 4JJ7A 2W37A 4JUIA 2M6LA 3NTLA 4MWTA 1NQWA 4US2R 3ONEA 5KWEA 1PI3A 2QD5A 3I6MA 1VCMA 4CR7A 1OXUA 2GZAA 3SBXA 1NZJA 4LC9A 1CRLA 5HMLA 4CI9A 2OXTA 1EUYA 2BD0A 1FX1A 1VL8A 1GVNB 2IS1A 1WQ3A 1H4QA 1P81A 2QGZA 1RQPA 4YP7A 4M7RA 3DXZA 5KQGA 3DL0A 3FUWA 4K1XA 1C7ZA 4P0PB 4JLJA 1Z4LA 5H16A 1QX4A 1QZZA 3HB5X 2A0XA 4GXRA 3C7CB 3B1WA 1AKRA 3ZZ1A 1EGAA 1QGYA 1ILWA 4Q3BA 3UJNA 1W36B 1M7BA 4MJ7A 3F6EX 4UEQA 4OKNA 2QBYB 3AEUA 3FM9A 1NUHA 2WHRA 4ITUA 5BQ3A 3H87A 3UGJA 1N3BA 3GGGA 3H6GA 3UMCA 4TWIA 2WYWA 2JJMA 5G0TA 3Q3CA 4OXKA 5IULC 3VPFA 2CDRA 2J3IA 2KQUA 4NE9A 3WJ1A 4FXOA 5JQWA 3NRCA 4P3PA 4N18A 2FEOA 1RI1A 3INGA 5KCZA 3KQNA 2GB4A 1F5SA 2FDXA 1N2JA 3ASUA 4Y2JA 2PFGA 1JAIA 1M2OA 1J07A 2PGNA 4B2LA 1WBJB 4Z8XA 1NIPA 3G0BA 4GSKA 2I55A 5E1DA 4LDPA 2GVDC 3ORYA 4J4BA 1JFFA 4GI2A 4IIEA 4U2DA 2XXJA 3SZGA 4C89A 3H3XA 5I45A 5AQEA 4KPUA 1TD1A 2IEGA 4I4TA 4Y2HA 2IDKA 3LCMA 1Q3TA 5AM4A 5EKUA 1G2PA 1XJ5A 3KJZA 1JHYA 3AOEA 3DZKA 1FP7A 4AN0A 1NE2A 3O8DA 1AZWA 2ROQA 4MEBA 4WOCA 3UENA 1USWA 1RKUA 1KDTA 2BFFB 4OIMA 3ZV7A 4S2UA 4YCAA 1NVMB 4WLEA 1PT5A 2X9VA 2WAYA 3I64A 3KTFA 1KWKA 2B5WA 4JP2A 4BPBA 2I8LA 3MK31 3TL2A 5D51S 1N4AA 4IEEA 4A15A 3DEKA 4C3UA 2B98A 2YN4A 3IXLA 3SG0A 1YDHA 3EUWA 3R7WA 4UVDA 3TUJC 5BORA 4P53A 4R5HA 4HNTA 1OB2A 4GSYA 4COKA 3L0IB 4MYTA 2ZUBA 4L5JA 2IU3A 1VPWA 1JEJA 2VHYA 2HWKA 3KDPA 4J29A 3GD5A 3LVFO 3ENKA 1M1YE 3H2IA 1O94C 3F6CA 5F9FA 2K4MA 4WESA 5I47A 2V5UA 1E3LA 2HRRA 3A05A 3Q72A 3K1ZA 1CZNA 2ONKA 2R00C 3U7QB 2R7LA 4UEOA 1RQ2A 3D8TA 4YV1A 3WA7A 2WE8A 3MMSA 4B74A 5BVGB 1Z5VA 2OY0A 2FG5A 4WZAA 2YBDA 2HF7A 4JUCA 5TX7A 3UOAB 4UAVA 1VB3A 1VBNA 1DJPA 3DAGA 3E2IA 3H1FA 1MJGA 4LYYA 4XUCA 3THXA 3TX6A 1OBVA 3BFKA 4OXYA 1GPMA 2QNIA 2QX6A 5AJHA 5G1NA 3ZLTA 4YJ3F 2P5UA 1K6EA 2BZ0A 2ZVQX 2VQ3A 5KHOC 2FPGB 2G04A 3HKBA 2QMHA 2R7KA 4FWBA 3OPYA 4B6JA 2V7VA 4JHXA 1DCFA 1RM5A 2AH5A 3G88A 3TOXA 1AGYA 1K6JA 4EW2A 4JAVC 4GKBA 1C1DA 1EM8A 1J0XO 3SM9A 4J1QA 2CT8A 1XEXB 3S28A 3GFGA 2EL7A 5KYVA 1ZSVA 1PNRA 1YZGA 4NLLA 3X1KA 1P6QA 2DT8A 2XTJA 4RA6B 3UG7A 3HI4A 3FDFA 3JQ8B 3URMA 4PGAA 2FPWA 1YC5A 1W47A 1PE0A 4JC0A 2V7WA 2RJOA 3MINA 4BCCA 2B6HA 1LU9A 3U7QA 3GLIB 3DLHA 5FLEX 2IVFA 3G2JA 4AKSA 1GV1A 5LQSA 1A3CA 2FQ1A 1DAHA 1ZMOA 2Q0XA 4BFLA 5EI5A 3AQIA 5AUNB 4PNPA 3B5JA 1MNAA 1KYZA 2XNDA 2QMZA 4B6QA 4BRZA 3EWNA 1LDEA 1XCJA 3GARA 1OJ7A 1SM4A 1QSGA 3WNCA 3PENA 3DGFC 5KOJB 3TLGA 2Y1FA 1OQAA 2AX3A 2CZCA 1U04A 1IXKA 3LX8A 3WK5A 3ZE9A 3LKVA 1M8JA 1Q3KA 2IE8A 3CH4B 3KXKA 4GQIA 2WF6A 2ISQA 4D6PA 1RRFA 2CMFA 4BMYA 2PR7A 5KYKA 5LN1A 3IVXA 5KTTA 4XVQA 3RW9A 3CR3C 3K5PA 1ZH6A 2CNBA 1GKLA 4JP3A 4HV4A 3UWPA 1OZ0A 1U0TA 1UANA 3ZHBA 1XZHA 2O2EA 3CRW1 2E85A 1GITA 3Q15C 3NUZA 2P0EA 1UPXA 5FOSA 4C0LA 1D4OA 4FHZA 3K4PA 5CFRA 4CEIB 5K09A 4M0MA 3TQRA 3IQGX 3MINB 1GG2A 3VX3A 3BGIA 1R12A 4R9SA 1VYVA 2C78A 5HTKA 2X9LA 2ILVA 4YAIA 4U7FA 1ZFNA 3EY9A 2DPXA 1JA1A 1P7VA 3AVPA 5IX8A 2R6AA 2ZREA 3R5JA 4IAOA 3QP9A 3YASA 1YKFA 4BGVA 1TAUA 4DMLA 4OTZA 1QKJA 3W2EA 2UZIR 5F9MA 2YVAA 4H7HA 5B7NA 5KMGB 5IDWA 4UM5A 4KOEC 1WPGA 2FJPA 1G7CA 4R1OA 3TVDA 5BUZA 3H8VA 1CD5A 3TM4A 2OR3A 4KQGA 5E1MA 2R6FA 4LYAA 5L3SB 3TQFA 1KORA 4ADSG 4G4SP 1GGKA 4TYWA 1IK6A 2ZJ4A 1YIAA 2ZWPA 4QYMA 4ZD6A 4AO7A 3L7YA 4QJ5A 1GPKA 2H07A 3ZWVA 3HL4A 1Q7CA 3EDOA 4V0MA 4BX8A 3EW7A 2PHZA 4NV3A 1C0EA 4US1R 5I8PA 3B6KA 4A36A 1DBWA 1U8YA 1BDIA 3G23A 4QECA 5HJEA 1Q0TA 2AW3A 1YKSA 5CIYA 4IZHA 1V5WA 2W5UA 3LQ4A 6GPBA 2GTHA 2OENG 3DFMA 1XVAA 3QUTA 5K0ZA 4WV3A 1AXGA 5BMVB 3WG9A 3GIWA 4BBZA 5HGXA 2CD9A 1H93A 2D4HA 4PO1A 4XVHA 4CTNA 1PR3A 2Z5GA 2WSSD 4IDPA 4WKPA 3W6UA 4CLEA 5IDYA 4NOKA 4TQGA 1U7HA 4WLFA 5LYJB 3T9BA 5IKPA 3LCRA 4JI4B 3BJMA 2X5XA 1H2AS 1Y63A 3CVOA 4LY9A 3H05A 4M1WA 5K05A 2ZIXB 3EXHB 4OQ4A 1N7IA 2VZ8A 3KKKA 2SKEA 3TQTA 4HVLA 4RNCA 1AV7A 5CLGA 5ENVA 1JDBB 4P38A 4MS1A 5KOHB 3D3WB 1QIFA 2YS6A 5ITWA 1OMOA 4HEQA 1LSJA 4FYYA 4Q21A 1MBZA 2JJ1A 3LBNA 3IQDB 1BFDA 4IIJF 2H2DA 1HNWB 1CVIA 1W30A 3PHBE 3S2UA 3NHWA 4R41A 3WIUA 2FI1A 2REQA 2B34A 3PFGA 1RAEA 1RMTA 2X19A 3OEED 5CB8A 1RPTA 3ZX4A 1TA0A 1T9ZA 1BSVA 1PR5A 5FOUA 1TXGA 2JJ1D 3FJ1A 4E32A 1SOVA 3V2IA 1ZVVA 1HLPA 4OI2A 4XEHA 4GEKA 3QVTA 3RIGA 1YA4A 1PEYA 2GD1O 4QTZA 3TTYA 4RANA 2VDWB 3AIOA 3BBLA 2F43B 3EXHA 3HY4A 1ML3A 2J46A 4RSHA 3WLLA 4A92A 5KQPA 2HSWA 1DSSG 1UDRA 4JH0A 1XYVA 2BR5A 3HFSA 4NAVA 2XXAB 4KDEA 4I19A 4TV8F 2XQFA 3A3PA 1HDEA 3HEAA 3IEUA 4JWKA 4QLOA 3RFVA 2EGUA 2GM9A 2ZUSA 3NRJA 2VSXA 1SU6A 3A1SA 3V9AA 4YX9A 4O25A 2YXDA 2HYDA 1BXGA 5K0NA 3UW3A 1VMAA 2GF0A 2V5VA 2XB8A 3JYQA 5A9SB 3S68A 4HLDA 2VL7A 1ODJA 1QGZA 2E48A 3B6JA 4FW8A 4HWGA 1FLDA 4QEZA 4RCVA 2ZTMA 3PQ8A 4KV9A 4KXNA 5LP1A 1EFVB 4WOKA 3HV0A 4M6WA 1IE3A 3HNPA 4YP9A 4C30A 1SCJA 1A76A 2Y2VA 2WMNB 1UPBA 4KO1S 2MJLA 4OQZA 4E5NA 2YJZA 4KI7A 1R0BA 3IE1A 3OOEA 4IJ6A 3KCNA 1II8B 4JLUA 3PFIA 3E58A 1SKUA 3B2NA 4OJYA 1X0VA 3EISA 5FEMA 3V2UA 4EQ6A 2E3JA 4NC9A 2G88A 3QXSA 1WD5A 2I54A 2KLHA 1SBQA 3N74A 1KPIA 5KWJA 4R2WA 821PA 4PV7A 2P9BA 2GBPA 5ETJA 5BSKA 4XWGA 1E5XA 3OPNA 1L4NA 3HWX1 4GLFA 4C5AA 1GAEO 2PN1A 1Q6YA 4YRBA 1YVRA 3R6GA 5GJCA 2ZTUA 3VI3B 1TYZA 4DB2A 3PUHA 3DSRA 2PWBA 1E94E 2F8LA 4EZEA 2BELA 4MWSA 1ZJJA 2GBCA 4MYDA 4N82A 4UHDA 4EMTA 4I6JA 3EVTA 4JLWA 1GNLA 3ON5A 4N5MA 1S4MA 4FYKA 1RQLA 3IQEA 1SG6A 2MYTA 5AW6A 4BTLA 3CW2A 4FFSA 3BD6A 2XZPA 4M1ZA 4O4LF 3U6BA 4LMRA 4I50B 4YWJA 5AJWA 2C4TA 3HJBA 4GP7A 1ZD4A 1A88A 2VHWA 1AZSC 1YZQA 1BMQA 3HCEA 3OZFA 4O1MA 4PTLA 3V8MA 2QAGA 5MFPA 1Q0HA 4LE1A 1B43A 3MWDB 4BFCA 4LJ6A 1ACJA 1MIOA 1JKIA 2P91A 2P9EA 2P2SA 1ENYA 4I3GA 1J70A 3Q0EA 4GRDA 3EJWA 4QOEA 5H0IA 5HEKA 3AI1A 3IDQA 1PT7A 2IEIA 2C98A 2NOAA 1GL6A 3ST7A 2PKWA 3KPUA 3UMFA 5LZ4A 4UXJA 4YEDA 1JHVA 2V9ZA 5F3DA 4CMCA 3CRMA 2WM8A 3F46A 4GC9A 4HNSA 1AS2A 4EPXA 3REFA 5IC6A 1EP1B 4Z0HO 1NX9A 2GO1A 3ONDA 3RNOA 2GCNA 1A1VA 2BTOA 2X0JA 5BYBA 3DYIA 5AKIA 1DQRA 3DO6A 3OSZA 1J90A 1CJBA 4P3OA 5HTOA 3H0KA 2ENUA 3I0MA 2M2IA 3OQIA 4FJ0A 1PJLA 1ZGJA 4ILEA 4NESA 4XPIA 3MCWA 4J0GA 3VGJA 5J58A 5K8CA 5C8ZA 3DOIA 4QO8A 3G9UA 3HRIA 2HSGA 2IP1A 2JATA 2OMEA 2QLBA 3U7JA 1KVTA 2WZBA 2ZYGA 4D43A 1EMDA 3BJRA 3CHYA 3CYFA 2R62A 1RP7A 2ZKIA 5DBOA 2PTGA 4Z1MD 1JILA 1CJTC 2HO5A 3HDVA 1EUQA 4H0CA 4RHYA 4AWBA 2PL3A 1H2FA 1TADA 1ZXLA 2J4CA 2OOKA 5D3MB 2NPFA 2HDOA 4IMRA 3WL8A 4FFBB 2MR5A 2HJ9A 4EZIA 3MJCA 4AG5A 5JC1A 1BE8A 4IUCS 2NO1A 3B7PA 1EZZA 4RZHA 1PJBA 3IDFA 5BSTA 1U9JA 2IEYA 3UPTA 1GADO 1QB7A 2ZLBA 4QPCA 3AHDA 2IBTA 3UZUA 1B8PA 4RXUA 5BNIA 4OKIA 1U3WA 2W6JA 3HACA 3LT1A 5M04A 3ENWA 1Y0BA 3MOSA 3LQKA 4HDKB 2HLPA 5JDIC 1GWNA 1UZNA 1GNQA 4YP1A 3TD6A 4Z4EA 3NVDA 3O38A 2VAVA 1J33A 3G59A 4DLTA 4K7JA 2QVGA 4ZOAA 1EXDA 5A3SA 3CBGA 3CLTD 2CXOA 2JIPA 5KTMA 3AVXA 2GCGA 4BO2A 4CU2A 1TYDE 4N76A 3L02A 2PBRA 3BH6A 5BV0A 3QVLA 3JQBC 2J33A 5FA5A 2QVZX 2ZULA 3OMWA 3AR6A 4I1UA 2C2ZA 3RKSA 2XNCA 2O20A 1WEHA 3PIIA 4O4HF 4NBSA 1CEXA 4IH9A 3L7IA 3D6UA 4RL4A 5AXBA 1E0JA 1KH2A 2YINC 4JUAA 1TZJA 2QPTA 1JA9A 4BFSA 1JBEA 3AJ9A 5CA1A 1ECCA 3SZMA 4L5CA 5AIAA 3LPDA 5FTNA 2B9EA 1NT4A 2DLDA 2GAAA 1ST2A 2YMLA 3JU3A 4TKMA 5CX1A 4EEKA 4EUHA 5C5DA 1NJ8A 1JR2A 1A8HA 2DP4E 2W70A 2LWIA 3ZU3A 1MQSA 3S1SA 4AQDA 1JEYB 3PEWA 4CODB 4QUGA 5A06A 2G17A 1GQOA 3IP8A 3KOZA 4COOA 3UAGA 3T3NA 4M37A 3Q5EA 4KWIA 1Q84A 3EVBA 3SAJA 3ANYB 1YUBA 1KQ3A 3C41J 3RUDA 2FDCA 3W4KA 5A1TA 2H11A 1DUSA 2A88A 3DLCA 1NZFA 1XDGA 2WVJA 4H27A 4BVEA 4WKGA 3PDIB 2EHJA 4RD0A 1Z3IX 3B5EA 4L85A 3ORQA 1NBIA 4RPCA 1T0BA 2RC5A 3O1IC 4E31A 1ORTA 4UFNA 3IXQA 1W75A 5DWDA 3QF4B 2IHZA 3DLTA 2QTZA 3BK7A 3L1JA 1JEOA 2M6SA 2PK3A 4RVOA 1Q0LA 3FB1A 3MAGA 2C54A 1PL6A 1YR3A 7YASA 3UMMA 5L6LB 4P34A 3KBOA 3B51X 1EK6A 3AR7A 1TE2A 4K26A 1UP6A 3A6EA 3AYXB 1RYNA 2HMVA 2IX9A 2IZ1A 3JAWB 1UJ2A 3GP8A 5E3HA 1T6ZA 1G66A 4KZKA 4XX0A 1XC7A 2WUVA 3SQXA 2R8OA 5EHZA 4CCSA 4E30A 4YRSA 4XR4A 2C3OA 1GDDA 4CIAA 2ATXA 1U3VA 8GPBA 2G9ZA 3AUUA 4YMHA 1Y4AE 3LIPA 1J8QA 5FPHA 3PQCA 2IODA 1IYZA 2XNJA 3U7RA 3VAZA 4R1MA 1VL6A 4C4AA 1B74A 2V6FA 4C0HA 3GEPA 1KH3A 3FUCA 4IS3A 2NU8B 4AYTA 2O8DB 2P0YA 1GFIA 2QROA 5BW5A 3N5CA 3JZIA 3ADDA 4UMFA 4D79A 3RYHB 4IIDA 4QYXA 1ZHFA 3LBFA 2DBVO 4RVSA 5GIOE 4MVCA 1F8FA 4L07A 4PO3X 3GJ3A 1QHYA 5E1OA 2BTEA 5C4MA 3LWZA 4C7OB 4Q6WA 4AMBA 1WO8A 4NPHA 1BA2A 1Q3HA 5BOSB 1XIVA 5TQJA 3H9QA 4OSOA 1U3FA 4A82A 1KFJB 2II6A 3AI7A 2W6NA 3CNHA 3QOFA 2HJWA 2V7UA 4A0RA 2P4HX 1KK0A 1V8FA 3HBNA 3IAUA 4KWCA 1Z4MA 1WPRA 2YFKA 4K0KB 2M1ZA 1IOLA 4M8SA 2HGSA 4NDNE 3GUZA 1CUJA 1OKKA 3N2IA 3RBVA 3RHZA 1FQJA 3WLHA 1RWPA 4F4JA 2JCGA 1TX4B 3MUNA 4X7MA 1WZEA 2IV7A 3ADCA 1T3HA 3NCHA 2F17A 1AM4D 1HI9A 2P4EA 3P2MA 2I6SA 1PSWA 3ICVA 4JLNA 4PLCA 5FBLB 2WSYB 4YAKA 2ZRLA 2C7PA 5CH5A 1C0PA 3PF8A 4YC7A 4R8LA 5LQMA 4NU5A 5G53C 4JLAA 1QVZA 2W6PA 2HWUA 1HSZA 2IQIA 1ZNXA 1WY5A 4YK7A 4ERNA 2IS4A 2QUHA 2V4UA 3ACCA 2QORA 3E84A 2ZI7A 3UAVA 2SNIE 3AY7A 3WL4A 1ZAYA 2JFGA 4DLRA 3FPJA 2GD2A 1D6JA 4F45A 4ZICA 3LSTA 4CR6A 3BTOA 5F12A 2HYIC 3EAFA 1NI5A 1S89A 2E18A 2Z2KA 5CPBA 5ANRB 1K89A 4BQIA 3H4MA 4LGMA 4D4KA 4HTFB 4B8YA 1G18A 4Z4GA 2A58A 1JYEA 2DFVA 5BVHA 4TV9F 5GTDA 3L46A 5EP4A 2W6QA 1QK5A 2FOXA 1N6LA 2PLNA 3AUAA 4CLOA 1L5WA 4OQMA 4Q3CA 4CKCB 1Q2XA 1ZSYA 3GNLA 4WCVA 2EFCB 3VRHA 2ZUCA 1HDCA 1W88B 1GCAA 4IVRA 3TTUA 5FEUA 4RE5A 5DCLA 4JJAA 1QJ4A 3TAUA 2C4MA 3CUTA 4KK4A 1KFEB 1Z75A 4NICA 4OI0A 1LA2A 1L8AA 1WDLA 2HSJA 3LZ6A 3HHEA 3M83A 4TTIA 2ZRPA 3CH5A 4UE3S 3WY9A 5GJWC 2ZJ3A 4FLFA 3TLEA 1E9EA 3BGSA 4HMPA 5EC8A 1N77A 4BLVA 3CPEA 5A4IS 3J81k 1RWKA 1HFJA 4DAEA 4BATA 5LYJF 1XAJA 4L4RA 4X71A 4BPRA 4DCCA 1HH4A 1Z56C 2RJNA 2PCJA 1EG2A 3K15A 1Z4KA 2Q6OA 2DFDA 2C29D 4RVFA 4XQEA 3BH7A 3F6RA 1ZJYA 4LJKA 3EN0A 5F3WB 4UTNA 4A8PA 1JR3A 1Q15A 2AD1A 3MSCA 5AK0A 4DZTA 3V8EA 1CZUA 3RS4A 2XAAA 1B3RA 1KY4A 3CXUA 1SKYB 4RMHA 5CK5A 2CSXA 3FF1A 2C94A 4PQGA 2QZSA 3SHQA 5C8DA 2FPLA 1AGXA 3OA0A 3MJTA 4C0JA 1YRQA 1EQAA 1UL1X 1SBIA 2ZIAA 4MVXA 1YQWA 1X1QA 5DEIA 4QSHA 1NWCA 4M21A 1IVYA 2ZRBA 3FZNA 4R9UC 3SJZA 1EM8B 3CRZA 1ISIA 5K3SA 3ELBA 2XB2A 3HHPA 2Q5IA 4DFDA 5IKEA 3HLKA 3QPAA 1K5PA 2AOXA 2JGFA 3PFKA 4B4WA 1JAXA 1JB9A 1XXHA 2PZGA 2IA5A 2QW1A 3DC7A 3IT0A 1L4BA 3JD3A 1MX3A 1JF8A 4S1OA 4YO8A 2QYHA 1AXEA 2WIAA 3BFJA 3EVDA 1ZAKA 4P2GA 4F8EA 1T2NA 3NFRA 3QPCA 3RARA 3HCWA 1ZUWA 3EHEA 3W5CA 3A04A 4S12A 2CK3D 3HJGA 2D7JA 2EL9A 2R85A 4GI3A 3I5AA 1XNJA 2QG9A 1QO9A 1M5UA 3NDRA 3BOSA 3NNNA 3PZRA 5IKXA 2OM2A 4DMKA 5HKOA 4CIVA 5TB5A 2RE8A 3O47A 5EZQA 1IXSB 4YI3A 2VUUA 1T0HB 4OYHA 4RPLA 1GUDA 3DQPA 2VCEA 2H2AA 3M3PA 4YALA 4ZV4A 2HX1A 1NGSA 1V4NA 3EVNA 1OU0A 4GPD1 2XMQA 3GOQA 2ZJ5A 4BNWA 5I7WA 1Z5NA 1WB9A 4Y6OA 2NV6A 1Y3IA 3FPGA 3EOAI 3K0BA 4PX3A 1F8YA 4W8HA 3IO3A 1DEAA 3CWCA 5F4ZA 2VHUA 4WK0B 4D81A 2VF8A 3O0TA 3EFHA 3IEKA 1E1RA 2KLBA 4AZ0B 1H3FA 2GEVA 2OGZA 4K9OA 1Z7GA 1OV6A 2QTMA 4GPEA 3K70B 1YJ5A 1AKNA 2H7VA 1W5EA 2MYPA 4HDRA 4X45A 4PLVA 3G8CA 1M8GA 3FBTA 1NQAO 3CUWA 1WA5A 2PZFA 3K8ZA 1QCYA 4DIFA 4Z99A 5KKCA 3B5IA 4HWSA 2XMBA 4KYIB 2DUNA 3I8OA 4XDYA 4LJ7A 4DG8A 1XLWA 4RJKA 3Q8WA 2FX2A 2BRUA 2GJ9A 3UMJA 1JVNA 4D9HA 1DRWA 1R10A 2XUOA 3VA7A 1D5CA 4PX9A 1WAMA 3FKSD 1V4BA 3QNUA 3UT5B 1UH5A 3RJ9A 3AYZB 1F6DA 1M0EA 2ONZA 2QE6A 3NV9A 4KQJA 4CIDA 4NENA 4PIPA 4H6PA 1WTAA 3KQWA 1CUXA 1NC3A 1F5NA 4NOMA 3V1NA 4RTQA 2EKDA 3QVXA 1W52X 4KTVE 5DGIA 2V7QD 3EQ9A 3GEGA 3WNZA 4XCVA 1VM6A 4LDAA 3ZWPA 3KYIB 1J1IA 3OJCA 3K96A 4I9HA 4PXAA 4ALLA 3T06B 3UNXA 1DWUA 3M6XA 1VPEA 3RIYA 3HGQA 3LRXA 4HDRB 4QXRA 5BNZA 2X0NA 2RHRA 4IJMA 5AI0A 3I2HA 5DISB 4JP1A 1NBEA 1RI4A 5B6IA 3UAYA 2QXYA 2YV3A 4G85A 2P41A 1P4RA 2XTMA 3JATB 2IUUA 1O97C 5HWSA 1YXMA 4CN9A 2OE2A 2FUKA 4LDRA 1ONOA 4KITB 4F04A 2M6KA 3O8OB 4I6GA 4EGCB 2SECE 3I1FA 4WBSA 3P4UA 4M1YA 2ZB4A 1N2HA 4JROA 5AHWA 4Y2UA 1SCIA 2BM9A 2HSZA 3MJRA 1HE4A 1T2CA 2ZIXA 3F4KA 2YJGA 3RKUA 1U9CA 2SHKA 3ZJVA 5ICCA 1XXLA 2G5GX 1JQJC 2RHJA 4YYEA 5HK8A 4BVAA 1IBMB 3PQ6A 4JU8A 1TF7A 3L4SO 4V0SA 1EAYA 2G80A 3S27A 2FMTA 1N6OA 4DXDA 3HN2A 3B7GA 3BA1A 1NBMD 5K3BA 2XUJA 3Q7PA 1UXOA 2CDNA 1UC4B 3V4RA 1VRCA 2WD7A 4PEVA 5B3KA 2AI3A 2CDAA 3WFIA 1OI2A 5IJAA 5KNBH 2NVUB 3LKBA 3TE6A 3TTTA 3ZBTA 1WBBA 1IG3A 2C00A 2C2MA 5CDFE 5IJ9A 4BY9E 3UWOA 1U1FA 2AEMA 1T10A 2ZBGA 1AG9A 2ZATA 1YDEA 3IOMA 2UAGA 3L0PA 3M5WA 4P6VF 4ZCMA 1W36C 16PKA 1RIFA 1XKLA 4M53A 4ALIA 1Z63A 2EFJA 1DAOA 3QUCA 3VVLA 4Q5IA 4KO2S 2UZ3A 3DHEA 4LQLA 2NUAB 1R74A 4BEWA 1GNRA 3LMKA 1L4YA 2HMWA 5C5IA 2D1YA 4I1RA 4ALJA 3A14A 2CVOA 3E7FA 3NXSA 4WACA 1THTA 1TTQB 3KPVA 5AVOA 5A6VA 3GRZA 3OOYA 1ULUA 3MTEA 1VL0A 2CL6X 1LNZA 5BMVF 4YQYA 4FBGA 1E77A 2XKAA 4H1WA 3PX3A 1G6HA 1ISHA 2VBIA 2LZ0A 4M46A 3TOCA 4DA4A 2F55A 5C1PA 4HQOA 1XDUA 3EWIA 3HP7A 4XQGA 3W6PA 2GF2A 2OVFA 4D3ZA 2VOJA 2NXCA 1AN9A 2FEKA 4NCBA 1RBYA 1EFVA 1RPAA 2WVHA 3B70A 3HO6A 3HA5A 3M70A 4H0NA 3SHFA 4E13A 4OOFA 5G0VA 2F8MA 1R6XA 3ND7A 3VPDA 1GRRA 5EHNA 2KSQA 4RD3A 3QYAA 1AQ6A 2JKYA 2CEKA 3DBIA 5AOVA 3TW8B 1RP1A 5JFOA 5EJ4A 1SA0A 1WF3A 5CH8A 2JFBA 2ORIA 4IVPA 2Z5LA 5T3UA 2KYRA 1P4AA 4UTRA 3HUDA 3LC1O 4HQRA 3SLKA 3U4GA 3VR5D 1N7GA 5P21A 4DC0A 4F1KA 1BEEA 2C57A 4HPJB 1EIZA 2WFMA 4WN9B 3W5VA 2G7MC 1ZSNA 2V45A 3ZQ4A 4NEHB 5JV5A 5TVKA 3ZGLA 2C77A 4Z9YA 1FP4B 2YW9A 1L7AA 4XM2A 3PFNA 2XADA 1YNOA 3SS8A 1RRKA 1Y9AA 3UM9A 2HMTA 5DFAA 3PPYA 1RPJA 3PKJA 2H9AA 4BQSA 1BJRE 1QVVA 1SBCA 4GZ5A 4KQ2A 3DO8A 1PIWA 4M0FA 1RYYA 4GNRA 2FVYA 3RV3A 4L5YA 4HGPA 2PXXA 3ZV4A 5C32A 3SQWA 1F1JA 4INAA 4RD2A 2ZPTX 2VDUE 3ENZA 4E12A 4MEAA 2WZQA 1UBKS 3WKEA 1KXJA 2YN0A 4ENWA 3BERA 3FYTA 3R7FA 3NH9A 4Z2AA 2MDTA 3L7AA 3DR5A 3V1KA 1CTQA 4YQFA 2EEZA 5K0CA 4ER6A 1VKHA 1RXYA 3N3AC 3PWTA 3FVRA 4O5OA 4LY6A 1KO8A 3ITEA 5JLJA 5KWSA 1SC4A 4K6HA 3LGSA 4YV7A 1KNQA 5HR5A 4YQEA 1U1CA 1NF8A 2XGMA 3PFWO 2JCBA 2VP6A 1ZNYA 4Q24A 4OU4A 4U8GA 1PZHA 2ZYWX 1U8AA 2VRCA 3OURA 4FJ2A 4AS2A 3VHXA 1S7CA 3M34A 3MWDA 4ND8A 1NR7A 3WRXC 1C2YA 5ED0A 1T2AA 2GILA 1WCYA 4KU4A 1DGQA 1O6ZA 2BFCB 3K16A 4QQFA 1H3EA 2WP8J 2XCLA 1H23A 5EVCA 1NRIA 4DCJA 2QUAA 3GLTA 1AUPA 3CEPB 3AH8A 2V6GA 1WE2A 2AE1A 3QEBZ 1QMGA 4DOMA 3F98A 4JYBA 1T34A 1ZK0A 2ISSD 5TE9A 4A0HA 3ZBUA 2REBA 5TS3A 4FFLA 1MB0A 5TQ2B 1YB4A 3SF8A 3ZY4A 4YRCA 5I4BA 1YV9A 3W8DA 1H85A 3CLRD 3HMQA 1ZD3A 2FZCA 2ID4A 3F5DA 1N8SA 2VPZA 4EJSA 1A82A 1DTSA 2GYVA 1SC1A 3BFPA 1V5FA 3IBYA 5IHPA 4FEEA 4TKVB 1DWOA 3G7UA 4I5EA 1Z4PX 4WVLA 5E7IA 3S8MA 4NQRA 3TB6A 1XRLA 3EOZA 2K6GA 4ROSA 4IJQA 3C6BA 3GLHE 1ZIDA 4PRZA 2RH4A 4R68A 4KFCA 3R2JA 4Z5XA 1KHTA 4L28A 2Q9BA 1WMBA 3NJ4A 1JFSA 3E7DA 1YI0A 2QD2A 1DO0A 5AM3A 3KOMA 2E4XA 3FE2A 2BEWB 4N49A 5ARCA 2P3LA 5MHTA 3ESAA 5BW4A 4RHEA 1XCOA 3AUTA 3GVHA 4ZOBA 1Z13A 4PC7A 3DBHA 4BO1A 1G64A 2OCKA 2EF0A 1Y8QB 1R64A 1WMEA 4ND6A 1U2ZA 2I80A 3V8PA 3SF8B 2PZKA 4P3YA 3W2IA 3KQKA 3PR1A 1ULHA 3FNQA 3NPMA 4FR2A 3UICA 2AEJA 5IF3A 3KEQA 2A9KA 4DQDA 1R16A 4JI0B 1PZXA 4BNNA 3T3IA 4BE9A 3E4CA 3P9YA 4EO4A 4O2BF 2ZVDA 1P9WA 4TKVA 2IK8A 4ZVPA 2AUNA 4G07A 3E05A 2PSDA 2TSYB 3C5WP 3VH1A 4Z3DA 4F5DA 2YWGA 1VB5A 4ENVA 2H1SA 1UM9B 1IFXA 1QAQA 1P91A 2PX5A 4KKVA 4MQ5A 4YP6A 3ZDZB 1MOSA 1WABA 5K1ZA 3T9DA 3MHPA 4NMWA 5EMJA 2WSBA 1QR2A 2OAGA 5EJ2A 3FNGA 4WXMA 4DRXB 1Z88A 4W9NC 4NFYA 1SC3A 3FUUA 5CT6A 1WNFA 3VPAA 2B1RA 1XE3A 5GINE 3U44A 4ZJZA 5HKBA 3EGEA 3OIGA 2H1VA 1NJ5A 1O6GA 4ON9A 2NZWA 1I2AA 4UNQA 4D1YA 2ASEA 3KKQA 4KAXA 3W5DA 1JQ5A 3I6YA 521PA 2J3LA 1Z0KA 2I4OA 3RLIA 1O6BA 1OIVA 3IPXA 3NBUA 2O4CA 2WJAA 4JDUA 2IHBA 2O5CA 3ELDA 1N3LA 2B7LA 3UH1A 3W3ZB 3DF7A 1V5EA 2FPXA 3D1VA 4WZ6A 1WV0A 2JK0A 2C61A 3OFJA 4GO1A 4RDIA 3ZGNA 1JDBC 2RI1A 4C4PA 4ZA2A 2VPTA 3AOGA 1TMYA 4D26A 1V4VA 2AJ8A 1KI2A 4J0DA 4RVHA 5EXSA 4MW2A 4R3NA 1ESNA 3ENVA 4R2JA 3H65A 4Z7OB 1G63A 3FMPB 3THSA 2AN4A 3K92A 4ZRMA 5G4LA 5CAEB 3WGIA 4HQ0A 3LRPA 2A8YA 1OZGA 3GFQA 4C0BA 2RAVA 3ZS9A 4HATA 1VYUA 2GA8A 1BOFA 1RMQA 3IHKA 1YRBA 4MKZA 4RVDA 2BBWA 4U7WA 3OLCX 4OHPA 4KUEA 4HDMB 1SVNA 1Y1PA 1CRZA 2Q5EA 4TVSA 5CGQB 3D4IA 4Q7LA 3EZ9A 3JZDA 3K1AB 3BMNA 4P58A 7ADHA 4RK0A 4Q7MB 5BV8A 2Q27A 3GMIA 3AOEC 4FD3A 1NVKA 1XTKA 1HGXA 2WU0A 5E95A 1PW7A 1LVUA 1QV9A 1T15A 3KKZA 3PIRA 1YBHA 2IHTA 2P6PA 3AHGA 3M6UA 3QLVA 4FZJA 3WJ2A 2IGTA 2KM1A 1UM8A 3L7JA 4M1OA 2YXBA 3K05A 13PKA 3WRVA 3GHYA 3UKOA 4BWVA 3N8GA 5E2BA 3TLMA 4UJ3A 2HMSA 3R23A 3CR8A 4FU0A 5IFLA 4NABA 1I3OA 3HCDA 4LMPA 3QUQA 4X5OA 4EA7A 4IQ0A 2WLSA 1MIHA 1S2DA 2A6PA 3GP5A 3R0VA 7GPBA 1GKYA 3THWA 5G4KA 2F59A 1CETA 1XROA 4ZVMA 4DLKA 2QM3A 4TMZA 3KFVA 5CG1A 5KNDH 4ZXFA 3SM3A 3WS7A 5JYEA 2P9FA 3CA8A 3CJRA 4K03A 3DFZA 2LTAA 5FFMA 1P0FA 2D3WA 4AWXA 4BCDA 3IERA 4RTSA 1JALA 2JVJA 2W6OA 3KQVA 4OGFA 2QP3A 3A26A 4HNQA 1V7PC 2XMRA 1R8SA 2H31A 1PR9A 2ZETA 1J2TA 4FZ3A 4MUIA 2OHXA 4DIBA 1E0DA 1P3JA 4MYUA 5CFPA 2WABA 4OK6A 3E5MA 4DCGA 1TA4A 2OCAA 5JHHB 1VI2A 5KU7A 2TYSB 5TXGA 1XF1A 3ZDQA 3QXJA 4TS3A 3C8DA 1UK7A 1K6XA 1MJNA 4PYLA 4IX9A 3GN2A 3G6WA 1NF9A 1PVDA 2GCOA 4R2HA 1XCBA 2CLDX 3GLSA 2CHQA 4AIRA 1P9NA 3A4TA 3TSZA 4EK9A 1PGNA 3Q8XB 3RVJA 3BG5A 4ARSA 3E5HA 3U0BA 3ZJYA 4FFOA 1JHMA 1K0FA 4MI3A 1TNDA 3EYAA 4AJJA 2PT5A 4LOLA 4YT5A 1LQTA 2D00A 1NBHA 1YMUA 3JQRA 3RC1A 3SZOA 3WQSB 4EY7A 4IJWA 1VRVA 3O9MA 2H1OA 5AOCA 3IDAA 1KE2A 1KJ8A 5KX5F 1E1MA 4AY4A 3AF2A 4RHCA 3KTAB 2YVUA 3LPAA 3SK0A 4A23A 1TZ2A 4KX5A 2NZYA 4R40A 2ZIUB 4AMVA 5F23A 4P32A 4F6CA 4YASA 4NZ9A 2G3YA 2QVCA 5BVHB 1M66A 5J3JA 2QTHA 3IP9A 4ZDJA 5DX8A 3K6SB 2X4IA 4OSEA 2E4VA 5FBWB 1XD2B 3L8MA 1W49A 3D3KA 5FL7D 1BRMA 2OD2A 3GEDA 4PLGA 3UATA 3U4MA 3ILVA 4X84A 5ALRA 3T7DA 5BN3A 1YGPA 1S9HA 2PIDA 1YBFA 5FBHA 2XY4A 3EVAA 3ZDAA 1GTL1 3DKPA 1TYEB 2XOKA 3VTKA 4EPTA 4FUTA 5J4LA 1UZMA 4XLTA 1L5SA 1M2HA 1SXJD 3IAEA 3PI6A 2LR0A 1Z06A 1PT8A 3SLRA 2VSQA 4UNSA 3UWSA 1NZDA 3IAS1 3WLJA 2ZJ6A 3OCCA 4C3OB 2QGNA 1MP0A 3T0GA 1Z0JA 3SIWA 4PFKA 1R50A 3ANXA 1GXSA 3TW4A 5B7PA 1EWRA 3DEIA 4AUKA 4XJSA 3SYKA 3FOZA 3OZTA 5CCBA 2EX1A 2O0HA 2VPXA 2QX7A 3TXXA 3OIDA 4YA6A 1DKMA 1S3GA 2HA5A 3KT0A 1FSGA 4BX0A 3A6LA 2R8ZA 1GG5A 5HE8A 5C8YB 3SICE 4JXJA 5IM4A 2PZ8A 3E9RA 1TQ2A 2YHIA 4ZYTA 3W5IA 1D2HA 1HQCA 1HQKA 1VA4A 3DDOA 4JS0A 1GTJ1 2GPBA 1OXTA 2B8TA 1GD1O 2R751 4JLSA 4E5DA 3P94A 4DSAA 2X7HA 4U2FA 3VKGA 2ZR9A 1PHRA 5DN6D 1UZLA 4EA6A 2P3OA 3CX3A 1V8DA 2RI0A 2LUOA 1TEHA 3RT1A 2GARA 1PQPA 2F3RA 1ISMA 2A1IA 3WK9A 4C9BA 3PNYA 1K4YA 1FUYB 3ZC3A 1N1EA 3G2LA 4HUQB 2J0UA 1M3SA 3GI1A 1GQRA 2GUGA 4P9NA 1Z8NA 4D8XA 1DG1G 1BXRB 1NJ1A 1Z0SA 5JQGF 1XA3A 3ZW9A 4ECAA 3HB4X 1FFEA 4TMYA 1TDJA 3CNOA 3LUAA 3ZOZA 1NFQA 3W7BA 4PHFA 1ULSA 3ZQKA 1IM2A 5THXA 3ZHRA 2PRYA 2YDYA 1GA6A 2I2BA 3QWHA 4KL8S 4QODA 4R16A 3KQQA 4QUBA 1S2OA 4XDZA 3V4FA 2AOWA 4AZ3A 2HZ7A 3W5UA 2YHIB 5GONB 2QT9A 3L1KA 3G7SA 2NSHA 4MIOA 3PXCX 5JROA 1NASA 2E5WA 5REQB 5HNKA 2X7JA 5GY7A 3G17A 1DIRA 3F3MA 2B6NA 2C92A 1WOMA 2HBZA 3L7LA 3OIVA 4I2VA 1NXTA 4M2LA 2VA9A 1ZJ4A 4HDNB 1EP3B 2LKCA 5CB0A 1KPHA 1MN6A 2NT3A 3U3XA 2CYBA 4HLUC 4AJPA 4CUKA 2W98A 3EXEB 3ILXA 4IQ8A 4QPDA 4OHWA 1QNFA 2PZJA 3EMBA 3IBSA 1NLUA 1U28A 2X0EA 3LUFA 4NQZA 1QNLA 2ZANA 1UUFA 3HFRA 3HMKA 4YT4A 4PSDA 1G17A 3QVGB 4CV3A 4PS0A 1LVGA 3E9MA 2R8YA 3FLAA 4TV8B 4ZOQI 2LW7A 1ZUD1 3AIMA 2FW6A 2IPAB 3V7YA 5M7EA 4MULA 3BQ9A 1KZ6A 3H2JA 1KEEA 1TTTA 4CDNA 1E0SA 4FC7A 3WBKA 4CKEA 1S8OA 4P3NA 1Q7BA 4Q4JA 1FJ2A 1H2BA 4NJEA 3TO5A 3HXQA 3UK2A 3RT7A 5AVSA 2AXPA 1C0KA 4C88A 1YZVA 3PI7A 1CV2A 2CJPA 1XZEA 5AOAA 1RI3A 4L8WB 2QNRA 2G4VA 2MYUA 3JCZA 4WY2A 4M60A 3ZZUA 2HRBA 3MIIA 4HH4A 4NCJA 5LBIA 1XTQA 2Z1NA 4N0PA 5C80A 1YR9A 2DKNA 2YY5A 5JVDA 4MQ6A 2ZAYA 5L7TA 4B17A 1B0ZA 3AXSA 4XSHA 4EB6B 1NOKA 1P4GA 2PKQO 2XEXA 3W34A 2G9VA 3SHTA 4W6ZA 3AL0C 3I4LA 1PT6A 2BUCA 3DNFA 4NWIA 2BT4A 2OYSA 4L0DA 1N32B 3HEMA 1K5HA 4QTUB 3ZHOA 5KNCA 2WM3A 1JYSA 1NKSA 3NWPA 4OXXA 3WBBA 1FQOA 1PUIA 4XE5A 4HNVA 5KDLA 3WJ7A 3BCSA 3L4JA 1FYVA 5FWYA 4DDWA 4PYKA 1NM5A 1Z73A 4URWR 4QHSA 1JJ7A 5ERGB 3WB9A 1SCBA 3GPLA 1XHEA 3ITDA 4TTJA 1T29A 1J2UA 3F4BA 4CT5A 1Y6ZA 1U0HC 2JAWA 3WLNA 2VVTA 4ZOLF 3LCCA 2YWJA 1QHHB 3WGZA 3A8TA 3PL1A 3UF0A 3TM5A 3TB4A 3P96A 1OWMA 5FUBA 2RH8A 3S40A 4C22A 2BEUB 2WMDA 1C1XB 2CFIA 1LSUA 4BGEA 4Q7QA 1T35A 5BV1A 3RUPA 1GT91 2HQRA 2Q3BA 3L7CA 1T3GA 3BRCA 1C1YA 4G5XA 3RODA 2R47A 2OXEA 1MV8A 3LX4A 2B35A 1XWWA 3MGAA 3D8RA 1VI5A 4EKEA 5KYXA 1F6WA 4W7SA 1BHJA 1YE3A 4RHUA 1B14A 1JH9A 1XRPA 1ZKDA 2XWSA 3CO0S 5H5JA 1M73E 3PRHA 4JOQA 4UNPA 4B73A 3QK7A 4HG2A 3ZK9A 2OV8A 1T9GR 2XE4A 2H1RA 1WUKS 1TU0A 4EM6A 1GZHB 1I4DD 2GZ3A 2B8WA 3QX9A 5KHAA 4R0MA 1UAGA 2QD1A 2PKYX 1TJNA 3QU7A 3MNFA 2FP4A 1DNPA 3ES9A 3CWZA 4LI0A 2A5JA 3FYUB 4QD3A 3LRTA 3ZWMA 5L6MB 2G4LA 3GPCA 5EXXA 4UFPA 3RFFA 2ODTX 1TZKA 5FP0A 3RVLA 4ZJUA 4G0XA 5HJ7A 4UHJA 3M9LA 1Q0SA 2BEUA 3I83A 2MINA 3DDNA 5CNIA 5JDCC 3AV0B 4U6QA 1HYQA 5CLFA 1A4IA 3VJMA 1VJRA 3A9UA 3CKKA 2EIHA 2PCLA 3EDYA 4M8IA 4AF8A 1UAYA 1VHQA 4K46A 1OZFA 2AG5A 1IZ7A 5AW2A 3SR0A 5KYXB 3L5OA 4O1IA 4O2BA 5FF9A 3TBHA 1XZKA 5ALEA 4DCPA 3QPBA 5JBNA 1RHKA 1LWOA 4YIKA 3IL2A 3P5BA 3FROA 4DWWA 4JOBA 3FSGD 4LTNA 3QFFA 1XSEA 5IW8A 4A6EA 2QRHA 1XMOB 1O2DA 1YC2A 3CVYA 1S0UA 1SA0B 5ALHA 4X7BA 2AKEA 4FD2A 5DXAA 2Z2YA 5LQCA 1YIOA 4EVQA 3QI7A 4E3ZA 2ASVA 4IWNA 5JAZA 2MSDB 2AN9A 1KZ1A 3CVJA 1XTPA 4HX2A 3SHVA 2PL9A 2Z98A 1GDTA 5BQFA 3PB3A 5B4TA 1PEAA 1GL7A 4J16C 4OQDA 5K0FA 3UJAA 1U4OA 3IEMA 3N0XA 5LB4A 1AKEA 1X0XA 2XSZD 4ZKEA 5THQA 4QICA 2AKYA 3DUFA 3BMXA 2WJ6A 2QMUA 4V24A 4XGNA 4I46A 2VO1A 5AKYA 4YY3B 4DZRA 3PRJA 4NS1A 5DGXA 3KCQA 2XEDA 3V48A 4BMCA 2XRZA 1MAWA 5DOZA 4ARUA 3GWGA 1N57A 3R7SA