1G3NC

Structure of a p18(ink4c)-cdk6-k-cyclin ternary complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
238
structure length
233
Chain Sequence
b'LCEDRIFYNILEIEPRFLTSDSVFGTFQQSLTSHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRSLTPISTSSLCYAAADSFSRQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLVGGSQHLDFWHHEVNTLITKALVDPLTGSLPASIISAAGCALLVPANVIPQGVVPQLASILGCDVSVLQAAVEQILTSVSDFDLRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE 6
publication title Structural basis of inhibition of CDK-cyclin complexes by INK4 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle, signaling protein
total genus 86
structure length 233
sequence length 238
chains with identical sequence G
ec nomenclature
pdb deposition date 2000-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00134 Cyclin_N Cyclin, N-terminal domain
C PF09080 K-cyclin_vir_C K cyclin, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1g3nC01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1g3nC02
3TNWB 1H25B 4II5B 1H27B 2CCIB 4BCND 2EUFA 4BCMD 4FX3B 4BCJB 1D3UB 4OR5B 4BCFB 3MY5B 4EOOB 2UUEB 1H4LD 2X1NB 1N4MA 2UZLB 1GH6B 2PMIB 4YOZA 4BCQB 4CFMB 2PK2A 1G3NC 4BCNB 1VINA 1OL2B 1UNGD 3TNIB 4EOJB 5IF1B 1FVVB 3EIDB 5LMKB 2PHGA 3K7AM 4EOSB 3MY1B 2W9FA 4EOKB 4EC8B 3BHUB 1GY3B 1H1QB 1OIYB 4F6SB 4CXAB 2UZDB 4F7JB 1GUXB 2C5VB 2IW6B 2C5NB 5HBHB 2W2HA 1FINB 2CCHB 2C6TB 4F6UB 2BPMB 3RGFB 2W96A 3BLHB 1JSTB 2UZEB 3BLRB 4KRCB 5BNJB 2C5XB 1W98B 2WHBB 1URCB 3QHWB 2W9ZA 5HNBB 4RODA 4NSTB 2IW9B 4CRLB 1AISB 5HQ0B 2WIPB 1F5QB 1O9KB 2WMAB 4EOIB 5L2WB 5LQFB 1E9HB 1GUXA 2F2CA 2W99A 2WXVB 4YC3B 2JGZB 5CEIB 3M03A 3EOCB 5HVYB 1XO2A 4CFVB 3MIAB 4YOOA 1H1PB 4CFUB 3LQ5B 5I5ZB 1UNLD 1TFBA 3BHVB 4CFWB 4EOLB 4F7SB 2WPAB 1H1RB 3BLQB 3DOGB 3DDQB 3BHTB 2I53A 1OKWB 3EJ1B 2BKZB 3H4CA 4BCHB 4EONB 4EOPB 1JKWA 1H28B 1ZP2A 1OI9B 1O9KA 4YOSA 2PK9B 1H1SB 4KRDB 3QHRB 1JOWA 1H26B 1OIUB 1JSUB 4CFUD 2WFYB 4BCOB 4F6WB 4EORB 4EOMB 3TN8B 4BCKB 2WIHB 1OGUB 1OKVB 2G9XB 4ELJA 5CYIB 4ROCA 2B9RA 1OL1B 2R7GA 4UN0A 1P5EB 2C4GB 4OGRB 4F70B 4IMYB 3TNHB 4ROEA 5HBEB 3POMA 1C9BA 4TTHA 2CJMB 5HBJB 4ELLA 5IDPB 1UNHD 4Y72B 1AD6A 4CFXB 2IVXA 5EFQB 5FGKB 5IDNB 5ACBA 3F5XB 2C5OB 3MI9B 4F7NB 2IW8B 1QMZB 2WMBB 1KXUA 2I40B 4G6LB 2WEVB 4CFNB 1VOLA 4EOQB 4I3ZB 4BCPB 1H24B 4BCMB 2QDJA 4F7LB 4BCGB 3G33B 4BCIB 1VYWB 3DDPB 4EC9B 2V22B 2UZBB 1BU2A 3O0GD 1PKDB 5ICPB 4BCQD
chains in the Genus database with same CATH superfamily
3TNWB 3X25B 1UGQB 2CYZB 4BCMD 2QDYB 3MY5B 3WVDB 1H4LD 4BCQB 1G3NC 3QZ9B 1VINA 4OB1B 1FVVB 3EIDB 2G77A 3MY1B 1OIYB 2C5NB 5HBHB 4FM4B 2W2HA 3RGFB 2W96A 3BLHB 1JSTB 2UZEB 1W98B 5HNBB 2IW9B 3B57A 1F5QB 1O9KB 5LQFB 5L2WB 1E9HB 2F2CA 2DXBB 4CFVB 4YOOA 3LQ5B 3BHVB 4F7SB 2BS3A 2WPAB 3BLQB 1OKWB 2LW4A 1H28B 1O9KA 2DXCB 4YOSA 3VYHB 4KRDB 3QHRB 1JSUB 4BY1X 4EOMB 3TN8B 2B9RA 2R7GA 3WVEB 3HB9A 4CFXB 2IVXA 5EFQB 5FGKB 2DD5B 2C5OB 1QMZB 4CFNB 4I3ZB 3X26B 4BBSM 3TW7A 4BCIB 1UGRB 3VKHA 4BCQD 1H25B 4II5B 1H27B 3DJBA 3BG9A 4OR5B 4BCFB 2UUEB 2ZPFB 1V29B 4ZGDB 2X1NB 1N4MA 1GH6B 4YOZA 2AHJB 1IREB 4BCNB 1OL2B 3TNIB 4AKGA 2DPPB 4JX6A 1GY3B 1H1QB 2DD4B 3NDQA 2ZPGB 2C6TB 2QQ8A 4ZGJB 5HQ0B 2WMAB 3A8LB 4EOIB 2W99A 3M03A 4ZGEB 3EOCB 3MIAB 1H1PB 5I5ZB 4CFWB 1H1RB 4EONB 3DOGB 3DDQB 3BHTB 4BCHB 2BKZB 1JKWA 2ZPBB 3DTOA 1H26B 1OIUB 4CFUD 2WFYB 4LOCA 4EORB 1OGUB 1OKVB 4ELJA 5CYIB 4ROCA 4UN0A 1P5EB 4HNUA 4ROEA 5HBEB 3POMA 4ELLA 1TD6A 3QWLA 2WJ9A 2ZPEB 3A8HB 5IDNB 2CZ0B 4F7NB 1KXUA 3QYBA 4G6LB 2WEVB 1FKMA 4EOQB 4BCMB 4OB3B 4F7LB 2QF7A 3X20B 2ZCFB 5DQWA 2V22B 2UZBB 4OB0B 1AD6A 2PJQA 2CCIB 4BCND 4BCJB 4Z6YA 4AI6A 3GTMS 5IHYA 2PMIB 4CFMB 2PK2A 4MFEA 5LMKB 2PHGA 4EOSB 2W9FA 4EOKB 2CZ7B 3BG3A 4F7JB 1GUXB 2IW6B 1FINB 4F6UB 2BPMB 3BLRB 4KRCB 2C5XB 2WHBB 1URCB 3QHWB 2W9ZA 4NSTB 3VYGB 4CRLB 3QZ5B 1GUXA 4YC3B 2WXVB 3QYHB 2JGZB 5CEIB 5HVYB 3HZJA 1XO2A 3A8MB 4HNVA 1UNLD 4EOLB 3DL1A 3EJ1B 1OI9B 2PK9B 1H1SB 4BCOB 4F6WB 4BBRM 2WIHB 3VKGA 1OL1B 1UGPB 4NC6A 2C4GB 2QGSA 4F70B 2KMGA 1C9BA 4TTHA 2CJMB 5IDPB 4BXXX 4Y72B 3TW6A 4OB2B 3MI9B 2IW8B 2WMBB 4QSHA 1UGSB 2I40B 4HNTA 4BCPB 1H24B 1E7PA 2QDJA 1AHJB 4BCGB 3G33B 3PO3S 2IN3A 3DDPB 2CZ1B 1BU2A 3O0GD 2ZPHB 4MIMA 2EUFA 4FX3B 1D3UB 4EOOB 1QLBA 2UZLB 3QYEA 1UNGD 4EOJB 5IF1B 3HO8A 3K7AM 3A8OB 4EC8B 3BHUB 4F6SB 4CXAB 2UZDB 2CZ6B 4MFDA 2C5VB 2QFZA 2CCHB 3A8GB 3HBLA 5BNJB 2D0QB 2BS4A 3X28B 4RODA 1AISB 2WIPB 4AKIA 2ZZDB 4CFUB 1TFBA 3HHTB 3H4CA 2I53A 2KR6A 4EOPB 3KHIA 3QYGB 4HLQA 4BY7X 1ZP2A 4HL4A 4AKHA 4M6VA 1JOWA 4BCKB 2G9XB 2DMEA 2BS2A 3BG5A 4OGRB 5EJCA 4IMYB 3TNHB 5HBJB 1ENWA 1UNHD 5ACBA 3F5XB 3X24B 1VOLA 4JX4A 5DQVA 3QXEB 2ZPIB 1VYWB 4EC9B 4JX5A 1PKDB 5ICPB
chains in the Genus database with same CATH topology
3TNWB 1H25B 4II5B 1H27B 2CCIB 4BCND 2EUFA 4BCMD 4FX3B 4BCJB 1D3UB 4OR5B 4BCFB 3MY5B 4EOOB 2UUEB 1H4LD 2X1NB 1N4MA 2UZLB 1GH6B 2PMIB 4YOZA 4BCQB 4CFMB 2PK2A 1G3NC 4BCNB 1VINA 1OL2B 1UNGD 3TNIB 4EOJB 5IF1B 1FVVB 3EIDB 5LMKB 2PHGA 3K7AM 4EOSB 3MY1B 2W9FA 4EOKB 4EC8B 3BHUB 1GY3B 1H1QB 1OIYB 4F6SB 4CXAB 2UZDB 4F7JB 1GUXB 2C5VB 2IW6B 2C5NB 5HBHB 2W2HA 1FINB 2CCHB 2C6TB 4F6UB 2BPMB 3RGFB 2W96A 3BLHB 1JSTB 2UZEB 3BLRB 4KRCB 5BNJB 2C5XB 1W98B 2WHBB 1URCB 3QHWB 2W9ZA 5HNBB 4RODA 4NSTB 2IW9B 4CRLB 1AISB 5HQ0B 2WIPB 1F5QB 1O9KB 2WMAB 4EOIB 5L2WB 5LQFB 1E9HB 1GUXA 2F2CA 2W99A 2WXVB 4YC3B 2JGZB 5CEIB 3M03A 3EOCB 5HVYB 1XO2A 4CFVB 3MIAB 4YOOA 1H1PB 4CFUB 3LQ5B 5I5ZB 1UNLD 1TFBA 3BHVB 4CFWB 4EOLB 4F7SB 2WPAB 1H1RB 3BLQB 3DOGB 3DDQB 3BHTB 2I53A 1OKWB 3EJ1B 2BKZB 3H4CA 4BCHB 4EONB 4EOPB 1JKWA 1H28B 1ZP2A 1OI9B 1O9KA 4YOSA 2PK9B 1H1SB 4KRDB 3QHRB 1JOWA 1H26B 1OIUB 1JSUB 4CFUD 2WFYB 4BCOB 4F6WB 4EORB 4EOMB 3TN8B 4BCKB 2WIHB 1OGUB 1OKVB 2G9XB 4ELJA 5CYIB 4ROCA 2B9RA 1OL1B 2R7GA 4UN0A 1P5EB 2C4GB 4OGRB 4F70B 4IMYB 3TNHB 4ROEA 5HBEB 3POMA 1C9BA 4TTHA 2CJMB 5HBJB 4ELLA 5IDPB 1UNHD 4Y72B 1AD6A 4CFXB 2IVXA 5EFQB 5FGKB 5IDNB 5ACBA 3F5XB 2C5OB 3MI9B 4F7NB 2IW8B 1QMZB 2WMBB 1KXUA 2I40B 4G6LB 2WEVB 4CFNB 1VOLA 4EOQB 4I3ZB 4BCPB 1H24B 4BCMB 2QDJA 4F7LB 4BCGB 3G33B 4BCIB 1VYWB 3DDPB 4EC9B 2V22B 2UZBB 1BU2A 3O0GD 1PKDB 5ICPB 4BCQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TNW B;  1H25 B;  4II5 B;  1H27 B;  2CCI B;  4BCN D;  2EUF A;  4BCM D;  4FX3 B;  4BCJ B;  1D3U B;  4OR5 B;  4BCF B;  3MY5 B;  4EOO B;  2UUE B;  1H4L D;  2X1N B;  1N4M A;  2UZL B;  1GH6 B;  2PMI B;  4YOZ A;  4BCQ B;  4CFM B;  2PK2 A;  1G3N C;  4BCN B;  1VIN A;  1OL2 B;  1UNG D;  3TNI B;  4EOJ B;  5IF1 B;  1FVV B;  3EID B;  5LMK B;  2PHG A;  3K7A M;  4EOS B;  3MY1 B;  2W9F A;  4EOK B;  4EC8 B;  3BHU B;  1GY3 B;  1H1Q B;  1OIY B;  4F6S B;  4CXA B;  2UZD B;  4F7J B;  1GUX B;  2C5V B;  2IW6 B;  2C5N B;  5HBH B;  2W2H A;  1FIN B;  2CCH B;  2C6T B;  4F6U B;  2BPM B;  3RGF B;  2W96 A;  3BLH B;  1JST B;  2UZE B;  3BLR B;  4KRC B;  5BNJ B;  2C5X B;  1W98 B;  2WHB B;  1URC B;  3QHW B;  2W9Z A;  5HNB B;  4ROD A;  4NST B;  2IW9 B;  4CRL B;  1AIS B;  5HQ0 B;  2WIP B;  1F5Q B;  1O9K B;  2WMA B;  4EOI B;  5L2W B;  5LQF B;  1E9H B;  1GUX A;  2F2C A;  2W99 A;  2WXV B;  4YC3 B;  2JGZ B;  5CEI B;  3M03 A;  3EOC B;  5HVY B;  1XO2 A;  4CFV B;  3MIA B;  4YOO A;  1H1P B;  4CFU B;  3LQ5 B;  5I5Z B;  1UNL D;  1TFB A;  3BHV B;  4CFW B;  4EOL B;  4F7S B;  2WPA B;  1H1R B;  3BLQ B;  3DOG B;  3DDQ B;  3BHT B;  2I53 A;  1OKW B;  3EJ1 B;  2BKZ B;  3H4C A;  4BCH B;  4EON B;  4EOP B;  1JKW A;  1H28 B;  1ZP2 A;  1OI9 B;  1O9K A;  4YOS A;  2PK9 B;  1H1S B;  4KRD B;  3QHR B;  1JOW A;  1H26 B;  1OIU B;  1JSU B;  4CFU D;  2WFY B;  4BCO B;  4F6W B;  4EOR B;  4EOM B;  3TN8 B;  4BCK B;  2WIH B;  1OGU B;  1OKV B;  2G9X B;  4ELJ A;  5CYI B;  4ROC A;  2B9R A;  1OL1 B;  2R7G A;  4UN0 A;  1P5E B;  2C4G B;  4OGR B;  4F70 B;  4IMY B;  3TNH B;  4ROE A;  5HBE B;  3POM A;  1C9B A;  4TTH A;  2CJM B;  5HBJ B;  4ELL A;  5IDP B;  1UNH D;  4Y72 B;  1AD6 A;  4CFX B;  2IVX A;  5EFQ B;  5FGK B;  5IDN B;  5ACB A;  3F5X B;  2C5O B;  3MI9 B;  4F7N B;  2IW8 B;  1QMZ B;  2WMB B;  1KXU A;  2I40 B;  4G6L B;  2WEV B;  4CFN B;  1VOL A;  4EOQ B;  4I3Z B;  4BCP B;  1H24 B;  4BCM B;  2QDJ A;  4F7L B;  4BCG B;  3G33 B;  4BCI B;  1VYW B;  3DDP B;  4EC9 B;  2V22 B;  2UZB B;  1BU2 A;  3O0G D;  1PKD B;  5ICP B;  4BCQ D; 
#chains in the Genus database with same CATH topology
 3TNW B;  3X25 B;  1UGQ B;  2CYZ B;  4BCM D;  2QDY B;  3MY5 B;  3WVD B;  1H4L D;  4BCQ B;  1G3N C;  3QZ9 B;  1VIN A;  4OB1 B;  1FVV B;  3EID B;  2G77 A;  3MY1 B;  1OIY B;  2C5N B;  5HBH B;  4FM4 B;  2W2H A;  3RGF B;  2W96 A;  3BLH B;  1JST B;  2UZE B;  1W98 B;  5HNB B;  2IW9 B;  3B57 A;  1F5Q B;  1O9K B;  5LQF B;  5L2W B;  1E9H B;  2F2C A;  2DXB B;  4CFV B;  4YOO A;  3LQ5 B;  3BHV B;  4F7S B;  2BS3 A;  2WPA B;  3BLQ B;  1OKW B;  2LW4 A;  1H28 B;  1O9K A;  2DXC B;  4YOS A;  3VYH B;  4KRD B;  3QHR B;  1JSU B;  4BY1 X;  4EOM B;  3TN8 B;  2B9R A;  2R7G A;  3WVE B;  3HB9 A;  4CFX B;  2IVX A;  5EFQ B;  5FGK B;  2DD5 B;  2C5O B;  1QMZ B;  4CFN B;  4I3Z B;  3X26 B;  4BBS M;  3TW7 A;  4BCI B;  1UGR B;  3VKH A;  4BCQ D;  1H25 B;  4II5 B;  1H27 B;  3DJB A;  3BG9 A;  4OR5 B;  4BCF B;  2UUE B;  2ZPF B;  1V29 B;  4ZGD B;  2X1N B;  1N4M A;  1GH6 B;  4YOZ A;  2AHJ B;  1IRE B;  4BCN B;  1OL2 B;  3TNI B;  4AKG A;  2DPP B;  4JX6 A;  1GY3 B;  1H1Q B;  2DD4 B;  3NDQ A;  2ZPG B;  2C6T B;  2QQ8 A;  4ZGJ B;  5HQ0 B;  2WMA B;  3A8L B;  4EOI B;  2W99 A;  3M03 A;  4ZGE B;  3EOC B;  3MIA B;  1H1P B;  5I5Z B;  4CFW B;  1H1R B;  4EON B;  3DOG B;  3DDQ B;  3BHT B;  4BCH B;  2BKZ B;  1JKW A;  2ZPB B;  3DTO A;  1H26 B;  1OIU B;  4CFU D;  2WFY B;  4LOC A;  4EOR B;  1OGU B;  1OKV B;  4ELJ A;  5CYI B;  4ROC A;  4UN0 A;  1P5E B;  4HNU A;  4ROE A;  5HBE B;  3POM A;  4ELL A;  1TD6 A;  3QWL A;  2WJ9 A;  2ZPE B;  3A8H B;  5IDN B;  2CZ0 B;  4F7N B;  1KXU A;  3QYB A;  4G6L B;  2WEV B;  1FKM A;  4EOQ B;  4BCM B;  4OB3 B;  4F7L B;  2QF7 A;  3X20 B;  2ZCF B;  5DQW A;  2V22 B;  2UZB B;  4OB0 B;  1AD6 A;  2PJQ A;  2CCI B;  4BCN D;  4BCJ B;  4Z6Y A;  4AI6 A;  3GTM S;  5IHY A;  2PMI B;  4CFM B;  2PK2 A;  4MFE A;  5LMK B;  2PHG A;  4EOS B;  2W9F A;  4EOK B;  2CZ7 B;  3BG3 A;  4F7J B;  1GUX B;  2IW6 B;  1FIN B;  4F6U B;  2BPM B;  3BLR B;  4KRC B;  2C5X B;  2WHB B;  1URC B;  3QHW B;  2W9Z A;  4NST B;  3VYG B;  4CRL B;  3QZ5 B;  1GUX A;  4YC3 B;  2WXV B;  3QYH B;  2JGZ B;  5CEI B;  5HVY B;  3HZJ A;  1XO2 A;  3A8M B;  4HNV A;  1UNL D;  4EOL B;  3DL1 A;  3EJ1 B;  1OI9 B;  2PK9 B;  1H1S B;  4BCO B;  4F6W B;  4BBR M;  2WIH B;  3VKG A;  1OL1 B;  1UGP B;  4NC6 A;  2C4G B;  2QGS A;  4F70 B;  2KMG A;  1C9B A;  4TTH A;  2CJM B;  5IDP B;  4BXX X;  4Y72 B;  3TW6 A;  4OB2 B;  3MI9 B;  2IW8 B;  2WMB B;  4QSH A;  1UGS B;  2I40 B;  4HNT A;  4BCP B;  1H24 B;  1E7P A;  2QDJ A;  1AHJ B;  4BCG B;  3G33 B;  3PO3 S;  2IN3 A;  3DDP B;  2CZ1 B;  1BU2 A;  3O0G D;  2ZPH B;  4MIM A;  2EUF A;  4FX3 B;  1D3U B;  4EOO B;  1QLB A;  2UZL B;  3QYE A;  1UNG D;  4EOJ B;  5IF1 B;  3HO8 A;  3K7A M;  3A8O B;  4EC8 B;  3BHU B;  4F6S B;  4CXA B;  2UZD B;  2CZ6 B;  4MFD A;  2C5V B;  2QFZ A;  2CCH B;  3A8G B;  3HBL A;  5BNJ B;  2D0Q B;  2BS4 A;  3X28 B;  4ROD A;  1AIS B;  2WIP B;  4AKI A;  2ZZD B;  4CFU B;  1TFB A;  3HHT B;  3H4C A;  2I53 A;  2KR6 A;  4EOP B;  3KHI A;  3QYG B;  4HLQ A;  4BY7 X;  1ZP2 A;  4HL4 A;  4AKH A;  4M6V A;  1JOW A;  4BCK B;  2G9X B;  2DME A;  2BS2 A;  3BG5 A;  4OGR B;  5EJC A;  4IMY B;  3TNH B;  5HBJ B;  1ENW A;  1UNH D;  5ACB A;  3F5X B;  3X24 B;  1VOL A;  4JX4 A;  5DQV A;  3QXE B;  2ZPI B;  1VYW B;  4EC9 B;  4JX5 A;  1PKD B;  5ICP B; 
#chains in the Genus database with same CATH homology
 3TNW B;  1H25 B;  4II5 B;  1H27 B;  2CCI B;  4BCN D;  2EUF A;  4BCM D;  4FX3 B;  4BCJ B;  1D3U B;  4OR5 B;  4BCF B;  3MY5 B;  4EOO B;  2UUE B;  1H4L D;  2X1N B;  1N4M A;  2UZL B;  1GH6 B;  2PMI B;  4YOZ A;  4BCQ B;  4CFM B;  2PK2 A;  1G3N C;  4BCN B;  1VIN A;  1OL2 B;  1UNG D;  3TNI B;  4EOJ B;  5IF1 B;  1FVV B;  3EID B;  5LMK B;  2PHG A;  3K7A M;  4EOS B;  3MY1 B;  2W9F A;  4EOK B;  4EC8 B;  3BHU B;  1GY3 B;  1H1Q B;  1OIY B;  4F6S B;  4CXA B;  2UZD B;  4F7J B;  1GUX B;  2C5V B;  2IW6 B;  2C5N B;  5HBH B;  2W2H A;  1FIN B;  2CCH B;  2C6T B;  4F6U B;  2BPM B;  3RGF B;  2W96 A;  3BLH B;  1JST B;  2UZE B;  3BLR B;  4KRC B;  5BNJ B;  2C5X B;  1W98 B;  2WHB B;  1URC B;  3QHW B;  2W9Z A;  5HNB B;  4ROD A;  4NST B;  2IW9 B;  4CRL B;  1AIS B;  5HQ0 B;  2WIP B;  1F5Q B;  1O9K B;  2WMA B;  4EOI B;  5L2W B;  5LQF B;  1E9H B;  1GUX A;  2F2C A;  2W99 A;  2WXV B;  4YC3 B;  2JGZ B;  5CEI B;  3M03 A;  3EOC B;  5HVY B;  1XO2 A;  4CFV B;  3MIA B;  4YOO A;  1H1P B;  4CFU B;  3LQ5 B;  5I5Z B;  1UNL D;  1TFB A;  3BHV B;  4CFW B;  4EOL B;  4F7S B;  2WPA B;  1H1R B;  3BLQ B;  3DOG B;  3DDQ B;  3BHT B;  2I53 A;  1OKW B;  3EJ1 B;  2BKZ B;  3H4C A;  4BCH B;  4EON B;  4EOP B;  1JKW A;  1H28 B;  1ZP2 A;  1OI9 B;  1O9K A;  4YOS A;  2PK9 B;  1H1S B;  4KRD B;  3QHR B;  1JOW A;  1H26 B;  1OIU B;  1JSU B;  4CFU D;  2WFY B;  4BCO B;  4F6W B;  4EOR B;  4EOM B;  3TN8 B;  4BCK B;  2WIH B;  1OGU B;  1OKV B;  2G9X B;  4ELJ A;  5CYI B;  4ROC A;  2B9R A;  1OL1 B;  2R7G A;  4UN0 A;  1P5E B;  2C4G B;  4OGR B;  4F70 B;  4IMY B;  3TNH B;  4ROE A;  5HBE B;  3POM A;  1C9B A;  4TTH A;  2CJM B;  5HBJ B;  4ELL A;  5IDP B;  1UNH D;  4Y72 B;  1AD6 A;  4CFX B;  2IVX A;  5EFQ B;  5FGK B;  5IDN B;  5ACB A;  3F5X B;  2C5O B;  3MI9 B;  4F7N B;  2IW8 B;  1QMZ B;  2WMB B;  1KXU A;  2I40 B;  4G6L B;  2WEV B;  4CFN B;  1VOL A;  4EOQ B;  4I3Z B;  4BCP B;  1H24 B;  4BCM B;  2QDJ A;  4F7L B;  4BCG B;  3G33 B;  4BCI B;  1VYW B;  3DDP B;  4EC9 B;  2V22 B;  2UZB B;  1BU2 A;  3O0G D;  1PKD B;  5ICP B;  4BCQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...