1G2SA

Solution structure of eotaxin-3
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
71
structure length
71
Chain Sequence
TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EOTAXIN-3
publication title NMR solution structure and backbone dynamics of the CC chemokine eotaxin-3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 8
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2000-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1g2sA00
2FINB 3D6WA 2B2UA 3ONAB 1CA5A 2B2UC 1U4LA 2X69A 3TN2A 2N88A 2FHTA 1AZQA 4XT3B 5CBEE 4RA8A 1WTWA 4OIKA 4RWSC 1EOTA 1U4MA 3FDTA 3Q6SA 4NW2A 2HDMA 4UAIA 1BF4A 2FMMA 1G6ZA 3DEPA 1PFMA 2RSOA 1VMCA 1LV9A 3H91A 2KUMA 1RHPA 2DY7A 2L11A 5D65A 1MSHA 1JE4A 1HFNA 4IUTA 3R93A 5JJZA 2K04A 1EL0A 4CJ1B 4CJ2C 2M2LA 1KNAA 1RODA 2B2TA 1QG7A 2KEEA 5AFWA 2B2TC 2EOTA 4DN4M 4ZLTF 1CA6A 3TZDA 5COYA 1BNZA 1NAPA 4LMQD 1WTVA 3I3CA 4HCSA 1NR4A 1F9QA 2RA4A 3KUPA 4MHEA 2Q8TA 2KECA 3QO2A 1U4RA 2NYZD 2R3ZA 2X6LA 2XIWA 4IUPA 2FFKB 2IL8A 3GV3A 4QUCA 1WVLA 1DZ1A 1G2TA 2H1EA 3MTSA 1SDFA 2SDFA 3UI2A 5EQ0A 4ZKCB 1M8AA 1O7ZA 2B2YA 2L1BA 4X3KA 2B2YC 2K28A 3FPUB 3HP3A 3DEOA 5DNFA 4ZK9B 2NWGA 1WTOA 1O7YA 5CORA 1EQTA 5E4WC 2JYOA 4IURA 1X3PA 3IFDA 5EPLA 1G2SA 1ML0D 1AZPA 1HA6A 4XT1B 1BBXC 1U4PA 4ZAIA 1HUMA 1NR2A 1IL8A 5EPJA 1C8CA 1F9PA 1GUWA 4MN3A 3MWYW 4ZKBB 1WTQA 2X6GA 1IKMA 2CVRA 1WD0A 1F2LA 1WTRA 1IKLA 2KOLA 1B50A 2L4NA 3G7LA 2MPMA 1F9RA 2L9HA 2D9UA 1NCVA 1DOLA 2BDNA 1X3QA 1ICWA 1XX8A 1QNKA 3LWEA 1RJTA 4X3TA 2MJ8A 1MGSA 1WTPA 1J9OA 1TVXA 1PFBA 1CM9A 1G91A 1MI2A 1ILPA 2RSNA 2EPBA 1HUNA 1MSGA 4O42A 4HSVA 4IUVA 2K01A 5D14A 3SVMA 2K05A 1B53A 2HDLA 1JICA 1RTNA 5E4XA 3I91A 2N55A 3KBXA 5T1GA 1XYIA 1HFGA 1B3AA 4R8IA 2FJ2A 2MGSA 1VMPA 1PLFA 2K03A 1Q3LA 1QE6A 2K1BA 3DM1A 3N52A 1SAPA 4IUUA 4OIJA 2HUGA 1AP0A 4R9WA 1DONA 1A15A 4X3SA 5EJWA 5CBAE 2HCIA 2J7ZA 2JP1A 3I8ZA 4IUQA 1PDQA 4HAEA 1WD1A 4HEDA 4QUFA 1S4ZA 1F9SA 1E0BA 1ZXTA 1X32A 1RTOA 1PFNA 1KNEA 2EE1A 5T1IA 1BO0A 1ESRA 2B2WA 2B2WC 3IL8A 1SSOA 2KEDA 2B2VA 2VXWA 2B2VC 4X3UA 2HCCA 4U68A 5EPKA 2NZ1D 1O80A 2RVLA 2Q8RE 4CJ0B 3P7JA 1B2TA 1EIHA 2KVMA 1HHVA 1EIGA 3F2UA 2DY8A 4XDXA 1WTXA 2L12A 2MP1A 3GV6A 1B4OA 3I90A 1DOMA 4RAUC 1DOKA 5EKIA 5CMDA 1J8IA 1HRJA 1ILQA
chains in the Genus database with same CATH superfamily
5BN4A 1STEA 1GOZA 3S15B 1ZKOA 3PGZA 1LTBD 1X55A 5FLXL 1PH7A 3Q6SA 2CFMA 2CKZB 5DM73 1PZID 4Q5VA 1XNRQ 2QKIC 5BN5A 1UE7A 1EL0A 4CJ2C 3TBIB 1Y1WH 4KD3A 2AUJD 1M1KC 3LWUA 1II3A 3J80i 4A3IH 2MQHA 1YVCA 1WYDA 4CDDC 2KHSA 3KLWA 2F0EA 1LTSD 4C3JH 4FF4A 4LFBQ 3LX0A 4LF7Q 5K36G 1U5KA 4L8JA 4A3KB 2CWPA 3OW2A 2UUAQ 5LMUQ 3GTPH 1HCZA 1TS3A 4A3KG 5EPLA 1CT1D 4PZ6A 4JI2L 4N9TA 1L1OA 2NTTA 1VQCA 4JK1C 3ULLA 2IPKD 5KRUA 1EOVA 3AB9A 5IWAL 3WOEA 4DV1L 2EXDA 3C3LA 2MJ8A 1HPCA 2QF7A 5AJ3L 1S5FD 5DLQE 4RFBA 3L2PA 2PI2E 1KXLA 5C5MA 4WJ4A 2JA7B 4JG2A 5E4XA 2KCTA 4A3DB 4YWMA 1VQKA 4ME3A 3Q24A 3NBHA 1DXMA 2UXBL 4PZ8A 4HJ8A 4YCVA 1LM0A 2SNSA 4K5XA 4PMWA 4AIMA 4QQBX 1B9MA 5CV7A 4HAEA 3G71A 3HOWB 1F9SA 2JJQA 4JCVE 4JBKA 1EYCA 2XRQD 1X3FA 4JOIC 4GKJQ 2WINB 2VXWA 1EEID 3BDCA 2EZVA 4L5RC 1GHKA 2R7ZB 3T16A 2WB1E 1I4RA 3FEWX 4DAYA 1FJGL 2NTSA 2LXJA 4A3BB 1EWCA 4RKBA 2DY8A 4DK0A 3F2UA 2R7ZG 3NTHA 4BWGB 4POFA 5KIXA 5IY0A 3VR2A 2FHTA 5JJLA 3CMAA 4FXKC 3E9HA 5GAHC 4HIOA 1BF4A 3S1NH 1PFMA 1LV9A 1RHPA 5A2QL 2MNAA 1EQQA 2PNRC 3AYHB 4BBRH 3OWFA 1K3BC 3N6RA 3ERSX 1JWUD 2VQFQ 3UDFA 4BA1I 1CA6A 3OWEB 1SNPA 1NAPA 4ME5A 1SXTA 4PMBA 1K8AC 2ENBA 4IUPA 4AQYL 4PG3A 2FFKB 1GO3E 3I4NB 3STBD 3K5LA 5C0XH 4ZCKA 1AE3A 4ZKCB 3I4MG 2YTXA 2B2YC 1SFOH 5CGKA 3PCOB 3SEBA 3HOVH 4KN7C 5M5WH 4DR1L 4EVOA 4CKCA 2F0NA 5C4XG 2NVQH 4C3HH 1HUMA 3OW7A 4DV7L 4HJAA 2WAQE 1YIJA 5LMNQ 4GOPC 2K50A 2WB1G 3M4QA 2ZT9C 4P2CB 5C44G 3H6MA 2HHHL 2JA5H 3MXNA 3S2HB 1IW7D 1SMYC 2NB0A 1ILPA 2F4VL 4B3SL 4P72A 2Q2UA 2ZJPA 3I91A 1ONLA 2KCCA 2SNMA 1Y1VG 2OT2A 2YTVA 1QE6A 1IBKL 1LLRD 1SYDA 2E2JH 4JI5L 3TRZA 3HKSA 1PYSB 4B3RQ 3KYHC 3CCJA 3I56A 1R9TH 2JP1A 3F8TA 2JEAI 3PO3G 4HEDA 1GUOA 4O1NA 1N34L 2B2WA 2QEJC 3WOFA 3I55A 2L0CA 1HZ9A 4B9XA 2NZ1D 2KCMA 3BDOA 4KKUA 4X6AH 4K8JA 2PMZE 4XDXA 1YHBA 3CCQA 5JOBA 4JVZA 2NVYH 2UUBQ 4NXNQ 2IX0A 3EIVA 2UUCQ 1TWGH 1NE3A 3V2TA 4DV0Q 4F7XA 2WAQG 5IT9c 4R4TA 4RWSC 3LGJA 3FDTA 3FHWA 2RSOA 3H91A 5DAUA 5K5PA 1E22A 4IQZA 5C6AA 3HOZG 2K14A 2F0OA 4ZLTF 1CKOA 4GNXC 2F0MA 2N49A 1E1TA 3V05A 1GJXA 1Y1WB 3KUPA 2WKDA 1EFID 2PZTA 5E7NA 4JI4Q 1LTLA 4F8MA 2F0HA 3TS0A 4X3KA 4QL5A 2M9VA 4C3JB 3HOUH 1WTOA 3CHBD 3I4LA 4LF6Q 1G2SA 1ML0D 1MBYA 3C1EA 5IGDA 3AFQA 3NK9A 1QOHA 1RL2A 3D4DA 3MWYW 1VQDA 3E0JA 3OPOA 2Y0SE 3BYTB 1XMOQ 2MPMA 1DOLA 2IT1A 1SYFA 5M3FH 4PNYA 1ICWA 1RIPA 2HQLA 4X62L 5A2QE 1TWHH 4DK6C 1JJGA 4K5WA 2TSSA 2K05A 1V1PA 1YHAA 4QCLA 1HH2P 3G6JB 3TMEA 2XTIA 1TIID 3KLSA 2FJ2A 2MGSA 1KDCA 3ND9A 1SEBD 3T1YQ 3K57A 1Y8PB 4L63B 3F2BA 4AH6A 5EJWA 4Y52H 2E75C 4OX9Q 3PQIA 3PUYA 3QJYA 2VB2X 5J3BA 2CW0D 2K75A 1HZCA 3UE1A 3SHLA 2JEBI 4A3GH 2UXDL 3K81C 1XNQL 3M85A 2VQEQ 1A3VA 2IHFA 4DR7Q 1SYEA 1YNNC 2Y0SB 3T4AC 2WFWA 1X3EA 2PYKA 2I46A 4WFN3 2X69A 2Y0SG 1S3OA 1V8QA 1TY2A 3A8JE 1G6ZA 1VQFA 4IFDG 1EIFA 5JEAH 3GP7A 3H09A 2IHEA 4OGQC 3S1NB 2VUMH 3NP8A 3PO2G 4R8NA 3HKZB 1RODA 2B2TA 4DN4M 5ELBA 1D5XC 1JWMD 4BBRB 4KY6A 1D7QA 4IPHA 4C1NI 2N8NA 1LT6D 2PW5A 4L6TB 1CHPD 1ASYA 2OTLA 1P16A 1U4RA 1Y8NB 3QOJA 2R93H 1WVLA 1UNSA 3W1GA 4A3LH 2ID0A 4IUNA 1ET6A 3TP8A 2F0WA 1E1OA 5CORA 1EQTA 1HQMC 1HR0L 4H13C 5C4ZA 4MN3A 1CSQA 5M5WB 3HOVB 1IBLL 1F2LA 1F77A 2NVQB 2K6AA 4I65A 4C3HB 3CD6A 2L4NA 1Q1BA 1X54A 1D5ZC 4O0AA 1ESFA 3HOYG 1RJTA 4HIDA 1JCKB 4KY7A 4RGOS 1VQ7A 1CQFA 3ZYYX 4X64Q 1Q81C 2JA5B 1MSGA 5TSSA 1PH8A 1LTTD 3MXPA 3URYA 1N33L 2F3WA 3MFYA 1OXVA 4R8IA 4WORA 4BY1G 4FF3A 5IP9H 3KF6B 3VR5A 2QDBA 3S1RH 2P5ZX 4K0KL 4CKEA 3J81L 1VQPA 4IUQA 4GLXA 1WD1A 3S16B 2E2JB 2LMCB 4O2DA 5KNBA 3GTMH 1N36Q 1R9TB 2A68C 2NZOA 2Z6KA 1KNEA 5FLMG 2K5VA 1L0YB 3FKIG 1SSOA 1H9RA 4B3MQ 1IHZA 2XNAC 4KV6A 5HGTA 4C2MH 1IBMQ 2K7VA 4JI8Q 3T56B 3ITPA 4A93G 3MEHA 2MO1A 5L37A 1NMGA 5BN3A 3RR5A 5IP7H 4DU9A 1V43A 3CU7A 4X65Q 1PYWD 4DV3Q 1SYBA 4E6IA 3TN2A 3T1HQ 3CXCA 2QILA 2LKVA 2RCFA 1TWGB 5KNDA 3OTOQ 2Q2HA 4KTAA 4UAIA 1SNQA 2EJFC 3MFGA 1BBUA 3K7UC 2DY7A 1PH5A 2OTJA 4XYQA 1OXXK 1R4PB 4BXXH 2ICIA 4GKKL 2EJGC 1KAAA 1BKBA 1M90C 5KYLA 3CPWA 5IOCA 4MHEA 4IOCA 4B3TQ 1PH1A 2NYZD 5LL6S 1GD7A 5ELDA 1DZ1A 3VYTA 4JI1L 2YU9H 5CC4A 4C3IG 4BBSH 1NUCA 4DNTB 4DR6Q 1XWEA 4TRDA 1CQVA 2B8GA 1M8AA 2L1BA 2Q2IA 3D4WA 4CBVA 5KEEA 4ZK9B 4A3MG 5IYBH 1PZJD 4GOPB 1S5ED 2JYOA 5EAYA 1KAWA 3HOUB 2UXCQ 1GUWA 2VZAA 4DK1A 4DR2L 4KI0A 1WD0A 1AH9A 5M9OA 3R2IA 3G7LA 4HJ5A 1NSNS 1SJED 1E7ZA 5C3EH 1E2WA 2JA6H 1ZYRD 2RQXA 1I5FA 3GQBA 4B9WA 1MI2A 2EPBA 1TWFH 2EY6A 5M3FB 5D14A 1TS4A 4G7OC 2H5XA 1EZ6A 2HDLA 1JICA 3TDQA 1I50B 1XTCD 5FJ8H 1SE3A 3TEHB 4A76A 2F4IA 4XQNA 2O2LD 1EY7A 3VA5A 2UU9Q 3NQIA 3U4ZA 2QEXA 1HZAA 1JJ2A 2E2HH 1LTID 1V1OA 1K73C 2F0JA 3X3MA 2JA8B 4LFBL 3QG1A 4LF7L 2VS1A 5LL6X 3CAMA 1BCPB 2UUAL 4XXEA 2JA8G 3RN2A 3S17B 5D3DA 2HIVA 4TQUS 2PCFB 2L5TA 2RDFA 4R4IA 1VQ8A 5C4HA 4JBJA 1E2VA 2QW7A 4ALPA 2MP1A 3IRBA 4A3GB 3RZOH 1FNUA 4RH6A 2TMPA 1J6QA 1WFQA 3SK4A 3JAMc 4KY5A 2N88A 1O78A 4XYOA 5CBEE 4LF5Q 1PYBA 2BDOA 2K5DA 3HZXA 4KMUC 4LF8L 1YEZA 3H0GH 3PIPA 2EVBA 3HRZC 5IYDG 3A54A 4KK7A 3KJOA 2G9HD 1Y14B 5M3MB 4MTNA 1TXYA 3GDEA 2LS01 3J81E 3NTIA 4RHSA 2RCNA 5M3MG 4V0BA 3VR6A 1RF2D 2LY7A 1CZWA 1G2TA 1MIUA 2LFNA 3T51B 2BE5D 1Q8KA 4YHHQ 4G7ZC 5JVH3 2R93B 1EY6A 2B63H 3FPPA 3D0FA 3MAQA 4JI6Q 1X3PA 4GKJL 2R6GA 4V190 1CK1A 1VF7A 2PPBC 1IYUA 4L5QA 5EPJA 1VQIA 1WCMH 3RUZA 1JQYD 4ZKBB 5EBDA 3PV0A 4DR3Q 1SROA 3UDIA 4J1MA 1Z7TA 1Q1EA 2D9UA 3C2PA 3RZDB 1FL0A 4KHPQ 3HOXH 1X3QA 1LTRD 2IX1A 4Y7NH 1RTNA 3VYSA 3QR8A 2K1BA 3KLSX 4A3FB 5C4JH 1WI5A 3E0EA 2I07B 5I6YA 4LF4Q 2J7ZA 3G6EA 4A3FG 1ENCA 1R4QB 3I70A 1S40A 2R7DA 1STNA 1Q8IA 1TS2A 4Q0FA 3GTMB 2B2VA 1HJPA 1ICFB 1SNOA 4HCEA 4AYBB 2DN8A 2YV5A 4DPGA 2VW9A 4RGTA 2JA7G 1JE5A 4A3JH 1ZEQX 1EIYB 4JBMA 2KA7A 2MUYA 1XTDA 4A3DG 5LMNL 4G4KA 3BS1A 3GTGH 2B2UC 1HZBA 1PXUA 4OO1G 4RA8A 4DGZA 2RHQB 3CKIB 1WTWA 1WOCA 1I6VC 2MO0A 4DUZQ 2R92H 3HOWG 4UHVA 3R3OA 4LWCA 2DJFC 2A73B 1JE4A 3W2DA 3U58A 3F2DA 4F87A 3OYYA 5FLXc 2A6EC 2ICEC 1D6EC 2EOTA 3E3XA 5JJKA 4A3EB 5CV9A 5COYA 1DD2A 3D31A 1TS5A 4HIKA 5ELOA 4B3RL 4OO1I 4A3BG 3T13A 4A3EG 1Q86C 3J7AF 3S2DB 4ZUJA 4BXXG 3GV3A 5FO8B 4XIGS 4JYAQ 1SNCA 3A8KE 4JI7Q 1NY4A 3FPUB 2EYHA 5DNFA 2YU9B 1CHQD 4EGVA 4BBSB 1SYGA 4RCNA 1CKNB 4R4QA 1BBXC 4ZAIA 3TP5A 5KNCA 1XPUA 3D6CA 2OF1A 1YITA 3ER0A 3AMUA 4NXNL 4OWTB 4EQNA 2UUBL 1B9NA 1NCVA 3UE0A 2AWOA 1XPOA 4DV0L 1XX8A 4KN4C 1VS0A 4EQOA 5GADC 1I4HA 2Z1CA 3V96A 5BR8Q 5C3EB 1W6KA 3ICEA 3I4NG 2E2DC 3TZUA 2ALYB 1B53A 3BYYB 2C5CA 1TWFB 3NPPA 3S1QH 1SAPA 2HUGA 1HTLD 2PZUA 4RKLA 1K3RA 2RDHA 3HG9A 3SE0A 4UDUC 5I2XA 1YZ6A 5FO7B 2AQ3B 4R4CA 2F0SA 1JB3A 3KF6A 3L3OC 1ENFA 4JI4L 3L9AX 1XPRA 1SBBB 4JPBW 4QMGA 4JOIA 3IL8A 1HNZQ 3J7AV 3H3VC 1FNWA 1S5BD 4X3UA 1EY9A 1I4XA 4LF6L 2L55A 3T53B 4CJ0B 1AEXA 1HTPA 1OXUA 2DNEA 4JI0L 1SYCA 1YNXA 2OWOA 2AUKA 1PA6A 3RNUA 4ILWA 2NN6G 4LUZA 1VF5C 2Z9HA 2I5LX 1UE1A 1U4MA 3J81j 2A69D 3PSIA 2IWHA 3RLOA 2KUMA 4GS3A 2F0DA 3AU7A 5D65A 1KHIA 1JC7A 1FJGQ 1CKMA 2KHIA 4CJ1B 3H0GB 1LUZA 1P8LA 1K8MA 4ZQ3A 4DXGA 5IYCH 3T1YL 2M00A 4LF9L 2NN6I 1BCPC 4J6HA 3J7A5 4LMQD 5CV8A 3WDNA 4DAPA 3K8AA 2XN9C 4RG1A 1HQRD 1RD9D 1V9PA 4ABNA 1PRTC 3MTSA 2PQAB 1RKNA 4NMZA 1PH4A 3M9BA 1EU4A 2B2YA 1G6PA 4BY7H 5E1FA 3RLNA 3DMUA 3RN5A 1KL9A 1HA6A 1U0LA 1U4PA 1LABA 1NR2A 4FVMA 2B63B 5FOBB 1WTQA 1EY4A 2CVRA 2N78A 4GOPA 3BVZA 2VQEL 1IKLA 4WJWA 1C4QA 4A3CH 4FNFA 3CC4A 3EBEA 4DR7L 3NENA 3C1FA 5JPNC 1BCPF 2ZXOA 4IN3A 3J80c 4FDBA 1SN8A 3F2CA 1Y1WG 4A3IB 3RMHA 1LTGD 4BS9A 1G91A 3HS0C 3K5OA 4FF1A 1WJJA 3MC0B 3NE5B 3HOXB 3SVMA 3BG3A 4A3IG 1PMRA 1JT8A 3KOJA 1FR3A 2EYPA 5M5XH 4IO9A 1VQNA 1ZYRC 1VMPA 4MZ9A 4C3JG 4DUYQ 2QGQA 2NBFA 3GTPB 4Y7NB 3Q8DA 1AP0A 4DR4Q 3M4YA 3H3VH 5C3WA 1K8GA 1A8VA 1PTOC 2HHHQ 3GTOH 4HIMA 5C4JB 1CFMA 3BVMA 3EJIA 4HR7B 1E0BA 1YNJC 2F0UA 4LFCQ 2HIXA 4K6LA 4M1UB 1PFNA 4KKTA 2F4VQ 1GVPA 3PF4A 1IYVA 5M5YH 3D4RA 3J81i 4CHTB 1DJRD 1D1KA 2EYJA 1U9RA 1K28A 2V1CC 1O80A 1XMQQ 1HHVA 3HKZE 4DAVA 1X9NA 3K6OA 2ZTCA 1HRJA 4YY3Q 4LW1A 1U4LA 4A3JB 1D8LA 4DK3C 2VNUD 1XXGA 5I9PA 1HNXQ 4G57A 4K2KA 2K5WA 2O5IC 1EOTA 3GTGB 4PV1C 2CWAA 2E74C 2FMMA 4F88A 4X64L 5IT9E 2DUDA 4OXPA 4ODGA 3S1MH 3RLFA 4CDFC 1Z6HA 2K04A 3PUZA 1VQ5A 1SE8A 3KF8B 1A2UA 2WP8J 4GLAC 2EDGA 3NXWA 4GNXA 1KIXA 1NMFA 4XQJA 2BH2A 3VA7A 2ASBA 4PZ7A 1WTVA 4MTKA 2RHSB 1S5CD 4XQQA 3PIOA 5GQOA 2KECA 3BZKA 4HSPA 3TREA 1VQ4A 1CZGA 1N36L 3EN2A 3D3RA 3HEJA 3M4OH 2EY2A 3HFZB 1O7YA 1SLJA 2EYLA 4IURA 5E3FA 2Z0SA 1VQ9A 1N32L 4B3ML 4PQXA 2EXZA 4JI8L 2X6GA 2QCPX 1Y69U 1WTRA 1B50A 4DV6Q 3HKZG 3KFUA 4DV3L 3RD4A 4BBRG 3OIQA 5G3LF 5J39A 3T1HL 1I6HH 4JI3L 1DGSA 5HGQA 1G291 4DAYB 4IFDI 1PTOH 4HSVA 4XTCS 3MHBA 2F3IA 4LFAQ 3KBXA 2N55A 4WRDA 1B70B 4OONA 3NQTA 3K0YA 4DV5Q 2Z8LA 3CCRA 5ELCA 3CRKC 1QJOA 2OQKA 1SFOB 2DGYA 1BR9A 4NP5A 5C0XG 3FRPB 2F52A 3S1QB 1ET9A 4NB3A 3IAYA 4GZYC 3HOVG 1STAA 4B3TL 4X62Q 4DV2Q 1BQQT 5FO9B 4NXML 2SOBA 4TKOB 4C3HG 3GTJH 2EE1A 5IGGA 2DJGC 4P74A 2Z4HA 1TWCH 1QUQB 3MXUA 3WWVA 2G9DA 1F2ZA 3W5OA 3PMFA 5C0XI 2JA5G 1D5MC 3CPFA 5DM63 5K36H 4UP9A 4YCWA 2UXCL 2SEBD 3I90A 1OXTA 2J4XA 3LNNA 3E6ZX 3A5ZB 3ONAB 4A3KH 1CA5A 3CCSA 4LJZC 4LK1C 4P75A 2OXPA 3DEPA 4U673 1UEBA 3BDLA 2UXDQ 4I7AA 1VDZA 1PHJA 4G7HC 3I4OA 4X66L 3MZ5A 2KEEA 3MXNB 3TZDA 4ULLA 4GN4B 3I3CA 4HCSA 2E76C 1Z47A 2AHOB 5EGTA 1BUVT 4IPCA 2NVYB 4LUVA 3CW2C 1SDFA 3K59A 1I4QA 5EQ0A 1QVGA 5IGCA 3HP3A 4JW0A 4RGNA 1MHWC 1STYA 2WACA 3VR4A 4XT1B 4BY7B 1W3SA 1STHA 4OL7A 3EA6A 3OHXC 1QCBD 1CKNA 4QJFA 5FK9C 2PW7A 1G8ZD 3LWEA 1WTPA 1MGSA 4LF5L 2E2IH 3Q23A 1B8AA 1HXYD 3DXJC 2R7ZH 2RSNA 1KDBA 1UE5A 1KD1C 3JAML 3SR1A 1GXDC 3NBIA 4HJ7A 1HFGA 5IIFA 1B3AA 2GVAA 1IBLQ 2A1AA 2K03A 1Q3LA 4IUUA 3STBC 4DV4L 3M3YH 1H95A 3K58A 4DR5L 2E5LQ 3K0XA 1DONA 5M5XB 1DM0B 5C5LA 3I72A 2HCIA 2KQ3A 1NJIC 3HOUG 1AFPA 1QVFA 4RCOA 3U50C 4QUFA 3DM3A 3GTOB 5KGUA 1YI2A 5T1IA 1JWSD 2NVTH 5JVG3 3CQZH 3OSOA 2FMCA 4ID6A 4U68A 1XNRL 2RVLA 1SNMA 1TWHB 1I94Q 5M5YB 4IJHA 2JK8A 5M3FG 2BA1A 3I4MH 1A62A 5HY6A 3ND8A 1WTXA 1IW7C 3GV6A 5IGEA 4DR3L 2CH4A 3SGIA 3CCLA 3I2ZA 4IFDJ 5C4XH 4KLKA 5EKKA 1MKHA 4DFAA 1AZQA 4KHPL 4B08A 1BOSA 4A4IA 1RCVD 4NW2A 2HDMA 3ULJA 1PV4A 4YIJA 4IPGA 2EYOA 4DNIA 5C44H 2J0TD 5LMUL 1TT2A 3KJPA 5I9OA 3EFXD 3S1MB 1PRTB 2AWNA 4KJNA 2A69C 3CCVA 4LF4L 1C9OA 5EBCA 1NR4A 1SRUA 1DCZA 3QWNA 3PF5A 4Z9CB 4CDEC 1B1ZA 1Y1VH 4IOAA 4A3GG 3SDZA 5C0XJ 2EY5A 2ZM6Q 4CGYB 3DEOA 3QIAA 4BA2I 3MEFA 2AQ1B 3PO3H 1H9MA 4UPAA 4RGMA 2PQAA 3NWSA 2V4DA 2NZHA 3M4OB 1J5EQ 2D0OA 1LT4D 2I5MX 3VR3A 1SE4A 1KRTA 5CYUA 1L0WA 1L1OC 2VUMB 2GVBA 1HNWQ 4FF2A 2BDNA 5JEAG 2L15A 4ZYSA 1QNKA 2VUMG 3P1HA 2HD3A 1QWYA 1YNND 2BCOA 1M4VA 4DUZL 3X3NA 1N8RC 1I6HB 1IL2A 1K8OA 1PTOB 4AYBE 3TP6A 4DR2Q 2R93G 1KC8C 3GTKH 4A3LG 3B6YA 3OOCA 4OIJA 4JV5Q 3A74A 4WJ3M 5CBAE 4P71A 3A7AB 5IGFA 2A6HD 4YWLA 3HOZH 3I8ZA 3UDGA 1B7YB 4QIWB 1RTOA 1QB5D 2GN5A 3FP9A 3TSSA 4JYAL 4JI7L 3JC66 3KDFB 3NUCA 1MJCA 4YWKA 3GTJB 2KHJA 5F2DA 3S24A 2ZJQA 5CV5A 1VQAA 1TWCB 2EYFA 4EQ5A 2IY5B 1EQRA 2L12A 2VQFL 5CMDA 1HR0W 4GN5A 1BDOA 3P75A 2ZJRA 3TQYA 2AKWB 2I0QA 1Q82C 3EVQA 5CV4A 3S1RB 5H1SE 3MVVA 5IP9G 1PH6A 3JAME 1GM5A 1LO5D 1QNUA 3ERQA 1VMCA 5CR3A 5BR8L 4IUTA 5C3XA 3R93A 3PIP3 5AFWA 4AYBG 1MJEA 1EYDA 2CW0C 4YCUA 4C2MB 3S14H 3KF8A 3NEMA 2Q8TA 2WKCA 1VQHA 3H94A 2IL8A 2D62A 1JORA 4LF8Q 1PVOA 3D8GA 3K7AH 3BJUA 5IP7G 1HNZL 3HGBA 3SXHA 3L7ZC 1VQOA 2A68D 2JA9A 1IL8A 1I4GA 1Q46A 1X56A 1Z9FA 4N8X1 2C35B 1AE2A 1PFSA 2ZXPA 2F0FA 2H4OA 2ES2A 1TQOA 4OHJA 1ASZA 5HURA 3J7ZC 4OWWB 4HTHA 4NDXA 2IW3A 1PFBA 4FP5D 4ZUIA 1UEAB 4O42A 2K01A 1T9HA 1TWAH 3CCMA 1XYIA 2E2IB 1JOQA 2YTYA 2K5NA 3E5SA 4FXGC 5JJIA 1QZGA 1UUPA 1S72A 4MIUA 4BBSG 1H9SB 3CCUA 3GD7A 1D2BA 2F1MA 3BZCA 4IFDH 3DLLA 4P73A 5J1ZA 5IE8A 3ZJYC 3UDXA 5IYBG 3M3YB 1C0AA 2UUCL 3PO2H 1S4ZA 1KLGD 1RDPD 2K33A 2R7FA 2ZXRA 4EX5A 2RDGA 1ESRA 1VQJA 2B2WC 2JA6B 1EEFD 2EJMA 4KJOA 5DEHA 4H7BA 5IT9L 2NVTB 5C3EG 3CQZB 4JI2Q 2JA6G 2E8GA 2K5QA 1EIGA 2O4XA 1QUQA 2XVSA 2Z4IA 2FINB 3D6WA 2B2UA 5IWAQ 4DNRB 3I4MB 1B44D 4DV1Q 3DHQA 5AJ3Q 3GTQH 5FJ8G 1Q12A 1Q7YC 1LACA 1UAPA 1X3GA 3Q22A 1C48A 5C4XB 1BBWA 1W6JA 2EIFA 3MA2B 3Q0AA 2E2HB 2XRSD 1AN8A 4K8IA 3J80L 1MSHA 1SE2A 1HFNA 5JEAJ 5JJZA 3HOYH 2WB1B 3O13A 1X65A 1KLUD 3GO5A 5C44B 4DUYL 4JC0A 1VQ6A 2UXBQ 4TVAB 4LAAA 4DF7A 4DR4L 5FLXE 3QO2A 1XMOL 2A5HA 1QILA 1STBA 4JBWA 3CCEA 4BY1H 1L0XB 1IXRA 3P20A 2AQ2B 4FXDA 2SDFA 4MNOA 3RZOB 4LFCL 2PZWA 1GUTA 2K52A 1Y1VB 1UE6A 2EYMA 1AW7A 1H9JA 2KJXA 2F0LA 5GAEC 1XMQL 5FLMH 2WIIB 3S16H 1I3QH 3FKIH 3PO3B 4RHRA 2CH4W 3H0GG 1PH3A 1JJCB 2L9HA 3QB3A 4YY3L 2EQSA 5GAGC 4OX9L 2XWJB 4A93H 1JOKA 3TP7A 1HNXL 4PMCA 4DA2A 4KKSA 1VQBA 2CHBD 2IX3A 4GN3B 4C56C 1KTKA 4H0LC 1PLFA 3OMGA 2WAQB 2A74C 1A15A 2K32A 2AMCB 1F2YA 3GTKB 2RKSA 2B63G 1K83H 1GUGA 4AQYQ 3EROA 1VQGA 1C7YA 1WCMB 3VDYA 1EYAA 1X32A 2F3VA 3HOZB 4LNQA 1WCMG 1SJHD 4UP7A 4IALA 3K5NA 2KEDA 4DR1Q 1EUJA 1PRTF 4M8AA 1KABA 2Q8RE 2K4KA 4C3IH 2QA4A 1OXSC 4DV7Q 3HOXG 3TS2A 4K2LA 1DOMA 2D2CC 4A3MH 3IKJA 2A19A 4LUOA 1YJ9A 2PNHA 3M4PA 4DV6L 3DWQA 2ZTEA 3G48A 1YBYA 1T5XD 4B3SQ 1SMXA 1EY5A 5KYIA 1BVSA 2VB3X 1JR0D 1BXTA 4LFAL 4DV5L 4JI0Q 1IBKQ 1EQVA 1OO9B 3GTLH 1IZ6A 4JI5Q 2XWBB 2B2TC 2PMZB 1N9WA 3A0JA 2KENA 1F9QA 4OWXB 5I2YA 5FKAC 1QZHA 1N34Q 2X6LA 2XIWA 3K80C 1A63A 5ISRA 1FD7D 1PTOF 4DV2L 1I50H 3S14B 1EFWA 4A3JG 2K28A 1STGA 2F0QA 4DKAC 2HQEA 5JAVA 4N9PA 1L1OB 3IFDA 3DUZA 3K7AB 1QVCA 1PH2A 3AEVA 3CMEA 4LF9Q 4R4OA 2R92B 1FGBD 2PQEA 2RBMA 3F1ZA 3CC2A 1NBWA 2JA8H 2R92G 1SR3A 3R8BA 2RF4A 5LMNW 3S17H 3G4SA 1CTMA 4QB4A 4KHVA 3J80E 1Y8OB 2B8FA 1HUNA 2DNCA 2R61A 4H02A 3NBHB 1O7IA 3S9WA 3DM1A 1V1QA 1TWAB 3W3AA 1YJNA 1KRSA 1IBML 1EWIA 2OQ0A 2XSCA 1S5DD 2BE5C 3JAMi 1EY8A 1OTCA 5IYDH 4X65L 1PDQA 2A6ED 2EY1A 1ZXTA 2NVXH 1FYCA 1KDAA 2Z6KC 4UY8C 3PUVA 3PO2B 4CDCC 3OTOL 2NUCA 4QF4A 4HJ9A 2F0TA 5M3MH 5GROA 4ZRZA 2A6HC 1SNDA 1G51A 1CSPA 3DWAA 3J7YW 2OEOA 5ELNA 1VQLA 2HT1A 3KDFA 3S15H 1E24A 1EWHA 2F0IA 4RAUC 1NTGA 1DOKA 1EIHA 3BVGA 3ULPA 1E2ZA 1TR5A 4FO2A 5I4DA 3A55A 1W2BA 3U9SA 5A35A 3OIPA 3M7GA 2A8VA 2B29A 2VY3A 4DR6L 3GTQB 3BU2A 1NNXA 3FMCA 1YHQA 2L11A 2LSSA 1DYQA 2F0GA 4J8QA 2M2LA 4J15A 3A5UA 3RZDH 1VQMA 3SK6A 3NHHA 1BNZA 1YJWA 3HOYB 2JE6I 2E5LL 2RA4A 2PO4A 3KLRA 2GA4B 1GHJA 3AQQA 4QUCA 3BZDB 1XJVA 2KBNA 3CC7A 5I6WA 3L0OA 3PIO3 2H1EA 1EU3A 1UWVA 2IJ0A 3UI2A 2MFIA 1GKHA 2YYZA 4IPDA 4KD4A 1O7ZA 1K0SA 1JOOA 4BY1B 1WTHA 4A3FH 2G5DA 1VCIA 3K5MA 1AZPA 1XNQQ 1I4PA 3R2TA 1SMYD 1C8CA 1F9PA 4TSSA 2N3SA 4DXFA 1I94L 1IKMA 1T5EA 1K0RA 2ATWA 2KOLA 2I5HA 1I3QB 3FKIB 2UU9L 1LYLA 1LT3D 1GUSA 3DWPA 4X3TA 2Q8IB 2F0KA 1L2FA 2JA7H 1TVXA 1CM9A 5IYCG 4K5VA 3MXGA 4A3DH 1X6OA 3SK5A 4A93B 1PH9A 1N32Q 2VL6A 4IZ8A 5T1GA 3IFTA 2B3GA 4OO1H 1B3QA 3N52A 3CF5A 4R9WA 3HOWH 4BY7G 2D0PA 4R1JA 4L5SA 5ELEA 4H44C 4JI3Q 2D5DA 4FYDA 4S3SA 1H9SA 3FVQA 1K83B 1BCPD 2C9OA 3I7FA 1E3PA 4CKBA 3E9IA 2JSOA 2ZM6L 1A3TA 2CQAA 1H9KA 5LHY1 3H15A 4A3CG 4A3BH 4A3EH 1Q90A 2HCCA 1HR0Q 1PRTD 5J22A 3CP0A 4L5TA 4KHZA 2PI2A 3S2DH 1J5EL 1F2MA 5NUCA 3U9OA 1J8IA 1O7LA 4C3IB 4K6DA 4POGA 1ILQA 1MD2D 1JB7A 1HNWL 4NXMQ 4A3MB 4XT3B 2WV6D 1D1IA 2Q2TA 4QGUA 3QOLA 4OIKA 3OMCA 4C1NK 1IYJB 1N33Q 3I73A 4N8FA 4YHHL 3NWTA 1JMCA 2QDLA 2JXMB 2KCNA 4A75A 3C46A 3J81c 1EYGA 3AFPA 3VYUA 4JI6L 5IODA 1KNAA 4RMFA 1QG7A 3W1BA 2F03A 4JV5L 3EQLC 1FVIA 3I4NH 1ENAA 1EY0A 2XGTA 3GTLB 4K0KQ 3SK8A 2R3ZA 1LTAD 3H3VI 2O5JC 2JN4A 5ELFA 1PTOD 4HN7A 2NWGA 2CCZA 2F0PA 1FNVA 5E4WC 4X66Q 4IJLA 1YNJD 2JQOA 5CV6A 1A2TA 2F0VA 4GLVB 3NTKA 2CQOA 1TY0A 1K9MC 4NKLA 3S2HH 4DAMA 1A0IA 1F9RA 4HMIA 1EZ8A 1FGUA 1V1PB 5EKLA 5JPMC 1A6XA 1J9OA 4QIWE 4I7ZC 5IGBA 3A56A 2OCEA 3M7NA 2BOSA 4IUVA 3VYRA 2NN6H 4APVA 2MHVA 2K5HA 4EQPA 4OEMB 3KBGA 4GKKQ 4HMJA 3NSWA 1LT5D 2Z6BA 4NPSA 4X3SA 1A3UA 4K14A 3CRLC 4JI1Q 2LXKA 1TKWB 3A8IE 1TU2B 3U4VA 1BO0A 4GNXB 5G3LD 2BH8A 3PUXA 2FXQA 2NVXB 1GUNA 2B2VC 5D3IB 1KQSA 1PZKD 4OELB 2BA0A 4DV4Q 1CI3M 3P7JA 1CUKA 3A7LA 4QY7A 1B2TA 1HA5A 2KVMA 4DR5Q 4UP8A 2B39A 3PUWA 1B4OA 5EKIA 3KK7A 5EPKA 3NELA 1VQEA 2ZTDA
chains in the Genus database with same CATH topology
5BN4A 1STEA 1GOZA 3S15B 1ZKOA 1LTBD 5FLXL 3Q6SA 5DM73 1PZID 4Q5VA 2QKIC 5BN5A 1EL0A 4CJ2C 3TBIB 4KD3A 2AUJD 3LWUA 1II3A 2KHSA 2F0EA 1LTSD 4FF4A 3LX0A 5K36G 4L8JA 4A3KB 1HCZA 1TS3A 5EPLA 1CT1D 4N9TA 2NTTA 4JK1C 2IPKD 5KRUA 3AB9A 3WOEA 3C3LA 2MJ8A 1HPCA 2QF7A 1S5FD 4RFBA 5C5MA 2JA7B 5E4XA 4A3DB 3Q24A 3NBHA 1DXMA 2SNSA 4K5XA 4PMWA 1B9MA 5CV7A 4HAEA 3HOWB 1F9SA 1EYCA 2XRQD 2WINB 2VXWA 1EEID 3BDCA 2EZVA 1GHKA 2R7ZB 3T16A 4DAYA 1I4RA 3FEWX 2NTSA 4A3BB 1EWCA 4RKBA 2DY8A 4DK0A 3F2UA 3NTHA 4BWGB 5KIXA 3VR2A 2FHTA 4FXKC 1BF4A 1PFMA 1LV9A 1RHPA 5A2QL 2PNRC 3OWFA 3N6RA 1JWUD 1CA6A 4BA1I 3OWEB 1SNPA 1NAPA 4ME5A 1SXTA 4PMBA 2ENBA 4IUPA 2FFKB 3I4NB 3K5LA 5C0XH 4ZKCB 2B2YC 5CGKA 3SEBA 4KN7C 4EVOA 4CKCA 2F0NA 1HUMA 3OW7A 2ZT9C 4P2CB 3H6MA 3MXNA 3S2HB 1IW7D 1SMYC 2NB0A 1ILPA 3I91A 1ONLA 2KCCA 2SNMA 2OT2A 1QE6A 1LLRD 1SYDA 2JP1A 2JEAI 4HEDA 1GUOA 4O1NA 2B2WA 2QEJC 3WOFA 2L0CA 4B9XA 2NZ1D 3BDOA 4KKUA 4K8JA 4XDXA 5JOBA 2IX0A 3V2TA 4F7XA 4RWSC 3FDTA 2RSOA 3H91A 5DAUA 5K5PA 4IQZA 5C6AA 2F0OA 4ZLTF 2F0MA 3V05A 1GJXA 1Y1WB 3KUPA 2WKDA 1EFID 2PZTA 4F8MA 2F0HA 4X3KA 2M9VA 4C3JB 1WTOA 3CHBD 3I4LA 1G2SA 1ML0D 1MBYA 3C1EA 5IGDA 3NK9A 1QOHA 3D4DA 3MWYW 3E0JA 3OPOA 3BYTB 2MPMA 1DOLA 2IT1A 1SYFA 4PNYA 1ICWA 5A2QE 4K5WA 2TSSA 2K05A 1V1PA 4QCLA 3G6JB 3TMEA 1TIID 3KLSA 2FJ2A 2MGSA 1KDCA 3ND9A 1SEBD 3K57A 1Y8PB 4L63B 5EJWA 2E75C 3PUYA 3QJYA 2VB2X 2CW0D 3SHLA 2JEBI 3M85A 1A3VA 1SYEA 1YNNC 2Y0SB 3T4AC 2PYKA 2I46A 4WFN3 2X69A 1V8QA 1TY2A 3A8JE 1G6ZA 4IFDG 5JEAH 3GP7A 3H09A 4OGQC 3S1NB 3NP8A 4R8NA 3HKZB 1RODA 2B2TA 4DN4M 5ELBA 1D5XC 1JWMD 4BBRB 4KY6A 4C1NI 1LT6D 2PW5A 4L6TB 1CHPD 1U4RA 1Y8NB 3QOJA 1WVLA 1UNSA 2ID0A 4IUNA 1ET6A 3TP8A 2F0WA 5CORA 1EQTA 1HQMC 4H13C 5C4ZA 4MN3A 3HOVB 5M5WB 1F2LA 1F77A 2NVQB 2K6AA 4I65A 4C3HB 2L4NA 1Q1BA 1D5ZC 1ESFA 1RJTA 1JCKB 4KY7A 4RGOS 1CQFA 3ZYYX 2JA5B 1MSGA 5TSSA 1LTTD 3MXPA 3URYA 2F3WA 3MFYA 1OXVA 4R8IA 4WORA 4FF3A 3VR5A 2QDBA 4CKEA 3J81L 4IUQA 3S16B 1WD1A 2E2JB 2LMCB 5KNBA 1R9TB 2A68C 1KNEA 1L0YB 1SSOA 1H9RA 1IHZA 2XNAC 4KV6A 5HGTA 2K7VA 3T56B 3ITPA 3MEHA 5BN3A 4DU9A 1V43A 3CU7A 1PYWD 1SYBA 4E6IA 3TN2A 2QILA 2LKVA 1TWGB 5KNDA 4KTAA 4UAIA 1SNQA 2EJFC 3MFGA 2DY7A 4XYQA 1OXXK 1R4PB 2ICIA 2EJGC 1KAAA 5KYLA 5IOCA 4MHEA 2NYZD 5LL6S 5ELDA 1DZ1A 3VYTA 5CC4A 4C3IG 1NUCA 4DNTB 1XWEA 4TRDA 1CQVA 2B8GA 1M8AA 2L1BA 3D4WA 4CBVA 5KEEA 4ZK9B 1PZJD 1S5ED 2JYOA 3HOUB 1GUWA 4DK1A 4KI0A 1WD0A 5M9OA 3R2IA 3G7LA 1NSNS 1SJED 1E2WA 1ZYRD 2RQXA 3GQBA 4B9WA 1MI2A 2EPBA 2EY6A 5M3FB 5D14A 1TS4A 4G7OC 1EZ6A 2HDLA 1JICA 3TDQA 1I50B 1XTCD 1SE3A 2F4IA 4XQNA 2O2LD 1EY7A 3VA5A 3NQIA 1LTID 1V1OA 2F0JA 3X3MA 2JA8B 3QG1A 5LL6X 1BCPB 4XXEA 3S17B 5D3DA 4TQUS 2PCFB 2L5TA 2RDFA 5C4HA 1E2VA 2MP1A 4A3GB 1FNUA 4RH6A 2TMPA 3SK4A 4KY5A 2N88A 1O78A 4XYOA 5CBEE 2BDOA 2K5DA 3HZXA 4KMUC 2EVBA 3HRZC 3A54A 4KK7A 2G9HD 5M3MB 2LS01 3J81E 3NTIA 4RHSA 4V0BA 3VR6A 1RF2D 2LY7A 1CZWA 1G2TA 2LFNA 3T51B 2BE5D 4G7ZC 5JVH3 2R93B 1EY6A 3FPPA 3MAQA 1X3PA 2R6GA 4V190 1CK1A 1VF7A 2PPBC 1IYUA 5EPJA 3RUZA 1JQYD 4ZKBB 5EBDA 3PV0A 4J1MA 1Z7TA 1Q1EA 2D9UA 3C2PA 3RZDB 1X3QA 1LTRD 2IX1A 1RTNA 3VYSA 2K1BA 3KLSX 4A3FB 5I6YA 2I07B 2J7ZA 1ENCA 1R4QB 3I70A 1STNA 1Q8IA 1TS2A 4Q0FA 3GTMB 2B2VA 1SNOA 4HCEA 4AYBB 2DN8A 4RGTA 1ZEQX 2KA7A 2MUYA 4G4KA 3BS1A 2B2UC 1PXUA 4OO1G 4RA8A 4DGZA 1WTWA 3CKIB 1I6VC 3R3OA 2A73B 1JE4A 3W2DA 4F87A 2A6EC 2ICEC 1D6EC 2EOTA 4A3EB 5CV9A 5COYA 1DD2A 3D31A 1TS5A 4OO1I 3T13A 3J7AF 3S2DB 4ZUJA 3GV3A 5FO8B 4XIGS 1SNCA 3A8KE 3FPUB 2EYHA 5DNFA 2YU9B 1CHQD 4EGVA 4BBSB 1SYGA 4RCNA 1BBXC 4ZAIA 3TP5A 5KNCA 3D6CA 2OF1A 3AMUA 4EQNA 1B9NA 1NCVA 2AWOA 1XX8A 4KN4C 4EQOA 1I4HA 2Z1CA 3V96A 5C3EB 1W6KA 2E2DC 3TZUA 1B53A 3BYYB 2C5CA 1TWFB 3NPPA 1SAPA 2HUGA 1HTLD 2PZUA 4RKLA 2RDHA 3HG9A 3SE0A 4UDUC 5I2XA 5FO7B 2AQ3B 2F0SA 1JB3A 3L3OC 1ENFA 3L9AX 1SBBB 4QMGA 3IL8A 3J7AV 3H3VC 1S5BD 1FNWA 4X3UA 1EY9A 1I4XA 2L55A 3T53B 4CJ0B 1AEXA 1HTPA 1OXUA 2DNEA 1SYCA 2AUKA 4ILWA 2NN6G 1VF5C 1U4MA 2A69D 2IWHA 2KUMA 2F0DA 3AU7A 5D65A 1JC7A 4CJ1B 3H0GB 1K8MA 4ZQ3A 4DXGA 2M00A 2NN6I 1BCPC 4J6HA 4LMQD 5CV8A 3WDNA 4DAPA 2XN9C 1HQRD 1RD9D 4ABNA 1PRTC 3MTSA 1RKNA 4NMZA 1EU4A 2B2YA 5E1FA 3DMUA 1HA6A 1U4PA 1LABA 1NR2A 4FVMA 2B63B 5FOBB 1WTQA 1EY4A 2CVRA 3BVZA 1IKLA 1C4QA 4FNFA 5JPNC 3C1FA 1BCPF 2ZXOA 4IN3A 4A3IB 3RMHA 1LTGD 4BS9A 1G91A 3HS0C 3K5OA 4FF1A 3MC0B 3NE5B 3HOXB 3SVMA 3BG3A 1PMRA 1FR3A 2EYPA 1ZYRC 1VMPA 4C3JG 2NBFA 3GTPB 4Y7NB 1AP0A 3M4YA 5C3WA 1PTOC 5C4JB 1CFMA 3BVMA 3EJIA 4HR7B 1E0BA 1YNJC 2F0UA 4K6LA 4M1UB 1PFNA 4KKTA 1IYVA 3D4RA 4CHTB 1DJRD 1D1KA 2EYJA 1U9RA 1O80A 1HHVA 4DAVA 3K6OA 1HRJA 1U4LA 4A3JB 2VNUD 1XXGA 5I9PA 4G57A 4K2KA 2K5WA 2O5IC 1EOTA 3GTGB 4PV1C 2E74C 2FMMA 4F88A 5IT9E 4ODGA 3RLFA 1Z6HA 2K04A 3PUZA 1A2UA 2WP8J 2EDGA 3NXWA 4XQJA 3VA7A 1WTVA 1S5CD 4XQQA 2KECA 4HSPA 1CZGA 3D3RA 3HEJA 2EY2A 1O7YA 5E3FA 2EYLA 4IURA 4PQXA 2EXZA 2X6GA 2QCPX 1Y69U 1WTRA 1B50A 3RD4A 3OIQA 5G3LF 5J39A 1G291 4IFDI 1PTOH 4HSVA 4XTCS 3MHBA 3KBXA 2N55A 4WRDA 3NQTA 3K0YA 2Z8LA 5ELCA 3CRKC 1QJOA 1SFOB 1BR9A 4NP5A 5C0XG 3FRPB 3S1QB 1ET9A 3IAYA 4GZYC 1STAA 1BQQT 5FO9B 2SOBA 4TKOB 4C3HG 2EE1A 5IGGA 2Z4HA 3MXUA 2G9DA 1F2ZA 3PMFA 5C0XI 1D5MC 5DM63 5K36H 2SEBD 3I90A 1OXTA 2J4XA 3LNNA 3E6ZX 3ONAB 1CA5A 4LJZC 4LK1C 2OXPA 3DEPA 4U673 3BDLA 1VDZA 4G7HC 3MZ5A 2KEEA 3TZDA 4ULLA 3I3CA 4HCSA 2E76C 1Z47A 5EGTA 1BUVT 2NVYB 1SDFA 3K59A 1I4QA 5EQ0A 5IGCA 3HP3A 4RGNA 1STYA 2WACA 3VR4A 4XT1B 4BY7B 1STHA 4OL7A 3EA6A 3OHXC 1QCBD 5FK9C 2PW7A 1G8ZD 3LWEA 1WTPA 1MGSA 3Q23A 1HXYD 3DXJC 2RSNA 1KDBA 3JAML 3SR1A 1GXDC 3NBIA 1HFGA 5IIFA 1B3AA 2K03A 1Q3LA 4IUUA 3K58A 1DONA 5M5XB 1DM0B 5C5LA 3I72A 2HCIA 2KQ3A 1AFPA 4RCOA 4QUFA 3GTOB 5KGUA 5T1IA 1JWSD 5JVG3 3OSOA 2FMCA 4ID6A 4U68A 2RVLA 1SNMA 1TWHB 5M5YB 2BA1A 3ND8A 1WTXA 1IW7C 3GV6A 5IGEA 4IFDJ 5EKKA 4DFAA 1AZQA 4B08A 1BOSA 1RCVD 4NW2A 2HDMA 4YIJA 2EYOA 2J0TD 1TT2A 5I9OA 3EFXD 3S1MB 1PRTB 2AWNA 4KJNA 2A69C 5EBCA 1NR4A 1DCZA 3QWNA 4Z9CB 1B1ZA 3SDZA 5C0XJ 2EY5A 4CGYB 3DEOA 3QIAA 4BA2I 2AQ1B 1H9MA 4RGMA 3NWSA 2V4DA 3M4OB 1LT4D 3VR3A 1SE4A 5CYUA 2VUMB 4FF2A 2BDNA 5JEAG 4ZYSA 1QNKA 3P1HA 1QWYA 1YNND 2BCOA 1M4VA 3X3NA 1I6HB 1K8OA 1PTOB 3TP6A 3OOCA 4OIJA 5CBAE 3A7AB 5IGFA 2A6HD 3I8ZA 4QIWB 1RTOA 1QB5D 3TSSA 3NUCA 3GTJB 5F2DA 5CV5A 1TWCB 2EYFA 2L12A 5CMDA 1BDOA 3P75A 3EVQA 5CV4A 3S1RB 3MVVA 3JAME 1LO5D 1QNUA 3ERQA 1VMCA 5CR3A 4IUTA 5C3XA 3R93A 3PIP3 5AFWA 1EYDA 2CW0C 4C2MB 3KF8A 2Q8TA 2WKCA 3H94A 2IL8A 2D62A 1JORA 3D8GA 3HGBA 3SXHA 3L7ZC 2A68D 1IL8A 1I4GA 2ZXPA 2F0FA 2H4OA 1TQOA 4OHJA 5HURA 4HTHA 4NDXA 2IW3A 1PFBA 4FP5D 4ZUIA 1UEAB 4O42A 2K01A 1XYIA 2E2IB 1JOQA 3E5SA 4FXGC 1UUPA 4MIUA 1H9SB 3GD7A 1D2BA 2F1MA 4IFDH 5J1ZA 3M3YB 1S4ZA 1KLGD 1RDPD 2K33A 2ZXRA 2RDGA 1ESRA 2B2WC 2JA6B 1EEFD 2EJMA 4KJOA 5DEHA 4H7BA 5IT9L 2NVTB 3CQZB 2K5QA 1EIGA 2O4XA 2XVSA 2Z4IA 2FINB 3D6WA 2B2UA 4DNRB 3I4MB 1B44D 3DHQA 1Q12A 1LACA 1UAPA 3Q22A 1C48A 5C4XB 3MA2B 1W6JA 3Q0AA 2E2HB 2XRSD 1AN8A 4K8IA 3J80L 1MSHA 1SE2A 1HFNA 5JEAJ 5JJZA 2WB1B 3O13A 1KLUD 3GO5A 5C44B 4LAAA 4DF7A 5FLXE 3QO2A 2A5HA 1QILA 1STBA 4JBWA 1L0XB 3P20A 2AQ2B 4FXDA 2SDFA 3RZOB 2PZWA 1GUTA 1Y1VB 2EYMA 1AW7A 1H9JA 2KJXA 2F0LA 2WIIB 3PO3B 4RHRA 2L9HA 3QB3A 2XWJB 1JOKA 3TP7A 4PMCA 4DA2A 4KKSA 2CHBD 2IX3A 4C56C 1KTKA 4H0LC 1PLFA 3OMGA 2WAQB 2A74C 1A15A 2K32A 1F2YA 3GTKB 2RKSA 1GUGA 3EROA 1WCMB 1EYAA 1X32A 2F3VA 3HOZB 1SJHD 4IALA 3K5NA 2KEDA 1PRTF 4M8AA 1KABA 2Q8RE 1OXSC 4K2LA 1DOMA 2D2CC 3IKJA 3DWQA 1T5XD 1EY5A 5KYIA 2VB3X 1JR0D 1BXTA 1EQVA 1OO9B 2XWBB 2B2TC 2PMZB 1F9QA 5I2YA 5FKAC 2X6LA 2XIWA 5ISRA 1FD7D 1PTOF 3S14B 2K28A 1STGA 2F0QA 2HQEA 5JAVA 4N9PA 3IFDA 3DUZA 3K7AB 2R92B 1FGBD 2PQEA 2RBMA 3R8BA 1CTMA 4QB4A 4KHVA 3J80E 1Y8OB 2B8FA 1HUNA 2DNCA 2R61A 3S9WA 3DM1A 1TWAB 3W3AA 2XSCA 1S5DD 2BE5C 1EY8A 1PDQA 2A6ED 2EY1A 1ZXTA 1FYCA 1KDAA 3PUVA 3PO2B 2NUCA 4QF4A 2F0TA 4ZRZA 2A6HC 1SNDA 3DWAA 3J7YW 2OEOA 1EWHA 2F0IA 4RAUC 1DOKA 1EIHA 3BVGA 1E2ZA 1TR5A 4FO2A 5I4DA 3A55A 3U9SA 5A35A 3OIPA 3M7GA 3GTQB 3FMCA 2L11A 1DYQA 2F0GA 4J8QA 2M2LA 3SK6A 3NHHA 1BNZA 3HOYB 2JE6I 2RA4A 2PO4A 3KLRA 2GA4B 1GHJA 4QUCA 3BZDB 5I6WA 3PIO3 2H1EA 1EU3A 2IJ0A 3UI2A 4KD4A 2YYZA 1O7ZA 1JOOA 4BY1B 1VCIA 3K5MA 1AZPA 1I4PA 3R2TA 1SMYD 1C8CA 1F9PA 4TSSA 4DXFA 1IKMA 1T5EA 2KOLA 1I3QB 3FKIB 1LT3D 2Q8IB 1GUSA 3DWPA 4X3TA 2F0KA 1TVXA 1CM9A 4K5VA 3MXGA 3SK5A 4A93B 4IZ8A 5T1GA 3IFTA 4OO1H 3N52A 4R9WA 5ELEA 4H44C 4FYDA 2D5DA 4S3SA 1H9SA 3FVQA 1K83B 1BCPD 2C9OA 4CKBA 2JSOA 1A3TA 2CQAA 1H9KA 5LHY1 1Q90A 2HCCA 1PRTD 5J22A 4KHZA 1F2MA 5NUCA 3U9OA 1J8IA 1O7LA 4C3IB 4K6DA 1ILQA 1MD2D 4A3MB 4XT3B 2WV6D 1D1IA 3QOLA 4OIKA 3OMCA 4C1NK 3I73A 3NWTA 2JXMB 2KCNA 3C46A 3VYUA 5IODA 1KNAA 1QG7A 2F03A 3EQLC 1ENAA 1EY0A 3GTLB 3SK8A 2R3ZA 1LTAD 2O5JC 5ELFA 1PTOD 4HN7A 2NWGA 2F0PA 1FNVA 5E4WC 1YNJD 5CV6A 1A2TA 2F0VA 3NTKA 1TY0A 4NKLA 1F9RA 4HMIA 1EZ8A 1V1PB 5EKLA 5JPMC 1A6XA 1J9OA 4I7ZC 5IGBA 3A56A 3M7NA 2BOSA 4IUVA 3VYRA 2NN6H 2MHVA 4EQPA 3KBGA 4HMJA 3NSWA 1LT5D 4X3SA 1A3UA 4K14A 3CRLC 1TKWB 3A8IE 1TU2B 1BO0A 5G3LD 3PUXA 2NVXB 1GUNA 2B2VC 5D3IB 1PZKD 2BA0A 1CI3M 3P7JA 1B2TA 3A7LA 1HA5A 2KVMA 2B39A 3PUWA 1B4OA 5EKIA 3KK7A 5EPKA 4WJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FIN B;  3D6W A;  2B2U A;  3ONA B;  1CA5 A;  2B2U C;  1U4L A;  2X69 A;  3TN2 A;  2N88 A;  2FHT A;  1AZQ A;  4XT3 B;  5CBE E;  4RA8 A;  1WTW A;  4OIK A;  4RWS C;  1EOT A;  1U4M A;  3FDT A;  3Q6S A;  4NW2 A;  2HDM A;  4UAI A;  1BF4 A;  2FMM A;  1G6Z A;  3DEP A;  1PFM A;  2RSO A;  1VMC A;  1LV9 A;  3H91 A;  2KUM A;  1RHP A;  2DY7 A;  2L11 A;  5D65 A;  1MSH A;  1JE4 A;  1HFN A;  4IUT A;  3R93 A;  5JJZ A;  2K04 A;  1EL0 A;  4CJ1 B;  4CJ2 C;  2M2L A;  1KNA A;  1ROD A;  2B2T A;  1QG7 A;  2KEE A;  5AFW A;  2B2T C;  2EOT A;  4DN4 M;  4ZLT F;  1CA6 A;  3TZD A;  5COY A;  1BNZ A;  1NAP A;  4LMQ D;  1WTV A;  3I3C A;  4HCS A;  1NR4 A;  1F9Q A;  2RA4 A;  3KUP A;  4MHE A;  2Q8T A;  2KEC A;  3QO2 A;  1U4R A;  2NYZ D;  2R3Z A;  2X6L A;  2XIW A;  4IUP A;  2FFK B;  2IL8 A;  3GV3 A;  4QUC A;  1WVL A;  1DZ1 A;  1G2T A;  2H1E A;  3MTS A;  1SDF A;  2SDF A;  3UI2 A;  5EQ0 A;  4ZKC B;  1M8A A;  1O7Z A;  2B2Y A;  2L1B A;  4X3K A;  2B2Y C;  2K28 A;  3FPU B;  3HP3 A;  3DEO A;  5DNF A;  4ZK9 B;  2NWG A;  1WTO A;  1O7Y A;  5COR A;  1EQT A;  5E4W C;  2JYO A;  4IUR A;  1X3P A;  3IFD A;  5EPL A;  1G2S A;  1ML0 D;  1AZP A;  1HA6 A;  4XT1 B;  1BBX C;  1U4P A;  4ZAI A;  1HUM A;  1NR2 A;  1IL8 A;  5EPJ A;  1C8C A;  1F9P A;  1GUW A;  4MN3 A;  3MWY W;  4ZKB B;  1WTQ A;  2X6G A;  1IKM A;  2CVR A;  1WD0 A;  1F2L A;  1WTR A;  1IKL A;  2KOL A;  1B50 A;  2L4N A;  3G7L A;  2MPM A;  1F9R A;  2L9H A;  2D9U A;  1NCV A;  1DOL A;  2BDN A;  1X3Q A;  1ICW A;  1XX8 A;  1QNK A;  3LWE A;  1RJT A;  4X3T A;  2MJ8 A;  1MGS A;  1WTP A;  1J9O A;  1TVX A;  1PFB A;  1CM9 A;  1G91 A;  1MI2 A;  1ILP A;  2RSN A;  2EPB A;  1HUN A;  1MSG A;  4O42 A;  4HSV A;  4IUV A;  2K01 A;  5D14 A;  3SVM A;  2K05 A;  1B53 A;  2HDL A;  1JIC A;  1RTN A;  5E4X A;  3I91 A;  2N55 A;  3KBX A;  5T1G A;  1XYI A;  1HFG A;  1B3A A;  4R8I A;  2FJ2 A;  2MGS A;  1VMP A;  1PLF A;  2K03 A;  1Q3L A;  1QE6 A;  2K1B A;  3DM1 A;  3N52 A;  1SAP A;  4IUU A;  4OIJ A;  2HUG A;  1AP0 A;  4R9W A;  1DON A;  1A15 A;  4X3S A;  5EJW A;  5CBA E;  2HCI A;  2J7Z A;  2JP1 A;  3I8Z A;  4IUQ A;  1PDQ A;  4HAE A;  1WD1 A;  4HED A;  4QUF A;  1S4Z A;  1F9S A;  1E0B A;  1ZXT A;  1X32 A;  1RTO A;  1PFN A;  1KNE A;  2EE1 A;  5T1I A;  1BO0 A;  1ESR A;  2B2W A;  2B2W C;  3IL8 A;  1SSO A;  2KED A;  2B2V A;  2VXW A;  2B2V C;  4X3U A;  2HCC A;  4U68 A;  5EPK A;  2NZ1 D;  1O80 A;  2RVL A;  2Q8R E;  4CJ0 B;  3P7J A;  1B2T A;  1EIH A;  2KVM A;  1HHV A;  1EIG A;  3F2U A;  2DY8 A;  4XDX A;  1WTX A;  2L12 A;  2MP1 A;  3GV6 A;  1B4O A;  3I90 A;  1DOM A;  4RAU C;  1DOK A;  5EKI A;  5CMD A;  1J8I A;  1HRJ A;  1ILQ A; 
#chains in the Genus database with same CATH topology
 5BN4 A;  1STE A;  1GOZ A;  3S15 B;  1ZKO A;  3PGZ A;  1LTB D;  1X55 A;  5FLX L;  1PH7 A;  3Q6S A;  2CFM A;  2CKZ B;  5DM7 3;  1PZI D;  4Q5V A;  1XNR Q;  2QKI C;  5BN5 A;  1UE7 A;  1EL0 A;  4CJ2 C;  3TBI B;  1Y1W H;  4KD3 A;  2AUJ D;  1M1K C;  3LWU A;  1II3 A;  3J80 i;  4A3I H;  2MQH A;  1YVC A;  1WYD A;  4CDD C;  2KHS A;  3KLW A;  2F0E A;  1LTS D;  4C3J H;  4FF4 A;  4LFB Q;  3LX0 A;  4LF7 Q;  5K36 G;  1U5K A;  4L8J A;  4A3K B;  2CWP A;  3OW2 A;  2UUA Q;  5LMU Q;  3GTP H;  1HCZ A;  1TS3 A;  4A3K G;  5EPL A;  1CT1 D;  4PZ6 A;  4JI2 L;  4N9T A;  1L1O A;  2NTT A;  1VQC A;  4JK1 C;  3ULL A;  2IPK D;  5KRU A;  1EOV A;  3AB9 A;  5IWA L;  3WOE A;  4DV1 L;  2EXD A;  3C3L A;  2MJ8 A;  1HPC A;  2QF7 A;  5AJ3 L;  1S5F D;  5DLQ E;  4RFB A;  3L2P A;  2PI2 E;  1KXL A;  5C5M A;  4WJ4 A;  2JA7 B;  4JG2 A;  5E4X A;  2KCT A;  4A3D B;  4YWM A;  1VQK A;  4ME3 A;  3Q24 A;  3NBH A;  1DXM A;  2UXB L;  4PZ8 A;  4HJ8 A;  4YCV A;  1LM0 A;  2SNS A;  4K5X A;  4PMW A;  4AIM A;  4QQB X;  1B9M A;  5CV7 A;  4HAE A;  3G71 A;  3HOW B;  1F9S A;  2JJQ A;  4JCV E;  4JBK A;  1EYC A;  2XRQ D;  1X3F A;  4JOI C;  4GKJ Q;  2WIN B;  2VXW A;  1EEI D;  3BDC A;  2EZV A;  4L5R C;  1GHK A;  2R7Z B;  3T16 A;  2WB1 E;  1I4R A;  3FEW X;  4DAY A;  1FJG L;  2NTS A;  2LXJ A;  4A3B B;  1EWC A;  4RKB A;  2DY8 A;  4DK0 A;  3F2U A;  2R7Z G;  3NTH A;  4BWG B;  4POF A;  5KIX A;  5IY0 A;  3VR2 A;  2FHT A;  5JJL A;  3CMA A;  4FXK C;  3E9H A;  5GAH C;  4HIO A;  1BF4 A;  3S1N H;  1PFM A;  1LV9 A;  1RHP A;  5A2Q L;  2MNA A;  1EQQ A;  2PNR C;  3AYH B;  4BBR H;  3OWF A;  1K3B C;  3N6R A;  3ERS X;  1JWU D;  2VQF Q;  3UDF A;  4BA1 I;  1CA6 A;  3OWE B;  1SNP A;  1NAP A;  4ME5 A;  1SXT A;  4PMB A;  1K8A C;  2ENB A;  4IUP A;  4AQY L;  4PG3 A;  2FFK B;  1GO3 E;  3I4N B;  3STB D;  3K5L A;  5C0X H;  4ZCK A;  1AE3 A;  4ZKC B;  3I4M G;  2YTX A;  2B2Y C;  1SFO H;  5CGK A;  3PCO B;  3SEB A;  3HOV H;  4KN7 C;  5M5W H;  4DR1 L;  4EVO A;  4CKC A;  2F0N A;  5C4X G;  2NVQ H;  4C3H H;  1HUM A;  3OW7 A;  4DV7 L;  4HJA A;  2WAQ E;  1YIJ A;  5LMN Q;  4GOP C;  2K50 A;  2WB1 G;  3M4Q A;  2ZT9 C;  4P2C B;  5C44 G;  3H6M A;  2HHH L;  2JA5 H;  3MXN A;  3S2H B;  1IW7 D;  1SMY C;  2NB0 A;  1ILP A;  2F4V L;  4B3S L;  4P72 A;  2Q2U A;  2ZJP A;  3I91 A;  1ONL A;  2KCC A;  2SNM A;  1Y1V G;  2OT2 A;  2YTV A;  1QE6 A;  1IBK L;  1LLR D;  1SYD A;  2E2J H;  4JI5 L;  3TRZ A;  3HKS A;  1PYS B;  4B3R Q;  3KYH C;  3CCJ A;  3I56 A;  1R9T H;  2JP1 A;  3F8T A;  2JEA I;  3PO3 G;  4HED A;  1GUO A;  4O1N A;  1N34 L;  2B2W A;  2QEJ C;  3WOF A;  3I55 A;  2L0C A;  1HZ9 A;  4B9X A;  2NZ1 D;  2KCM A;  3BDO A;  4KKU A;  4X6A H;  4K8J A;  2PMZ E;  4XDX A;  1YHB A;  3CCQ A;  5JOB A;  4JVZ A;  2NVY H;  2UUB Q;  4NXN Q;  2IX0 A;  3EIV A;  2UUC Q;  1TWG H;  1NE3 A;  3V2T A;  4DV0 Q;  4F7X A;  2WAQ G;  5IT9 c;  4R4T A;  4RWS C;  3LGJ A;  3FDT A;  3FHW A;  2RSO A;  3H91 A;  5DAU A;  5K5P A;  1E22 A;  4IQZ A;  5C6A A;  3HOZ G;  2K14 A;  2F0O A;  4ZLT F;  1CKO A;  4GNX C;  2F0M A;  2N49 A;  1E1T A;  3V05 A;  1GJX A;  1Y1W B;  3KUP A;  2WKD A;  1EFI D;  2PZT A;  5E7N A;  4JI4 Q;  1LTL A;  4F8M A;  2F0H A;  3TS0 A;  4X3K A;  4QL5 A;  2M9V A;  4C3J B;  3HOU H;  1WTO A;  3CHB D;  3I4L A;  4LF6 Q;  1G2S A;  1ML0 D;  1MBY A;  3C1E A;  5IGD A;  3AFQ A;  3NK9 A;  1QOH A;  1RL2 A;  3D4D A;  3MWY W;  1VQD A;  3E0J A;  3OPO A;  2Y0S E;  3BYT B;  1XMO Q;  2MPM A;  1DOL A;  2IT1 A;  1SYF A;  5M3F H;  4PNY A;  1ICW A;  1RIP A;  2HQL A;  4X62 L;  5A2Q E;  1TWH H;  4DK6 C;  1JJG A;  4K5W A;  2TSS A;  2K05 A;  1V1P A;  1YHA A;  4QCL A;  1HH2 P;  3G6J B;  3TME A;  2XTI A;  1TII D;  3KLS A;  2FJ2 A;  2MGS A;  1KDC A;  3ND9 A;  1SEB D;  3T1Y Q;  3K57 A;  1Y8P B;  4L63 B;  3F2B A;  4AH6 A;  5EJW A;  4Y52 H;  2E75 C;  4OX9 Q;  3PQI A;  3PUY A;  3QJY A;  2VB2 X;  5J3B A;  2CW0 D;  2K75 A;  1HZC A;  3UE1 A;  3SHL A;  2JEB I;  4A3G H;  2UXD L;  3K81 C;  1XNQ L;  3M85 A;  2VQE Q;  1A3V A;  2IHF A;  4DR7 Q;  1SYE A;  1YNN C;  2Y0S B;  3T4A C;  2WFW A;  1X3E A;  2PYK A;  2I46 A;  4WFN 3;  2X69 A;  2Y0S G;  1S3O A;  1V8Q A;  1TY2 A;  3A8J E;  1G6Z A;  1VQF A;  4IFD G;  1EIF A;  5JEA H;  3GP7 A;  3H09 A;  2IHE A;  4OGQ C;  3S1N B;  2VUM H;  3NP8 A;  3PO2 G;  4R8N A;  3HKZ B;  1ROD A;  2B2T A;  4DN4 M;  5ELB A;  1D5X C;  1JWM D;  4BBR B;  4KY6 A;  1D7Q A;  4IPH A;  4C1N I;  2N8N A;  1LT6 D;  2PW5 A;  4L6T B;  1CHP D;  1ASY A;  2OTL A;  1P16 A;  1U4R A;  1Y8N B;  3QOJ A;  2R93 H;  1WVL A;  1UNS A;  3W1G A;  4A3L H;  2ID0 A;  4IUN A;  1ET6 A;  3TP8 A;  2F0W A;  1E1O A;  5COR A;  1EQT A;  1HQM C;  1HR0 L;  4H13 C;  5C4Z A;  4MN3 A;  1CSQ A;  5M5W B;  3HOV B;  1IBL L;  1F2L A;  1F77 A;  2NVQ B;  2K6A A;  4I65 A;  4C3H B;  3CD6 A;  2L4N A;  1Q1B A;  1X54 A;  1D5Z C;  4O0A A;  1ESF A;  3HOY G;  1RJT A;  4HID A;  1JCK B;  4KY7 A;  4RGO S;  1VQ7 A;  1CQF A;  3ZYY X;  4X64 Q;  1Q81 C;  2JA5 B;  1MSG A;  5TSS A;  1PH8 A;  1LTT D;  3MXP A;  3URY A;  1N33 L;  2F3W A;  3MFY A;  1OXV A;  4R8I A;  4WOR A;  4BY1 G;  4FF3 A;  5IP9 H;  3KF6 B;  3VR5 A;  2QDB A;  3S1R H;  2P5Z X;  4K0K L;  4CKE A;  3J81 L;  1VQP A;  4IUQ A;  4GLX A;  1WD1 A;  3S16 B;  2E2J B;  2LMC B;  4O2D A;  5KNB A;  3GTM H;  1N36 Q;  1R9T B;  2A68 C;  2NZO A;  2Z6K A;  1KNE A;  5FLM G;  2K5V A;  1L0Y B;  3FKI G;  1SSO A;  1H9R A;  4B3M Q;  1IHZ A;  2XNA C;  4KV6 A;  5HGT A;  4C2M H;  1IBM Q;  2K7V A;  4JI8 Q;  3T56 B;  3ITP A;  4A93 G;  3MEH A;  2MO1 A;  5L37 A;  1NMG A;  5BN3 A;  3RR5 A;  5IP7 H;  4DU9 A;  1V43 A;  3CU7 A;  4X65 Q;  1PYW D;  4DV3 Q;  1SYB A;  4E6I A;  3TN2 A;  3T1H Q;  3CXC A;  2QIL A;  2LKV A;  2RCF A;  1TWG B;  5KND A;  3OTO Q;  2Q2H A;  4KTA A;  4UAI A;  1SNQ A;  2EJF C;  3MFG A;  1BBU A;  3K7U C;  2DY7 A;  1PH5 A;  2OTJ A;  4XYQ A;  1OXX K;  1R4P B;  4BXX H;  2ICI A;  4GKK L;  2EJG C;  1KAA A;  1BKB A;  1M90 C;  5KYL A;  3CPW A;  5IOC A;  4MHE A;  4IOC A;  4B3T Q;  1PH1 A;  2NYZ D;  5LL6 S;  1GD7 A;  5ELD A;  1DZ1 A;  3VYT A;  4JI1 L;  2YU9 H;  5CC4 A;  4C3I G;  4BBS H;  1NUC A;  4DNT B;  4DR6 Q;  1XWE A;  4TRD A;  1CQV A;  2B8G A;  1M8A A;  2L1B A;  2Q2I A;  3D4W A;  4CBV A;  5KEE A;  4ZK9 B;  4A3M G;  5IYB H;  1PZJ D;  4GOP B;  1S5E D;  2JYO A;  5EAY A;  1KAW A;  3HOU B;  2UXC Q;  1GUW A;  2VZA A;  4DK1 A;  4DR2 L;  4KI0 A;  1WD0 A;  1AH9 A;  5M9O A;  3R2I A;  3G7L A;  4HJ5 A;  1NSN S;  1SJE D;  1E7Z A;  5C3E H;  1E2W A;  2JA6 H;  1ZYR D;  2RQX A;  1I5F A;  3GQB A;  4B9W A;  1MI2 A;  2EPB A;  1TWF H;  2EY6 A;  5M3F B;  5D14 A;  1TS4 A;  4G7O C;  2H5X A;  1EZ6 A;  2HDL A;  1JIC A;  3TDQ A;  1I50 B;  1XTC D;  5FJ8 H;  1SE3 A;  3TEH B;  4A76 A;  2F4I A;  4XQN A;  2O2L D;  1EY7 A;  3VA5 A;  2UU9 Q;  3NQI A;  3U4Z A;  2QEX A;  1HZA A;  1JJ2 A;  2E2H H;  1LTI D;  1V1O A;  1K73 C;  2F0J A;  3X3M A;  2JA8 B;  4LFB L;  3QG1 A;  4LF7 L;  2VS1 A;  5LL6 X;  3CAM A;  1BCP B;  2UUA L;  4XXE A;  2JA8 G;  3RN2 A;  3S17 B;  5D3D A;  2HIV A;  4TQU S;  2PCF B;  2L5T A;  2RDF A;  4R4I A;  1VQ8 A;  5C4H A;  4JBJ A;  1E2V A;  2QW7 A;  4ALP A;  2MP1 A;  3IRB A;  4A3G B;  3RZO H;  1FNU A;  4RH6 A;  2TMP A;  1J6Q A;  1WFQ A;  3SK4 A;  3JAM c;  4KY5 A;  2N88 A;  1O78 A;  4XYO A;  5CBE E;  4LF5 Q;  1PYB A;  2BDO A;  2K5D A;  3HZX A;  4KMU C;  4LF8 L;  1YEZ A;  3H0G H;  3PIP A;  2EVB A;  3HRZ C;  5IYD G;  3A54 A;  4KK7 A;  3KJO A;  2G9H D;  1Y14 B;  5M3M B;  4MTN A;  1TXY A;  3GDE A;  2LS0 1;  3J81 E;  3NTI A;  4RHS A;  2RCN A;  5M3M G;  4V0B A;  3VR6 A;  1RF2 D;  2LY7 A;  1CZW A;  1G2T A;  1MIU A;  2LFN A;  3T51 B;  2BE5 D;  1Q8K A;  4YHH Q;  4G7Z C;  5JVH 3;  2R93 B;  1EY6 A;  2B63 H;  3FPP A;  3D0F A;  3MAQ A;  4JI6 Q;  1X3P A;  4GKJ L;  2R6G A;  4V19 0;  1CK1 A;  1VF7 A;  2PPB C;  1IYU A;  4L5Q A;  5EPJ A;  1VQI A;  1WCM H;  3RUZ A;  1JQY D;  4ZKB B;  5EBD A;  3PV0 A;  4DR3 Q;  1SRO A;  3UDI A;  4J1M A;  1Z7T A;  1Q1E A;  2D9U A;  3C2P A;  3RZD B;  1FL0 A;  4KHP Q;  3HOX H;  1X3Q A;  1LTR D;  2IX1 A;  4Y7N H;  1RTN A;  3VYS A;  3QR8 A;  2K1B A;  3KLS X;  4A3F B;  5C4J H;  1WI5 A;  3E0E A;  2I07 B;  5I6Y A;  4LF4 Q;  2J7Z A;  3G6E A;  4A3F G;  1ENC A;  1R4Q B;  3I70 A;  1S40 A;  2R7D A;  1STN A;  1Q8I A;  1TS2 A;  4Q0F A;  3GTM B;  2B2V A;  1HJP A;  1ICF B;  1SNO A;  4HCE A;  4AYB B;  2DN8 A;  2YV5 A;  4DPG A;  2VW9 A;  4RGT A;  2JA7 G;  1JE5 A;  4A3J H;  1ZEQ X;  1EIY B;  4JBM A;  2KA7 A;  2MUY A;  1XTD A;  4A3D G;  5LMN L;  4G4K A;  3BS1 A;  3GTG H;  2B2U C;  1HZB A;  1PXU A;  4OO1 G;  4RA8 A;  4DGZ A;  2RHQ B;  3CKI B;  1WTW A;  1WOC A;  1I6V C;  2MO0 A;  4DUZ Q;  2R92 H;  3HOW G;  4UHV A;  3R3O A;  4LWC A;  2DJF C;  2A73 B;  1JE4 A;  3W2D A;  3U58 A;  3F2D A;  4F87 A;  3OYY A;  5FLX c;  2A6E C;  2ICE C;  1D6E C;  2EOT A;  3E3X A;  5JJK A;  4A3E B;  5CV9 A;  5COY A;  1DD2 A;  3D31 A;  1TS5 A;  4HIK A;  5ELO A;  4B3R L;  4OO1 I;  4A3B G;  3T13 A;  4A3E G;  1Q86 C;  3J7A F;  3S2D B;  4ZUJ A;  4BXX G;  3GV3 A;  5FO8 B;  4XIG S;  4JYA Q;  1SNC A;  3A8K E;  4JI7 Q;  1NY4 A;  3FPU B;  2EYH A;  5DNF A;  2YU9 B;  1CHQ D;  4EGV A;  4BBS B;  1SYG A;  4RCN A;  1CKN B;  4R4Q A;  1BBX C;  4ZAI A;  3TP5 A;  5KNC A;  1XPU A;  3D6C A;  2OF1 A;  1YIT A;  3ER0 A;  3AMU A;  4NXN L;  4OWT B;  4EQN A;  2UUB L;  1B9N A;  1NCV A;  3UE0 A;  2AWO A;  1XPO A;  4DV0 L;  1XX8 A;  4KN4 C;  1VS0 A;  4EQO A;  5GAD C;  1I4H A;  2Z1C A;  3V96 A;  5BR8 Q;  5C3E B;  1W6K A;  3ICE A;  3I4N G;  2E2D C;  3TZU A;  2ALY B;  1B53 A;  3BYY B;  2C5C A;  1TWF B;  3NPP A;  3S1Q H;  1SAP A;  2HUG A;  1HTL D;  2PZU A;  4RKL A;  1K3R A;  2RDH A;  3HG9 A;  3SE0 A;  4UDU C;  5I2X A;  1YZ6 A;  5FO7 B;  2AQ3 B;  4R4C A;  2F0S A;  1JB3 A;  3KF6 A;  3L3O C;  1ENF A;  4JI4 L;  3L9A X;  1XPR A;  1SBB B;  4JPB W;  4QMG A;  4JOI A;  3IL8 A;  1HNZ Q;  3J7A V;  3H3V C;  1FNW A;  1S5B D;  4X3U A;  1EY9 A;  1I4X A;  4LF6 L;  2L55 A;  3T53 B;  4CJ0 B;  1AEX A;  1HTP A;  1OXU A;  2DNE A;  4JI0 L;  1SYC A;  1YNX A;  2OWO A;  2AUK A;  1PA6 A;  3RNU A;  4ILW A;  2NN6 G;  4LUZ A;  1VF5 C;  2Z9H A;  2I5L X;  1UE1 A;  1U4M A;  3J81 j;  2A69 D;  3PSI A;  2IWH A;  3RLO A;  2KUM A;  4GS3 A;  2F0D A;  3AU7 A;  5D65 A;  1KHI A;  1JC7 A;  1FJG Q;  1CKM A;  2KHI A;  4CJ1 B;  3H0G B;  1LUZ A;  1P8L A;  1K8M A;  4ZQ3 A;  4DXG A;  5IYC H;  3T1Y L;  2M00 A;  4LF9 L;  2NN6 I;  1BCP C;  4J6H A;  3J7A 5;  4LMQ D;  5CV8 A;  3WDN A;  4DAP A;  3K8A A;  2XN9 C;  4RG1 A;  1HQR D;  1RD9 D;  1V9P A;  4ABN A;  1PRT C;  3MTS A;  2PQA B;  1RKN A;  4NMZ A;  1PH4 A;  3M9B A;  1EU4 A;  2B2Y A;  1G6P A;  4BY7 H;  5E1F A;  3RLN A;  3DMU A;  3RN5 A;  1KL9 A;  1HA6 A;  1U0L A;  1U4P A;  1LAB A;  1NR2 A;  4FVM A;  2B63 B;  5FOB B;  1WTQ A;  1EY4 A;  2CVR A;  2N78 A;  4GOP A;  3BVZ A;  2VQE L;  1IKL A;  4WJW A;  1C4Q A;  4A3C H;  4FNF A;  3CC4 A;  3EBE A;  4DR7 L;  3NEN A;  3C1F A;  5JPN C;  1BCP F;  2ZXO A;  4IN3 A;  3J80 c;  4FDB A;  1SN8 A;  3F2C A;  1Y1W G;  4A3I B;  3RMH A;  1LTG D;  4BS9 A;  1G91 A;  3HS0 C;  3K5O A;  4FF1 A;  1WJJ A;  3MC0 B;  3NE5 B;  3HOX B;  3SVM A;  3BG3 A;  4A3I G;  1PMR A;  1JT8 A;  3KOJ A;  1FR3 A;  2EYP A;  5M5X H;  4IO9 A;  1VQN A;  1ZYR C;  1VMP A;  4MZ9 A;  4C3J G;  4DUY Q;  2QGQ A;  2NBF A;  3GTP B;  4Y7N B;  3Q8D A;  1AP0 A;  4DR4 Q;  3M4Y A;  3H3V H;  5C3W A;  1K8G A;  1A8V A;  1PTO C;  2HHH Q;  3GTO H;  4HIM A;  5C4J B;  1CFM A;  3BVM A;  3EJI A;  4HR7 B;  1E0B A;  1YNJ C;  2F0U A;  4LFC Q;  2HIX A;  4K6L A;  4M1U B;  1PFN A;  4KKT A;  2F4V Q;  1GVP A;  3PF4 A;  1IYV A;  5M5Y H;  3D4R A;  3J81 i;  4CHT B;  1DJR D;  1D1K A;  2EYJ A;  1U9R A;  1K28 A;  2V1C C;  1O80 A;  1XMQ Q;  1HHV A;  3HKZ E;  4DAV A;  1X9N A;  3K6O A;  2ZTC A;  1HRJ A;  4YY3 Q;  4LW1 A;  1U4L A;  4A3J B;  1D8L A;  4DK3 C;  2VNU D;  1XXG A;  5I9P A;  1HNX Q;  4G57 A;  4K2K A;  2K5W A;  2O5I C;  1EOT A;  3GTG B;  4PV1 C;  2CWA A;  2E74 C;  2FMM A;  4F88 A;  4X64 L;  5IT9 E;  2DUD A;  4OXP A;  4ODG A;  3S1M H;  3RLF A;  4CDF C;  1Z6H A;  2K04 A;  3PUZ A;  1VQ5 A;  1SE8 A;  3KF8 B;  1A2U A;  2WP8 J;  4GLA C;  2EDG A;  3NXW A;  4GNX A;  1KIX A;  1NMF A;  4XQJ A;  2BH2 A;  3VA7 A;  2ASB A;  4PZ7 A;  1WTV A;  4MTK A;  2RHS B;  1S5C D;  4XQQ A;  3PIO A;  5GQO A;  2KEC A;  3BZK A;  4HSP A;  3TRE A;  1VQ4 A;  1CZG A;  1N36 L;  3EN2 A;  3D3R A;  3HEJ A;  3M4O H;  2EY2 A;  3HFZ B;  1O7Y A;  1SLJ A;  2EYL A;  4IUR A;  5E3F A;  2Z0S A;  1VQ9 A;  1N32 L;  4B3M L;  4PQX A;  2EXZ A;  4JI8 L;  2X6G A;  2QCP X;  1Y69 U;  1WTR A;  1B50 A;  4DV6 Q;  3HKZ G;  3KFU A;  4DV3 L;  3RD4 A;  4BBR G;  3OIQ A;  5G3L F;  5J39 A;  3T1H L;  1I6H H;  4JI3 L;  1DGS A;  5HGQ A;  1G29 1;  4DAY B;  4IFD I;  1PTO H;  4HSV A;  4XTC S;  3MHB A;  2F3I A;  4LFA Q;  3KBX A;  2N55 A;  4WRD A;  1B70 B;  4OON A;  3NQT A;  3K0Y A;  4DV5 Q;  2Z8L A;  3CCR A;  5ELC A;  3CRK C;  1QJO A;  2OQK A;  1SFO B;  2DGY A;  1BR9 A;  4NP5 A;  5C0X G;  3FRP B;  2F52 A;  3S1Q B;  1ET9 A;  4NB3 A;  3IAY A;  4GZY C;  3HOV G;  1STA A;  4B3T L;  4X62 Q;  4DV2 Q;  1BQQ T;  5FO9 B;  4NXM L;  2SOB A;  4TKO B;  4C3H G;  3GTJ H;  2EE1 A;  5IGG A;  2DJG C;  4P74 A;  2Z4H A;  1TWC H;  1QUQ B;  3MXU A;  3WWV A;  2G9D A;  1F2Z A;  3W5O A;  3PMF A;  5C0X I;  2JA5 G;  1D5M C;  3CPF A;  5DM6 3;  5K36 H;  4UP9 A;  4YCW A;  2UXC L;  2SEB D;  3I90 A;  1OXT A;  2J4X A;  3LNN A;  3E6Z X;  3A5Z B;  3ONA B;  4A3K H;  1CA5 A;  3CCS A;  4LJZ C;  4LK1 C;  4P75 A;  2OXP A;  3DEP A;  4U67 3;  1UEB A;  3BDL A;  2UXD Q;  4I7A A;  1VDZ A;  1PHJ A;  4G7H C;  3I4O A;  4X66 L;  3MZ5 A;  2KEE A;  3MXN B;  3TZD A;  4ULL A;  4GN4 B;  3I3C A;  4HCS A;  2E76 C;  1Z47 A;  2AHO B;  5EGT A;  1BUV T;  4IPC A;  2NVY B;  4LUV A;  3CW2 C;  1SDF A;  3K59 A;  1I4Q A;  5EQ0 A;  1QVG A;  5IGC A;  3HP3 A;  4JW0 A;  4RGN A;  1MHW C;  1STY A;  2WAC A;  3VR4 A;  4XT1 B;  4BY7 B;  1W3S A;  1STH A;  4OL7 A;  3EA6 A;  3OHX C;  1QCB D;  1CKN A;  4QJF A;  5FK9 C;  2PW7 A;  1G8Z D;  3LWE A;  1WTP A;  1MGS A;  4LF5 L;  2E2I H;  3Q23 A;  1B8A A;  1HXY D;  3DXJ C;  2R7Z H;  2RSN A;  1KDB A;  1UE5 A;  1KD1 C;  3JAM L;  3SR1 A;  1GXD C;  3NBI A;  4HJ7 A;  1HFG A;  5IIF A;  1B3A A;  2GVA A;  1IBL Q;  2A1A A;  2K03 A;  1Q3L A;  4IUU A;  3STB C;  4DV4 L;  3M3Y H;  1H95 A;  3K58 A;  4DR5 L;  2E5L Q;  3K0X A;  1DON A;  5M5X B;  1DM0 B;  5C5L A;  3I72 A;  2HCI A;  2KQ3 A;  1NJI C;  3HOU G;  1AFP A;  1QVF A;  4RCO A;  3U50 C;  4QUF A;  3DM3 A;  3GTO B;  5KGU A;  1YI2 A;  5T1I A;  1JWS D;  2NVT H;  5JVG 3;  3CQZ H;  3OSO A;  2FMC A;  4ID6 A;  4U68 A;  1XNR L;  2RVL A;  1SNM A;  1TWH B;  1I94 Q;  5M5Y B;  4IJH A;  2JK8 A;  5M3F G;  2BA1 A;  3I4M H;  1A62 A;  5HY6 A;  3ND8 A;  1WTX A;  1IW7 C;  3GV6 A;  5IGE A;  4DR3 L;  2CH4 A;  3SGI A;  3CCL A;  3I2Z A;  4IFD J;  5C4X H;  4KLK A;  5EKK A;  1MKH A;  4DFA A;  1AZQ A;  4KHP L;  4B08 A;  1BOS A;  4A4I A;  1RCV D;  4NW2 A;  2HDM A;  3ULJ A;  1PV4 A;  4YIJ A;  4IPG A;  2EYO A;  4DNI A;  5C44 H;  2J0T D;  5LMU L;  1TT2 A;  3KJP A;  5I9O A;  3EFX D;  3S1M B;  1PRT B;  2AWN A;  4KJN A;  2A69 C;  3CCV A;  4LF4 L;  1C9O A;  5EBC A;  1NR4 A;  1SRU A;  1DCZ A;  3QWN A;  3PF5 A;  4Z9C B;  4CDE C;  1B1Z A;  1Y1V H;  4IOA A;  4A3G G;  3SDZ A;  5C0X J;  2EY5 A;  2ZM6 Q;  4CGY B;  3DEO A;  3QIA A;  4BA2 I;  3MEF A;  2AQ1 B;  3PO3 H;  1H9M A;  4UPA A;  4RGM A;  2PQA A;  3NWS A;  2V4D A;  2NZH A;  3M4O B;  1J5E Q;  2D0O A;  1LT4 D;  2I5M X;  3VR3 A;  1SE4 A;  1KRT A;  5CYU A;  1L0W A;  1L1O C;  2VUM B;  2GVB A;  1HNW Q;  4FF2 A;  2BDN A;  5JEA G;  2L15 A;  4ZYS A;  1QNK A;  2VUM G;  3P1H A;  2HD3 A;  1QWY A;  1YNN D;  2BCO A;  1M4V A;  4DUZ L;  3X3N A;  1N8R C;  1I6H B;  1IL2 A;  1K8O A;  1PTO B;  4AYB E;  3TP6 A;  4DR2 Q;  2R93 G;  1KC8 C;  3GTK H;  4A3L G;  3B6Y A;  3OOC A;  4OIJ A;  4JV5 Q;  3A74 A;  4WJ3 M;  5CBA E;  4P71 A;  3A7A B;  5IGF A;  2A6H D;  4YWL A;  3HOZ H;  3I8Z A;  3UDG A;  1B7Y B;  4QIW B;  1RTO A;  1QB5 D;  2GN5 A;  3FP9 A;  3TSS A;  4JYA L;  4JI7 L;  3JC6 6;  3KDF B;  3NUC A;  1MJC A;  4YWK A;  3GTJ B;  2KHJ A;  5F2D A;  3S24 A;  2ZJQ A;  5CV5 A;  1VQA A;  1TWC B;  2EYF A;  4EQ5 A;  2IY5 B;  1EQR A;  2L12 A;  2VQF L;  5CMD A;  1HR0 W;  4GN5 A;  1BDO A;  3P75 A;  2ZJR A;  3TQY A;  2AKW B;  2I0Q A;  1Q82 C;  3EVQ A;  5CV4 A;  3S1R B;  5H1S E;  3MVV A;  5IP9 G;  1PH6 A;  3JAM E;  1GM5 A;  1LO5 D;  1QNU A;  3ERQ A;  1VMC A;  5CR3 A;  5BR8 L;  4IUT A;  5C3X A;  3R93 A;  3PIP 3;  5AFW A;  4AYB G;  1MJE A;  1EYD A;  2CW0 C;  4YCU A;  4C2M B;  3S14 H;  3KF8 A;  3NEM A;  2Q8T A;  2WKC A;  1VQH A;  3H94 A;  2IL8 A;  2D62 A;  1JOR A;  4LF8 Q;  1PVO A;  3D8G A;  3K7A H;  3BJU A;  5IP7 G;  1HNZ L;  3HGB A;  3SXH A;  3L7Z C;  1VQO A;  2A68 D;  2JA9 A;  1IL8 A;  1I4G A;  1Q46 A;  1X56 A;  1Z9F A;  4N8X 1;  2C35 B;  1AE2 A;  1PFS A;  2ZXP A;  2F0F A;  2H4O A;  2ES2 A;  1TQO A;  4OHJ A;  1ASZ A;  5HUR A;  3J7Z C;  4OWW B;  4HTH A;  4NDX A;  2IW3 A;  1PFB A;  4FP5 D;  4ZUI A;  1UEA B;  4O42 A;  2K01 A;  1T9H A;  1TWA H;  3CCM A;  1XYI A;  2E2I B;  1JOQ A;  2YTY A;  2K5N A;  3E5S A;  4FXG C;  5JJI A;  1QZG A;  1UUP A;  1S72 A;  4MIU A;  4BBS G;  1H9S B;  3CCU A;  3GD7 A;  1D2B A;  2F1M A;  3BZC A;  4IFD H;  3DLL A;  4P73 A;  5J1Z A;  5IE8 A;  3ZJY C;  3UDX A;  5IYB G;  3M3Y B;  1C0A A;  2UUC L;  3PO2 H;  1S4Z A;  1KLG D;  1RDP D;  2K33 A;  2R7F A;  2ZXR A;  4EX5 A;  2RDG A;  1ESR A;  1VQJ A;  2B2W C;  2JA6 B;  1EEF D;  2EJM A;  4KJO A;  5DEH A;  4H7B A;  5IT9 L;  2NVT B;  5C3E G;  3CQZ B;  4JI2 Q;  2JA6 G;  2E8G A;  2K5Q A;  1EIG A;  2O4X A;  1QUQ A;  2XVS A;  2Z4I A;  2FIN B;  3D6W A;  2B2U A;  5IWA Q;  4DNR B;  3I4M B;  1B44 D;  4DV1 Q;  3DHQ A;  5AJ3 Q;  3GTQ H;  5FJ8 G;  1Q12 A;  1Q7Y C;  1LAC A;  1UAP A;  1X3G A;  3Q22 A;  1C48 A;  5C4X B;  1BBW A;  1W6J A;  2EIF A;  3MA2 B;  3Q0A A;  2E2H B;  2XRS D;  1AN8 A;  4K8I A;  3J80 L;  1MSH A;  1SE2 A;  1HFN A;  5JEA J;  5JJZ A;  3HOY H;  2WB1 B;  3O13 A;  1X65 A;  1KLU D;  3GO5 A;  5C44 B;  4DUY L;  4JC0 A;  1VQ6 A;  2UXB Q;  4TVA B;  4LAA A;  4DF7 A;  4DR4 L;  5FLX E;  3QO2 A;  1XMO L;  2A5H A;  1QIL A;  1STB A;  4JBW A;  3CCE A;  4BY1 H;  1L0X B;  1IXR A;  3P20 A;  2AQ2 B;  4FXD A;  2SDF A;  4MNO A;  3RZO B;  4LFC L;  2PZW A;  1GUT A;  2K52 A;  1Y1V B;  1UE6 A;  2EYM A;  1AW7 A;  1H9J A;  2KJX A;  2F0L A;  5GAE C;  1XMQ L;  5FLM H;  2WII B;  3S16 H;  1I3Q H;  3FKI H;  3PO3 B;  4RHR A;  2CH4 W;  3H0G G;  1PH3 A;  1JJC B;  2L9H A;  3QB3 A;  4YY3 L;  2EQS A;  5GAG C;  4OX9 L;  2XWJ B;  4A93 H;  1JOK A;  3TP7 A;  1HNX L;  4PMC A;  4DA2 A;  4KKS A;  1VQB A;  2CHB D;  2IX3 A;  4GN3 B;  4C56 C;  1KTK A;  4H0L C;  1PLF A;  3OMG A;  2WAQ B;  2A74 C;  1A15 A;  2K32 A;  2AMC B;  1F2Y A;  3GTK B;  2RKS A;  2B63 G;  1K83 H;  1GUG A;  4AQY Q;  3ERO A;  1VQG A;  1C7Y A;  1WCM B;  3VDY A;  1EYA A;  1X32 A;  2F3V A;  3HOZ B;  4LNQ A;  1WCM G;  1SJH D;  4UP7 A;  4IAL A;  3K5N A;  2KED A;  4DR1 Q;  1EUJ A;  1PRT F;  4M8A A;  1KAB A;  2Q8R E;  2K4K A;  4C3I H;  2QA4 A;  1OXS C;  4DV7 Q;  3HOX G;  3TS2 A;  4K2L A;  1DOM A;  2D2C C;  4A3M H;  3IKJ A;  2A19 A;  4LUO A;  1YJ9 A;  2PNH A;  3M4P A;  4DV6 L;  3DWQ A;  2ZTE A;  3G48 A;  1YBY A;  1T5X D;  4B3S Q;  1SMX A;  1EY5 A;  5KYI A;  1BVS A;  2VB3 X;  1JR0 D;  1BXT A;  4LFA L;  4DV5 L;  4JI0 Q;  1IBK Q;  1EQV A;  1OO9 B;  3GTL H;  1IZ6 A;  4JI5 Q;  2XWB B;  2B2T C;  2PMZ B;  1N9W A;  3A0J A;  2KEN A;  1F9Q A;  4OWX B;  5I2Y A;  5FKA C;  1QZH A;  1N34 Q;  2X6L A;  2XIW A;  3K80 C;  1A63 A;  5ISR A;  1FD7 D;  1PTO F;  4DV2 L;  1I50 H;  3S14 B;  1EFW A;  4A3J G;  2K28 A;  1STG A;  2F0Q A;  4DKA C;  2HQE A;  5JAV A;  4N9P A;  1L1O B;  3IFD A;  3DUZ A;  3K7A B;  1QVC A;  1PH2 A;  3AEV A;  3CME A;  4LF9 Q;  4R4O A;  2R92 B;  1FGB D;  2PQE A;  2RBM A;  3F1Z A;  3CC2 A;  1NBW A;  2JA8 H;  2R92 G;  1SR3 A;  3R8B A;  2RF4 A;  5LMN W;  3S17 H;  3G4S A;  1CTM A;  4QB4 A;  4KHV A;  3J80 E;  1Y8O B;  2B8F A;  1HUN A;  2DNC A;  2R61 A;  4H02 A;  3NBH B;  1O7I A;  3S9W A;  3DM1 A;  1V1Q A;  1TWA B;  3W3A A;  1YJN A;  1KRS A;  1IBM L;  1EWI A;  2OQ0 A;  2XSC A;  1S5D D;  2BE5 C;  3JAM i;  1EY8 A;  1OTC A;  5IYD H;  4X65 L;  1PDQ A;  2A6E D;  2EY1 A;  1ZXT A;  2NVX H;  1FYC A;  1KDA A;  2Z6K C;  4UY8 C;  3PUV A;  3PO2 B;  4CDC C;  3OTO L;  2NUC A;  4QF4 A;  4HJ9 A;  2F0T A;  5M3M H;  5GRO A;  4ZRZ A;  2A6H C;  1SND A;  1G51 A;  1CSP A;  3DWA A;  3J7Y W;  2OEO A;  5ELN A;  1VQL A;  2HT1 A;  3KDF A;  3S15 H;  1E24 A;  1EWH A;  2F0I A;  4RAU C;  1NTG A;  1DOK A;  1EIH A;  3BVG A;  3ULP A;  1E2Z A;  1TR5 A;  4FO2 A;  5I4D A;  3A55 A;  1W2B A;  3U9S A;  5A35 A;  3OIP A;  3M7G A;  2A8V A;  2B29 A;  2VY3 A;  4DR6 L;  3GTQ B;  3BU2 A;  1NNX A;  3FMC A;  1YHQ A;  2L11 A;  2LSS A;  1DYQ A;  2F0G A;  4J8Q A;  2M2L A;  4J15 A;  3A5U A;  3RZD H;  1VQM A;  3SK6 A;  3NHH A;  1BNZ A;  1YJW A;  3HOY B;  2JE6 I;  2E5L L;  2RA4 A;  2PO4 A;  3KLR A;  2GA4 B;  1GHJ A;  3AQQ A;  4QUC A;  3BZD B;  1XJV A;  2KBN A;  3CC7 A;  5I6W A;  3L0O A;  3PIO 3;  2H1E A;  1EU3 A;  1UWV A;  2IJ0 A;  3UI2 A;  2MFI A;  1GKH A;  2YYZ A;  4IPD A;  4KD4 A;  1O7Z A;  1K0S A;  1JOO A;  4BY1 B;  1WTH A;  4A3F H;  2G5D A;  1VCI A;  3K5M A;  1AZP A;  1XNQ Q;  1I4P A;  3R2T A;  1SMY D;  1C8C A;  1F9P A;  4TSS A;  2N3S A;  4DXF A;  1I94 L;  1IKM A;  1T5E A;  1K0R A;  2ATW A;  2KOL A;  2I5H A;  1I3Q B;  3FKI B;  2UU9 L;  1LYL A;  1LT3 D;  1GUS A;  3DWP A;  4X3T A;  2Q8I B;  2F0K A;  1L2F A;  2JA7 H;  1TVX A;  1CM9 A;  5IYC G;  4K5V A;  3MXG A;  4A3D H;  1X6O A;  3SK5 A;  4A93 B;  1PH9 A;  1N32 Q;  2VL6 A;  4IZ8 A;  5T1G A;  3IFT A;  2B3G A;  4OO1 H;  1B3Q A;  3N52 A;  3CF5 A;  4R9W A;  3HOW H;  4BY7 G;  2D0P A;  4R1J A;  4L5S A;  5ELE A;  4H44 C;  4JI3 Q;  2D5D A;  4FYD A;  4S3S A;  1H9S A;  3FVQ A;  1K83 B;  1BCP D;  2C9O A;  3I7F A;  1E3P A;  4CKB A;  3E9I A;  2JSO A;  2ZM6 L;  1A3T A;  2CQA A;  1H9K A;  5LHY 1;  3H15 A;  4A3C G;  4A3B H;  4A3E H;  1Q90 A;  2HCC A;  1HR0 Q;  1PRT D;  5J22 A;  3CP0 A;  4L5T A;  4KHZ A;  2PI2 A;  3S2D H;  1J5E L;  1F2M A;  5NUC A;  3U9O A;  1J8I A;  1O7L A;  4C3I B;  4K6D A;  4POG A;  1ILQ A;  1MD2 D;  1JB7 A;  1HNW L;  4NXM Q;  4A3M B;  4XT3 B;  2WV6 D;  1D1I A;  2Q2T A;  4QGU A;  3QOL A;  4OIK A;  3OMC A;  4C1N K;  1IYJ B;  1N33 Q;  3I73 A;  4N8F A;  4YHH L;  3NWT A;  1JMC A;  2QDL A;  2JXM B;  2KCN A;  4A75 A;  3C46 A;  3J81 c;  1EYG A;  3AFP A;  3VYU A;  4JI6 L;  5IOD A;  1KNA A;  4RMF A;  1QG7 A;  3W1B A;  2F03 A;  4JV5 L;  3EQL C;  1FVI A;  3I4N H;  1ENA A;  1EY0 A;  2XGT A;  3GTL B;  4K0K Q;  3SK8 A;  2R3Z A;  1LTA D;  3H3V I;  2O5J C;  2JN4 A;  5ELF A;  1PTO D;  4HN7 A;  2NWG A;  2CCZ A;  2F0P A;  1FNV A;  5E4W C;  4X66 Q;  4IJL A;  1YNJ D;  2JQO A;  5CV6 A;  1A2T A;  2F0V A;  4GLV B;  3NTK A;  2CQO A;  1TY0 A;  1K9M C;  4NKL A;  3S2H H;  4DAM A;  1A0I A;  1F9R A;  4HMI A;  1EZ8 A;  1FGU A;  1V1P B;  5EKL A;  5JPM C;  1A6X A;  1J9O A;  4QIW E;  4I7Z C;  5IGB A;  3A56 A;  2OCE A;  3M7N A;  2BOS A;  4IUV A;  3VYR A;  2NN6 H;  4APV A;  2MHV A;  2K5H A;  4EQP A;  4OEM B;  3KBG A;  4GKK Q;  4HMJ A;  3NSW A;  1LT5 D;  2Z6B A;  4NPS A;  4X3S A;  1A3U A;  4K14 A;  3CRL C;  4JI1 Q;  2LXK A;  1TKW B;  3A8I E;  1TU2 B;  3U4V A;  1BO0 A;  4GNX B;  5G3L D;  2BH8 A;  3PUX A;  2FXQ A;  2NVX B;  1GUN A;  2B2V C;  5D3I B;  1KQS A;  1PZK D;  4OEL B;  2BA0 A;  4DV4 Q;  1CI3 M;  3P7J A;  1CUK A;  3A7L A;  4QY7 A;  1B2T A;  1HA5 A;  2KVM A;  4DR5 Q;  4UP8 A;  2B39 A;  3PUW A;  1B4O A;  5EKI A;  3KK7 A;  5EPK A;  3NEL A;  1VQE A;  2ZTD A; 
#chains in the Genus database with same CATH homology
 5BN4 A;  1STE A;  1GOZ A;  3S15 B;  1ZKO A;  1LTB D;  5FLX L;  3Q6S A;  5DM7 3;  1PZI D;  4Q5V A;  2QKI C;  5BN5 A;  1EL0 A;  4CJ2 C;  3TBI B;  4KD3 A;  2AUJ D;  3LWU A;  1II3 A;  2KHS A;  2F0E A;  1LTS D;  4FF4 A;  3LX0 A;  5K36 G;  4L8J A;  4A3K B;  1HCZ A;  1TS3 A;  5EPL A;  1CT1 D;  4N9T A;  2NTT A;  4JK1 C;  2IPK D;  5KRU A;  3AB9 A;  3WOE A;  3C3L A;  2MJ8 A;  1HPC A;  2QF7 A;  1S5F D;  4RFB A;  5C5M A;  2JA7 B;  5E4X A;  4A3D B;  3Q24 A;  3NBH A;  1DXM A;  2SNS A;  4K5X A;  4PMW A;  1B9M A;  5CV7 A;  4HAE A;  3HOW B;  1F9S A;  1EYC A;  2XRQ D;  2WIN B;  2VXW A;  1EEI D;  3BDC A;  2EZV A;  1GHK A;  2R7Z B;  3T16 A;  4DAY A;  1I4R A;  3FEW X;  2NTS A;  4A3B B;  1EWC A;  4RKB A;  2DY8 A;  4DK0 A;  3F2U A;  3NTH A;  4BWG B;  5KIX A;  3VR2 A;  2FHT A;  4FXK C;  1BF4 A;  1PFM A;  1LV9 A;  1RHP A;  5A2Q L;  2PNR C;  3OWF A;  3N6R A;  1JWU D;  1CA6 A;  4BA1 I;  3OWE B;  1SNP A;  1NAP A;  4ME5 A;  1SXT A;  4PMB A;  2ENB A;  4IUP A;  2FFK B;  3I4N B;  3K5L A;  5C0X H;  4ZKC B;  2B2Y C;  5CGK A;  3SEB A;  4KN7 C;  4EVO A;  4CKC A;  2F0N A;  1HUM A;  3OW7 A;  2ZT9 C;  4P2C B;  3H6M A;  3MXN A;  3S2H B;  1IW7 D;  1SMY C;  2NB0 A;  1ILP A;  3I91 A;  1ONL A;  2KCC A;  2SNM A;  2OT2 A;  1QE6 A;  1LLR D;  1SYD A;  2JP1 A;  2JEA I;  4HED A;  1GUO A;  4O1N A;  2B2W A;  2QEJ C;  3WOF A;  2L0C A;  4B9X A;  2NZ1 D;  3BDO A;  4KKU A;  4K8J A;  4XDX A;  5JOB A;  2IX0 A;  3V2T A;  4F7X A;  4RWS C;  3FDT A;  2RSO A;  3H91 A;  5DAU A;  5K5P A;  4IQZ A;  5C6A A;  2F0O A;  4ZLT F;  2F0M A;  3V05 A;  1GJX A;  1Y1W B;  3KUP A;  2WKD A;  1EFI D;  2PZT A;  4F8M A;  2F0H A;  4X3K A;  2M9V A;  4C3J B;  1WTO A;  3CHB D;  3I4L A;  1G2S A;  1ML0 D;  1MBY A;  3C1E A;  5IGD A;  3NK9 A;  1QOH A;  3D4D A;  3MWY W;  3E0J A;  3OPO A;  3BYT B;  2MPM A;  1DOL A;  2IT1 A;  1SYF A;  4PNY A;  1ICW A;  5A2Q E;  4K5W A;  2TSS A;  2K05 A;  1V1P A;  4QCL A;  3G6J B;  3TME A;  1TII D;  3KLS A;  2FJ2 A;  2MGS A;  1KDC A;  3ND9 A;  1SEB D;  3K57 A;  1Y8P B;  4L63 B;  5EJW A;  2E75 C;  3PUY A;  3QJY A;  2VB2 X;  2CW0 D;  3SHL A;  2JEB I;  3M85 A;  1A3V A;  1SYE A;  1YNN C;  2Y0S B;  3T4A C;  2PYK A;  2I46 A;  4WFN 3;  2X69 A;  1V8Q A;  1TY2 A;  3A8J E;  1G6Z A;  4IFD G;  5JEA H;  3GP7 A;  3H09 A;  4OGQ C;  3S1N B;  3NP8 A;  4R8N A;  3HKZ B;  1ROD A;  2B2T A;  4DN4 M;  5ELB A;  1D5X C;  1JWM D;  4BBR B;  4KY6 A;  4C1N I;  1LT6 D;  2PW5 A;  4L6T B;  1CHP D;  1U4R A;  1Y8N B;  3QOJ A;  1WVL A;  1UNS A;  2ID0 A;  4IUN A;  1ET6 A;  3TP8 A;  2F0W A;  5COR A;  1EQT A;  1HQM C;  4H13 C;  5C4Z A;  4MN3 A;  3HOV B;  5M5W B;  1F2L A;  1F77 A;  2NVQ B;  2K6A A;  4I65 A;  4C3H B;  2L4N A;  1Q1B A;  1D5Z C;  1ESF A;  1RJT A;  1JCK B;  4KY7 A;  4RGO S;  1CQF A;  3ZYY X;  2JA5 B;  1MSG A;  5TSS A;  1LTT D;  3MXP A;  3URY A;  2F3W A;  3MFY A;  1OXV A;  4R8I A;  4WOR A;  4FF3 A;  3VR5 A;  2QDB A;  4CKE A;  3J81 L;  4IUQ A;  3S16 B;  1WD1 A;  2E2J B;  2LMC B;  5KNB A;  1R9T B;  2A68 C;  1KNE A;  1L0Y B;  1SSO A;  1H9R A;  1IHZ A;  2XNA C;  4KV6 A;  5HGT A;  2K7V A;  3T56 B;  3ITP A;  3MEH A;  5BN3 A;  4DU9 A;  1V43 A;  3CU7 A;  1PYW D;  1SYB A;  4E6I A;  3TN2 A;  2QIL A;  2LKV A;  1TWG B;  5KND A;  4KTA A;  4UAI A;  1SNQ A;  2EJF C;  3MFG A;  2DY7 A;  4XYQ A;  1OXX K;  1R4P B;  2ICI A;  2EJG C;  1KAA A;  5KYL A;  5IOC A;  4MHE A;  2NYZ D;  5LL6 S;  5ELD A;  1DZ1 A;  3VYT A;  5CC4 A;  4C3I G;  1NUC A;  4DNT B;  1XWE A;  4TRD A;  1CQV A;  2B8G A;  1M8A A;  2L1B A;  3D4W A;  4CBV A;  5KEE A;  4ZK9 B;  1PZJ D;  1S5E D;  2JYO A;  3HOU B;  1GUW A;  4DK1 A;  4KI0 A;  1WD0 A;  5M9O A;  3R2I A;  3G7L A;  1NSN S;  1SJE D;  1E2W A;  1ZYR D;  2RQX A;  3GQB A;  4B9W A;  1MI2 A;  2EPB A;  2EY6 A;  5M3F B;  5D14 A;  1TS4 A;  4G7O C;  1EZ6 A;  2HDL A;  1JIC A;  3TDQ A;  1I50 B;  1XTC D;  1SE3 A;  2F4I A;  4XQN A;  2O2L D;  1EY7 A;  3VA5 A;  3NQI A;  1LTI D;  1V1O A;  2F0J A;  3X3M A;  2JA8 B;  3QG1 A;  5LL6 X;  1BCP B;  4XXE A;  3S17 B;  5D3D A;  4TQU S;  2PCF B;  2L5T A;  2RDF A;  5C4H A;  1E2V A;  2MP1 A;  4A3G B;  1FNU A;  4RH6 A;  2TMP A;  3SK4 A;  4KY5 A;  2N88 A;  1O78 A;  4XYO A;  5CBE E;  2BDO A;  2K5D A;  3HZX A;  4KMU C;  2EVB A;  3HRZ C;  3A54 A;  4KK7 A;  2G9H D;  5M3M B;  2LS0 1;  3J81 E;  3NTI A;  4RHS A;  4V0B A;  3VR6 A;  1RF2 D;  2LY7 A;  1CZW A;  1G2T A;  2LFN A;  3T51 B;  2BE5 D;  4G7Z C;  5JVH 3;  2R93 B;  1EY6 A;  3FPP A;  3MAQ A;  1X3P A;  2R6G A;  4V19 0;  1CK1 A;  1VF7 A;  2PPB C;  1IYU A;  5EPJ A;  3RUZ A;  1JQY D;  4ZKB B;  5EBD A;  3PV0 A;  4J1M A;  1Z7T A;  1Q1E A;  2D9U A;  3C2P A;  3RZD B;  1X3Q A;  1LTR D;  2IX1 A;  1RTN A;  3VYS A;  2K1B A;  3KLS X;  4A3F B;  5I6Y A;  2I07 B;  2J7Z A;  1ENC A;  1R4Q B;  3I70 A;  1STN A;  1Q8I A;  1TS2 A;  4Q0F A;  3GTM B;  2B2V A;  1SNO A;  4HCE A;  4AYB B;  2DN8 A;  4RGT A;  1ZEQ X;  2KA7 A;  2MUY A;  4G4K A;  3BS1 A;  2B2U C;  1PXU A;  4OO1 G;  4RA8 A;  4DGZ A;  1WTW A;  3CKI B;  1I6V C;  3R3O A;  2A73 B;  1JE4 A;  3W2D A;  4F87 A;  2A6E C;  2ICE C;  1D6E C;  2EOT A;  4A3E B;  5CV9 A;  5COY A;  1DD2 A;  3D31 A;  1TS5 A;  4OO1 I;  3T13 A;  3J7A F;  3S2D B;  4ZUJ A;  3GV3 A;  5FO8 B;  4XIG S;  1SNC A;  3A8K E;  3FPU B;  2EYH A;  5DNF A;  2YU9 B;  1CHQ D;  4EGV A;  4BBS B;  1SYG A;  4RCN A;  1BBX C;  4ZAI A;  3TP5 A;  5KNC A;  3D6C A;  2OF1 A;  3AMU A;  4EQN A;  1B9N A;  1NCV A;  2AWO A;  1XX8 A;  4KN4 C;  4EQO A;  1I4H A;  2Z1C A;  3V96 A;  5C3E B;  1W6K A;  2E2D C;  3TZU A;  1B53 A;  3BYY B;  2C5C A;  1TWF B;  3NPP A;  1SAP A;  2HUG A;  1HTL D;  2PZU A;  4RKL A;  2RDH A;  3HG9 A;  3SE0 A;  4UDU C;  5I2X A;  5FO7 B;  2AQ3 B;  2F0S A;  1JB3 A;  3L3O C;  1ENF A;  3L9A X;  1SBB B;  4QMG A;  3IL8 A;  3J7A V;  3H3V C;  1S5B D;  1FNW A;  4X3U A;  1EY9 A;  1I4X A;  2L55 A;  3T53 B;  4CJ0 B;  1AEX A;  1HTP A;  1OXU A;  2DNE A;  1SYC A;  2AUK A;  4ILW A;  2NN6 G;  1VF5 C;  1U4M A;  2A69 D;  2IWH A;  2KUM A;  2F0D A;  3AU7 A;  5D65 A;  1JC7 A;  4CJ1 B;  3H0G B;  1K8M A;  4ZQ3 A;  4DXG A;  2M00 A;  2NN6 I;  1BCP C;  4J6H A;  4LMQ D;  5CV8 A;  3WDN A;  4DAP A;  2XN9 C;  1HQR D;  1RD9 D;  4ABN A;  1PRT C;  3MTS A;  1RKN A;  4NMZ A;  1EU4 A;  2B2Y A;  5E1F A;  3DMU A;  1HA6 A;  1U4P A;  1LAB A;  1NR2 A;  4FVM A;  2B63 B;  5FOB B;  1WTQ A;  1EY4 A;  2CVR A;  3BVZ A;  1IKL A;  1C4Q A;  4FNF A;  5JPN C;  3C1F A;  1BCP F;  2ZXO A;  4IN3 A;  4A3I B;  3RMH A;  1LTG D;  4BS9 A;  1G91 A;  3HS0 C;  3K5O A;  4FF1 A;  3MC0 B;  3NE5 B;  3HOX B;  3SVM A;  3BG3 A;  1PMR A;  1FR3 A;  2EYP A;  1ZYR C;  1VMP A;  4C3J G;  2NBF A;  3GTP B;  4Y7N B;  1AP0 A;  3M4Y A;  5C3W A;  1PTO C;  5C4J B;  1CFM A;  3BVM A;  3EJI A;  4HR7 B;  1E0B A;  1YNJ C;  2F0U A;  4K6L A;  4M1U B;  1PFN A;  4KKT A;  1IYV A;  3D4R A;  4CHT B;  1DJR D;  1D1K A;  2EYJ A;  1U9R A;  1O80 A;  1HHV A;  4DAV A;  3K6O A;  1HRJ A;  1U4L A;  4A3J B;  2VNU D;  1XXG A;  5I9P A;  4G57 A;  4K2K A;  2K5W A;  2O5I C;  1EOT A;  3GTG B;  4PV1 C;  2E74 C;  2FMM A;  4F88 A;  5IT9 E;  4ODG A;  3RLF A;  1Z6H A;  2K04 A;  3PUZ A;  1A2U A;  2WP8 J;  2EDG A;  3NXW A;  4XQJ A;  3VA7 A;  1WTV A;  1S5C D;  4XQQ A;  2KEC A;  4HSP A;  1CZG A;  3D3R A;  3HEJ A;  2EY2 A;  1O7Y A;  5E3F A;  2EYL A;  4IUR A;  4PQX A;  2EXZ A;  2X6G A;  2QCP X;  1Y69 U;  1WTR A;  1B50 A;  3RD4 A;  3OIQ A;  5G3L F;  5J39 A;  1G29 1;  4IFD I;  1PTO H;  4HSV A;  4XTC S;  3MHB A;  3KBX A;  2N55 A;  4WRD A;  3NQT A;  3K0Y A;  2Z8L A;  5ELC A;  3CRK C;  1QJO A;  1SFO B;  1BR9 A;  4NP5 A;  5C0X G;  3FRP B;  3S1Q B;  1ET9 A;  3IAY A;  4GZY C;  1STA A;  1BQQ T;  5FO9 B;  2SOB A;  4TKO B;  4C3H G;  2EE1 A;  5IGG A;  2Z4H A;  3MXU A;  2G9D A;  1F2Z A;  3PMF A;  5C0X I;  1D5M C;  5DM6 3;  5K36 H;  2SEB D;  3I90 A;  1OXT A;  2J4X A;  3LNN A;  3E6Z X;  3ONA B;  1CA5 A;  4LJZ C;  4LK1 C;  2OXP A;  3DEP A;  4U67 3;  3BDL A;  1VDZ A;  4G7H C;  3MZ5 A;  2KEE A;  3TZD A;  4ULL A;  3I3C A;  4HCS A;  2E76 C;  1Z47 A;  5EGT A;  1BUV T;  2NVY B;  1SDF A;  3K59 A;  1I4Q A;  5EQ0 A;  5IGC A;  3HP3 A;  4RGN A;  1STY A;  2WAC A;  3VR4 A;  4XT1 B;  4BY7 B;  1STH A;  4OL7 A;  3EA6 A;  3OHX C;  1QCB D;  5FK9 C;  2PW7 A;  1G8Z D;  3LWE A;  1WTP A;  1MGS A;  3Q23 A;  1HXY D;  3DXJ C;  2RSN A;  1KDB A;  3JAM L;  3SR1 A;  1GXD C;  3NBI A;  1HFG A;  5IIF A;  1B3A A;  2K03 A;  1Q3L A;  4IUU A;  3K58 A;  1DON A;  5M5X B;  1DM0 B;  5C5L A;  3I72 A;  2HCI A;  2KQ3 A;  1AFP A;  4RCO A;  4QUF A;  3GTO B;  5KGU A;  5T1I A;  1JWS D;  5JVG 3;  3OSO A;  2FMC A;  4ID6 A;  4U68 A;  2RVL A;  1SNM A;  1TWH B;  5M5Y B;  2BA1 A;  3ND8 A;  1WTX A;  1IW7 C;  3GV6 A;  5IGE A;  4IFD J;  5EKK A;  4DFA A;  1AZQ A;  4B08 A;  1BOS A;  1RCV D;  4NW2 A;  2HDM A;  4YIJ A;  2EYO A;  2J0T D;  1TT2 A;  5I9O A;  3EFX D;  3S1M B;  1PRT B;  2AWN A;  4KJN A;  2A69 C;  5EBC A;  1NR4 A;  1DCZ A;  3QWN A;  4Z9C B;  1B1Z A;  3SDZ A;  5C0X J;  2EY5 A;  4CGY B;  3DEO A;  3QIA A;  4BA2 I;  2AQ1 B;  1H9M A;  4RGM A;  3NWS A;  2V4D A;  3M4O B;  1LT4 D;  3VR3 A;  1SE4 A;  5CYU A;  2VUM B;  4FF2 A;  2BDN A;  5JEA G;  4ZYS A;  1QNK A;  3P1H A;  1QWY A;  1YNN D;  2BCO A;  1M4V A;  3X3N A;  1I6H B;  1K8O A;  1PTO B;  3TP6 A;  3OOC A;  4OIJ A;  5CBA E;  3A7A B;  5IGF A;  2A6H D;  3I8Z A;  4QIW B;  1RTO A;  1QB5 D;  3TSS A;  3NUC A;  3GTJ B;  5F2D A;  5CV5 A;  1TWC B;  2EYF A;  2L12 A;  5CMD A;  1BDO A;  3P75 A;  3EVQ A;  5CV4 A;  3S1R B;  3MVV A;  3JAM E;  1LO5 D;  1QNU A;  3ERQ A;  1VMC A;  5CR3 A;  4IUT A;  5C3X A;  3R93 A;  3PIP 3;  5AFW A;  1EYD A;  2CW0 C;  4C2M B;  3KF8 A;  2Q8T A;  2WKC A;  3H94 A;  2IL8 A;  2D62 A;  1JOR A;  3D8G A;  3HGB A;  3SXH A;  3L7Z C;  2A68 D;  1IL8 A;  1I4G A;  2ZXP A;  2F0F A;  2H4O A;  1TQO A;  4OHJ A;  5HUR A;  4HTH A;  4NDX A;  2IW3 A;  1PFB A;  4FP5 D;  4ZUI A;  1UEA B;  4O42 A;  2K01 A;  1XYI A;  2E2I B;  1JOQ A;  3E5S A;  4FXG C;  1UUP A;  4MIU A;  1H9S B;  3GD7 A;  1D2B A;  2F1M A;  4IFD H;  5J1Z A;  3M3Y B;  1S4Z A;  1KLG D;  1RDP D;  2K33 A;  2ZXR A;  2RDG A;  1ESR A;  2B2W C;  2JA6 B;  1EEF D;  2EJM A;  4KJO A;  5DEH A;  4H7B A;  5IT9 L;  2NVT B;  3CQZ B;  2K5Q A;  1EIG A;  2O4X A;  2XVS A;  2Z4I A;  2FIN B;  3D6W A;  2B2U A;  4DNR B;  3I4M B;  1B44 D;  3DHQ A;  1Q12 A;  1LAC A;  1UAP A;  3Q22 A;  1C48 A;  5C4X B;  3MA2 B;  1W6J A;  3Q0A A;  2E2H B;  2XRS D;  1AN8 A;  4K8I A;  3J80 L;  1MSH A;  1SE2 A;  1HFN A;  5JEA J;  5JJZ A;  2WB1 B;  3O13 A;  1KLU D;  3GO5 A;  5C44 B;  4LAA A;  4DF7 A;  5FLX E;  3QO2 A;  2A5H A;  1QIL A;  1STB A;  4JBW A;  1L0X B;  3P20 A;  2AQ2 B;  4FXD A;  2SDF A;  3RZO B;  2PZW A;  1GUT A;  1Y1V B;  2EYM A;  1AW7 A;  1H9J A;  2KJX A;  2F0L A;  2WII B;  3PO3 B;  4RHR A;  2L9H A;  3QB3 A;  2XWJ B;  1JOK A;  3TP7 A;  4PMC A;  4DA2 A;  4KKS A;  2CHB D;  2IX3 A;  4C56 C;  1KTK A;  4H0L C;  1PLF A;  3OMG A;  2WAQ B;  2A74 C;  1A15 A;  2K32 A;  1F2Y A;  3GTK B;  2RKS A;  1GUG A;  3ERO A;  1WCM B;  1EYA A;  1X32 A;  2F3V A;  3HOZ B;  1SJH D;  4IAL A;  3K5N A;  2KED A;  1PRT F;  4M8A A;  1KAB A;  2Q8R E;  1OXS C;  4K2L A;  1DOM A;  2D2C C;  3IKJ A;  3DWQ A;  1T5X D;  1EY5 A;  5KYI A;  2VB3 X;  1JR0 D;  1BXT A;  1EQV A;  1OO9 B;  2XWB B;  2B2T C;  2PMZ B;  1F9Q A;  5I2Y A;  5FKA C;  2X6L A;  2XIW A;  5ISR A;  1FD7 D;  1PTO F;  3S14 B;  2K28 A;  1STG A;  2F0Q A;  2HQE A;  5JAV A;  4N9P A;  3IFD A;  3DUZ A;  3K7A B;  2R92 B;  1FGB D;  2PQE A;  2RBM A;  3R8B A;  1CTM A;  4QB4 A;  4KHV A;  3J80 E;  1Y8O B;  2B8F A;  1HUN A;  2DNC A;  2R61 A;  3S9W A;  3DM1 A;  1TWA B;  3W3A A;  2XSC A;  1S5D D;  2BE5 C;  1EY8 A;  1PDQ A;  2A6E D;  2EY1 A;  1ZXT A;  1FYC A;  1KDA A;  3PUV A;  3PO2 B;  2NUC A;  4QF4 A;  2F0T A;  4ZRZ A;  2A6H C;  1SND A;  3DWA A;  3J7Y W;  2OEO A;  1EWH A;  2F0I A;  4RAU C;  1DOK A;  1EIH A;  3BVG A;  1E2Z A;  1TR5 A;  4FO2 A;  5I4D A;  3A55 A;  3U9S A;  5A35 A;  3OIP A;  3M7G A;  3GTQ B;  3FMC A;  2L11 A;  1DYQ A;  2F0G A;  4J8Q A;  2M2L A;  3SK6 A;  3NHH A;  1BNZ A;  3HOY B;  2JE6 I;  2RA4 A;  2PO4 A;  3KLR A;  2GA4 B;  1GHJ A;  4QUC A;  3BZD B;  5I6W A;  3PIO 3;  2H1E A;  1EU3 A;  2IJ0 A;  3UI2 A;  4KD4 A;  2YYZ A;  1O7Z A;  1JOO A;  4BY1 B;  1VCI A;  3K5M A;  1AZP A;  1I4P A;  3R2T A;  1SMY D;  1C8C A;  1F9P A;  4TSS A;  4DXF A;  1IKM A;  1T5E A;  2KOL A;  1I3Q B;  3FKI B;  1LT3 D;  2Q8I B;  1GUS A;  3DWP A;  4X3T A;  2F0K A;  1TVX A;  1CM9 A;  4K5V A;  3MXG A;  3SK5 A;  4A93 B;  4IZ8 A;  5T1G A;  3IFT A;  4OO1 H;  3N52 A;  4R9W A;  5ELE A;  4H44 C;  4FYD A;  2D5D A;  4S3S A;  1H9S A;  3FVQ A;  1K83 B;  1BCP D;  2C9O A;  4CKB A;  2JSO A;  1A3T A;  2CQA A;  1H9K A;  5LHY 1;  1Q90 A;  2HCC A;  1PRT D;  5J22 A;  4KHZ A;  1F2M A;  5NUC A;  3U9O A;  1J8I A;  1O7L A;  4C3I B;  4K6D A;  1ILQ A;  1MD2 D;  4A3M B;  4XT3 B;  2WV6 D;  1D1I A;  3QOL A;  4OIK A;  3OMC A;  4C1N K;  3I73 A;  3NWT A;  2JXM B;  2KCN A;  3C46 A;  3VYU A;  5IOD A;  1KNA A;  1QG7 A;  2F03 A;  3EQL C;  1ENA A;  1EY0 A;  3GTL B;  3SK8 A;  2R3Z A;  1LTA D;  2O5J C;  5ELF A;  1PTO D;  4HN7 A;  2NWG A;  2F0P A;  1FNV A;  5E4W C;  1YNJ D;  5CV6 A;  1A2T A;  2F0V A;  3NTK A;  1TY0 A;  4NKL A;  1F9R A;  4HMI A;  1EZ8 A;  1V1P B;  5EKL A;  5JPM C;  1A6X A;  1J9O A;  4I7Z C;  5IGB A;  3A56 A;  3M7N A;  2BOS A;  4IUV A;  3VYR A;  2NN6 H;  2MHV A;  4EQP A;  3KBG A;  4HMJ A;  3NSW A;  1LT5 D;  4X3S A;  1A3U A;  4K14 A;  3CRL C;  1TKW B;  3A8I E;  1TU2 B;  1BO0 A;  5G3L D;  3PUX A;  2NVX B;  1GUN A;  2B2V C;  5D3I B;  1PZK D;  2BA0 A;  1CI3 M;  3P7J A;  1B2T A;  3A7L A;  1HA5 A;  2KVM A;  2B39 A;  3PUW A;  1B4O A;  5EKI A;  3KK7 A;  5EPK A;  4WJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...