1G2SA

Solution structure of eotaxin-3
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
71
structure length
71
Chain Sequence
TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EOTAXIN-3
publication title NMR solution structure and backbone dynamics of the CC chemokine eotaxin-3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 8
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2000-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1g2sA00
1DONA 1EL0A 3GV6A 5CORA 1WD0A 1Q3LA 2KEDA 4OIKA 3SVMA 2B2TC 1WTQA 1AP0A 2BDNA 1DZ1A 2RVLA 2L4NA 1BBXC 1VMPA 1ILQA 5EKIA 5EPJA 3FDTA 4DN4M 1WTXA 4ZLTF 2RA4A 2X69A 2FHTA 1SSOA 4XDXA 4ZK9B 2J7ZA 3G7LA 2IL8A 1U4PA 3DEOA 3F2UA 1X3PA 2K01A 3ONAB 2B2UA 4QUCA 1F9PA 5JJZA 5DNFA 2XIWA 2KECA 1HRJA 1SDFA 1IKLA 1RTOA 2FFKB 2KUMA 4RAUC 3R93A 4ZKBB 4R8IA 1WTWA 1WTVA 1U4LA 2L9HA 1M8AA 1KNEA 1BNZA 2B2UC 1X32A 4HEDA 1WD1A 1RODA 1F9SA 1U4MA 1F9RA 2FINB 5EQ0A 4CJ0B 1O80A 3MWYW 5EJWA 4QUFA 1CM9A 1X3QA 4RA8A 1JE4A 2X6LA 4RWSC 4X3SA 4ZKCB 1MSHA 3MTSA 2RSOA 1IKMA 1XX8A 2B2WC 4UAIA 4X3TA 1AZPA 1B53A 2L11A 2NYZD 3TZDA 1DOKA 2HCIA 2MJ8A 2Q8TA 3TN2A 1ZXTA 2EE1A 4U68A 1BO0A 4CJ2C 2KVMA 3DM1A 2B2VA 1E0BA 1J9OA 4ZAIA 1EOTA 2MPMA 1HUMA 2NZ1D 5CBAE 3IL8A 4X3KA 1ML0D 2R3ZA 1HFNA 2HDMA 2KOLA 1F2LA 1EIGA 5E4WC 1HA6A 4IUQA 2B2WA 1WTPA 1HUNA 1WVLA 5EPLA 3N52A 4IUPA 2B2VC 2KEEA 1QNKA 2D9UA 1RJTA 2NWGA 1B2TA 4HSVA 5EPKA 5T1IA 2CVRA 3I8ZA 1DOLA 4HAEA 1PDQA 3D6WA 1B4OA 1A15A 1BF4A 3KUPA 1MI2A 2L1BA 3I90A 1SAPA 4IUVA 2B2YA 1O7YA 2DY8A 2N55A 1CA5A 1HHVA 1LV9A 2MGSA 5D65A 4IUUA 2EOTA 1QG7A 4MN3A 2K28A 1EQTA 4XT3B 1AZQA 4OIJA 1EIHA 1F9QA 2DY7A 1XYIA 1B50A 2K1BA 1WTRA 2RSNA 2B2YC 1U4RA 1TVXA 3I3CA 1PLFA 1J8IA 2SDFA 5CMDA 1MSGA 1RHPA 1NAPA 5CBEE 3LWEA 1ILPA 1PFMA 1G6ZA 1VMCA 3UI2A 1KNAA 1G2TA 2L12A 2K03A 3Q6SA 4NW2A 1WTOA 1JICA 1MGSA 1DOMA 3QO2A 5D14A 1S4ZA 3H91A 5E4XA 1C8CA 2HUGA 3P7JA 1PFNA 2JYOA 4HCSA 1QE6A 2N88A 3HP3A 3IFDA 4X3UA 2VXWA 2HCCA 2H1EA 2K04A 1ICWA 1NR4A 1B3AA 1RTNA 2JP1A 4MHEA 1GUWA 1CA6A 2FMMA 1ESRA 2X6GA 1IL8A 2K05A 2EPBA 4CJ1B 1NCVA 3KBXA 1O7ZA 4R9WA 2HDLA 3DEPA 3I91A 2Q8RE 4IURA 2B2TA 5AFWA 3GV3A 2FJ2A 1HFGA 3FPUB 4LMQD 5COYA 1PFBA 5T1GA 4IUTA 4O42A 1G2SA 1NR2A 1G91A 4XT1B 2MP1A 2M2LA
chains in the Genus database with same CATH superfamily
4AIMA 1LLRD 4GLXA 1EIFA 2B2TC 1VQDA 1I50B 2BDNA 2NVYB 5BN5A 3PO3H 1CI3M 1FNUA 4GN5A 2FXQA 3G7LA 2JXMB 2K01A 1XPOA 2QGQA 1JCKB 3ND9A 3S1QH 1NSNS 1GUSA 4BXXH 3S9WA 1E24A 2PYKA 2B3GA 1YITA 4Y7NB 4PQXA 3AU7A 3A8KE 4RWSC 3G6JB 4KKUA 2ALYB 1IBKL 1R4PB 2E2JH 4A3FH 1LUZA 2BDOA 2NTSA 2ZM6L 2F4VQ 1C7YA 3BDCA 2KA7A 5CV4A 2JA6B 2A68C 2NVTB 4R1JA 4IO9A 2D2CC 4C3HH 3S1RH 3GTLB 4X62Q 1SMYD 3VR5A 4DR2Q 2CVRA 4LWCA 4I7ZC 4B3TL 2E2HB 1V1OA 3S1NH 3HZXA 1JR0D 4MN3A 3L7ZC 5C4JB 1F9QA 1S40A 4A3KH 1N33L 4CGYB 3CF5A 1M90C 4B3RQ 1UEBA 3FRPB 3WWVA 5HGTA 2SEBD 1LT6D 5C5MA 4KK7A 5NUCA 1T5EA 5E7NA 1SE8A 3VYSA 4PZ6A 2K5WA 1QWYA 3CQZH 3OW2A 3HP3A 1XPRA 4BS9A 4POFA 4O2DA 4JI7L 1VQOA 4ZUJA 2IY5B 1BVSA 4DR3L 2L0CA 1TIID 3I91A 3IRBA 3M4OB 4L63B 1BKBA 5AFWA 2EZVA 4LF5L 2DJGC 2MQHA 4HR7B 3KLSX 4PMWA 2F0MA 4KN7C 1HZAA 1MJEA 1G2SA 3I4NB 1SNOA 1SNQA 1CQVA 3UE0A 4GN3B 3SVMA 2F0NA 2I46A 2RVLA 1BBXC 4G57A 4DV3L 4DV6L 1SEBD 2IL8A 3S16B 3BVMA 4QUCA 2CKZB 3UDXA 2F0QA 2A5HA 3A55A 5M5XH 2G9HD 2CCZA 4IOCA 4A3JH 5IWAL 5CGKA 3TP5A 2UXCQ 1FYCA 1FGBD 1HTPA 2I0QA 1JORA 2ZJPA 2XRQD 2OTLA 1SN8A 3ND8A 2NUCA 3MWYW 1S3OA 1CM9A 1GUTA 5C4XH 2YTVA 1AFPA 3RZOH 4C1NI 4A3LG 1IBLQ 2IX3A 3T1HL 2PZUA 3KDFA 2JA8H 4P71A 2CH4A 1EEFD 4PZ7A 2QCPX 1K8AC 4X3KA 1ML0D 5BR8Q 4X64L 5C3EG 4DNRB 1N9WA 1RF2D 3PIOA 1GJXA 2NZOA 1XNRL 4C3JB 3I8ZA 3T13A 3HOYB 2K5NA 5IIFA 1PH6A 3S15B 1HHVA 1VQAA 4A3DB 1B3QA 4F87A 1WFQA 2XWJB 1ICFB 1Q86C 4YCVA 1TWCB 3ULJA 1XNQL 3C1EA 3ULLA 3I3CA 4KKTA 3S1MH 2UXBQ 5G3LD 4RGOS 1JJGA 4LF9L 2UU9L 4ZUIA 1HXYD 5IE8A 3DM3A 1A62A 2K03A 1R9TB 3I55A 1SYEA 4JI6L 1SNMA 1N34L 2PQAB 3H0GB 4NXNL 4GKJQ 4M8AA 2N88A 2Y0SG 3K8AA 2FMMA 1CHPD 4BY7G 1T5XD 5C0XJ 4ODGA 1WCMB 3AMUA 4XQJA 4LK1C 1J5EL 2BE5C 4RCOA 3I2ZA 3DUZA 1A0IA 1VQIA 4BY1H 3CPFA 3S14H 2E2DC 1DD2A 1V1QA 1PH4A 3NE5B 5EKIA 3NEMA 3K0XA 3PF5A 1I3QB 4XDXA 2VUMB 4P75A 1UAPA 1TWFH 1ZEQX 1LTAD 5K5PA 1YHQA 2NVQH 5A2QL 1RTOA 5IYCG 3S2DB 4OWTB 1Z7TA 1U4LA 4DXGA 3U9SA 5C4ZA 3NBHA 1CK1A 1F9SA 1AE3A 1CFMA 2B8FA 2LXJA 1YVCA 4X3SA 1F2YA 5FLXc 4HN7A 4DGZA 2VW9A 1VQLA 3K80C 4KJOA 4RH6A 1ASYA 3HOUB 4DR4L 1E2WA 1FJGQ 1UUPA 1BO0A 3MHBA 3K6OA 3DM1A 4K2KA 2RDFA 3IL8A 3PQIA 2R3ZA 3I4NH 5IY0A 2F3IA 1JB3A 1SYGA 5EPLA 1XMQQ 4H44C 3HGBA 3R2TA 4DA2A 4L8JA 1NE3A 2GVAA 4KTAA 5IP7H 3CMEA 2QDLA 5M3FG 4HAEA 4A4IA 2Z6BA 4X66Q 1N32Q 2A1AA 1QVCA 1A63A 5JPNC 1KQSA 2F0SA 1BDOA 4IQZA 4QIWE 4R4OA 1M4VA 1IYUA 1CKNB 3I72A 2B2YC 3BDOA 3OSOA 1B8AA 2SDFA 3U4VA 1ILPA 1MD2D 1PXUA 1KNAA 5LMNQ 3HRZC 2L12A 5D14A 2I5LX 2D0PA 4X3UA 2HCCA 2XWBB 3C1FA 3D3RA 3STBD 4JBWA 1VF7A 4DF7A 3HOVG 4A3LH 4YCWA 2RF4A 2K5QA 5LL6X 3G6EA 4DV1Q 1TS4A 2LKVA 1UE6A 2F3WA 3PO2G 5L37A 5C3EH 3T1YQ 1IL2A 3NPPA 3MXNB 3J7AV 2B63G 2KQ3A 1Y1VG 3U50C 4J15A 1SSOA 3I4MG 5F2DA 2QILA 1I6HH 4RMFA 2LSSA 2GN5A 1B70B 4WFN3 4DR2L 1KHIA 3P20A 5JJIA 1GUNA 3HOZB 4EX5A 1NY4A 1I4PA 2BA1A 2J0TD 2VL6A 3FEWX 1K8GA 2F0PA 2JA5G 1KAWA 3I4OA 3F2DA 1VQ8A 5EJWA 4B3RL 1JE4A 1RIPA 2X6LA 4JV5Q 4HMIA 3HOWB 1IZ6A 1IKMA 1AZPA 4X3TA 2NN6G 5CV5A 2YU9B 1A6XA 3TN2A 2O5IC 1ZXTA 2VB2X 4FDBA 3RMHA 3M7NA 2DUDA 1J9OA 4KY7A 3NQIA 2ZJRA 4R4QA 3K5NA 1HFNA 4QIWB 2WB1B 2PMZB 3GD7A 1HNZQ 1Q82C 1N36L 1K28A 1SR3A 3H3VI 1ENCA 4RKBA 1PHJA 2NN6I 2H4OA 1JB7A 4LF4Q 4C3IG 3KUPA 4A3MB 1SAPA 4YHHL 1H9KA 3C3LA 3T56B 1VQEA 1PH9A 1YZ6A 4JI1Q 4OIJA 2DY7A 1XYIA 2K7VA 2YTYA 3A74A 5K36G 2IW3A 3K58A 5CMDA 5J39A 3KFUA 5IYCH 1PFMA 1G6ZA 1M1KC 1VMCA 3EVQA 3F1ZA 3WOEA 4LF6Q 3VYRA 3PO3B 3GTGB 1GUWA 1C9OA 3MFGA 4DAYB 2DNCA 2Z4HA 4KD3A 2F3VA 4WRDA 2EYFA 2HDLA 3S1QB 4DPGA 2ZTCA 5FKAC 2AUJD 2JA7G 1PYWD 3UE1A 4O42A 5HY6A 1D2BA 1NR2A 5DEHA 1H9SA 5M5WH 4EQPA 4ZYSA 5TSSA 5IODA 2R7DA 3U58A 4WJ4A 1K83H 2OXPA 2RHQB 3K81C 1SROA 4A3FB 1KXLA 2DJFC 1ET6A 1HCZA 3VR6A 4DK0A 1TR5A 1QCBD 4K8IA 1BBWA 4YCUA 4HJ5A 3X3NA 2K5DA 4HEDA 1STYA 2JK8A 3ERSX 2IPKD 4HIMA 1HNXL 5KNDA 4C3HB 1KLUD 1NBWA 4AYBE 3UDFA 3S1RB 4JI4Q 3RZDH 1FVIA 3C46A 3PSIA 2NYZD 1BXTA 3GP7A 4JC0A 1CT1D 3I56A 1YIJA 1TXYA 4A3IH 3S1NB 5J1ZA 3Q8DA 1GKHA 1SE2A 3A56A 1D6EC 4JCVE 5GAHC 3HOVH 2KHSA 3PIO3 4A3KB 1JC7A 4UY8C 3FKIG 4JPBW 1TT2A 1JWSD 4FP5D 4KLKA 4DUYL 1D5ZC 3RLFA 1RJTA 4X65L 1G51A 1B2TA 3G48A 5T1IA 4V0BA 2BOSA 4OONA 3PO2H 1X3EA 2L1BA 3CQZB 4A3BH 1Q90A 1Y1VH 3EA6A 3VA5A 2OF1A 1G6PA 2EJFC 1VQJA 1VQBA 1B50A 1Q7YC 2EYHA 3S2HH 1BQQT 4KV6A 3BG3A 3NQTA 4L5TA 2F0GA 2EY2A 4S3SA 1K8OA 1D5MC 3PIP3 4QY7A 1TU2B 1HPCA 4CBVA 1TY2A 3K5MA 3OWFA 2BCOA 2JA5H 3HOWH 4JI3Q 4HCSA 4A75A 4ID6A 1NR4A 5IT9E 3SK5A 5FLXL 4LFCQ 2PQAA 3HKZB 4LF7Q 2F4IA 2MO0A 3E5SA 3KF6B 4IURA 2F0DA 2F0IA 5J22A 5M5XB 5M9OA 3FPUB 3D0FA 1HJPA 4A3JB 2M9VA 2WAQG 4XT1B 3N6RA 4AYBG 3VA7A 1CQFA 2KEDA 3TP7A 4B3ML 1HZ9A 1AE2A 3NWTA 4ZCKA 2RA4A 3RZOB 2Q2HA 1U4PA 3DEOA 3M85A 3GTKH 2EDGA 4BBSG 1NMFA 4HMJA 1OXSC 4C3IH 5ELCA 1Y1WG 1Y14B 4CDDC 1IKLA 2JA8B 4R8IA 1SNCA 3QB3A 1X6OA 1VQPA 2Z6KA 2XNAC 4DV7Q 3RLOA 2AQ2B 3W2DA 5K36H 3V05A 2Z8LA 1QZGA 1EIYB 2Z0SA 2RSOA 1BCPC 4CKEA 3SXHA 3GTGH 2EYMA 3I70A 5FLXE 1PH1A 2H5XA 4IFDH 1ONLA 4GKKQ 2HCIA 2K33A 3A0JA 4KN4C 4A3GG 5FK9C 2FMCA 1FNWA 3TMEA 1EY0A 3JAME 1E0BA 4N9PA 1RL2A 1AH9A 2Z9HA 2AHOB 4DV2Q 1D7QA 1KLGD 1XWEA 4DR1L 3S1MB 1PTOC 1GHJA 1WTPA 5JOBA 2A69D 4LFAQ 4GLVB 2B39A 1LT5D 2L15A 2B2VC 1BUVT 1IBMQ 1YNJC 3BVGA 3SR1A 3TBIB 1VQCA 1L1OC 3G4SA 4B3SQ 1PRTC 2AWOA 2F03A 1QG7A 4B9WA 3QIAA 2YYZA 1Q8KA 1P8LA 2L5TA 2F1MA 2MFIA 2K6AA 1KTKA 4GNXC 1FNVA 1XXGA 3H15A 4X6AH 4DNTB 3L9AX 5ELDA 2XVSA 1RHPA 1NAPA 2PQEA 3TS0A 1CKNA 4JBKA 4GOPB 1MGSA 4BY1B 4DR7Q 1F2MA 4KHPQ 2D5DA 3S14B 3EFXD 2H1EA 1WOCA 5I9PA 4NXML 4DAPA 1STAA 1CHQD 1DCZA 4RG1A 4C2MH 1IL8A 1HZCA 1K8MA 2MHVA 1TWFB 3DWAA 4NKLA 3P75A 3MZ5A 2NVQB 5FOBB 1JT8A 1Y69U 4XIGS 1X65A 4TQUS 3UDIA 4JI2Q 1TY0A 4ZKBB 4DAVA 5LMUQ 3GV6A 4ZQ3A 3FKIH 4BWGB 5EBDA 1HNZL 1Z6HA 2J7ZA 1UE1A 3MXNA 3F2UA 2B2UA 1CZWA 2OWOA 2NTTA 1U0LA 1YNJD 4HJ7A 4OO1G 2KUMA 3QOLA 4DV5Q 3OIPA 4WJ3M 1S5FD 4TVAB 2UUBL 4LF8L 2F0KA 1STNA 1U4MA 2EQSA 2KCCA 2C9OA 1LTGD 5C6AA 1NJIC 1EYGA 3E0EA 4CDEC 4ZKCB 5IGCA 2UXDQ 1XX8A 1B53A 2A68D 4FXGC 2CHBD 4OO1I 4IPCA 1UEAB 2Y0SE 4LF6L 1DGSA 2A6EC 1EZ6A 1TS5A 2F0UA 3E9IA 1YNNC 3FMCA 2QDBA 4RKLA 3G71A 4LUVA 4IUQA 1VQKA 4DR5L 3D6CA 1XMOL 2KEEA 2NWGA 3EJIA 1K3BC 3RN5A 2HHHQ 3TRZA 1MBYA 3KLRA 4QMGA 1JWUD 1DOLA 3D6WA 1E2VA 4YY3L 4IALA 1LTTD 5CYUA 4XYOA 2F0HA 3E9HA 3JAMi 1EZ8A 3FPPA 1XTDA 2K1BA 2RSNA 4K5XA 4BBSH 1FGUA 1MSGA 3J81E 4XTCS 3D4RA 3PUXA 4JI5Q 2VNUD 2R61A 2BA0A 5LL6S 5C3EB 2LY7A 4AQYQ 4LFBL 3GO5A 2VXWA 2OCEA 4DNIA 2O4XA 3T53B 1OTCA 4NP5A 1SYDA 3Q22A 1I6HB 1R4QB 3SGIA 4DUZQ 4JI8Q 4NDXA 3DWQA 4C3JG 3CRKC 2AWNA 3W1BA 4DAYA 3K7UC 1HFGA 2I5HA 4LMQD 5E3FA 2E8GA 1EY5A 3BDLA 3HOYG 1HR0Q 3H09A 1PZJD 4IPHA 3PUWA 2UUCL 1PYSB 4A3DG 2PI2A 4XQNA 5CORA 1S5ED 2RCFA 3M3YH 1VQGA 3WDNA 1ILQA 5IT9c 4YWMA 3FDTA 4DN4M 1WTXA 4HJ9A 1I94L 3H3VC 1LACA 1LABA 2HIVA 2I07B 4JYAQ 3L0OA 3J80c 5DNFA 1CTMA 1SDFA 1BR9A 2OT2A 1BOSA 3KOJA 3H0GG 3D4WA 1K3RA 3M4QA 3P1HA 4J1MA 1WD1A 5CV8A 4DXFA 2VQFQ 2N78A 4GNXB 4DV0L 3PV0A 5M3MG 2HT1A 2XSCA 4EVOA 1QUQA 2WIIB 5IGFA 1MSHA 1WCMG 3MTSA 3Q0AA 4GZYC 1DJRD 5C0XG 2F0VA 3VR4A 2RCNA 1KRSA 4HJ8A 4ZAIA 2R7ZG 1SYCA 1YHBA 5J3BA 2XN9C 3A5UA 2JE6I 2K4KA 2AUKA 4LFCL 4DV4Q 4EQNA 3NP8A 1YJ9A 4LF7L 1F2LA 2HD3A 3SDZA 1ZYRC 3N52A 1JJ2A 1I4XA 4DAMA 1HZBA 2D9UA 5C0XI 4Q5VA 2EYPA 3SK4A 2E2IH 4ILWA 1O7IA 4BA1I 1PDQA 2PZWA 4DKAC 3KJPA 1IYVA 3SHLA 1YHAA 5C3WA 4JI0Q 3OTOQ 3ICEA 5D65A 1WJJA 2JN4A 3RR5A 2RDHA 3JAMc 3NBIA 4ABNA 3HKSA 5I2YA 4FXDA 4UP8A 3DHQA 4DR6Q 4OX9L 2VZAA 1KDCA 3MVVA 4G7OC 4C56C 3KF8B 1LTRD 1KABA 2ID0A 2UUAQ 4NW2A 4JG2A 5M5WB 4PNYA 3QO2A 1S4ZA 2R92G 4QF4A 2VQEQ 2JYOA 1L0WA 1G291 1K83B 1PTOF 2BE5D 2Q8IB 3U4ZA 2DN8A 4K6LA 2QW7A 3VYUA 5DAUA 2CWAA 4PV1C 1SFOH 2E74C 1SMXA 3IFTA 2ICIA 1EUJA 2KENA 5T1GA 4B08A 4A3EG 4IUTA 3J81i 5ELNA 4K0KQ 2R93G 3KF6A 1PRTF 4FF1A 2CW0C 1STHA 4F8MA 1EL0A 1X3FA 5JEAG 3PUZA 4DV2L 1AEXA 3NUCA 1H9JA 5C44G 2EXDA 3LGJA 4YWLA 3D8GA 3RZDB 4N8FA 4HSPA 5KIXA 1IBML 3MAQA 4L5QA 4EGVA 2E5LQ 1SJED 3GTQH 2XIWA 4DK6C 4RCNA 2FFKB 4A3IB 1Q81C 4B3SL 2HIXA 3HOVB 3GQBA 2F4VL 4K14A 4L6TB 2M00A 4OXPA 1Q1BA 3TQYA 2JEBI 4DFAA 5HURA 5FJ8G 3PO2B 3OMCA 3CKIB 4X62L 4A3BB 1K0SA 4HIDA 1QNUA 2B63B 4A3CG 1IYJB 1DYQA 1Y1VB 1TWAB 4QGUA 1STEA 1KIXA 4IOAA 4CHTB 1MKHA 2PNRC 3VDYA 3S2HB 4Y52H 1EIGA 1IBKQ 4OWWB 1HUNA 3J7A5 5FLMG 5GAEC 2A74C 4Z9CB 3CCMA 1QNKA 1PTOH 1GVPA 4FF3A 1YBYA 1LO5D 2KCNA 2JA5B 4JI2L 4OWXB 1U9RA 4MIUA 5KNCA 2ZXOA 2SNSA 1UE5A 2EOTA 4XT3B 1EQTA 4KMUC 4ZRZA 4V190 3T51B 4JOIA 3OHXC 1TQOA 4R4IA 4C1NK 4BY7H 3A7AB 1EWIA 4B3TQ 3R2IA 5CBEE 5CR3A 2DNEA 3GDEA 2TMPA 2RQXA 1JE5A 3HG9A 4BBRG 1AN8A 4EQOA 2O2LD 1WTOA 1JICA 2F0JA 2R7FA 3GTOH 1EOVA 3V96A 1N33Q 5M3MH 5H1SE 2JP1A 4GOPA 1LTLA 2WB1G 3CC4A 4UP7A 3NSWA 3GTKB 3M4YA 2UXDL 4C3IB 1PVOA 2A6HC 2K5HA 4WORA 1A3VA 5JJKA 1VQ9A 1ENAA 3GV3A 1GOZA 3J81c 1KD1C 4JK1C 1GO3E 3IAYA 3EQLC 2K5VA 3CCEA 3HS0C 2R7ZH 1G91A 3NXWA 2IHFA 3BVZA 3VR2A 4JI7Q 4NB3A 5BN4A 2VY3A 3L3OC 3DWPA 1U5KA 4DR3Q 3PUVA 2UXCL 4JW0A 3CCUA 3CD6A 4LF5Q 4IFDJ 2IX1A 1MHWC 3MXPA 1QILA 1SE3A 3AYHB 1NMGA 2WP8J 3PUYA 4RAUC 2ATWA 1IBLL 5CV9A 4LAAA 2QEXA 2NBFA 4F7XA 4DV6Q 5EGTA 1V9PA 1CZGA 5BR8L 4FNFA 3E6ZX 2CWPA 5IWAQ 4JI5L 3TZDA 1K0RA 2MJ8A 3NENA 4XXEA 1AW7A 5M3FH 1EU3A 3MC0B 4R8NA 1CSPA 4DUZL 2QEJC 4KD4A 1PZKD 3KJOA 4QJFA 4A3EH 4A3FG 4LUOA 2WAQE 4IPDA 4OEMB 3E0JA 2UXBL 1PYBA 5IOCA 4HIKA 1SJHD 2DY8A 2PPBC 5JEAH 1LV9A 4E6IA 1EYDA 5IT9L 2ZT9C 1II3A 4KJNA 1XNRQ 5C44H 4GKJL 4C2MB 5CV7A 5JJLA 2JSOA 3K5OA 1U4RA 2F0FA 3BS1A 4IPGA 1G2TA 2E76C 1PH7A 3TS2A 2VS1A 1JMCA 1EQVA 3FKIB 2B29A 1XNQQ 4GLAC 1RTNA 4NPSA 4A3KG 3CCLA 1S72A 3B6YA 2B63H 2K14A 3HOXG 2UU9Q 1TWAH 3I7FA 3TZUA 1EFID 3OYYA 3I4MH 2B2TA 4TSSA 4JI6Q 1B9MA 1N34Q 1I4QA 4H7BA 4A3CH 1EU4A 4OL7A 3CP0A 2CQAA 3CCJA 4P73A 4LJZC 1JQYD 4H13C 2EYJA 5KEEA 5I6YA 1DZ1A 2LXKA 2MUYA 1PZID 5FLMH 1Q1EA 1JWMD 1A3TA 2Q2UA 2JA9A 5I2XA 5IGGA 2WFWA 1HQRD 3R3OA 2IHEA 1F9PA 1QOHA 2XRSD 3H3VH 1HRJA 2PW5A 3R93A 2NN6H 3J80E 3QWNA 1K9MC 3OTOL 4JI0L 3JAML 5M5YH 1FJGL 3EROA 1C48A 1TWGH 4G4KA 1PMRA 1V43A 1X3QA 4RA8A 1X3GA 3MXGA 2V4DA 4BBRH 2WAQB 4K2LA 2XTIA 1TKWB 4AYBB 2UUAL 1XMQL 1DOKA 4A3JG 2G5DA 2V1CC 4CJ2C 1T9HA 2D0OA 1JOQA 1PH3A 1EOTA 4FF2A 1HUMA 2NZ1D 4A93G 4X66L 1N32L 5IGEA 1Y8PB 1OO9B 2HDMA 3T16A 4POGA 4BBSB 4O1NA 2ZXRA 5C4XG 5E4WC 1CUKA 3SK6A 3PGZA 4IUPA 3TREA 4DR4Q 2OTJA 1Q12A 2ZTEA 4APVA 1SNPA 5EPKA 1OXUA 1W3SA 2NZHA 3QJYA 3S24A 1B1ZA 4IUVA 1CA5A 3HEJA 4MNOA 4J8QA 5LMNL 1EYCA 2MGSA 3GTMH 4IZ8A 2EYOA 1SMYC 4UDUC 1EIHA 1L2FA 2CQOA 1S5CD 2ZTDA 3AFPA 1ESFA 1DM0B 5FO9B 3UI2A 3D31A 4CKBA 2BH8A 2JA7H 4R4TA 1LM0A 1C8CA 1DOMA 5D3IB 5LMNW 3M3YB 3P7JA 3KF8A 3MA2B 4DV1L 1CA6A 3T1YL 3K59A 1K73C 2X6GA 4RHRA 1VQHA 3RUZA 1NTGA 1PA6A 5ISRA 3DEPA 3DLLA 1KRTA 1OXVA 2FJ2A 1PFBA 1I5FA 2EY1A 4RHSA 2PZTA 4G7HC 1DONA 1E3PA 3M4PA 2VB3X 1EYAA 3CXCA 1O7LA 2X69A 4ZK9B 3LX0A 1A3UA 3MEFA 2JA6G 3W5OA 4KHZA 3VYTA 4QQBX 2WACA 5AJ3Q 4JV5L 3FHWA 4L5SA 1WTWA 4BY1G 3NK9A 1G8ZD 2N49A 1BCPD 1BNZA 4N8X1 3SK8A 1X32A 5IGDA 1EY7A 3QR8A 1TS3A 4YWKA 3J7AF 1S5BD 2SNMA 2Z6KC 3DXJC 4OHJA 4CDFC 5A35A 1UWVA 4B9XA 4KKSA 4XYQA 2E2IB 1VDZA 2Q2IA 5KYIA 1NNXA 1PTOD 3OMGA 3K57A 1EFWA 4U68A 5GAGC 3J80i 4LF4L 1STGA 1A2TA 2MPMA 4IN3A 2A73B 2EJGC 3HOXH 3MEHA 1W6JA 3ERQA 1HA6A 2B2WA 3ZYYX 4JI1L 1PRTD 3J81L 2PW7A 1ET9A 5LHY1 1HH2P 1HNWQ 1A15A 1BF4A 3I90A 4P72A 1E1OA 1O7YA 4FVMA 3SE0A 1N36Q 3I4NG 1H9SB 4N9TA 3CCQA 1V1PB 5EKKA 1SFOB 1TVXA 2WV6D 1SNDA 3A8JE 5IP7G 3OWEB 3NTIA 1JOOA 4YHHQ 4LUZA 5EAYA 1W6KA 1I4HA 3T4AC 1RD9D 4UP9A 3E3XA 1DXMA 1XPUA 3PCOB 3OOCA 1ESRA 4LNQA 2KHIA 1NCVA 1D8LA 3GTQB 3BZCA 3GTJH 1ENFA 3GTPH 1GUOA 5KRUA 1Y1WH 4A76A 1I6VC 3VR3A 4QL5A 3K7AH 4A93H 1QJOA 1WTHA 2Z1CA 3ZJYC 1YJWA 1WD0A 3C2PA 1WTQA 4QB4A 2GA4B 3L2PA 5HGQA 2LFNA 2EXZA 3KLWA 5C4HA 1Y8NB 1TWHH 3ONAB 3I73A 4JVZA 4JI4L 2KCMA 1BCPB 2KECA 1PH2A 5EBCA 1SYBA 5JVG3 3CCRA 5FO7B 4A3GH 3CU7A 1B7YB 2B2UC 5E1FA 5JVH3 1F9RA 1I50H 2NVYH 4QUFA 2R6GA 1GM5A 3A8IE 2A6ED 1P16A 1FR3A 3W1GA 2EJMA 1PTOB 5EKLA 1YNND 2B2WC 4CDCC 1RCVD 3RLNA 3PMFA 4U673 1EY8A 3AFQA 2JJQA 2WINB 1LT3D 1UE7A 1C0AA 1D1KA 5D3DA 1KDBA 3H6MA 2KVMA 3F8TA 3JC66 1PV4A 1HNXQ 1L1OB 1OXXK 2KJXA 1STBA 4GN4B 2Y0SB 1PRTB 3TP8A 3R8BA 2ZJQA 4BY7B 4Y7NH 4CKCA 4TKOB 3PIPA 3MFYA 5IYDG 2GVBA 4HSVA 4HCEA 3KLSA 3OW7A 1MI2A 3X3MA 2WKDA 2IT1A 3GTOB 2B2YA 2N55A 4GS3A 5M3MB 1QVGA 1SBBB 1FD7D 3CRLC 1AZQA 5ELOA 4JI3L 4DUYQ 2JA6H 5JAVA 1VQFA 4BA2I 4K8JA 4X65Q 1YI2A 1VQ7A 4KY5A 2NVTH 3KK7A 1X55A 1J8IA 1SLJA 3LWEA 4RGNA 3GTLH 2VUMG 2R7ZB 2NVXB 2F52A 3H91A 1IXRA 3K5LA 1PFNA 2E2HH 1VS0A 1QE6A 5CV6A 1LYLA 3AQQA 2K50A 5C4JH 2A19A 1LT4D 4P2CB 2Q8RE 1VQ5A 1BCPF 3STBC 3J81j 4IJHA 2RKSA 4OO1H 3M7GA 3HOUG 2MP1A 2CFMA 1YJNA 5IP9G 4OIKA 4PG3A 1AP0A 2JEAI 4PMBA 2C5CA 3J7YW 5EPJA 3KBGA 1MJCA 5IYBG 4ZLTF 4DV7L 1SXTA 1CSQA 2QKIC 3KYHC 2K75A 2R92B 4HIOA 3M4OH 1I4GA 1O78A 2EY6A 5M3FB 4J6HA 3U9OA 4B3MQ 5C5LA 1KL9A 1M8AA 5GADC 4GKKL 3Q24A 1KNEA 4ULLA 2XGTA 2CH4W 5ELFA 1RODA 4EQ5A 1I4RA 1B44D 1B9NA 5EQ0A 3F2BA 1O80A 4A3EB 1QB5D 3NTHA 2R93B 5GROA 3AB9A 1ASZA 2L11A 5JEAJ 1C4QA 4LFAL 4H0LC 1Q46A 1ZKOA 1V8QA 3S16H 2Q8TA 1L0XB 5A2QE 3BYYB 1ZYRD 2WB1E 2PMZE 3V2TA 5C44B 5CBAE 5KGUA 2KOLA 3W3AA 1RDPD 3RNUA 1PFSA 3WOFA 4FXKC 4A3IG 2OQ0A 4QCLA 1TS2A 3LNNA 5I6WA 5BN3A 4OGQC 1PH5A 2P5ZX 1KC8C 4DR1Q 4IUUA 2PCFB 1LTID 3CAMA 2K28A 3RN2A 4DR7L 4KHPL 3NWSA 5GQOA 3EBEA 3QG1A 1D1IA 1VQMA 4AH6A 1EQQA 3I4MB 4F88A 4FF4A 1X56A 1EY4A 1PLFA 1W2BA 2MO1A 3S17B 2F0EA 5AJ3L 1GD7A 4C3JH 2MNAA 3SEBA 4PZ8A 1EWHA 4K5WA 3TSSA 3Q6SA 4A3BG 2F0LA 1MIUA 4YIJA 3HOYH 2ZM6Q 4I7AA 3A7LA 3S15H 2RBMA 3PF4A 4A3DH 3URYA 2K04A 3HOZG 1XJVA 1ICWA 1A8VA 3ITPA 4DK1A 5LMUL 5KNBA 2ENBA 4ME5A 2CW0D 2PI2E 1TWCH 1IHZA 2RHSB 5ELEA 4CJ1B 4ALPA 1WYDA 2EVBA 4P74A 1J6QA 1EY6A 3BZDB 2BH2A 2EY5A 3HOWG 5M5YB 1R9TH 2PNHA 2K52A 2M2LA 3F2CA 3QOJA 1Q3LA 3H0GH 5I9OA 4DV5L 4NXMQ 2JQOA 1TWGB 2AQ3B 3TP6A 4UHVA 4FYDA 2WKCA 5IYDH 4KY6A 1YNXA 4BBRB 3IKJA 4DK3C 1WCMH 5JJZA 1HNWL 3OPOA 3FVQA 2EYLA 1S5DD 5C0XH 5G3LF 3CCSA 1SRUA 2ICEC 1H9MA 1KAAA 1VF5C 2AQ1B 3UDGA 4A3MG 1SE4A 2NVXH 3MXUA 3ER0A 1E1TA 1UNSA 1QZHA 1I3QH 3KDFB 1Y8OB 2VUMH 4UAIA 2KHJA 2L55A 1E22A 4KHVA 4RGMA 1Q8IA 1X9NA 1VQNA 2IJ0A 2HHHL 2UUBQ 4LF8Q 2EE1A 3GTMB 3DMUA 3S2DH 1XTCD 1Z47A 2F0WA 1X54A 3H94A 2YTXA 2Z4IA 2TSSA 4MZ9A 4JBJA 5KYLA 2OEOA 4NMZA 2OQKA 3PO3G 4TRDA 1QVFA 4DV3Q 2G9DA 3A5ZB 4IFDG 3CMAA 2JA7B 1SYFA 3HOUH 2ES2A 5IP9H 2AKWB 2IWHA 4BXXG 3BYTB 3LWUA 2R92H 3FP9A 2KCTA 5IYBH 3K0YA 1F77A 4DR5Q 1XMOQ 4AQYL 4K6DA 4I65A 1WTRA 4HJAA 4LW1A 3OIQA 4IFDI 1HA5A 5IGBA 1V1PA 2YV5A 1F2ZA 4JI8L 4XQQA 4YY3Q 2A8VA 1IW7C 4JOIC 3T1HQ 3BZKA 1Z9FA 2R93H 2HUGA 2A6HD 5C3XA 1GUGA 3HKZE 1HR0L 3IFDA 1B3AA 1EQRA 3NELA 2E2JB 4X64Q 1JOKA 4L5RC 1LTBD 2K05A 2EPBA 3KBXA 1O7ZA 4H02A 4R9WA 1H9RA 4C3HG 4GOPC 1CKOA 1QUQB 3J80L 4LFBQ 4JYAL 1HR0W 3M9BA 2DGYA 3EIVA 3EN2A 4JBMA 1EEID 2L4NA 1VMPA 5DM63 4M1UB 2FHTA 2EIFA 1HQMC 2LS01 2VQFL 3TDQA 3CC7A 1X3PA 3TEHB 2UUCQ 3BU2A 4LF9Q 3NBHB 5FJ8H 2AMCB 2NB0A 1WTVA 2F0TA 2L9HA 3AEVA 3J7ZC 3S17H 1EWCA 4NXNQ 1CKMA 2IX0A 3HOXB 1VQ4A 1I94Q 2LMCB 1RKNA 4IJLA 2Q2TA 2FINB 1GXDC 4CJ0B 4DV4L 1A2UA 4KI0A 3D4DA 2K32A 4IUNA 2KBNA 4Q0FA 1NUCA 2RDGA 4G7ZC 1J5EQ 1VQ6A 1IW7D 4OELB 5JPMC 3HOZH 4WJWA 2B2VA 1L0YB 1FL0A 2ZXPA 5DM73 4DV0Q 4O0AA 2SOBA 3CHBD 3HFZB 4RFBA 1KDAA 3A54A 1E2ZA 2QF7A 1L1OA 1PH8A 1WVLA 2I5MX 3CCVA 2ASBA 2B8GA 4FO2A 2O5JC 3HKZG 5CC4A 4PMCA 4DR6L 3CC2A 2N3SA 2PO4A 1B4OA 5DLQE 2YU9H 4GNXA 1OXTA 2A69C 1N8RC 3CPWA 3BJUA 2HQLA 2VQEL 1HTLD 3RD4A 2D62A 2N8NA 3GTJB 4ME3A 3O13A 3GTPB 2QA4A 1LTSD 1GHKA 1Y1WB 2J4XA 2E75C 1VCIA 1YEZA 3K7AB 4RGTA 4A93B 1D5XC 5E4XA 3CW2C 4A3MH 4K0KL 5C4XB 1BBUA 2JA8G 3NHHA 4MHEA 5I4DA 5FO8B 4OX9Q 2HQEA 3I4LA 1WI5A 4MTKA 4DU9A 1TWHB 2F0OA 1EY9A 4K5VA 3NTKA 3Q23A 4UPAA 3ULPA 4MTNA 5COYA 1JJCB 1E7ZA 4HTHA 1H95A 4R4CA 2E5LL 5ELBA 4A3GB 2C35B
chains in the Genus database with same CATH topology
1LLRD 2B2TC 1I50B 2BDNA 2NVYB 5BN5A 1CI3M 1FNUA 3G7LA 2JXMB 2K01A 1JCKB 3ND9A 1NSNS 1GUSA 3S9WA 2PYKA 4Y7NB 4PQXA 3AU7A 3A8KE 4RWSC 3G6JB 4KKUA 1R4PB 2BDOA 2NTSA 3BDCA 2KA7A 5CV4A 2JA6B 2A68C 2NVTB 2D2CC 3GTLB 1SMYD 3VR5A 2CVRA 4I7ZC 2E2HB 1V1OA 3HZXA 1JR0D 4MN3A 3L7ZC 5C4JB 1F9QA 4CGYB 3FRPB 5HGTA 2SEBD 1LT6D 5C5MA 4KK7A 5NUCA 1T5EA 3VYSA 2K5WA 1QWYA 3HP3A 4BS9A 4ZUJA 2L0CA 1TIID 3I91A 3M4OB 4L63B 5AFWA 2EZVA 4PMWA 4HR7B 3KLSX 2F0MA 4KN7C 1G2SA 3I4NB 1SNOA 1SNQA 1CQVA 3SVMA 2F0NA 2I46A 2RVLA 1BBXC 4G57A 1SEBD 2IL8A 3S16B 3BVMA 4QUCA 2F0QA 2A5HA 3A55A 2G9HD 5CGKA 3TP5A 1FYCA 1FGBD 1HTPA 1JORA 2XRQD 3ND8A 2NUCA 3MWYW 1CM9A 1GUTA 1AFPA 4C1NI 2IX3A 2PZUA 1EEFD 2QCPX 4X3KA 1ML0D 4DNRB 1RF2D 1GJXA 4C3JB 3I8ZA 3T13A 3HOYB 5IIFA 3S15B 1HHVA 4A3DB 4F87A 2XWJB 1TWCB 3C1EA 3I3CA 4KKTA 5G3LD 4RGOS 4ZUIA 1HXYD 2K03A 1R9TB 1SYEA 1SNMA 3H0GB 4M8AA 2N88A 2FMMA 1CHPD 1T5XD 5C0XJ 4ODGA 1WCMB 3AMUA 4XQJA 4LK1C 2BE5C 4RCOA 3DUZA 2E2DC 1DD2A 3NE5B 5EKIA 1I3QB 4XDXA 2VUMB 1UAPA 1ZEQX 1LTAD 5K5PA 5A2QL 1RTOA 3S2DB 1Z7TA 1U4LA 4DXGA 3U9SA 5C4ZA 3NBHA 1CK1A 1F9SA 1CFMA 2B8FA 4X3SA 1F2YA 4HN7A 4DGZA 4KJOA 4RH6A 3HOUB 1E2WA 1UUPA 1BO0A 3MHBA 3K6OA 3DM1A 4K2KA 2RDFA 3IL8A 2R3ZA 1JB3A 1SYGA 5EPLA 4H44C 3HGBA 3R2TA 4DA2A 4L8JA 4KTAA 4HAEA 5JPNC 2F0SA 1BDOA 4IQZA 1M4VA 1IYUA 3I72A 2B2YC 3BDOA 3OSOA 2SDFA 1ILPA 1MD2D 1PXUA 1KNAA 3HRZC 2L12A 5D14A 4X3UA 2HCCA 2XWBB 3C1FA 3D3RA 4JBWA 1VF7A 4DF7A 2K5QA 5LL6X 1TS4A 2LKVA 2F3WA 3NPPA 3J7AV 2KQ3A 1SSOA 5F2DA 2QILA 4WFN3 3P20A 1GUNA 3HOZB 1I4PA 2BA1A 2J0TD 3FEWX 2F0PA 5EJWA 1JE4A 2X6LA 4HMIA 3HOWB 1IKMA 1AZPA 4X3TA 2NN6G 5CV5A 2YU9B 1A6XA 3TN2A 2O5IC 1ZXTA 2VB2X 3RMHA 3M7NA 1J9OA 4KY7A 3NQIA 3K5NA 1HFNA 4QIWB 2WB1B 2PMZB 3GD7A 1ENCA 4RKBA 2NN6I 2H4OA 4C3IG 3KUPA 4A3MB 1SAPA 1H9KA 3C3LA 3T56B 4OIJA 2DY7A 1XYIA 2K7VA 5K36G 2IW3A 3K58A 5CMDA 5J39A 1PFMA 1G6ZA 1VMCA 3EVQA 3WOEA 3VYRA 3PO3B 3GTGB 1GUWA 3MFGA 2DNCA 2Z4HA 4KD3A 2F3VA 4WRDA 2EYFA 2HDLA 3S1QB 5FKAC 2AUJD 1PYWD 4O42A 1D2BA 1NR2A 5DEHA 1H9SA 4EQPA 4ZYSA 5TSSA 5IODA 2OXPA 4A3FB 1ET6A 1HCZA 3VR6A 4DK0A 1TR5A 1QCBD 4K8IA 3X3NA 2K5DA 4HEDA 1STYA 2IPKD 5KNDA 4C3HB 1KLUD 3S1RB 3C46A 2NYZD 1BXTA 3GP7A 1CT1D 3S1NB 5J1ZA 1SE2A 3A56A 1D6EC 2KHSA 3PIO3 4A3KB 1JC7A 1TT2A 1JWSD 4FP5D 1D5ZC 3RLFA 1RJTA 1B2TA 5T1IA 4V0BA 2BOSA 2L1BA 3CQZB 1Q90A 3EA6A 3VA5A 2OF1A 2EJFC 1B50A 2EYHA 1BQQT 4KV6A 3BG3A 3NQTA 2F0GA 2EY2A 4S3SA 1K8OA 1D5MC 3PIP3 1TU2B 1HPCA 4CBVA 1TY2A 3K5MA 3OWFA 2BCOA 4HCSA 4ID6A 1NR4A 5IT9E 3SK5A 5FLXL 3HKZB 2F4IA 3E5SA 4IURA 2F0DA 2F0IA 5J22A 5M5XB 5M9OA 3FPUB 4A3JB 2M9VA 4XT1B 3N6RA 3VA7A 1CQFA 2KEDA 3TP7A 3NWTA 2RA4A 3RZOB 1U4PA 3DEOA 3M85A 2EDGA 4HMJA 1OXSC 5ELCA 1IKLA 2JA8B 4R8IA 1SNCA 3QB3A 2XNAC 2AQ2B 3W2DA 5K36H 3V05A 2Z8LA 2RSOA 1BCPC 4CKEA 3SXHA 2EYMA 3I70A 5FLXE 4IFDH 1ONLA 2HCIA 2K33A 4KN4C 5FK9C 2FMCA 1FNWA 3TMEA 1EY0A 3JAME 1E0BA 4N9PA 1KLGD 1XWEA 3S1MB 1PTOC 1GHJA 1WTPA 5JOBA 2A69D 2B39A 1LT5D 2B2VC 1BUVT 1YNJC 3BVGA 3SR1A 3TBIB 1PRTC 2AWOA 2F03A 1QG7A 4B9WA 3QIAA 2YYZA 2L5TA 2F1MA 2K6AA 1KTKA 1FNVA 1XXGA 4DNTB 3L9AX 5ELDA 2XVSA 1RHPA 1NAPA 2PQEA 1MGSA 4BY1B 1F2MA 2D5DA 3S14B 3EFXD 2H1EA 5I9PA 4DAPA 1STAA 1CHQD 1DCZA 1IL8A 1K8MA 2MHVA 1TWFB 3DWAA 4NKLA 3P75A 3MZ5A 2NVQB 5FOBB 1Y69U 4XIGS 4TQUS 1TY0A 4ZKBB 4DAVA 3GV6A 4ZQ3A 4BWGB 5EBDA 1Z6HA 2J7ZA 3MXNA 3F2UA 2B2UA 1CZWA 2NTTA 1YNJD 4OO1G 2KUMA 3QOLA 3OIPA 1S5FD 2F0KA 1STNA 1U4MA 2KCCA 2C9OA 1LTGD 5C6AA 4ZKCB 5IGCA 1XX8A 1B53A 2A68D 4FXGC 2CHBD 4OO1I 1UEAB 2A6EC 1EZ6A 1TS5A 2F0UA 1YNNC 3FMCA 2QDBA 4RKLA 4IUQA 3D6CA 2KEEA 2NWGA 3EJIA 1MBYA 3KLRA 4QMGA 1JWUD 1DOLA 3D6WA 1E2VA 4IALA 1LTTD 5CYUA 4XYOA 2F0HA 1EZ8A 3FPPA 2K1BA 2RSNA 4K5XA 1MSGA 3J81E 4XTCS 3D4RA 3PUXA 2VNUD 2R61A 2BA0A 5LL6S 5C3EB 2LY7A 3GO5A 2VXWA 2O4XA 3T53B 4NP5A 1SYDA 3Q22A 1I6HB 1R4QB 4NDXA 3DWQA 4C3JG 3CRKC 2AWNA 4DAYA 1HFGA 4LMQD 5E3FA 1EY5A 3BDLA 3H09A 1PZJD 3PUWA 4XQNA 5CORA 1S5ED 3WDNA 1ILQA 3FDTA 4DN4M 1WTXA 3H3VC 1LACA 1LABA 2I07B 5DNFA 1CTMA 1SDFA 1BR9A 2OT2A 1BOSA 3D4WA 3P1HA 4J1MA 1WD1A 5CV8A 4DXFA 3PV0A 2XSCA 4EVOA 2WIIB 5IGFA 1MSHA 3MTSA 3Q0AA 4GZYC 1DJRD 5C0XG 2F0VA 3VR4A 4ZAIA 1SYCA 2XN9C 2JE6I 2AUKA 4EQNA 3NP8A 1F2LA 3SDZA 1ZYRC 3N52A 1I4XA 2D9UA 5C0XI 4Q5VA 2EYPA 3SK4A 4ILWA 4BA1I 1PDQA 2PZWA 1IYVA 3SHLA 5C3WA 5D65A 2RDHA 3NBIA 4ABNA 5I2YA 4FXDA 3DHQA 1KDCA 3MVVA 4G7OC 4C56C 1LTRD 1KABA 2ID0A 4NW2A 5M5WB 4PNYA 3QO2A 1S4ZA 4QF4A 2JYOA 1G291 1K83B 1PTOF 2BE5D 2Q8IB 2DN8A 4K6LA 3VYUA 5DAUA 4PV1C 2E74C 3IFTA 2ICIA 5T1GA 4B08A 4IUTA 1PRTF 4FF1A 2CW0C 1STHA 4F8MA 1EL0A 5JEAG 3PUZA 1AEXA 3NUCA 1H9JA 3RZDB 3D8GA 4HSPA 5KIXA 3MAQA 4EGVA 1SJED 2XIWA 4RCNA 2FFKB 4A3IB 3HOVB 3GQBA 4K14A 4L6TB 2M00A 1Q1BA 2JEBI 4DFAA 5HURA 3PO2B 3OMCA 3CKIB 4A3BB 1QNUA 2B63B 1DYQA 1Y1VB 1TWAB 1STEA 4CHTB 2PNRC 3S2HB 1EIGA 1HUNA 2A74C 4Z9CB 1QNKA 1PTOH 4FF3A 1LO5D 2KCNA 2JA5B 1U9RA 4MIUA 5KNCA 2ZXOA 2SNSA 2EOTA 4XT3B 1EQTA 4KMUC 4ZRZA 4V190 3T51B 3OHXC 1TQOA 4C1NK 3A7AB 3R2IA 5CBEE 5CR3A 2DNEA 2TMPA 2RQXA 3HG9A 1AN8A 4EQOA 2O2LD 1WTOA 1JICA 2F0JA 3V96A 2JP1A 3NSWA 3GTKB 3M4YA 4C3IB 2A6HC 4WORA 1A3VA 1ENAA 3GV3A 1GOZA 4JK1C 3IAYA 3EQLC 3HS0C 1G91A 3NXWA 3BVZA 3VR2A 5BN4A 3L3OC 3DWPA 3PUVA 4IFDJ 2IX1A 3MXPA 1QILA 1SE3A 2WP8J 3PUYA 4RAUC 5CV9A 4LAAA 2NBFA 4F7XA 5EGTA 1CZGA 4FNFA 3E6ZX 3TZDA 2MJ8A 4XXEA 1AW7A 1EU3A 3MC0B 4R8NA 2QEJC 4KD4A 1PZKD 3E0JA 5IOCA 1SJHD 2DY8A 2PPBC 5JEAH 1LV9A 4E6IA 1EYDA 5IT9L 2ZT9C 1II3A 4KJNA 4C2MB 5CV7A 2JSOA 3K5OA 1U4RA 2F0FA 3BS1A 1G2TA 2E76C 1EQVA 3FKIB 1RTNA 3TZUA 1EFID 2B2TA 4TSSA 1B9MA 1I4QA 4H7BA 1EU4A 4OL7A 2CQAA 4LJZC 1JQYD 4H13C 2EYJA 5KEEA 5I6YA 1DZ1A 2MUYA 1PZID 1Q1EA 1JWMD 1A3TA 5I2XA 5IGGA 3R3OA 1HQRD 1F9PA 1QOHA 2XRSD 1HRJA 3R93A 2PW5A 2NN6H 3J80E 3QWNA 3JAML 3EROA 1C48A 4G4KA 1PMRA 1V43A 1X3QA 4RA8A 3MXGA 2V4DA 2WAQB 4K2LA 1TKWB 4AYBB 1DOKA 4CJ2C 1JOQA 1EOTA 4FF2A 1HUMA 2NZ1D 5IGEA 1Y8PB 1OO9B 2HDMA 3T16A 4BBSB 4O1NA 2ZXRA 5E4WC 3SK6A 4IUPA 1Q12A 1SNPA 5EPKA 1OXUA 3QJYA 1B1ZA 4IUVA 1CA5A 3HEJA 4J8QA 1EYCA 2MGSA 4IZ8A 2EYOA 1SMYC 4UDUC 1EIHA 1S5CD 1ESFA 1DM0B 5FO9B 3UI2A 3D31A 4CKBA 1C8CA 1DOMA 5D3IB 3M3YB 3P7JA 3KF8A 3MA2B 1CA6A 3K59A 2X6GA 4RHRA 3RUZA 5ISRA 3DEPA 1OXVA 2FJ2A 1PFBA 2EY1A 4RHSA 2PZTA 4G7HC 1DONA 2VB3X 1EYAA 1O7LA 2X69A 4ZK9B 3LX0A 1A3UA 4KHZA 3VYTA 2WACA 1WTWA 3NK9A 1G8ZD 1BCPD 1BNZA 3SK8A 1X32A 5IGDA 1EY7A 1TS3A 3J7AF 1S5BD 2SNMA 3DXJC 4OHJA 5A35A 4B9XA 4KKSA 4XYQA 2E2IB 1VDZA 5KYIA 1PTOD 3OMGA 3K57A 4U68A 1STGA 1A2TA 2MPMA 4IN3A 2A73B 2EJGC 3MEHA 1W6JA 3ERQA 1HA6A 2B2WA 3ZYYX 1PRTD 3J81L 2PW7A 1ET9A 5LHY1 1A15A 1BF4A 3I90A 1O7YA 4FVMA 3SE0A 1H9SB 4N9TA 1V1PB 5EKKA 1SFOB 1TVXA 2WV6D 1SNDA 3A8JE 3OWEB 3NTIA 1JOOA 1W6KA 1I4HA 3T4AC 1RD9D 1DXMA 3OOCA 1ESRA 1NCVA 3GTQB 1ENFA 1GUOA 5KRUA 1I6VC 3VR3A 1QJOA 2Z1CA 1WD0A 3C2PA 1WTQA 4QB4A 2GA4B 2LFNA 2EXZA 5C4HA 1Y8NB 3ONAB 3I73A 1BCPB 2KECA 5EBCA 1SYBA 5JVG3 5FO7B 3CU7A 2B2UC 5E1FA 5JVH3 1F9RA 4QUFA 2R6GA 3A8IE 2A6ED 1FR3A 2EJMA 1PTOB 5EKLA 1YNND 2B2WC 1RCVD 3PMFA 4U673 1EY8A 2WINB 1LT3D 1D1KA 5D3DA 1KDBA 2KVMA 3H6MA 1OXXK 2KJXA 1STBA 2Y0SB 1PRTB 3TP8A 3R8BA 4BY7B 4CKCA 4TKOB 3MFYA 4HSVA 4HCEA 3KLSA 3OW7A 1MI2A 3X3MA 2WKDA 2IT1A 3GTOB 2B2YA 2N55A 5M3MB 1SBBB 1FD7D 3CRLC 1AZQA 5JAVA 4BA2I 4K8JA 4KY5A 3KK7A 1J8IA 3LWEA 4RGNA 2R7ZB 2NVXB 3H91A 3K5LA 1PFNA 1QE6A 5CV6A 1LT4D 4P2CB 2Q8RE 1BCPF 2RKSA 4OO1H 3M7GA 2MP1A 4OIKA 1AP0A 2JEAI 4PMBA 2C5CA 3J7YW 5EPJA 3KBGA 4ZLTF 1SXTA 2QKIC 2R92B 1I4GA 1O78A 2EY6A 5M3FB 4J6HA 3U9OA 5C5LA 1M8AA 3Q24A 1KNEA 4ULLA 5ELFA 1RODA 1I4RA 1B44D 1B9NA 5EQ0A 1O80A 4A3EB 1QB5D 3NTHA 2R93B 3AB9A 2L11A 5JEAJ 1C4QA 4H0LC 1ZKOA 1V8QA 2Q8TA 1L0XB 5A2QE 3BYYB 1ZYRD 3V2TA 5C44B 5CBAE 5KGUA 2KOLA 3W3AA 1RDPD 3WOFA 4FXKC 4QCLA 1TS2A 3LNNA 5I6WA 5BN3A 4OGQC 4IUUA 2PCFB 1LTID 2K28A 3NWSA 3QG1A 1D1IA 3I4MB 4F88A 4FF4A 1EY4A 1PLFA 3S17B 2F0EA 3SEBA 1EWHA 4K5WA 3TSSA 3Q6SA 2F0LA 4YIJA 3A7LA 2RBMA 3URYA 2K04A 1ICWA 3ITPA 4DK1A 5KNBA 2ENBA 4ME5A 2CW0D 5ELEA 1IHZA 4CJ1B 2EVBA 1EY6A 3BZDB 2EY5A 5M5YB 2M2LA 3QOJA 1Q3LA 5I9OA 1TWGB 2AQ3B 3TP6A 4FYDA 2WKCA 4KY6A 4BBRB 3IKJA 5JJZA 3OPOA 3FVQA 2EYLA 1S5DD 5C0XH 5G3LF 2ICEC 1H9MA 1KAAA 1VF5C 2AQ1B 1SE4A 3MXUA 1UNSA 1Y8OB 4UAIA 2L55A 4KHVA 4RGMA 1Q8IA 2IJ0A 2EE1A 3GTMB 3DMUA 1XTCD 1Z47A 2F0WA 3H94A 2Z4IA 2TSSA 5KYLA 2OEOA 4NMZA 4TRDA 2G9DA 4IFDG 2JA7B 1SYFA 2IWHA 3BYTB 3LWUA 3K0YA 1F77A 4K6DA 4I65A 1WTRA 3OIQA 4IFDI 1HA5A 5IGBA 1V1PA 1F2ZA 4XQQA 1IW7C 2HUGA 2A6HD 5C3XA 1GUGA 3IFDA 1B3AA 2E2JB 1JOKA 1LTBD 2K05A 2EPBA 3KBXA 1O7ZA 4R9WA 1H9RA 4C3HG 3J80L 1EEID 2L4NA 1VMPA 5DM63 4M1UB 2FHTA 1HQMC 2LS01 3TDQA 1X3PA 2NB0A 1WTVA 2F0TA 2L9HA 1EWCA 2IX0A 3HOXB 2LMCB 1RKNA 2FINB 1GXDC 4CJ0B 1A2UA 4KI0A 3D4DA 2K32A 4IUNA 4Q0FA 1NUCA 2RDGA 4G7ZC 1IW7D 5JPMC 4WJWA 2B2VA 1L0YB 2ZXPA 5DM73 2SOBA 3CHBD 4RFBA 1KDAA 3A54A 1E2ZA 2QF7A 1WVLA 2B8GA 4FO2A 2O5JC 5CC4A 4PMCA 2PO4A 1B4OA 1OXTA 2A69C 1HTLD 3RD4A 2D62A 3GTJB 3O13A 3GTPB 1LTSD 1GHKA 1Y1WB 2J4XA 2E75C 1VCIA 3K7AB 4RGTA 4A93B 1D5XC 5E4XA 5C4XB 3NHHA 4MHEA 5I4DA 5FO8B 2HQEA 3I4LA 4DU9A 1TWHB 2F0OA 1EY9A 4K5VA 3NTKA 3Q23A 5COYA 4HTHA 5ELBA 4A3GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DON A;  1EL0 A;  3GV6 A;  5COR A;  1WD0 A;  1Q3L A;  2KED A;  4OIK A;  3SVM A;  2B2T C;  1WTQ A;  1AP0 A;  2BDN A;  1DZ1 A;  2RVL A;  2L4N A;  1BBX C;  1VMP A;  1ILQ A;  5EKI A;  5EPJ A;  3FDT A;  4DN4 M;  1WTX A;  4ZLT F;  2RA4 A;  2X69 A;  2FHT A;  1SSO A;  4XDX A;  4ZK9 B;  2J7Z A;  3G7L A;  2IL8 A;  1U4P A;  3DEO A;  3F2U A;  1X3P A;  2K01 A;  3ONA B;  2B2U A;  4QUC A;  1F9P A;  5JJZ A;  5DNF A;  2XIW A;  2KEC A;  1HRJ A;  1SDF A;  1IKL A;  1RTO A;  2FFK B;  2KUM A;  4RAU C;  3R93 A;  4ZKB B;  4R8I A;  1WTW A;  1WTV A;  1U4L A;  2L9H A;  1M8A A;  1KNE A;  1BNZ A;  2B2U C;  1X32 A;  4HED A;  1WD1 A;  1ROD A;  1F9S A;  1U4M A;  1F9R A;  2FIN B;  5EQ0 A;  4CJ0 B;  1O80 A;  3MWY W;  5EJW A;  4QUF A;  1CM9 A;  1X3Q A;  4RA8 A;  1JE4 A;  2X6L A;  4RWS C;  4X3S A;  4ZKC B;  1MSH A;  3MTS A;  2RSO A;  1IKM A;  1XX8 A;  2B2W C;  4UAI A;  4X3T A;  1AZP A;  1B53 A;  2L11 A;  2NYZ D;  3TZD A;  1DOK A;  2HCI A;  2MJ8 A;  2Q8T A;  3TN2 A;  1ZXT A;  2EE1 A;  4U68 A;  1BO0 A;  4CJ2 C;  2KVM A;  3DM1 A;  2B2V A;  1E0B A;  1J9O A;  4ZAI A;  1EOT A;  2MPM A;  1HUM A;  2NZ1 D;  5CBA E;  3IL8 A;  4X3K A;  1ML0 D;  2R3Z A;  1HFN A;  2HDM A;  2KOL A;  1F2L A;  1EIG A;  5E4W C;  1HA6 A;  4IUQ A;  2B2W A;  1WTP A;  1HUN A;  1WVL A;  5EPL A;  3N52 A;  4IUP A;  2B2V C;  2KEE A;  1QNK A;  2D9U A;  1RJT A;  2NWG A;  1B2T A;  4HSV A;  5EPK A;  5T1I A;  2CVR A;  3I8Z A;  1DOL A;  4HAE A;  1PDQ A;  3D6W A;  1B4O A;  1A15 A;  1BF4 A;  3KUP A;  1MI2 A;  2L1B A;  3I90 A;  1SAP A;  4IUV A;  2B2Y A;  1O7Y A;  2DY8 A;  2N55 A;  1CA5 A;  1HHV A;  1LV9 A;  2MGS A;  5D65 A;  4IUU A;  2EOT A;  1QG7 A;  4MN3 A;  2K28 A;  1EQT A;  4XT3 B;  1AZQ A;  4OIJ A;  1EIH A;  1F9Q A;  2DY7 A;  1XYI A;  1B50 A;  2K1B A;  1WTR A;  2RSN A;  2B2Y C;  1U4R A;  1TVX A;  3I3C A;  1PLF A;  1J8I A;  2SDF A;  5CMD A;  1MSG A;  1RHP A;  1NAP A;  5CBE E;  3LWE A;  1ILP A;  1PFM A;  1G6Z A;  1VMC A;  3UI2 A;  1KNA A;  1G2T A;  2L12 A;  2K03 A;  3Q6S A;  4NW2 A;  1WTO A;  1JIC A;  1MGS A;  1DOM A;  3QO2 A;  5D14 A;  1S4Z A;  3H91 A;  5E4X A;  1C8C A;  2HUG A;  3P7J A;  1PFN A;  2JYO A;  4HCS A;  1QE6 A;  2N88 A;  3HP3 A;  3IFD A;  4X3U A;  2VXW A;  2HCC A;  2H1E A;  2K04 A;  1ICW A;  1NR4 A;  1B3A A;  1RTN A;  2JP1 A;  4MHE A;  1GUW A;  1CA6 A;  2FMM A;  1ESR A;  2X6G A;  1IL8 A;  2K05 A;  2EPB A;  4CJ1 B;  1NCV A;  3KBX A;  1O7Z A;  4R9W A;  2HDL A;  3DEP A;  3I91 A;  2Q8R E;  4IUR A;  2B2T A;  5AFW A;  3GV3 A;  2FJ2 A;  1HFG A;  3FPU B;  4LMQ D;  5COY A;  1PFB A;  5T1G A;  4IUT A;  4O42 A;  1G2S A;  1NR2 A;  1G91 A;  4XT1 B;  2MP1 A;  2M2L A; 
#chains in the Genus database with same CATH topology
 4AIM A;  1LLR D;  4GLX A;  1EIF A;  2B2T C;  1VQD A;  1I50 B;  2BDN A;  2NVY B;  5BN5 A;  3PO3 H;  1CI3 M;  1FNU A;  4GN5 A;  2FXQ A;  3G7L A;  2JXM B;  2K01 A;  1XPO A;  2QGQ A;  1JCK B;  3ND9 A;  3S1Q H;  1NSN S;  1GUS A;  4BXX H;  3S9W A;  1E24 A;  2PYK A;  2B3G A;  1YIT A;  4Y7N B;  4PQX A;  3AU7 A;  3A8K E;  4RWS C;  3G6J B;  4KKU A;  2ALY B;  1IBK L;  1R4P B;  2E2J H;  4A3F H;  1LUZ A;  2BDO A;  2NTS A;  2ZM6 L;  2F4V Q;  1C7Y A;  3BDC A;  2KA7 A;  5CV4 A;  2JA6 B;  2A68 C;  2NVT B;  4R1J A;  4IO9 A;  2D2C C;  4C3H H;  3S1R H;  3GTL B;  4X62 Q;  1SMY D;  3VR5 A;  4DR2 Q;  2CVR A;  4LWC A;  4I7Z C;  4B3T L;  2E2H B;  1V1O A;  3S1N H;  3HZX A;  1JR0 D;  4MN3 A;  3L7Z C;  5C4J B;  1F9Q A;  1S40 A;  4A3K H;  1N33 L;  4CGY B;  3CF5 A;  1M90 C;  4B3R Q;  1UEB A;  3FRP B;  3WWV A;  5HGT A;  2SEB D;  1LT6 D;  5C5M A;  4KK7 A;  5NUC A;  1T5E A;  5E7N A;  1SE8 A;  3VYS A;  4PZ6 A;  2K5W A;  1QWY A;  3CQZ H;  3OW2 A;  3HP3 A;  1XPR A;  4BS9 A;  4POF A;  4O2D A;  4JI7 L;  1VQO A;  4ZUJ A;  2IY5 B;  1BVS A;  4DR3 L;  2L0C A;  1TII D;  3I91 A;  3IRB A;  3M4O B;  4L63 B;  1BKB A;  5AFW A;  2EZV A;  4LF5 L;  2DJG C;  2MQH A;  4HR7 B;  3KLS X;  4PMW A;  2F0M A;  4KN7 C;  1HZA A;  1MJE A;  1G2S A;  3I4N B;  1SNO A;  1SNQ A;  1CQV A;  3UE0 A;  4GN3 B;  3SVM A;  2F0N A;  2I46 A;  2RVL A;  1BBX C;  4G57 A;  4DV3 L;  4DV6 L;  1SEB D;  2IL8 A;  3S16 B;  3BVM A;  4QUC A;  2CKZ B;  3UDX A;  2F0Q A;  2A5H A;  3A55 A;  5M5X H;  2G9H D;  2CCZ A;  4IOC A;  4A3J H;  5IWA L;  5CGK A;  3TP5 A;  2UXC Q;  1FYC A;  1FGB D;  1HTP A;  2I0Q A;  1JOR A;  2ZJP A;  2XRQ D;  2OTL A;  1SN8 A;  3ND8 A;  2NUC A;  3MWY W;  1S3O A;  1CM9 A;  1GUT A;  5C4X H;  2YTV A;  1AFP A;  3RZO H;  4C1N I;  4A3L G;  1IBL Q;  2IX3 A;  3T1H L;  2PZU A;  3KDF A;  2JA8 H;  4P71 A;  2CH4 A;  1EEF D;  4PZ7 A;  2QCP X;  1K8A C;  4X3K A;  1ML0 D;  5BR8 Q;  4X64 L;  5C3E G;  4DNR B;  1N9W A;  1RF2 D;  3PIO A;  1GJX A;  2NZO A;  1XNR L;  4C3J B;  3I8Z A;  3T13 A;  3HOY B;  2K5N A;  5IIF A;  1PH6 A;  3S15 B;  1HHV A;  1VQA A;  4A3D B;  1B3Q A;  4F87 A;  1WFQ A;  2XWJ B;  1ICF B;  1Q86 C;  4YCV A;  1TWC B;  3ULJ A;  1XNQ L;  3C1E A;  3ULL A;  3I3C A;  4KKT A;  3S1M H;  2UXB Q;  5G3L D;  4RGO S;  1JJG A;  4LF9 L;  2UU9 L;  4ZUI A;  1HXY D;  5IE8 A;  3DM3 A;  1A62 A;  2K03 A;  1R9T B;  3I55 A;  1SYE A;  4JI6 L;  1SNM A;  1N34 L;  2PQA B;  3H0G B;  4NXN L;  4GKJ Q;  4M8A A;  2N88 A;  2Y0S G;  3K8A A;  2FMM A;  1CHP D;  4BY7 G;  1T5X D;  5C0X J;  4ODG A;  1WCM B;  3AMU A;  4XQJ A;  4LK1 C;  1J5E L;  2BE5 C;  4RCO A;  3I2Z A;  3DUZ A;  1A0I A;  1VQI A;  4BY1 H;  3CPF A;  3S14 H;  2E2D C;  1DD2 A;  1V1Q A;  1PH4 A;  3NE5 B;  5EKI A;  3NEM A;  3K0X A;  3PF5 A;  1I3Q B;  4XDX A;  2VUM B;  4P75 A;  1UAP A;  1TWF H;  1ZEQ X;  1LTA D;  5K5P A;  1YHQ A;  2NVQ H;  5A2Q L;  1RTO A;  5IYC G;  3S2D B;  4OWT B;  1Z7T A;  1U4L A;  4DXG A;  3U9S A;  5C4Z A;  3NBH A;  1CK1 A;  1F9S A;  1AE3 A;  1CFM A;  2B8F A;  2LXJ A;  1YVC A;  4X3S A;  1F2Y A;  5FLX c;  4HN7 A;  4DGZ A;  2VW9 A;  1VQL A;  3K80 C;  4KJO A;  4RH6 A;  1ASY A;  3HOU B;  4DR4 L;  1E2W A;  1FJG Q;  1UUP A;  1BO0 A;  3MHB A;  3K6O A;  3DM1 A;  4K2K A;  2RDF A;  3IL8 A;  3PQI A;  2R3Z A;  3I4N H;  5IY0 A;  2F3I A;  1JB3 A;  1SYG A;  5EPL A;  1XMQ Q;  4H44 C;  3HGB A;  3R2T A;  4DA2 A;  4L8J A;  1NE3 A;  2GVA A;  4KTA A;  5IP7 H;  3CME A;  2QDL A;  5M3F G;  4HAE A;  4A4I A;  2Z6B A;  4X66 Q;  1N32 Q;  2A1A A;  1QVC A;  1A63 A;  5JPN C;  1KQS A;  2F0S A;  1BDO A;  4IQZ A;  4QIW E;  4R4O A;  1M4V A;  1IYU A;  1CKN B;  3I72 A;  2B2Y C;  3BDO A;  3OSO A;  1B8A A;  2SDF A;  3U4V A;  1ILP A;  1MD2 D;  1PXU A;  1KNA A;  5LMN Q;  3HRZ C;  2L12 A;  5D14 A;  2I5L X;  2D0P A;  4X3U A;  2HCC A;  2XWB B;  3C1F A;  3D3R A;  3STB D;  4JBW A;  1VF7 A;  4DF7 A;  3HOV G;  4A3L H;  4YCW A;  2RF4 A;  2K5Q A;  5LL6 X;  3G6E A;  4DV1 Q;  1TS4 A;  2LKV A;  1UE6 A;  2F3W A;  3PO2 G;  5L37 A;  5C3E H;  3T1Y Q;  1IL2 A;  3NPP A;  3MXN B;  3J7A V;  2B63 G;  2KQ3 A;  1Y1V G;  3U50 C;  4J15 A;  1SSO A;  3I4M G;  5F2D A;  2QIL A;  1I6H H;  4RMF A;  2LSS A;  2GN5 A;  1B70 B;  4WFN 3;  4DR2 L;  1KHI A;  3P20 A;  5JJI A;  1GUN A;  3HOZ B;  4EX5 A;  1NY4 A;  1I4P A;  2BA1 A;  2J0T D;  2VL6 A;  3FEW X;  1K8G A;  2F0P A;  2JA5 G;  1KAW A;  3I4O A;  3F2D A;  1VQ8 A;  5EJW A;  4B3R L;  1JE4 A;  1RIP A;  2X6L A;  4JV5 Q;  4HMI A;  3HOW B;  1IZ6 A;  1IKM A;  1AZP A;  4X3T A;  2NN6 G;  5CV5 A;  2YU9 B;  1A6X A;  3TN2 A;  2O5I C;  1ZXT A;  2VB2 X;  4FDB A;  3RMH A;  3M7N A;  2DUD A;  1J9O A;  4KY7 A;  3NQI A;  2ZJR A;  4R4Q A;  3K5N A;  1HFN A;  4QIW B;  2WB1 B;  2PMZ B;  3GD7 A;  1HNZ Q;  1Q82 C;  1N36 L;  1K28 A;  1SR3 A;  3H3V I;  1ENC A;  4RKB A;  1PHJ A;  2NN6 I;  2H4O A;  1JB7 A;  4LF4 Q;  4C3I G;  3KUP A;  4A3M B;  1SAP A;  4YHH L;  1H9K A;  3C3L A;  3T56 B;  1VQE A;  1PH9 A;  1YZ6 A;  4JI1 Q;  4OIJ A;  2DY7 A;  1XYI A;  2K7V A;  2YTY A;  3A74 A;  5K36 G;  2IW3 A;  3K58 A;  5CMD A;  5J39 A;  3KFU A;  5IYC H;  1PFM A;  1G6Z A;  1M1K C;  1VMC A;  3EVQ A;  3F1Z A;  3WOE A;  4LF6 Q;  3VYR A;  3PO3 B;  3GTG B;  1GUW A;  1C9O A;  3MFG A;  4DAY B;  2DNC A;  2Z4H A;  4KD3 A;  2F3V A;  4WRD A;  2EYF A;  2HDL A;  3S1Q B;  4DPG A;  2ZTC A;  5FKA C;  2AUJ D;  2JA7 G;  1PYW D;  3UE1 A;  4O42 A;  5HY6 A;  1D2B A;  1NR2 A;  5DEH A;  1H9S A;  5M5W H;  4EQP A;  4ZYS A;  5TSS A;  5IOD A;  2R7D A;  3U58 A;  4WJ4 A;  1K83 H;  2OXP A;  2RHQ B;  3K81 C;  1SRO A;  4A3F B;  1KXL A;  2DJF C;  1ET6 A;  1HCZ A;  3VR6 A;  4DK0 A;  1TR5 A;  1QCB D;  4K8I A;  1BBW A;  4YCU A;  4HJ5 A;  3X3N A;  2K5D A;  4HED A;  1STY A;  2JK8 A;  3ERS X;  2IPK D;  4HIM A;  1HNX L;  5KND A;  4C3H B;  1KLU D;  1NBW A;  4AYB E;  3UDF A;  3S1R B;  4JI4 Q;  3RZD H;  1FVI A;  3C46 A;  3PSI A;  2NYZ D;  1BXT A;  3GP7 A;  4JC0 A;  1CT1 D;  3I56 A;  1YIJ A;  1TXY A;  4A3I H;  3S1N B;  5J1Z A;  3Q8D A;  1GKH A;  1SE2 A;  3A56 A;  1D6E C;  4JCV E;  5GAH C;  3HOV H;  2KHS A;  3PIO 3;  4A3K B;  1JC7 A;  4UY8 C;  3FKI G;  4JPB W;  1TT2 A;  1JWS D;  4FP5 D;  4KLK A;  4DUY L;  1D5Z C;  3RLF A;  1RJT A;  4X65 L;  1G51 A;  1B2T A;  3G48 A;  5T1I A;  4V0B A;  2BOS A;  4OON A;  3PO2 H;  1X3E A;  2L1B A;  3CQZ B;  4A3B H;  1Q90 A;  1Y1V H;  3EA6 A;  3VA5 A;  2OF1 A;  1G6P A;  2EJF C;  1VQJ A;  1VQB A;  1B50 A;  1Q7Y C;  2EYH A;  3S2H H;  1BQQ T;  4KV6 A;  3BG3 A;  3NQT A;  4L5T A;  2F0G A;  2EY2 A;  4S3S A;  1K8O A;  1D5M C;  3PIP 3;  4QY7 A;  1TU2 B;  1HPC A;  4CBV A;  1TY2 A;  3K5M A;  3OWF A;  2BCO A;  2JA5 H;  3HOW H;  4JI3 Q;  4HCS A;  4A75 A;  4ID6 A;  1NR4 A;  5IT9 E;  3SK5 A;  5FLX L;  4LFC Q;  2PQA A;  3HKZ B;  4LF7 Q;  2F4I A;  2MO0 A;  3E5S A;  3KF6 B;  4IUR A;  2F0D A;  2F0I A;  5J22 A;  5M5X B;  5M9O A;  3FPU B;  3D0F A;  1HJP A;  4A3J B;  2M9V A;  2WAQ G;  4XT1 B;  3N6R A;  4AYB G;  3VA7 A;  1CQF A;  2KED A;  3TP7 A;  4B3M L;  1HZ9 A;  1AE2 A;  3NWT A;  4ZCK A;  2RA4 A;  3RZO B;  2Q2H A;  1U4P A;  3DEO A;  3M85 A;  3GTK H;  2EDG A;  4BBS G;  1NMF A;  4HMJ A;  1OXS C;  4C3I H;  5ELC A;  1Y1W G;  1Y14 B;  4CDD C;  1IKL A;  2JA8 B;  4R8I A;  1SNC A;  3QB3 A;  1X6O A;  1VQP A;  2Z6K A;  2XNA C;  4DV7 Q;  3RLO A;  2AQ2 B;  3W2D A;  5K36 H;  3V05 A;  2Z8L A;  1QZG A;  1EIY B;  2Z0S A;  2RSO A;  1BCP C;  4CKE A;  3SXH A;  3GTG H;  2EYM A;  3I70 A;  5FLX E;  1PH1 A;  2H5X A;  4IFD H;  1ONL A;  4GKK Q;  2HCI A;  2K33 A;  3A0J A;  4KN4 C;  4A3G G;  5FK9 C;  2FMC A;  1FNW A;  3TME A;  1EY0 A;  3JAM E;  1E0B A;  4N9P A;  1RL2 A;  1AH9 A;  2Z9H A;  2AHO B;  4DV2 Q;  1D7Q A;  1KLG D;  1XWE A;  4DR1 L;  3S1M B;  1PTO C;  1GHJ A;  1WTP A;  5JOB A;  2A69 D;  4LFA Q;  4GLV B;  2B39 A;  1LT5 D;  2L15 A;  2B2V C;  1BUV T;  1IBM Q;  1YNJ C;  3BVG A;  3SR1 A;  3TBI B;  1VQC A;  1L1O C;  3G4S A;  4B3S Q;  1PRT C;  2AWO A;  2F03 A;  1QG7 A;  4B9W A;  3QIA A;  2YYZ A;  1Q8K A;  1P8L A;  2L5T A;  2F1M A;  2MFI A;  2K6A A;  1KTK A;  4GNX C;  1FNV A;  1XXG A;  3H15 A;  4X6A H;  4DNT B;  3L9A X;  5ELD A;  2XVS A;  1RHP A;  1NAP A;  2PQE A;  3TS0 A;  1CKN A;  4JBK A;  4GOP B;  1MGS A;  4BY1 B;  4DR7 Q;  1F2M A;  4KHP Q;  2D5D A;  3S14 B;  3EFX D;  2H1E A;  1WOC A;  5I9P A;  4NXM L;  4DAP A;  1STA A;  1CHQ D;  1DCZ A;  4RG1 A;  4C2M H;  1IL8 A;  1HZC A;  1K8M A;  2MHV A;  1TWF B;  3DWA A;  4NKL A;  3P75 A;  3MZ5 A;  2NVQ B;  5FOB B;  1JT8 A;  1Y69 U;  4XIG S;  1X65 A;  4TQU S;  3UDI A;  4JI2 Q;  1TY0 A;  4ZKB B;  4DAV A;  5LMU Q;  3GV6 A;  4ZQ3 A;  3FKI H;  4BWG B;  5EBD A;  1HNZ L;  1Z6H A;  2J7Z A;  1UE1 A;  3MXN A;  3F2U A;  2B2U A;  1CZW A;  2OWO A;  2NTT A;  1U0L A;  1YNJ D;  4HJ7 A;  4OO1 G;  2KUM A;  3QOL A;  4DV5 Q;  3OIP A;  4WJ3 M;  1S5F D;  4TVA B;  2UUB L;  4LF8 L;  2F0K A;  1STN A;  1U4M A;  2EQS A;  2KCC A;  2C9O A;  1LTG D;  5C6A A;  1NJI C;  1EYG A;  3E0E A;  4CDE C;  4ZKC B;  5IGC A;  2UXD Q;  1XX8 A;  1B53 A;  2A68 D;  4FXG C;  2CHB D;  4OO1 I;  4IPC A;  1UEA B;  2Y0S E;  4LF6 L;  1DGS A;  2A6E C;  1EZ6 A;  1TS5 A;  2F0U A;  3E9I A;  1YNN C;  3FMC A;  2QDB A;  4RKL A;  3G71 A;  4LUV A;  4IUQ A;  1VQK A;  4DR5 L;  3D6C A;  1XMO L;  2KEE A;  2NWG A;  3EJI A;  1K3B C;  3RN5 A;  2HHH Q;  3TRZ A;  1MBY A;  3KLR A;  4QMG A;  1JWU D;  1DOL A;  3D6W A;  1E2V A;  4YY3 L;  4IAL A;  1LTT D;  5CYU A;  4XYO A;  2F0H A;  3E9H A;  3JAM i;  1EZ8 A;  3FPP A;  1XTD A;  2K1B A;  2RSN A;  4K5X A;  4BBS H;  1FGU A;  1MSG A;  3J81 E;  4XTC S;  3D4R A;  3PUX A;  4JI5 Q;  2VNU D;  2R61 A;  2BA0 A;  5LL6 S;  5C3E B;  2LY7 A;  4AQY Q;  4LFB L;  3GO5 A;  2VXW A;  2OCE A;  4DNI A;  2O4X A;  3T53 B;  1OTC A;  4NP5 A;  1SYD A;  3Q22 A;  1I6H B;  1R4Q B;  3SGI A;  4DUZ Q;  4JI8 Q;  4NDX A;  3DWQ A;  4C3J G;  3CRK C;  2AWN A;  3W1B A;  4DAY A;  3K7U C;  1HFG A;  2I5H A;  4LMQ D;  5E3F A;  2E8G A;  1EY5 A;  3BDL A;  3HOY G;  1HR0 Q;  3H09 A;  1PZJ D;  4IPH A;  3PUW A;  2UUC L;  1PYS B;  4A3D G;  2PI2 A;  4XQN A;  5COR A;  1S5E D;  2RCF A;  3M3Y H;  1VQG A;  3WDN A;  1ILQ A;  5IT9 c;  4YWM A;  3FDT A;  4DN4 M;  1WTX A;  4HJ9 A;  1I94 L;  3H3V C;  1LAC A;  1LAB A;  2HIV A;  2I07 B;  4JYA Q;  3L0O A;  3J80 c;  5DNF A;  1CTM A;  1SDF A;  1BR9 A;  2OT2 A;  1BOS A;  3KOJ A;  3H0G G;  3D4W A;  1K3R A;  3M4Q A;  3P1H A;  4J1M A;  1WD1 A;  5CV8 A;  4DXF A;  2VQF Q;  2N78 A;  4GNX B;  4DV0 L;  3PV0 A;  5M3M G;  2HT1 A;  2XSC A;  4EVO A;  1QUQ A;  2WII B;  5IGF A;  1MSH A;  1WCM G;  3MTS A;  3Q0A A;  4GZY C;  1DJR D;  5C0X G;  2F0V A;  3VR4 A;  2RCN A;  1KRS A;  4HJ8 A;  4ZAI A;  2R7Z G;  1SYC A;  1YHB A;  5J3B A;  2XN9 C;  3A5U A;  2JE6 I;  2K4K A;  2AUK A;  4LFC L;  4DV4 Q;  4EQN A;  3NP8 A;  1YJ9 A;  4LF7 L;  1F2L A;  2HD3 A;  3SDZ A;  1ZYR C;  3N52 A;  1JJ2 A;  1I4X A;  4DAM A;  1HZB A;  2D9U A;  5C0X I;  4Q5V A;  2EYP A;  3SK4 A;  2E2I H;  4ILW A;  1O7I A;  4BA1 I;  1PDQ A;  2PZW A;  4DKA C;  3KJP A;  1IYV A;  3SHL A;  1YHA A;  5C3W A;  4JI0 Q;  3OTO Q;  3ICE A;  5D65 A;  1WJJ A;  2JN4 A;  3RR5 A;  2RDH A;  3JAM c;  3NBI A;  4ABN A;  3HKS A;  5I2Y A;  4FXD A;  4UP8 A;  3DHQ A;  4DR6 Q;  4OX9 L;  2VZA A;  1KDC A;  3MVV A;  4G7O C;  4C56 C;  3KF8 B;  1LTR D;  1KAB A;  2ID0 A;  2UUA Q;  4NW2 A;  4JG2 A;  5M5W B;  4PNY A;  3QO2 A;  1S4Z A;  2R92 G;  4QF4 A;  2VQE Q;  2JYO A;  1L0W A;  1G29 1;  1K83 B;  1PTO F;  2BE5 D;  2Q8I B;  3U4Z A;  2DN8 A;  4K6L A;  2QW7 A;  3VYU A;  5DAU A;  2CWA A;  4PV1 C;  1SFO H;  2E74 C;  1SMX A;  3IFT A;  2ICI A;  1EUJ A;  2KEN A;  5T1G A;  4B08 A;  4A3E G;  4IUT A;  3J81 i;  5ELN A;  4K0K Q;  2R93 G;  3KF6 A;  1PRT F;  4FF1 A;  2CW0 C;  1STH A;  4F8M A;  1EL0 A;  1X3F A;  5JEA G;  3PUZ A;  4DV2 L;  1AEX A;  3NUC A;  1H9J A;  5C44 G;  2EXD A;  3LGJ A;  4YWL A;  3D8G A;  3RZD B;  4N8F A;  4HSP A;  5KIX A;  1IBM L;  3MAQ A;  4L5Q A;  4EGV A;  2E5L Q;  1SJE D;  3GTQ H;  2XIW A;  4DK6 C;  4RCN A;  2FFK B;  4A3I B;  1Q81 C;  4B3S L;  2HIX A;  3HOV B;  3GQB A;  2F4V L;  4K14 A;  4L6T B;  2M00 A;  4OXP A;  1Q1B A;  3TQY A;  2JEB I;  4DFA A;  5HUR A;  5FJ8 G;  3PO2 B;  3OMC A;  3CKI B;  4X62 L;  4A3B B;  1K0S A;  4HID A;  1QNU A;  2B63 B;  4A3C G;  1IYJ B;  1DYQ A;  1Y1V B;  1TWA B;  4QGU A;  1STE A;  1KIX A;  4IOA A;  4CHT B;  1MKH A;  2PNR C;  3VDY A;  3S2H B;  4Y52 H;  1EIG A;  1IBK Q;  4OWW B;  1HUN A;  3J7A 5;  5FLM G;  5GAE C;  2A74 C;  4Z9C B;  3CCM A;  1QNK A;  1PTO H;  1GVP A;  4FF3 A;  1YBY A;  1LO5 D;  2KCN A;  2JA5 B;  4JI2 L;  4OWX B;  1U9R A;  4MIU A;  5KNC A;  2ZXO A;  2SNS A;  1UE5 A;  2EOT A;  4XT3 B;  1EQT A;  4KMU C;  4ZRZ A;  4V19 0;  3T51 B;  4JOI A;  3OHX C;  1TQO A;  4R4I A;  4C1N K;  4BY7 H;  3A7A B;  1EWI A;  4B3T Q;  3R2I A;  5CBE E;  5CR3 A;  2DNE A;  3GDE A;  2TMP A;  2RQX A;  1JE5 A;  3HG9 A;  4BBR G;  1AN8 A;  4EQO A;  2O2L D;  1WTO A;  1JIC A;  2F0J A;  2R7F A;  3GTO H;  1EOV A;  3V96 A;  1N33 Q;  5M3M H;  5H1S E;  2JP1 A;  4GOP A;  1LTL A;  2WB1 G;  3CC4 A;  4UP7 A;  3NSW A;  3GTK B;  3M4Y A;  2UXD L;  4C3I B;  1PVO A;  2A6H C;  2K5H A;  4WOR A;  1A3V A;  5JJK A;  1VQ9 A;  1ENA A;  3GV3 A;  1GOZ A;  3J81 c;  1KD1 C;  4JK1 C;  1GO3 E;  3IAY A;  3EQL C;  2K5V A;  3CCE A;  3HS0 C;  2R7Z H;  1G91 A;  3NXW A;  2IHF A;  3BVZ A;  3VR2 A;  4JI7 Q;  4NB3 A;  5BN4 A;  2VY3 A;  3L3O C;  3DWP A;  1U5K A;  4DR3 Q;  3PUV A;  2UXC L;  4JW0 A;  3CCU A;  3CD6 A;  4LF5 Q;  4IFD J;  2IX1 A;  1MHW C;  3MXP A;  1QIL A;  1SE3 A;  3AYH B;  1NMG A;  2WP8 J;  3PUY A;  4RAU C;  2ATW A;  1IBL L;  5CV9 A;  4LAA A;  2QEX A;  2NBF A;  4F7X A;  4DV6 Q;  5EGT A;  1V9P A;  1CZG A;  5BR8 L;  4FNF A;  3E6Z X;  2CWP A;  5IWA Q;  4JI5 L;  3TZD A;  1K0R A;  2MJ8 A;  3NEN A;  4XXE A;  1AW7 A;  5M3F H;  1EU3 A;  3MC0 B;  4R8N A;  1CSP A;  4DUZ L;  2QEJ C;  4KD4 A;  1PZK D;  3KJO A;  4QJF A;  4A3E H;  4A3F G;  4LUO A;  2WAQ E;  4IPD A;  4OEM B;  3E0J A;  2UXB L;  1PYB A;  5IOC A;  4HIK A;  1SJH D;  2DY8 A;  2PPB C;  5JEA H;  1LV9 A;  4E6I A;  1EYD A;  5IT9 L;  2ZT9 C;  1II3 A;  4KJN A;  1XNR Q;  5C44 H;  4GKJ L;  4C2M B;  5CV7 A;  5JJL A;  2JSO A;  3K5O A;  1U4R A;  2F0F A;  3BS1 A;  4IPG A;  1G2T A;  2E76 C;  1PH7 A;  3TS2 A;  2VS1 A;  1JMC A;  1EQV A;  3FKI B;  2B29 A;  1XNQ Q;  4GLA C;  1RTN A;  4NPS A;  4A3K G;  3CCL A;  1S72 A;  3B6Y A;  2B63 H;  2K14 A;  3HOX G;  2UU9 Q;  1TWA H;  3I7F A;  3TZU A;  1EFI D;  3OYY A;  3I4M H;  2B2T A;  4TSS A;  4JI6 Q;  1B9M A;  1N34 Q;  1I4Q A;  4H7B A;  4A3C H;  1EU4 A;  4OL7 A;  3CP0 A;  2CQA A;  3CCJ A;  4P73 A;  4LJZ C;  1JQY D;  4H13 C;  2EYJ A;  5KEE A;  5I6Y A;  1DZ1 A;  2LXK A;  2MUY A;  1PZI D;  5FLM H;  1Q1E A;  1JWM D;  1A3T A;  2Q2U A;  2JA9 A;  5I2X A;  5IGG A;  2WFW A;  1HQR D;  3R3O A;  2IHE A;  1F9P A;  1QOH A;  2XRS D;  3H3V H;  1HRJ A;  2PW5 A;  3R93 A;  2NN6 H;  3J80 E;  3QWN A;  1K9M C;  3OTO L;  4JI0 L;  3JAM L;  5M5Y H;  1FJG L;  3ERO A;  1C48 A;  1TWG H;  4G4K A;  1PMR A;  1V43 A;  1X3Q A;  4RA8 A;  1X3G A;  3MXG A;  2V4D A;  4BBR H;  2WAQ B;  4K2L A;  2XTI A;  1TKW B;  4AYB B;  2UUA L;  1XMQ L;  1DOK A;  4A3J G;  2G5D A;  2V1C C;  4CJ2 C;  1T9H A;  2D0O A;  1JOQ A;  1PH3 A;  1EOT A;  4FF2 A;  1HUM A;  2NZ1 D;  4A93 G;  4X66 L;  1N32 L;  5IGE A;  1Y8P B;  1OO9 B;  2HDM A;  3T16 A;  4POG A;  4BBS B;  4O1N A;  2ZXR A;  5C4X G;  5E4W C;  1CUK A;  3SK6 A;  3PGZ A;  4IUP A;  3TRE A;  4DR4 Q;  2OTJ A;  1Q12 A;  2ZTE A;  4APV A;  1SNP A;  5EPK A;  1OXU A;  1W3S A;  2NZH A;  3QJY A;  3S24 A;  1B1Z A;  4IUV A;  1CA5 A;  3HEJ A;  4MNO A;  4J8Q A;  5LMN L;  1EYC A;  2MGS A;  3GTM H;  4IZ8 A;  2EYO A;  1SMY C;  4UDU C;  1EIH A;  1L2F A;  2CQO A;  1S5C D;  2ZTD A;  3AFP A;  1ESF A;  1DM0 B;  5FO9 B;  3UI2 A;  3D31 A;  4CKB A;  2BH8 A;  2JA7 H;  4R4T A;  1LM0 A;  1C8C A;  1DOM A;  5D3I B;  5LMN W;  3M3Y B;  3P7J A;  3KF8 A;  3MA2 B;  4DV1 L;  1CA6 A;  3T1Y L;  3K59 A;  1K73 C;  2X6G A;  4RHR A;  1VQH A;  3RUZ A;  1NTG A;  1PA6 A;  5ISR A;  3DEP A;  3DLL A;  1KRT A;  1OXV A;  2FJ2 A;  1PFB A;  1I5F A;  2EY1 A;  4RHS A;  2PZT A;  4G7H C;  1DON A;  1E3P A;  3M4P A;  2VB3 X;  1EYA A;  3CXC A;  1O7L A;  2X69 A;  4ZK9 B;  3LX0 A;  1A3U A;  3MEF A;  2JA6 G;  3W5O A;  4KHZ A;  3VYT A;  4QQB X;  2WAC A;  5AJ3 Q;  4JV5 L;  3FHW A;  4L5S A;  1WTW A;  4BY1 G;  3NK9 A;  1G8Z D;  2N49 A;  1BCP D;  1BNZ A;  4N8X 1;  3SK8 A;  1X32 A;  5IGD A;  1EY7 A;  3QR8 A;  1TS3 A;  4YWK A;  3J7A F;  1S5B D;  2SNM A;  2Z6K C;  3DXJ C;  4OHJ A;  4CDF C;  5A35 A;  1UWV A;  4B9X A;  4KKS A;  4XYQ A;  2E2I B;  1VDZ A;  2Q2I A;  5KYI A;  1NNX A;  1PTO D;  3OMG A;  3K57 A;  1EFW A;  4U68 A;  5GAG C;  3J80 i;  4LF4 L;  1STG A;  1A2T A;  2MPM A;  4IN3 A;  2A73 B;  2EJG C;  3HOX H;  3MEH A;  1W6J A;  3ERQ A;  1HA6 A;  2B2W A;  3ZYY X;  4JI1 L;  1PRT D;  3J81 L;  2PW7 A;  1ET9 A;  5LHY 1;  1HH2 P;  1HNW Q;  1A15 A;  1BF4 A;  3I90 A;  4P72 A;  1E1O A;  1O7Y A;  4FVM A;  3SE0 A;  1N36 Q;  3I4N G;  1H9S B;  4N9T A;  3CCQ A;  1V1P B;  5EKK A;  1SFO B;  1TVX A;  2WV6 D;  1SND A;  3A8J E;  5IP7 G;  3OWE B;  3NTI A;  1JOO A;  4YHH Q;  4LUZ A;  5EAY A;  1W6K A;  1I4H A;  3T4A C;  1RD9 D;  4UP9 A;  3E3X A;  1DXM A;  1XPU A;  3PCO B;  3OOC A;  1ESR A;  4LNQ A;  2KHI A;  1NCV A;  1D8L A;  3GTQ B;  3BZC A;  3GTJ H;  1ENF A;  3GTP H;  1GUO A;  5KRU A;  1Y1W H;  4A76 A;  1I6V C;  3VR3 A;  4QL5 A;  3K7A H;  4A93 H;  1QJO A;  1WTH A;  2Z1C A;  3ZJY C;  1YJW A;  1WD0 A;  3C2P A;  1WTQ A;  4QB4 A;  2GA4 B;  3L2P A;  5HGQ A;  2LFN A;  2EXZ A;  3KLW A;  5C4H A;  1Y8N B;  1TWH H;  3ONA B;  3I73 A;  4JVZ A;  4JI4 L;  2KCM A;  1BCP B;  2KEC A;  1PH2 A;  5EBC A;  1SYB A;  5JVG 3;  3CCR A;  5FO7 B;  4A3G H;  3CU7 A;  1B7Y B;  2B2U C;  5E1F A;  5JVH 3;  1F9R A;  1I50 H;  2NVY H;  4QUF A;  2R6G A;  1GM5 A;  3A8I E;  2A6E D;  1P16 A;  1FR3 A;  3W1G A;  2EJM A;  1PTO B;  5EKL A;  1YNN D;  2B2W C;  4CDC C;  1RCV D;  3RLN A;  3PMF A;  4U67 3;  1EY8 A;  3AFQ A;  2JJQ A;  2WIN B;  1LT3 D;  1UE7 A;  1C0A A;  1D1K A;  5D3D A;  1KDB A;  3H6M A;  2KVM A;  3F8T A;  3JC6 6;  1PV4 A;  1HNX Q;  1L1O B;  1OXX K;  2KJX A;  1STB A;  4GN4 B;  2Y0S B;  1PRT B;  3TP8 A;  3R8B A;  2ZJQ A;  4BY7 B;  4Y7N H;  4CKC A;  4TKO B;  3PIP A;  3MFY A;  5IYD G;  2GVB A;  4HSV A;  4HCE A;  3KLS A;  3OW7 A;  1MI2 A;  3X3M A;  2WKD A;  2IT1 A;  3GTO B;  2B2Y A;  2N55 A;  4GS3 A;  5M3M B;  1QVG A;  1SBB B;  1FD7 D;  3CRL C;  1AZQ A;  5ELO A;  4JI3 L;  4DUY Q;  2JA6 H;  5JAV A;  1VQF A;  4BA2 I;  4K8J A;  4X65 Q;  1YI2 A;  1VQ7 A;  4KY5 A;  2NVT H;  3KK7 A;  1X55 A;  1J8I A;  1SLJ A;  3LWE A;  4RGN A;  3GTL H;  2VUM G;  2R7Z B;  2NVX B;  2F52 A;  3H91 A;  1IXR A;  3K5L A;  1PFN A;  2E2H H;  1VS0 A;  1QE6 A;  5CV6 A;  1LYL A;  3AQQ A;  2K50 A;  5C4J H;  2A19 A;  1LT4 D;  4P2C B;  2Q8R E;  1VQ5 A;  1BCP F;  3STB C;  3J81 j;  4IJH A;  2RKS A;  4OO1 H;  3M7G A;  3HOU G;  2MP1 A;  2CFM A;  1YJN A;  5IP9 G;  4OIK A;  4PG3 A;  1AP0 A;  2JEA I;  4PMB A;  2C5C A;  3J7Y W;  5EPJ A;  3KBG A;  1MJC A;  5IYB G;  4ZLT F;  4DV7 L;  1SXT A;  1CSQ A;  2QKI C;  3KYH C;  2K75 A;  2R92 B;  4HIO A;  3M4O H;  1I4G A;  1O78 A;  2EY6 A;  5M3F B;  4J6H A;  3U9O A;  4B3M Q;  5C5L A;  1KL9 A;  1M8A A;  5GAD C;  4GKK L;  3Q24 A;  1KNE A;  4ULL A;  2XGT A;  2CH4 W;  5ELF A;  1ROD A;  4EQ5 A;  1I4R A;  1B44 D;  1B9N A;  5EQ0 A;  3F2B A;  1O80 A;  4A3E B;  1QB5 D;  3NTH A;  2R93 B;  5GRO A;  3AB9 A;  1ASZ A;  2L11 A;  5JEA J;  1C4Q A;  4LFA L;  4H0L C;  1Q46 A;  1ZKO A;  1V8Q A;  3S16 H;  2Q8T A;  1L0X B;  5A2Q E;  3BYY B;  1ZYR D;  2WB1 E;  2PMZ E;  3V2T A;  5C44 B;  5CBA E;  5KGU A;  2KOL A;  3W3A A;  1RDP D;  3RNU A;  1PFS A;  3WOF A;  4FXK C;  4A3I G;  2OQ0 A;  4QCL A;  1TS2 A;  3LNN A;  5I6W A;  5BN3 A;  4OGQ C;  1PH5 A;  2P5Z X;  1KC8 C;  4DR1 Q;  4IUU A;  2PCF B;  1LTI D;  3CAM A;  2K28 A;  3RN2 A;  4DR7 L;  4KHP L;  3NWS A;  5GQO A;  3EBE A;  3QG1 A;  1D1I A;  1VQM A;  4AH6 A;  1EQQ A;  3I4M B;  4F88 A;  4FF4 A;  1X56 A;  1EY4 A;  1PLF A;  1W2B A;  2MO1 A;  3S17 B;  2F0E A;  5AJ3 L;  1GD7 A;  4C3J H;  2MNA A;  3SEB A;  4PZ8 A;  1EWH A;  4K5W A;  3TSS A;  3Q6S A;  4A3B G;  2F0L A;  1MIU A;  4YIJ A;  3HOY H;  2ZM6 Q;  4I7A A;  3A7L A;  3S15 H;  2RBM A;  3PF4 A;  4A3D H;  3URY A;  2K04 A;  3HOZ G;  1XJV A;  1ICW A;  1A8V A;  3ITP A;  4DK1 A;  5LMU L;  5KNB A;  2ENB A;  4ME5 A;  2CW0 D;  2PI2 E;  1TWC H;  1IHZ A;  2RHS B;  5ELE A;  4CJ1 B;  4ALP A;  1WYD A;  2EVB A;  4P74 A;  1J6Q A;  1EY6 A;  3BZD B;  2BH2 A;  2EY5 A;  3HOW G;  5M5Y B;  1R9T H;  2PNH A;  2K52 A;  2M2L A;  3F2C A;  3QOJ A;  1Q3L A;  3H0G H;  5I9O A;  4DV5 L;  4NXM Q;  2JQO A;  1TWG B;  2AQ3 B;  3TP6 A;  4UHV A;  4FYD A;  2WKC A;  5IYD H;  4KY6 A;  1YNX A;  4BBR B;  3IKJ A;  4DK3 C;  1WCM H;  5JJZ A;  1HNW L;  3OPO A;  3FVQ A;  2EYL A;  1S5D D;  5C0X H;  5G3L F;  3CCS A;  1SRU A;  2ICE C;  1H9M A;  1KAA A;  1VF5 C;  2AQ1 B;  3UDG A;  4A3M G;  1SE4 A;  2NVX H;  3MXU A;  3ER0 A;  1E1T A;  1UNS A;  1QZH A;  1I3Q H;  3KDF B;  1Y8O B;  2VUM H;  4UAI A;  2KHJ A;  2L55 A;  1E22 A;  4KHV A;  4RGM A;  1Q8I A;  1X9N A;  1VQN A;  2IJ0 A;  2HHH L;  2UUB Q;  4LF8 Q;  2EE1 A;  3GTM B;  3DMU A;  3S2D H;  1XTC D;  1Z47 A;  2F0W A;  1X54 A;  3H94 A;  2YTX A;  2Z4I A;  2TSS A;  4MZ9 A;  4JBJ A;  5KYL A;  2OEO A;  4NMZ A;  2OQK A;  3PO3 G;  4TRD A;  1QVF A;  4DV3 Q;  2G9D A;  3A5Z B;  4IFD G;  3CMA A;  2JA7 B;  1SYF A;  3HOU H;  2ES2 A;  5IP9 H;  2AKW B;  2IWH A;  4BXX G;  3BYT B;  3LWU A;  2R92 H;  3FP9 A;  2KCT A;  5IYB H;  3K0Y A;  1F77 A;  4DR5 Q;  1XMO Q;  4AQY L;  4K6D A;  4I65 A;  1WTR A;  4HJA A;  4LW1 A;  3OIQ A;  4IFD I;  1HA5 A;  5IGB A;  1V1P A;  2YV5 A;  1F2Z A;  4JI8 L;  4XQQ A;  4YY3 Q;  2A8V A;  1IW7 C;  4JOI C;  3T1H Q;  3BZK A;  1Z9F A;  2R93 H;  2HUG A;  2A6H D;  5C3X A;  1GUG A;  3HKZ E;  1HR0 L;  3IFD A;  1B3A A;  1EQR A;  3NEL A;  2E2J B;  4X64 Q;  1JOK A;  4L5R C;  1LTB D;  2K05 A;  2EPB A;  3KBX A;  1O7Z A;  4H02 A;  4R9W A;  1H9R A;  4C3H G;  4GOP C;  1CKO A;  1QUQ B;  3J80 L;  4LFB Q;  4JYA L;  1HR0 W;  3M9B A;  2DGY A;  3EIV A;  3EN2 A;  4JBM A;  1EEI D;  2L4N A;  1VMP A;  5DM6 3;  4M1U B;  2FHT A;  2EIF A;  1HQM C;  2LS0 1;  2VQF L;  3TDQ A;  3CC7 A;  1X3P A;  3TEH B;  2UUC Q;  3BU2 A;  4LF9 Q;  3NBH B;  5FJ8 H;  2AMC B;  2NB0 A;  1WTV A;  2F0T A;  2L9H A;  3AEV A;  3J7Z C;  3S17 H;  1EWC A;  4NXN Q;  1CKM A;  2IX0 A;  3HOX B;  1VQ4 A;  1I94 Q;  2LMC B;  1RKN A;  4IJL A;  2Q2T A;  2FIN B;  1GXD C;  4CJ0 B;  4DV4 L;  1A2U A;  4KI0 A;  3D4D A;  2K32 A;  4IUN A;  2KBN A;  4Q0F A;  1NUC A;  2RDG A;  4G7Z C;  1J5E Q;  1VQ6 A;  1IW7 D;  4OEL B;  5JPM C;  3HOZ H;  4WJW A;  2B2V A;  1L0Y B;  1FL0 A;  2ZXP A;  5DM7 3;  4DV0 Q;  4O0A A;  2SOB A;  3CHB D;  3HFZ B;  4RFB A;  1KDA A;  3A54 A;  1E2Z A;  2QF7 A;  1L1O A;  1PH8 A;  1WVL A;  2I5M X;  3CCV A;  2ASB A;  2B8G A;  4FO2 A;  2O5J C;  3HKZ G;  5CC4 A;  4PMC A;  4DR6 L;  3CC2 A;  2N3S A;  2PO4 A;  1B4O A;  5DLQ E;  2YU9 H;  4GNX A;  1OXT A;  2A69 C;  1N8R C;  3CPW A;  3BJU A;  2HQL A;  2VQE L;  1HTL D;  3RD4 A;  2D62 A;  2N8N A;  3GTJ B;  4ME3 A;  3O13 A;  3GTP B;  2QA4 A;  1LTS D;  1GHK A;  1Y1W B;  2J4X A;  2E75 C;  1VCI A;  1YEZ A;  3K7A B;  4RGT A;  4A93 B;  1D5X C;  5E4X A;  3CW2 C;  4A3M H;  4K0K L;  5C4X B;  1BBU A;  2JA8 G;  3NHH A;  4MHE A;  5I4D A;  5FO8 B;  4OX9 Q;  2HQE A;  3I4L A;  1WI5 A;  4MTK A;  4DU9 A;  1TWH B;  2F0O A;  1EY9 A;  4K5V A;  3NTK A;  3Q23 A;  4UPA A;  3ULP A;  4MTN A;  5COY A;  1JJC B;  1E7Z A;  4HTH A;  1H95 A;  4R4C A;  2E5L L;  5ELB A;  4A3G B;  2C35 B; 
#chains in the Genus database with same CATH homology
 1LLR D;  2B2T C;  1I50 B;  2BDN A;  2NVY B;  5BN5 A;  1CI3 M;  1FNU A;  3G7L A;  2JXM B;  2K01 A;  1JCK B;  3ND9 A;  1NSN S;  1GUS A;  3S9W A;  2PYK A;  4Y7N B;  4PQX A;  3AU7 A;  3A8K E;  4RWS C;  3G6J B;  4KKU A;  1R4P B;  2BDO A;  2NTS A;  3BDC A;  2KA7 A;  5CV4 A;  2JA6 B;  2A68 C;  2NVT B;  2D2C C;  3GTL B;  1SMY D;  3VR5 A;  2CVR A;  4I7Z C;  2E2H B;  1V1O A;  3HZX A;  1JR0 D;  4MN3 A;  3L7Z C;  5C4J B;  1F9Q A;  4CGY B;  3FRP B;  5HGT A;  2SEB D;  1LT6 D;  5C5M A;  4KK7 A;  5NUC A;  1T5E A;  3VYS A;  2K5W A;  1QWY A;  3HP3 A;  4BS9 A;  4ZUJ A;  2L0C A;  1TII D;  3I91 A;  3M4O B;  4L63 B;  5AFW A;  2EZV A;  4PMW A;  4HR7 B;  3KLS X;  2F0M A;  4KN7 C;  1G2S A;  3I4N B;  1SNO A;  1SNQ A;  1CQV A;  3SVM A;  2F0N A;  2I46 A;  2RVL A;  1BBX C;  4G57 A;  1SEB D;  2IL8 A;  3S16 B;  3BVM A;  4QUC A;  2F0Q A;  2A5H A;  3A55 A;  2G9H D;  5CGK A;  3TP5 A;  1FYC A;  1FGB D;  1HTP A;  1JOR A;  2XRQ D;  3ND8 A;  2NUC A;  3MWY W;  1CM9 A;  1GUT A;  1AFP A;  4C1N I;  2IX3 A;  2PZU A;  1EEF D;  2QCP X;  4X3K A;  1ML0 D;  4DNR B;  1RF2 D;  1GJX A;  4C3J B;  3I8Z A;  3T13 A;  3HOY B;  5IIF A;  3S15 B;  1HHV A;  4A3D B;  4F87 A;  2XWJ B;  1TWC B;  3C1E A;  3I3C A;  4KKT A;  5G3L D;  4RGO S;  4ZUI A;  1HXY D;  2K03 A;  1R9T B;  1SYE A;  1SNM A;  3H0G B;  4M8A A;  2N88 A;  2FMM A;  1CHP D;  1T5X D;  5C0X J;  4ODG A;  1WCM B;  3AMU A;  4XQJ A;  4LK1 C;  2BE5 C;  4RCO A;  3DUZ A;  2E2D C;  1DD2 A;  3NE5 B;  5EKI A;  1I3Q B;  4XDX A;  2VUM B;  1UAP A;  1ZEQ X;  1LTA D;  5K5P A;  5A2Q L;  1RTO A;  3S2D B;  1Z7T A;  1U4L A;  4DXG A;  3U9S A;  5C4Z A;  3NBH A;  1CK1 A;  1F9S A;  1CFM A;  2B8F A;  4X3S A;  1F2Y A;  4HN7 A;  4DGZ A;  4KJO A;  4RH6 A;  3HOU B;  1E2W A;  1UUP A;  1BO0 A;  3MHB A;  3K6O A;  3DM1 A;  4K2K A;  2RDF A;  3IL8 A;  2R3Z A;  1JB3 A;  1SYG A;  5EPL A;  4H44 C;  3HGB A;  3R2T A;  4DA2 A;  4L8J A;  4KTA A;  4HAE A;  5JPN C;  2F0S A;  1BDO A;  4IQZ A;  1M4V A;  1IYU A;  3I72 A;  2B2Y C;  3BDO A;  3OSO A;  2SDF A;  1ILP A;  1MD2 D;  1PXU A;  1KNA A;  3HRZ C;  2L12 A;  5D14 A;  4X3U A;  2HCC A;  2XWB B;  3C1F A;  3D3R A;  4JBW A;  1VF7 A;  4DF7 A;  2K5Q A;  5LL6 X;  1TS4 A;  2LKV A;  2F3W A;  3NPP A;  3J7A V;  2KQ3 A;  1SSO A;  5F2D A;  2QIL A;  4WFN 3;  3P20 A;  1GUN A;  3HOZ B;  1I4P A;  2BA1 A;  2J0T D;  3FEW X;  2F0P A;  5EJW A;  1JE4 A;  2X6L A;  4HMI A;  3HOW B;  1IKM A;  1AZP A;  4X3T A;  2NN6 G;  5CV5 A;  2YU9 B;  1A6X A;  3TN2 A;  2O5I C;  1ZXT A;  2VB2 X;  3RMH A;  3M7N A;  1J9O A;  4KY7 A;  3NQI A;  3K5N A;  1HFN A;  4QIW B;  2WB1 B;  2PMZ B;  3GD7 A;  1ENC A;  4RKB A;  2NN6 I;  2H4O A;  4C3I G;  3KUP A;  4A3M B;  1SAP A;  1H9K A;  3C3L A;  3T56 B;  4OIJ A;  2DY7 A;  1XYI A;  2K7V A;  5K36 G;  2IW3 A;  3K58 A;  5CMD A;  5J39 A;  1PFM A;  1G6Z A;  1VMC A;  3EVQ A;  3WOE A;  3VYR A;  3PO3 B;  3GTG B;  1GUW A;  3MFG A;  2DNC A;  2Z4H A;  4KD3 A;  2F3V A;  4WRD A;  2EYF A;  2HDL A;  3S1Q B;  5FKA C;  2AUJ D;  1PYW D;  4O42 A;  1D2B A;  1NR2 A;  5DEH A;  1H9S A;  4EQP A;  4ZYS A;  5TSS A;  5IOD A;  2OXP A;  4A3F B;  1ET6 A;  1HCZ A;  3VR6 A;  4DK0 A;  1TR5 A;  1QCB D;  4K8I A;  3X3N A;  2K5D A;  4HED A;  1STY A;  2IPK D;  5KND A;  4C3H B;  1KLU D;  3S1R B;  3C46 A;  2NYZ D;  1BXT A;  3GP7 A;  1CT1 D;  3S1N B;  5J1Z A;  1SE2 A;  3A56 A;  1D6E C;  2KHS A;  3PIO 3;  4A3K B;  1JC7 A;  1TT2 A;  1JWS D;  4FP5 D;  1D5Z C;  3RLF A;  1RJT A;  1B2T A;  5T1I A;  4V0B A;  2BOS A;  2L1B A;  3CQZ B;  1Q90 A;  3EA6 A;  3VA5 A;  2OF1 A;  2EJF C;  1B50 A;  2EYH A;  1BQQ T;  4KV6 A;  3BG3 A;  3NQT A;  2F0G A;  2EY2 A;  4S3S A;  1K8O A;  1D5M C;  3PIP 3;  1TU2 B;  1HPC A;  4CBV A;  1TY2 A;  3K5M A;  3OWF A;  2BCO A;  4HCS A;  4ID6 A;  1NR4 A;  5IT9 E;  3SK5 A;  5FLX L;  3HKZ B;  2F4I A;  3E5S A;  4IUR A;  2F0D A;  2F0I A;  5J22 A;  5M5X B;  5M9O A;  3FPU B;  4A3J B;  2M9V A;  4XT1 B;  3N6R A;  3VA7 A;  1CQF A;  2KED A;  3TP7 A;  3NWT A;  2RA4 A;  3RZO B;  1U4P A;  3DEO A;  3M85 A;  2EDG A;  4HMJ A;  1OXS C;  5ELC A;  1IKL A;  2JA8 B;  4R8I A;  1SNC A;  3QB3 A;  2XNA C;  2AQ2 B;  3W2D A;  5K36 H;  3V05 A;  2Z8L A;  2RSO A;  1BCP C;  4CKE A;  3SXH A;  2EYM A;  3I70 A;  5FLX E;  4IFD H;  1ONL A;  2HCI A;  2K33 A;  4KN4 C;  5FK9 C;  2FMC A;  1FNW A;  3TME A;  1EY0 A;  3JAM E;  1E0B A;  4N9P A;  1KLG D;  1XWE A;  3S1M B;  1PTO C;  1GHJ A;  1WTP A;  5JOB A;  2A69 D;  2B39 A;  1LT5 D;  2B2V C;  1BUV T;  1YNJ C;  3BVG A;  3SR1 A;  3TBI B;  1PRT C;  2AWO A;  2F03 A;  1QG7 A;  4B9W A;  3QIA A;  2YYZ A;  2L5T A;  2F1M A;  2K6A A;  1KTK A;  1FNV A;  1XXG A;  4DNT B;  3L9A X;  5ELD A;  2XVS A;  1RHP A;  1NAP A;  2PQE A;  1MGS A;  4BY1 B;  1F2M A;  2D5D A;  3S14 B;  3EFX D;  2H1E A;  5I9P A;  4DAP A;  1STA A;  1CHQ D;  1DCZ A;  1IL8 A;  1K8M A;  2MHV A;  1TWF B;  3DWA A;  4NKL A;  3P75 A;  3MZ5 A;  2NVQ B;  5FOB B;  1Y69 U;  4XIG S;  4TQU S;  1TY0 A;  4ZKB B;  4DAV A;  3GV6 A;  4ZQ3 A;  4BWG B;  5EBD A;  1Z6H A;  2J7Z A;  3MXN A;  3F2U A;  2B2U A;  1CZW A;  2NTT A;  1YNJ D;  4OO1 G;  2KUM A;  3QOL A;  3OIP A;  1S5F D;  2F0K A;  1STN A;  1U4M A;  2KCC A;  2C9O A;  1LTG D;  5C6A A;  4ZKC B;  5IGC A;  1XX8 A;  1B53 A;  2A68 D;  4FXG C;  2CHB D;  4OO1 I;  1UEA B;  2A6E C;  1EZ6 A;  1TS5 A;  2F0U A;  1YNN C;  3FMC A;  2QDB A;  4RKL A;  4IUQ A;  3D6C A;  2KEE A;  2NWG A;  3EJI A;  1MBY A;  3KLR A;  4QMG A;  1JWU D;  1DOL A;  3D6W A;  1E2V A;  4IAL A;  1LTT D;  5CYU A;  4XYO A;  2F0H A;  1EZ8 A;  3FPP A;  2K1B A;  2RSN A;  4K5X A;  1MSG A;  3J81 E;  4XTC S;  3D4R A;  3PUX A;  2VNU D;  2R61 A;  2BA0 A;  5LL6 S;  5C3E B;  2LY7 A;  3GO5 A;  2VXW A;  2O4X A;  3T53 B;  4NP5 A;  1SYD A;  3Q22 A;  1I6H B;  1R4Q B;  4NDX A;  3DWQ A;  4C3J G;  3CRK C;  2AWN A;  4DAY A;  1HFG A;  4LMQ D;  5E3F A;  1EY5 A;  3BDL A;  3H09 A;  1PZJ D;  3PUW A;  4XQN A;  5COR A;  1S5E D;  3WDN A;  1ILQ A;  3FDT A;  4DN4 M;  1WTX A;  3H3V C;  1LAC A;  1LAB A;  2I07 B;  5DNF A;  1CTM A;  1SDF A;  1BR9 A;  2OT2 A;  1BOS A;  3D4W A;  3P1H A;  4J1M A;  1WD1 A;  5CV8 A;  4DXF A;  3PV0 A;  2XSC A;  4EVO A;  2WII B;  5IGF A;  1MSH A;  3MTS A;  3Q0A A;  4GZY C;  1DJR D;  5C0X G;  2F0V A;  3VR4 A;  4ZAI A;  1SYC A;  2XN9 C;  2JE6 I;  2AUK A;  4EQN A;  3NP8 A;  1F2L A;  3SDZ A;  1ZYR C;  3N52 A;  1I4X A;  2D9U A;  5C0X I;  4Q5V A;  2EYP A;  3SK4 A;  4ILW A;  4BA1 I;  1PDQ A;  2PZW A;  1IYV A;  3SHL A;  5C3W A;  5D65 A;  2RDH A;  3NBI A;  4ABN A;  5I2Y A;  4FXD A;  3DHQ A;  1KDC A;  3MVV A;  4G7O C;  4C56 C;  1LTR D;  1KAB A;  2ID0 A;  4NW2 A;  5M5W B;  4PNY A;  3QO2 A;  1S4Z A;  4QF4 A;  2JYO A;  1G29 1;  1K83 B;  1PTO F;  2BE5 D;  2Q8I B;  2DN8 A;  4K6L A;  3VYU A;  5DAU A;  4PV1 C;  2E74 C;  3IFT A;  2ICI A;  5T1G A;  4B08 A;  4IUT A;  1PRT F;  4FF1 A;  2CW0 C;  1STH A;  4F8M A;  1EL0 A;  5JEA G;  3PUZ A;  1AEX A;  3NUC A;  1H9J A;  3RZD B;  3D8G A;  4HSP A;  5KIX A;  3MAQ A;  4EGV A;  1SJE D;  2XIW A;  4RCN A;  2FFK B;  4A3I B;  3HOV B;  3GQB A;  4K14 A;  4L6T B;  2M00 A;  1Q1B A;  2JEB I;  4DFA A;  5HUR A;  3PO2 B;  3OMC A;  3CKI B;  4A3B B;  1QNU A;  2B63 B;  1DYQ A;  1Y1V B;  1TWA B;  1STE A;  4CHT B;  2PNR C;  3S2H B;  1EIG A;  1HUN A;  2A74 C;  4Z9C B;  1QNK A;  1PTO H;  4FF3 A;  1LO5 D;  2KCN A;  2JA5 B;  1U9R A;  4MIU A;  5KNC A;  2ZXO A;  2SNS A;  2EOT A;  4XT3 B;  1EQT A;  4KMU C;  4ZRZ A;  4V19 0;  3T51 B;  3OHX C;  1TQO A;  4C1N K;  3A7A B;  3R2I A;  5CBE E;  5CR3 A;  2DNE A;  2TMP A;  2RQX A;  3HG9 A;  1AN8 A;  4EQO A;  2O2L D;  1WTO A;  1JIC A;  2F0J A;  3V96 A;  2JP1 A;  3NSW A;  3GTK B;  3M4Y A;  4C3I B;  2A6H C;  4WOR A;  1A3V A;  1ENA A;  3GV3 A;  1GOZ A;  4JK1 C;  3IAY A;  3EQL C;  3HS0 C;  1G91 A;  3NXW A;  3BVZ A;  3VR2 A;  5BN4 A;  3L3O C;  3DWP A;  3PUV A;  4IFD J;  2IX1 A;  3MXP A;  1QIL A;  1SE3 A;  2WP8 J;  3PUY A;  4RAU C;  5CV9 A;  4LAA A;  2NBF A;  4F7X A;  5EGT A;  1CZG A;  4FNF A;  3E6Z X;  3TZD A;  2MJ8 A;  4XXE A;  1AW7 A;  1EU3 A;  3MC0 B;  4R8N A;  2QEJ C;  4KD4 A;  1PZK D;  3E0J A;  5IOC A;  1SJH D;  2DY8 A;  2PPB C;  5JEA H;  1LV9 A;  4E6I A;  1EYD A;  5IT9 L;  2ZT9 C;  1II3 A;  4KJN A;  4C2M B;  5CV7 A;  2JSO A;  3K5O A;  1U4R A;  2F0F A;  3BS1 A;  1G2T A;  2E76 C;  1EQV A;  3FKI B;  1RTN A;  3TZU A;  1EFI D;  2B2T A;  4TSS A;  1B9M A;  1I4Q A;  4H7B A;  1EU4 A;  4OL7 A;  2CQA A;  4LJZ C;  1JQY D;  4H13 C;  2EYJ A;  5KEE A;  5I6Y A;  1DZ1 A;  2MUY A;  1PZI D;  1Q1E A;  1JWM D;  1A3T A;  5I2X A;  5IGG A;  3R3O A;  1HQR D;  1F9P A;  1QOH A;  2XRS D;  1HRJ A;  3R93 A;  2PW5 A;  2NN6 H;  3J80 E;  3QWN A;  3JAM L;  3ERO A;  1C48 A;  4G4K A;  1PMR A;  1V43 A;  1X3Q A;  4RA8 A;  3MXG A;  2V4D A;  2WAQ B;  4K2L A;  1TKW B;  4AYB B;  1DOK A;  4CJ2 C;  1JOQ A;  1EOT A;  4FF2 A;  1HUM A;  2NZ1 D;  5IGE A;  1Y8P B;  1OO9 B;  2HDM A;  3T16 A;  4BBS B;  4O1N A;  2ZXR A;  5E4W C;  3SK6 A;  4IUP A;  1Q12 A;  1SNP A;  5EPK A;  1OXU A;  3QJY A;  1B1Z A;  4IUV A;  1CA5 A;  3HEJ A;  4J8Q A;  1EYC A;  2MGS A;  4IZ8 A;  2EYO A;  1SMY C;  4UDU C;  1EIH A;  1S5C D;  1ESF A;  1DM0 B;  5FO9 B;  3UI2 A;  3D31 A;  4CKB A;  1C8C A;  1DOM A;  5D3I B;  3M3Y B;  3P7J A;  3KF8 A;  3MA2 B;  1CA6 A;  3K59 A;  2X6G A;  4RHR A;  3RUZ A;  5ISR A;  3DEP A;  1OXV A;  2FJ2 A;  1PFB A;  2EY1 A;  4RHS A;  2PZT A;  4G7H C;  1DON A;  2VB3 X;  1EYA A;  1O7L A;  2X69 A;  4ZK9 B;  3LX0 A;  1A3U A;  4KHZ A;  3VYT A;  2WAC A;  1WTW A;  3NK9 A;  1G8Z D;  1BCP D;  1BNZ A;  3SK8 A;  1X32 A;  5IGD A;  1EY7 A;  1TS3 A;  3J7A F;  1S5B D;  2SNM A;  3DXJ C;  4OHJ A;  5A35 A;  4B9X A;  4KKS A;  4XYQ A;  2E2I B;  1VDZ A;  5KYI A;  1PTO D;  3OMG A;  3K57 A;  4U68 A;  1STG A;  1A2T A;  2MPM A;  4IN3 A;  2A73 B;  2EJG C;  3MEH A;  1W6J A;  3ERQ A;  1HA6 A;  2B2W A;  3ZYY X;  1PRT D;  3J81 L;  2PW7 A;  1ET9 A;  5LHY 1;  1A15 A;  1BF4 A;  3I90 A;  1O7Y A;  4FVM A;  3SE0 A;  1H9S B;  4N9T A;  1V1P B;  5EKK A;  1SFO B;  1TVX A;  2WV6 D;  1SND A;  3A8J E;  3OWE B;  3NTI A;  1JOO A;  1W6K A;  1I4H A;  3T4A C;  1RD9 D;  1DXM A;  3OOC A;  1ESR A;  1NCV A;  3GTQ B;  1ENF A;  1GUO A;  5KRU A;  1I6V C;  3VR3 A;  1QJO A;  2Z1C A;  1WD0 A;  3C2P A;  1WTQ A;  4QB4 A;  2GA4 B;  2LFN A;  2EXZ A;  5C4H A;  1Y8N B;  3ONA B;  3I73 A;  1BCP B;  2KEC A;  5EBC A;  1SYB A;  5JVG 3;  5FO7 B;  3CU7 A;  2B2U C;  5E1F A;  5JVH 3;  1F9R A;  4QUF A;  2R6G A;  3A8I E;  2A6E D;  1FR3 A;  2EJM A;  1PTO B;  5EKL A;  1YNN D;  2B2W C;  1RCV D;  3PMF A;  4U67 3;  1EY8 A;  2WIN B;  1LT3 D;  1D1K A;  5D3D A;  1KDB A;  2KVM A;  3H6M A;  1OXX K;  2KJX A;  1STB A;  2Y0S B;  1PRT B;  3TP8 A;  3R8B A;  4BY7 B;  4CKC A;  4TKO B;  3MFY A;  4HSV A;  4HCE A;  3KLS A;  3OW7 A;  1MI2 A;  3X3M A;  2WKD A;  2IT1 A;  3GTO B;  2B2Y A;  2N55 A;  5M3M B;  1SBB B;  1FD7 D;  3CRL C;  1AZQ A;  5JAV A;  4BA2 I;  4K8J A;  4KY5 A;  3KK7 A;  1J8I A;  3LWE A;  4RGN A;  2R7Z B;  2NVX B;  3H91 A;  3K5L A;  1PFN A;  1QE6 A;  5CV6 A;  1LT4 D;  4P2C B;  2Q8R E;  1BCP F;  2RKS A;  4OO1 H;  3M7G A;  2MP1 A;  4OIK A;  1AP0 A;  2JEA I;  4PMB A;  2C5C A;  3J7Y W;  5EPJ A;  3KBG A;  4ZLT F;  1SXT A;  2QKI C;  2R92 B;  1I4G A;  1O78 A;  2EY6 A;  5M3F B;  4J6H A;  3U9O A;  5C5L A;  1M8A A;  3Q24 A;  1KNE A;  4ULL A;  5ELF A;  1ROD A;  1I4R A;  1B44 D;  1B9N A;  5EQ0 A;  1O80 A;  4A3E B;  1QB5 D;  3NTH A;  2R93 B;  3AB9 A;  2L11 A;  5JEA J;  1C4Q A;  4H0L C;  1ZKO A;  1V8Q A;  2Q8T A;  1L0X B;  5A2Q E;  3BYY B;  1ZYR D;  3V2T A;  5C44 B;  5CBA E;  5KGU A;  2KOL A;  3W3A A;  1RDP D;  3WOF A;  4FXK C;  4QCL A;  1TS2 A;  3LNN A;  5I6W A;  5BN3 A;  4OGQ C;  4IUU A;  2PCF B;  1LTI D;  2K28 A;  3NWS A;  3QG1 A;  1D1I A;  3I4M B;  4F88 A;  4FF4 A;  1EY4 A;  1PLF A;  3S17 B;  2F0E A;  3SEB A;  1EWH A;  4K5W A;  3TSS A;  3Q6S A;  2F0L A;  4YIJ A;  3A7L A;  2RBM A;  3URY A;  2K04 A;  1ICW A;  3ITP A;  4DK1 A;  5KNB A;  2ENB A;  4ME5 A;  2CW0 D;  5ELE A;  1IHZ A;  4CJ1 B;  2EVB A;  1EY6 A;  3BZD B;  2EY5 A;  5M5Y B;  2M2L A;  3QOJ A;  1Q3L A;  5I9O A;  1TWG B;  2AQ3 B;  3TP6 A;  4FYD A;  2WKC A;  4KY6 A;  4BBR B;  3IKJ A;  5JJZ A;  3OPO A;  3FVQ A;  2EYL A;  1S5D D;  5C0X H;  5G3L F;  2ICE C;  1H9M A;  1KAA A;  1VF5 C;  2AQ1 B;  1SE4 A;  3MXU A;  1UNS A;  1Y8O B;  4UAI A;  2L55 A;  4KHV A;  4RGM A;  1Q8I A;  2IJ0 A;  2EE1 A;  3GTM B;  3DMU A;  1XTC D;  1Z47 A;  2F0W A;  3H94 A;  2Z4I A;  2TSS A;  5KYL A;  2OEO A;  4NMZ A;  4TRD A;  2G9D A;  4IFD G;  2JA7 B;  1SYF A;  2IWH A;  3BYT B;  3LWU A;  3K0Y A;  1F77 A;  4K6D A;  4I65 A;  1WTR A;  3OIQ A;  4IFD I;  1HA5 A;  5IGB A;  1V1P A;  1F2Z A;  4XQQ A;  1IW7 C;  2HUG A;  2A6H D;  5C3X A;  1GUG A;  3IFD A;  1B3A A;  2E2J B;  1JOK A;  1LTB D;  2K05 A;  2EPB A;  3KBX A;  1O7Z A;  4R9W A;  1H9R A;  4C3H G;  3J80 L;  1EEI D;  2L4N A;  1VMP A;  5DM6 3;  4M1U B;  2FHT A;  1HQM C;  2LS0 1;  3TDQ A;  1X3P A;  2NB0 A;  1WTV A;  2F0T A;  2L9H A;  1EWC A;  2IX0 A;  3HOX B;  2LMC B;  1RKN A;  2FIN B;  1GXD C;  4CJ0 B;  1A2U A;  4KI0 A;  3D4D A;  2K32 A;  4IUN A;  4Q0F A;  1NUC A;  2RDG A;  4G7Z C;  1IW7 D;  5JPM C;  4WJW A;  2B2V A;  1L0Y B;  2ZXP A;  5DM7 3;  2SOB A;  3CHB D;  4RFB A;  1KDA A;  3A54 A;  1E2Z A;  2QF7 A;  1WVL A;  2B8G A;  4FO2 A;  2O5J C;  5CC4 A;  4PMC A;  2PO4 A;  1B4O A;  1OXT A;  2A69 C;  1HTL D;  3RD4 A;  2D62 A;  3GTJ B;  3O13 A;  3GTP B;  1LTS D;  1GHK A;  1Y1W B;  2J4X A;  2E75 C;  1VCI A;  3K7A B;  4RGT A;  4A93 B;  1D5X C;  5E4X A;  5C4X B;  3NHH A;  4MHE A;  5I4D A;  5FO8 B;  2HQE A;  3I4L A;  4DU9 A;  1TWH B;  2F0O A;  1EY9 A;  4K5V A;  3NTK A;  3Q23 A;  5COY A;  4HTH A;  5ELB A;  4A3G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...