1G3UA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with thymidine monophosphate (tmp)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
208
structure length
208
Chain Sequence
b'MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
publication title X-ray structure of TMP kinase from Mycobacterium tuberculosis complexed with TMP at 1.95 A resolution.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 80
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g3uA00
1F5NA 1N0WA 1UDXA 2ZRLA 2GXSA 4M1WA 2B7CA 5CITA 4MRNA 5UKDA 1OFIA 4PHTA 4GL2A 4DSTA 2WJHA 4L8GA 1ZRHA 5JI2E 4M9SA 3U6BA 2ZAMA 5CK5A 2J41A 1QG2A 3X1WA 2OAP1 2Q3HA 1VIYA 2C98A 2HT6A 3THXB 4ASUA 1F2UB 4F4JA 1VHTA 3L8ZA 1ZIOA 3EZ7A 3PUWA 5FBRB 2WIAA 3NXSA 4DLZA 2WAXA 3QF7A 5LDDC 1MRNA 3I8SA 3C8UA 3BAFA 4NKRA 4MRRA 4YMWA 2A5DA 2HXYA 2VTKA 1C4OA 3P1JA 1X6VA 3K70C 2C99A 1RJ9A 2IXFA 4R2IA 4D6PA 4DSUA 5JS8A 4A8JB 4K8OA 4KITB 1E4VA 3B1ZA 3WNDA 1JR3A 4AURA 3BE4A 5F2EA 3VR6A 3FKSD 3ND9A 3T15A 3KKOA 4QC2A 5E3HA 1WP9A 3LW8A 2Z0MA 1OJLA 1RRCA 3RS4A 2Q0HA 1Q1BA 2AR7A 1T8UA 4LJ9A 3KJGA 4PQRA 4DRZA 4FMDB 3MFYA 4TMVA 4CVNA 3IBGA 5FL7A 1EFHA 1SVMA 4HYYA 4OK3A 4F38A 2EW1A 3QPWA 3A4MA 5IHPA 2YVUA 4GT1A 3CX7A 3G0HA 1XDBA 1Q12A 3EZ2A 4C0AC 1GG2A 1ZW6A 2WJJA 5BYJA 3VR5A 2ZUCA 1JR6A 3AF2A 2JJ1A 4I1VA 1HT1E 2BEJA 4NDZA 5CB8A 6Q21A 2QN6A 4BPBA 4LV5B 4A6XA 3REFA 3U7FB 3LXXA 4JVLA 2IL1A 5D3MA 3MMPA 4P4SA 2KB0A 1U2RA 1XTQA 2OUKA 3AVTA 1FL9A 1G3QA 3CX8A 3MJRA 5JI3E 4B2PA 5L3SA 2V3CC 3QUSA 1E0SA 4G1UC 1QHSA 4PO8A 3IBYA 1Z0JA 2FE4A 3EPKA 2X1VA 4JBWA 4HLQB 3HU1A 5KPJA 2PJRA 4X8MA 1DPFA 5KSPA 4JT4A 4JIMA 3SZRA 4A2WA 2R6AA 5G3YA 2EFGA 3B7GA 1UKVY 4C2TA 2IA5A 2JJ8A 5A5GA 2CNWD 5LD2B 2JEOA 3S1AB 2VF8A 2ZQ5A 4L9SA 1GKUB 1J8YF 5TV2A 4XVUA 3EPHA 4B47A 2YOHA 2IX3A 3QKSA 2H92A 3QXHA 4TLDA 2GZHA 3LQRA 4Z54A 5TXGA 1U9IA 3DMDA 2IC5A 1RRGA 3K0AA 4MGZR 3UXMA 3Q5EA 4QXAA 4JLAA 3GP8A 2F1IA 3IEUA 3REGA 3AF1A 1CXZA 1NVVQ 2JLXA 1QHHA 3THWB 2Z43A 2QMEA 3AVUA 1R2QA 2CCJA 2HYDA 3R7WA 2FN4A 1XMSA 2WJYA 4B75A 1COWA 5BN5A 3ZVLA 3C4JA 1SXJD 4HAWA 1UPTA 3ETLA 3FVQA 4DXAA 3TSWA 1CJVC 4DLUA 3EX7C 1G8GA 1G7SA 2ZE5A 5JSZA 4PFSA 3FYHA 4AD8A 2JGNA 5HE8A 2IEZA 2GAAA 3RANA 2ZRBA 4LBZA 1E2EA 4P4TA 4ZCIA 1E2JA 1W46A 4PPGA 2AKAB 2R44A 1I4TD 1AZTA 1OHHA 1Q44A 3T34A 4B43A 1BIFA 2QSYA 3B78A 4GMDA 4URZR 4MDEA 3R9IA 2P67A 3T12A 2IBMA 4M2LA 3UMSA 2C9CA 2J46A 3BIFA 4V0MA 3VHLB 4BZXA 3U7GA 4R2HA 3ZH9B 1KJZA 1XJQA 3AH8A 2NOAA 5HPYB 2CE7A 4JLBA 4NYIQ 3DDCA 2O8FA 2XOKD 5AUPB 1E2NA 2D62A 1W36B 4PSAA 2ZJOA 3FMFA 5FOUA 4AYWA 3PXGA 2GILA 2NG1A 1DEKA 2HF9A 3LO5A 3CR7A 2FNAA 3FMPB 4IDQA 1YJ5A 1WF3A 3EIQA 3TAUA 1XTRA 5KUTA 1P72A 1FQJA 1YR9A 4IVRA 5BXQC 4CEIB 4BLQA 3U3OA 4EJSA 4A36A 2QY9A 1R4AA 3VX3A 2BKEA 5JWOA 4FMCF 4C3ZA 5J47A 5FBLB 3M0EA 1BOFA 1W0JD 1JEEA 1KMHA 1T91A 3EASA 1OYYA 3AF4A 3BB4A 1Q20A 3W90A 1KZGB 2G6BA 4LHYA 4HDOB 3VNUA 1G17A 2FPLA 1AGPA 1J70A 3DVLA 1LV7A 2HJVA 3ZIAA 1NSTA 2QL6A 4JLVA 1E2QA 4FMDF 3NH9A 4RFSA 3GJ8A 4PX9A 2KE5A 3U60B 5JJKA 4TMZA 3U7HB 1OSNA 2OCYC 2ZRMA 1EWRA 3QF4A 3MWLA 1XEFA 1XMJA 4K81B 2JIZA 1WBBA 1E9BA 2ZSDA 1OKKD 2BKUA 2REBA 3UWOA 1CLUA 3LNCA 1GTVA 4IFEA 4LCBA 2FEMA 2QBYB 1XZQA 1WE2A 2J9RA 2ZSAA 3DZDA 1D9XA 4LZZA 3CPEA 2ATVA 4AIIA 4XTRA 2E9SA 4LHWA 4H1UA 1T3HA 3TGPA 2D7DA 2IF0A 2E87A 4MYUA 1E69A 4H9GA 4WZ6A 4M4SA 3LLUA 2H16A 4TMWA 1M7BA 4EFLA 4V03A 1II0A 3KXKA 2UZIR 5EE9A 3VU9B 1XU4A 2BJWA 5DN6A 2KJQA 4Z1MD 4PC6A 4M1OA 2HYIC 3KB1A 4GP6A 4A1FA 2ODNA 3AF0A 4HB2A 4NE2A 1G21E 5C1BA 3I4LA 2XB4A 4Q5IA 4EFMA 2D7CA 3O47A 5FL3A 1QBKC 1ZNXA 1KNXA 2D4HA 4D0GA 3L0OA 1J7KA 2IW3A 2ZRCA 4C4PA 1GKIA 1SHZA 1XZPA 2BCGY 2C8VA 2VH5R 4GI7A 4OHYA 2QPOA 4G0NA 2MSEB 3G82C 1WBDA 2RKOA 2GXQA 3CR8A 1Z5ZA 4Q1AA 2GJ8A 4M8NE 5CYPA 2DB3A 1W0KA 2F7SA 1IONA 2YJTD 4R98A 2QORA 1E2MA 1KDOA 2ZVPX 4Q7JB 4WVFA 2R9VA 4ZV4A 3CIOA 2OLJA 3RSOA 2JLZA 4EPYA 2OE2A 5TMPA 2OXRA 2IYTA 4RCYA 4BLTA 4RKEA 4HAUA 3B6EA 2TMKA 1JEDA 4JJKA 3IPYA 1E9AA 4R7ZA 1GUAA 4DLXA 1AK2A 2BM1A 3N2IA 1KMQA 2AWNA 4TL6A 3RSLA 5EE3A 3GLIA 1DAGA 2IHYA 3ZZ0A 1A7JA 1I2MA 1AIPA 4BWYA 1WRBA 1CBUA 3TAHA 4W9MC 3IO3A 3LQQA 5HZKA 3VTKA 4D4LA 3WNBA 1DVRA 5FPSA 3NIBA 4RZ2A 2VL7A 1N6HA 2HF8A 1VDZA 4RD2A 5DI3A 2IK8A 4OQXA 1OB2A 1NVUQ 1N0UA 2B7BA 1JQLB 2EVWX 3FWYA 2QG6A 3CF0A 4LBYA 5TVKA 5B30A 5JZVA 5EP1A 4BLSA 4Q4AA 1D2MA 2OBMA 5G3ZA 1OFTA 1XX6A 3OIUA 4PPFA 1X8KA 3VX4A 3RABA 5AJVB 4C0QC 3UATA 4M21A 2ZRFA 2Z6VA 1OXSC 3L43A 4JVSB 1S3GA 3PR1A 1TMKA 4Q9KA 3JZMA 1IM2A 5JCZA 5CYOA 2AK2A 3IDQA 4IOKA 1W4RA 4OI0A 1KI6A 1XP8A 3OZXA 2XSZA 5FUYA 1E1RA 2WJVA 4UXIA 2C77A 3U3RA 3IQWA 1N2CE 1KI9A 3PUXA 2WWXA 4QGGA 1W4BA 2RGXA 3LRPA 3AP1A 3PV0A 3TJZA 2HT1A 1N5IA 3FHOA 1CR0A 5CK4A 4BZPA 3CONA 1XWIA 2KBEA 2NO1A 3GJ6A 4FWIB 4RZ3A 3SDZA 1DAIA 1R10A 4PO1A 2EWWA 3ONWA 4TQUS 4JMPA 2QT0A 5KSZA 1W2HA 4GZLA 2AFHE 1LS1A 2IUTA 2G1KA 5HKKD 3SEAA 3CRRA 1W47A 2W0MA 3FMOB 2V9PA 1QHNA 1HY3A 4XSGA 1CR4A 3NDPA 3LA6A 4RZUA 5KSOA 1LB1B 4D4JA 1GL6A 3CW2A 5GADl 4PSKA 3I92A 4EPVA 1IN6A 1Z29A 3SHFA 4FXPA 2XX3A 5JBQA 1AA9A 4MKIA 1IXRC 3I61A 2ZI4A 3QG5A 4J0QA 1JBKA 4M1SA 4B3BA 3FDIA 2O8CB 4KHZA 4AWXA 5FTKA 1FP7A 1W5TA 2OBNA 2AX4A 1GILA 2ZYVX 2YWHA 4MKGA 4TL7A 5TY0A 3AEZA 4TTQA 1E2HA 2GZDA 4HDQB 5C4MA 3A36A 4U02A 3AVYA 4Q1BA 2A7QA 2GJAA 3FHCB 1US8B 4Q01A 2BIFA 4NH0A 3L0SA 3V9PA 1E9FA 5KDDA 2QAGA 1AM4D 4WAUA 3RHFA 3MUFA 4YMVA 2CBZA 5K8UA 3EXAA 4M1YA 1O87A 4YMUA 2EYQA 1P61B 4UNQA 4D0NA 1UBGA 4IDOA 421PA 1D5CA 2D06A 1KAGA 3X1ZA 2GCOB 4Q4HA 3GMTA 2KI5A 1E9SA 3ND8A 2OV2A 1N6IA 2ZANA 4DJTA 2A5GA 3GEEA 4LYAA 4DSNA 1X8LA 1JXMA 2ZI9A 3HDTA 1R5BA 2F3TA 3L0PA 3E5HA 4V0ME 5CLLA 2OFWA 3K9LA 4IDHA 1BMFD 1Z22A 1EX7A 2ZYTX 4YQFA 4TL9A 2GK7A 2H8KA 3CNLA 1NN1A 2DFLA 1S2MA 3SS8A 1I2DA 2QZ4A 1IXSB 4JT2A 1U0JA 2QSZA 4PHGA 3EA5A 2QUZA 3B5JA 4A82A 1G7CA 1M7HA 3SR0A 1G4AE 1M7GA 3TRFA 3CF2A 3I73A 4O3MA 2ZS7A 1K6MA 1MABA 3KX2A 3CB4A 3KZ1E 4AI6A 1E3MA 3SJZA 1U0LA 1FZQA 4HZUA 1R7RA 4XD7A 1E79A 2OBLA 5KHOC 3THYA 4KFTA 4GP7A 3B13B 4DUGA 2JLQA 4AG6A 1E0AA 1ONBA 4C7OB 3RS3A 1Y63A 2RB4A 3MSXA 1LF5A 2J87A 2NIPA 3ZVRA 4II7A 3HP1A 5SZKB 2V6IA 1GKYA 2G0NA 1KO1A 4P3YA 4FCVA 1NMZA 1R6BX 1G5PA 5L3QA 2FGJA 2O8EA 4X8LA 3H1TA 1DAEA 4YDHB 4TYNA 2WICA 1NBME 2CNWA 3ZD6A 1OIXA 5TDHA 1RYHA 2ORIA 1ZYUA 5CJPA 3VFDA 4GOXA 3WMFA 1IAQA 4PC2A 4RKFA 4ACAA 3QEOA 5A0FA 4NU0A 3U3JA 3IILA 4JYCA 4CGZA 3HJNA 1VG9B 5K8LA 3NBFA 1ZCBA 1G3MA 5B2ZA 4MYHA 5G53C 1NN5A 1E32A 2QM7A 3JZAA 1EX6A 3WYAA 1AKEA 2C9OA 4S2EA 1NG9A 2W00A 1EFRA 1W5SA 3B2EA 1QDEA 1HE1C 4MA4A 3QENA 5FUWA 1XXHA 2BC9A 2NO0A 2FSFA 4FD2A 2ZRGA 1YZLA 3PUVA 4Q47A 1PLKA 2WMOB 2F1HA 4OJQA 3B8HA 3PEUA 2JJ2D 3LW7A 1H8ED 3ICEA 2VP5A 3CNOA 1QRAA 1VCIA 3A1SA 1R5NA 1NIJA 4CIDA 1VTKA 3GLGA 4UJ5A 2C2HA 3GJ7A 5FI0B 1S1CA 4JLDA 2ZJZA 4C0KA 2JA1A 4JL8A 3NG1A 2BBOA 2PEZA 3QKUA 5DHFA 3R20A 3ZLJA 2G88A 4LPSA 1EFUA 1KNQA 2H1LA 2V4ZA 4MGIR 3A1VA 1XMVA 2A5FA 4WXPA 3JVUA 1TQ4A 5HE9A 4B3DA 1RPZA 1G3IA 4EPRA 1XB2A 4DIEA 3FMIA 2QE7A 3MAAC 4B6FA 4B2LA 1YU9A 2XJ4A 4JL6A 1FOEB 4U5XA 1E2FA 1OF1A 4XOIA 4B3FX 2GJKA 1E0KA 1W49A 4GMXA 2OXCA 4ILEA 2PX3A 3MWKA 3AVVA 1U99A 2BHRA 1DBSA 1CU1A 2FH5B 2Z83A 2ZR7A 1FQKA 4Q02A 3VQTA 2GHIA 1OW3B 4D25A 1HQYE 2NMVA 4LJ4A 3GLIE 2VP9A 4ARZB 1BKDR 4FI3C 3THXA 1RYFA 1NN3A 1F2UA 1KHTA 1G19A 4G5SA 4Q7KA 3QBVA 1P9NA 2P65A 1AQUA 1QVAA 4PC1A 4MYTA 2CLDX 3A37A 4M9QA 1H8HD 5B64A 3C15C 1SXJB 3BFXA 2ZIAA 1CRPA 3IHLA 2FV8A 3MWYW 4CEJA 5SZJA 2ZSEA 2HCJB 2P6UA 3GJ3A 3LD9A 2WPDA 4A8JA 2ODBA 5EJEA 1XJCA 2KWIA 4PPQA 2OO7A 3TUJC 1MO4A 1P9RA 2AD5A 4HUQB 4NCJA 3CWQA 4BASA 1FX0B 1EXMA 1G3RA 1II8B 2XGJA 1Q22A 3QKTA 3GLHE 2ZUBA 4DT1B 1XBTA 5AWFC 3F8TA 1UBCA 4U00A 2YOGA 3B60A 1IN7A 3QSYA 1SHKA 3UIEA 4URVR 3VKHA 2QGNA 2WWFA 4JL5A 1ZU4A 4CRWB 3RWOA 1YQTA 1OPXA 2OT3B 3NBXX 4YXWD 3BRWD 1K5GA 4P33A 4QKQA 4TT3D 4L4UA 1ODFA 1JAHA 3BORA 4ZCMA 5CIQA 1N5KA 1W48A 2VP4A 5DI9A 1V5WA 2IS6A 1QHIA 2K5UA 1PVOA 1F2TB 2NZ8A 3KKPA 1QHGA 2HJGA 3SFVA 3QI2A 4LWZA 2QT1A 5HCIA 5EUQB 1OB5A 5G40A 2WKQA 3V4RA 1YR6A 3MLEA 1ZVQA 2Z4RA 1HUQA 1AZSC 1SVLA 1M34E 1UDWA 4Y0VA 1ZC3A 3OEHA 4MKFA 4BFXA 2GNOA 2SHKA 3RRNA 4FMCB 4ZI3A 3NEJA 1W36C 1KDPA 5CDFA 1KDTA 1YZTA 4AKGA 4TLEA 2Q3FA 5EXSA 3KJHA 1NMXA 5CM9C 2OAQ1 5DNYB 1U9IC 1NIPA 2GCNA 2R6CA 2IS2A 2VHUA 1QHYA 3S1AA 4IKEA 2IXEA 1B0UA 2HV8A 1D8TA 4TSFA 2ZXUA 1MH1A 5IK2A 4Q48A 2IYWA 4V0OA 3TQFA 3KQLA 3ADCA 1IY1A 1KK1A 4P4UA 2VBCA 3PVSA 4EUNA 2LKCA 2O0JA 5P21A 4ZIRA 2NO6A 3FPAA 3W8RA 5JJIA 1W44A 1BO6A 1XTJA 3THWA 2FSIA 3GLFB 3B9PA 4E5UA 1UF9A 3BBPA 4V0LA 3SI7A 1OFHA 2WOOA 1QG4A 1E2KA 2BDTA 5KDOA 4MUBA 1KAOA 1VYTA 1RKBA 4KSCA 2OCBA 3NVAA 2AXNA 3T61A 4HUTA 5FOVA 2WWGA 4PHHA 3SQXA 3T5DA 3HPRA 2OILA 3QXCA 5AJZA 4LGMA 4QBIA 4TN1A 1E96A 3F0TA 1CP2A 3X1DA 2F55A 4QG7A 5BN3A 1LTQA 3Q85A 5FPHA 1ZCAA 1GNPA 5FTNA 4DVGA 1DS6A 3U4QB 3ADKA 3K0EA 2RGBA 2R65A 4LX0A 3SYNA 4ZDWA 4QOSA 4TMXA 4A9AA 2Z4SA 4QGAA 3EWAA 2BMFA 4DCTA 2JLUA 2WWWA 3FFAA 1CR1A 1G7RA 2QMUA 3ICQB 4Q4JA 1OXVA 4TQ9A 5EP3A 5IRCD 2H17A 2GWHA 4LJYA 4EJSC 2B92A 1JJ7A 2VPPA 2ZJYA 4ZO4A 4HI0E 2I1VB 2OEPA 4FCTA 1UM8A 4KVGA 1JALA 3TUZC 1G8FA 4Q7LA 3OIWA 4A15A 2NQ2C 1FTNA 2P5SA 2GXAA 4Q18A 2DFNA 2DFKB 2ERYA 2V7QD 1XNJA 3DMNA 4G01B 3SNHA 4CEIA 2QQEA 2FFQA 1JAIA 1E4YA 2XNDD 5AJXA 2JASA 1UEIA 3SJBA 3AVPA 4AC9A 1FNMA 2OM2A 4P31A 1SZPA 4LJ8A 5E7JA 1U8YA 1ZM7A 4URWR 2WHXA 2BV3A 2AFIE 2GEUA 1EGAA 2REXB 2ZVQX 3FTQA 5LBIA 4EPXA 1P62B 2FSGA 3I1FA 2FOLA 2JCSA 2RGGA 2G0TA 5BW8A 1E9EA 4B32A 2ZYUX 3D3QA 1SKQA 1SKYE 4Q03A 2ZRNA 1A5TA 1YZKA 2QMHA 1GM5A 2ZI6A 2B21A 4I1UA 4IW3B 3O8CA 1VG1A 3A4NA 1E1QD 1HEIA 1V43A 1YZGA 4A4DA 1OYWA 1ZM9A 1JPNA 1XXHE 2QBYA 4G5OA 3D31A 4D4KA 5BN4A 3TLXA 2GK6A 3BS4A 4Q1DA 5JHHB 1KY2A 4ERNA 5HR5A 2DR3A 1OH7A 4PXAA 5DYIA 3OIYA 3OE7A 5H1YA 1LVGA 1XEWX 1P2SA 4IVPA 4LC1A 2DWQA 4KI0A 3A1WA 3VU9A 3E1SA 3KXLA 5EXXA 1E6CA 1VHLA 4ZDIA 1JXOA 1FNNA 3DKPA 3GEIA 3WHLA 4MRPA 1C1YA 3K70B 2CLSA 1JNYA 4D81A 1N5LA 4D4MA 1G9XA 1Z2CA 2MSCB 2YINC 1NSFA 1U8AA 5FFMA 3UK6A 3GJ5A 4JVMA 1FP6A 1GRNA 1W1WA 1R8SA 2JLSA 4NCIA 3IPXA 3K0SA 4M22A 3SHWA 3HU2A 2GVZC 1KO7A 3OAAA 1S3SA 4FIDA 3AGPA 3W5JA 3B1XA 1S0UA 4RY2A 1HYQA 2ECKA 1NLYA 1VYVA 1AS3A 2LKDA 2QP4A 3LWNA 4HB0A 4IOMA 4KBFA 1Z63A 2AXPA 1XD9A 5DLQC 4RCZA 2V54A 2UZ3A 2ZE7A 4PSVA 3TNFA 4TMKA 1G64A 2HLDD 1UFQA 2XITA 4HLCA 1EK0A 4GDFA 2PT7A 1AKYA 2PCJA 1F48A 5FTLA 1KK3A 1G4UR 1G8PA 3IHWA 1KZ7B 4BRWA 2J0QA 1TADA 3HR8A 3P4YA 1LFDB 4RFVA 5E95A 3PEYA 2NZJA 3NHBA 2ZROA 2O8BB 3GJ0A 4WBSA 3QY0A 4RSGA 4UKDA 1GNQA 2XXAB 1CS4C 2PJZA 2EWVA 2PMDA 2UKDA 3EIEA 4KFUA 1IOZA 1OXTA 3QPVA 2QA5A 2GXUA 1NKTA 4Y0AA 3KQNA 3AF3A 3AVOA 2QROA 1HURA 1KO8A 2ZUDA 3SYKA 5F9FA 1G1MA 4TMTA 1MO5A 3CF6R 3OEED 2RH5A 5KNBA 1NKSA 1M2OB 1L4UA 3QIAA 2O8FB 5GJVC 5EE0A 3EPJA 4OYHA 4B33A 2YZ2A 3IIMA 2BEKA 5FPKA 2QQ0A 721PA 1U94A 3QPUA 4PTLA 1PUJA 4F7WA 4CT4B 3DHWC 3W3ZB 4ACBA 1G16A 4QJ5A 2QENA 2AL7A 4ZI2A 3W9YA 4OHWA 1IN8A 2QI9C 2A9KA 2D2EA 2CL7X 2BOVA 3W6OA 1Z83A 1S8FA 2G77B 2FFAA 2I1QA 3PIRA 3WNCA 1PV4A 5EZ5A 3A8TA 2W2TA 2P6RA 5BWMA 4PQYA 1BYIA 1KSFX 4BZQA 3I5YA 1XRJA 2IYRA 1RW4A 3H84A 2ZRJA 1K8RA 4YONB 1QF9A 4PQFA 3SJAA 2ZJ8A 3V4FA 3M4YA 2Q21A 2ZJBA 1PLJA 3CWZA 2FA9A 2BM0A 4F4CA 4G5GA 2FU5C 3FE2A 2WIBA 3KQUA 4DEXA 1PLLA 4UQOA 3X1XA 2RCNA 4L16A 4TLAA 1NN0A 3L82B 2Q9CA 1GL7A 2PT5A 2G9NA 1DE0A 1S96A 1A4RA 3RRYA 1Z0DA 1RVDA 1OLOA 1JR3E 4NYMQ 3WMEA 1TAGA 2F43B 4TZ0A 2QGZA 4PZZA 3KDSE 5KU1A 1G6OA 3CM0A 2P5TB 3BD9A 2V1UA 3ASZA 2QP9X 1AS0A 5FL7D 3QJYA 2F1JA 3D7MA 4C0LA 4Z51A 2QRNA 2JDIA 1ZD1A 2EFHB 4Q9LA 4IOLA 2RAPA 2CVFA 4US0R 5KYKA 3KQHA 1UKEA 2O8DB 1MOZA 4F92B 5FTJA 1L8QA 1F60A 2QAGC 2O8CA 2ZU0C 2RGCA 2VF7A 221PA 3UANA 1X1SA 3KJIA 2MSDB 3T1TA 1W4AA 3TKLA 1IXZA 3O8DA 4W7SA 2CK3D 2WVJA 1E2IA 4KCGA 1E2GA 4LOAA 1H8HA 2FJUA 4NCKA 4E09A 1TL7C 2XB2A 2RHMA 3OF5A 2FDCA 1US8A 1ZUIA 3P4XA 2VSXA 3EIHA 4QRHA 1ZD8A 4US2R 3LLMA 5J40A 1ZBDA 1KDRA 4E22A 2J45A 3CBQA 3D8BA 3LV8A 4KAXA 1TEVA 4C0BA 3RDPA 4NHOA 3CPJB 2IEYA 1IHUA 1LNZA 1ETUA 3VKWA 2GCOA 1VIAA 1X1RA 5EUMA 3R9XA 2EFCB 2PZFA 2JATA 4I99A 1SGWA 3KUCA 1HQCA 1DELA 621PA 1SVKA 5A4JA 3GCGA 3K70D 2XZOA 2W6JA 2PL3A 2IYYA 2QM8A 1BH2A 4OHVA 4AYTA 4LBVA 4BEJA 4QGHA 2OCAA 3AKEA 3VNVA 3T5GA 3K0FB 3ZVNA 3BH6A 1E9RA 1KYIA 2OLKA 3TW4A 2REOA 1YRAA 4EDHA 3GEHA 4B35A 4DCNA 5B58C 4FWTA 1Z07A 2ZRDA 4RD0A 3WYGA 3RAPR 4UNSA 3I5XA 4IRUB 1ZM2A 1CRQA 3MG9A 3W6PA 2ZI5A 3E2IA 1Q1QA 2OHFA 3WHKA 4DZZA 4HAXA 1J90A 3RC8A 2R6GA 3O8RA 3ASYA 2OZEA 4AG5A 3N5CA 4QJ3A 1RZ3A 1ZD9A 3OFND 4JLPA 4LI0A 3TUIC 4QM6A 2ZM5A 1XTSA 3BH7A 5DISB 2DBYA 2NGRA 3B9QA 1IJEA 1E0JA 1N3BA 1N25A 2R8RA 1QHXA 1D9ZA 4ESVA 4IDNA 4C7OA 2VA8A 3ZS9A 3NDBB 3F5FA 4GZMA 4KFSA 1NG1A 3QVUA 3TIFA 2CDNA 2OSBA 4ZPXA 3PITA 4U7DA 4DB2A 3GLHB 4Q9HA 1U81A 1NI3A 3OHMA 3FKSA 4KO8A 3OESA 3KL4A 2D3WA 1XEXB 4JBYA 2J0VA 4GOJA 4XTCS 3NTUA 1WA5A 5FI1B 1TQ2A 4ON9A 4Q1EA 2EU8A 1PUIA 2GF0A 2YYZA 2XZPA 4RD6A 2RHDA 4GBMA 3AVQA 1ZUHA 4XVQA 2FMXA 3LDAA 5AR1A 5CM8B 1NJGA 3TR5A 4EIWA 1WQ1R 4JLJA 3I62A 2ZRAA 1VCMA 2GEVA 4CYMA 5DHAA 4DCVA 2JLYA 1RE0A 1KGDA 4QL3A 1SXJC 1YHNA 1XTIA 2VHCA 1DAFA 4TTPA 2DCUA 3FHTA 4JSYA 3AKCA 3EA0A 1G3UA 1NRJB 3TBKA 4CEHB 1FW6A 2GTPA 3NBZC 1Z06A 2VHTA 3NH6A 2J7PD 1JI0A 4P0TA 4PC3A 3WMGA 5JCPA 1UBFA 3ZIAD 2KSQA 2A3RA 5EXPA 3TK1A 2NTYC 1NF3A 5GVSA 3UMFA 1SULA 1XMIA 4M9XA 2R6FA 4JLOA 4YC7A 1NVVR 4HZIA 1IQPA 2DY1A 3K9GA 4CZ2A 3IQXA 4JS0A 3ZDQA 4R71A 4HLUC 5FBVB 1A2KC 1NBMD 2AKYA 1ESMA 2JIZD 2ODWA 3T06B 2XNSA 1EFTA 4LJ7A 3CRVA 1VG0B 3U2QA 3VAAA 2X19A 3P26A 1SVWA 4BFWA 2ORVA 5JLJA 3LBHA 1OXUA 3ZGXA 1P9WA 1KIMA 3Q5DA 4A0GA 2BCJQ 2J0UB 1ZP6A 3AVWA 2QU8A 4PHFA 4OL0A 4PAMA 2C04A 1UBEA 4G3XA 3DM9B 3C16C 1KKMA 1T9HA 1FFHA 1YZQA 4LC0A 1G6HA 5DN6D 1P3JA 5JEDA 2D74A 2GJ9A 2L0XA 1J99A 3ZZUA 4ARZA 4BUJA 4Q4LA 5D3QA 1CTQA 2WSMA 2GJSA 4BGDA 2YOFA 1Z6GA 4KVAA 5L3VA 4LJ5A 4NYIR 4A8JC 4LRWA 5C4GB 4TLBA 2KBFA 1KSHA 2C03A 3L8YA 1SXJA 3CO5A 1M1YE 1W7AA 5AUNB 2ZSFA 4BLPA 2QPAA 1NY6A 1G291 2W83A 1VPLA 1VKJA 1N6RA 5FPTA 5HCNA 4CF7A 2F1RA 4L15A 3U44B 1I4DD 2V1XA 2E1RA 5DE3A 4B34A 2XAUA 5FBQB 3QVVA 1IN4A 2BBSA 2WAYA 1W0KD 4JKIA 2QAJA 1GIAA 4A0FA 1J8MF 3BFVA 2EFDB 1MABB 4HUQA 5C18A 4F91B 2CL0X 2ZI7A 4LHXA 1FX0A 1II8A 4N3NA 1Z8FA 1R0WA 2IYSA 4TYPA 4F4IA 2DHRA 2CL6X 1GWNA 1YR7A 2OESA 3H0KA 4S35A 4TYQA 4DT1A 2NO7A 4ZKDA 1NMYA 4WIAA 4WZAE 4HLUA 2XOKA 4I1SA 3AKYA 3RRMA 4Q7MB 2V6JA 2J1LA 3KQKA 1WMSA 3C5CA 3L2OB 5JRJA 1Q21A 5FUXA 4EKDA 4I1OA 3ECCA 4TWZA 5KTYA 3AP2A 1N6PA 3AUYA 3BK7A 4N1AA 3U7EB 4OHZA 4KODA 2LCFA 5H70A 3K9NA 2ZS9A 5FH9A 1KY3A 1ZINA 2WSSD 1P73A 4EQ6B 4JSTA 3QXXA 2FF7A 3CKLA 3T1VA 1W0JA 4PZLA 4A0RA 5KSYA 2C9YA 3B1VA 1GVNB 3U6KA 2YC4C 5IF9A 1KJYA 3UKDA 4EAQA 5JRZA 5HTKA 4B48A 1CJTC 1XD2B 1KSJA 3ADBA 2WJGA 3G5UA 3RYTC 1XD8A 2IYZA 4BFSA 4IJMA 4GPTA 4QBFA 5LD2C 1XFAA 3LXRA 2G83A 2A2ZA 1VCNA 5ANRB 1SQ5A 1XXHB 1OH8A 1S1MA 1HA3A 4OJKA 4MGKR 1OKKA 4B2IA 5SZHB 1LW7A 2PX0A 1TQ6A 2VHQA 3LVQE 4XWKA 5FPYA 3FKQA 1KK0A 1M74A 3KJEA 4FMBB 4RVCA 3ZD7A 3B85A 4EFNA 4Q1CA 3DOEA 1N6KA 2ZU6A 2XSZD 2IYXA 3E70C 1E1RD 2ZITA 1D2NA 1TF2A 3DPUA 3PFIA 1XTKA 3PG5A 3SYLA 4A6PA 2QEQA 1U0HC 3I72A 3MWJA 2NPFA 4M1TA 2IXGA 2CJWB 4Z1MA 3Q72A 1S9DA 1RFLA 4W5JA 5J4YA 4N0DA 1NVXQ 4N0EA 1R0YA 1L7VC 1Z0FA 3NEYA 1F6BA 3LFUA 5AUQA 4A0HA 4EPTA 1Z6AA 2ZREA 4QNRA 4TYYA 3LX5A 4DDWA 5EZ6B 3GLFA 2NO9A 1MKYA 3RS2A 1GSIA 5F98A 1FUUA 1Z28A 4LYHA 3WY9A 1NP6A 2JLRA 1D6JA 2BJVA 2GAOA 1F3OA 4OHXA 4X8HA 4Q9JA 3BB3A 3WBJA 1TU4A 1YKSA 2DWPA 1KI4A 4OI1A 2J7KA 1XCMA 2IUUA 1OH6A 2WOJA 3HYTA 2A5YB 1CKEA 4NPHA 4NMMA 3EZ9A 4NTZA 1OT3A 3ZQJA 3QKRB 5JJLA 3CLVA 1AJEA 5KDLA 1L2TA 4NCHA 1Q57A 2DFTA 4NYMR 5JECA 2V55B 3AV0B 3RS5A 3KTAB 3U4QA 4FW9A 5TARA 3KKMA 3DL0A 2QP3A 3MD0A 3KFXA 2ZEJA 4DCSA 4MITA 1GP2A 4W5HA 1FMJA 2OFXA 1RC8A 3LBNA 4CEJB 4Z8YA 3MJHA 3EZFA 2ANCA 4DC9A 5DSZA 3WBKA 1P6XA 2QMOA 1II9A 1ZMXA 3LVRE 1UAAA 3MGCA 3TQCA 3UG7A 4KBGA 4B3GA 4ITRC 3CRW1 3GJXC 3SOPA 2C95A 3PENA 2ZJAA 4L5BA 1XEWY 3TR0A 2P0EA 1E2DA 4X8OA 1G20E 2Q9BA 3KKNA 2BMDA 4IEIA 2J3EA 3QNUA 2W6ID 1N6NA 2GBLC 3ZYCA 1QZXA 4HDCA 3QXJA 2A30A 1EESA 1KK2A 2GCPA 4RD1A 1LS6A 5M04A 2QNRA 2VIIA 1A82A 2Q6TA 5BYKA 1IY2A 1T6NA 4XJXA 4BFUA 1U8ZA 5K8TA 5B57C 3VR1A 1CJKC 3D6TB 1ANKA 5LB2A 3MCAA 3IIKA 4DDTA 4MRSA 4TTRA 2QTHA 4JLKA 1Z6XA 2GEDA 4TQAA 2XZLA 1EFCA 2HDNB 1FUKA 3MRSA 4LPKA 1KI8A 2XTMA 4AY2A 3WYFA 2WM9B 1M8PA 3AKDA 4OI4A 4B3CA 3V00A 4RD4A 1CEEA 2CK3A 2GVDC 4DLYA 1Z08A 2GKSA 4XD7D 2JLVA 1E79D 3I32A 3J81k 2R6DA 4I81A 5AUOB 4MKHA 1KTVA 2ZR0A 2ZTSA 4LV8B 4DUGD 5FTMA 3K53A 4QHTA 5GJCA 4L9WA 3TSZA 1RJ9B 4OI2A 5JWRA 3EC2A 2UVQA 4QHYA 4HEJA 1P2VA 2RMKA 1LF0A 4A92A 4D0LB 4D82A 4UNRA 4AKEA 3EG5A 4NYJQ 1SVSA 2CVHA 3BOSA 4AKIA 4LV6A 3A4LA 2RGNC 4RJLA 1U98A 2FWRA 1GITA 4I4LA 4V0NA 5IT5A 4Q66C 1Z3IX 2VYFA 2Z5FA 5HKKA 4BE7B 2GDJA 2BBTA 2RGDA 5EE5B 4DB4A 1T5IA 5FR2A 4DDUA 4DKXA 2ZRKA 3KB2A 3IO5A 3SC3A 1AGRA 4QHSA 2B8WA 1W2GA 2IYUA 1NY5A 1G8YA 1MO3A 5FOSA 2MMCA 4TLCA 2F9LA 1OXXK 4ABYA 3U5ZB 3CPHA 3NC0C 1R5OA 2EYUA 4DCUA 4G5QA 1XPUA 4UNNA 4ZIRB 5CLQA 1TUEA 4B71A 3FOZA 4P32A 1EFRD 4M0LA 2GBLA 2GZAA 4GOKA 3LAWA 1HV8A 3OFNA 3VKGA 2N46A 3I8XA 4JZKA 2O0KA 1AQYA 2CE2X 1P7CA 4Q00A 2WV9A 2FPKA 5D3MB 4P4SB 2YWGA 2PCLA 1VCOA 1VMAA 5L8VA 3DEFA 2DYKA 4FINA 2O8BA 2FG5A 3TH5A 2FFHA 3R9WA 5L3SB 5GVRA 3EW9A 1E2PA 1SXJE 3K0CC 4IOJA 4C0SA 2XXAA 3GLGE 4XSHA 2W0SA 1ELOA 2B6HA 2WJIA 2BVNA 3I3SR 1RRFA 4DLWA 4LJ6A 2PEYA 1MR3F 3K8YA 2Y8EA 3F3YA 3LY5A 2ZETA 5FOWA 1ZM3A 2GESA 4Q4JB 1WDTA 2QE7D 2QPTA 4KU4A 1BMFA 4NL4H 5G41A 5C2JB 3GD7A 3THOA 4LDJA 4AKHA 3RVBA 2RGNA 4OQNA 2J5XA 1ZNZA 3QKSB 1XF9A 5KPDA 3B1YA 1O3YA 4AYXA 2IS1A 2PZEA 3K0AB 4QBGB 3SE0A 5J4LA 1ZC4A 1N0VC 1GRRA 2HCBA 2ZS8A 4HB4A 3IUYA 1QHHB 2O5VA 2YHSA 4URUR 5EP4A 3ZZTA 2XTZA 3EC1A 4KYUA 4Q19A 3PEVA 2J7PA 2VSFA 2YKGA 3R7WB 2ANBA 3UMRA 1E98A 1T5LA 4DSOA 1FMLA 4MUAA 1DG1G 3BERA 3LH5A 3EAQA 4OK5A 4URYR 1GZSA 1IN5A 5F3WB 1PZNA 2IWRA 5JSZB 1TUIA 2QRZA 2IUSA 2QTVB 2VQSA 4JKYA 5CIWA 2ZE6A 4PPNA 3RC3A 2A78A 2WPDD 4M9ZA 4MGYR 3VR3A 3DM5A 3CH5A 1NBMA 2GRJA 4R9UC 1M6NA 4IHQA 4DEYA 3U3KA 4UXJA 4B6EA 1MT0A 2O52A 1OIVA 1HTWA 1XPOA 3C5HA 4KJZA 3ADDA 3K0CA 3HR7A 4WOPA 1RRPA 2BWJA 2ZRHA 2D2FA 3EARA 3AGQA 2F43A 1OFUX 1Q1EA 2JAQA 3DOFA 2X2EA 4V0KA 2PBRA 5EE1A 5TB5A 1XCGB 4BLOA 4POAA 2AWOA 1PJRA 3UWKA 4TZ6A 4MQBA 2JLWA 2H57A 3RWMB 4PANA 4IXMA 3W3AA 2ZYWX 3CZQA 5FOXA 1Y3AA 1KSGA 3ZS8A 3SQWA 4C2UA 1XJ0A 4M1MA 2IT1A 1DOAA 1KI7A 5E7MA 2O8DA 1T3LA 4EJSB 4O25A 4M53A 3H2YA 5EXTA 3FFBA 1Z0AA 3C14C 4CDGA 4ESHA 2XJ9A 4ASUD 1TQDA 2CMKA 1KMHB 3IEVA 2CHQA 2XTNA 2FZ4A 4NCNA 3AM1A 1DTSA 2JJ2A 1H8EA 4O2LA 4YMTA 5JFGA 2P6NA 4BEBA 3GLFE 5FR1A 4D2IA 2ZRIA 5ELXA 1Q3HA 1TF5A 4NZYA 3QE0A 1DAMA 8OHMA 2VP2A 121PA 2X2FA 2ZPTX 3KKQA 2F6RA 4RFSB 3QBTA 2EFEB 3EZ6A 2WWIA 5KNDA 4MDFA 2PLRA 2ASEA 3C7KA 4JLNA 2IS4A 1YZUA 3OEHD 3QF4B 1JR3D 4ZDJA 1G18A 2QTFA 4K46A 1GRQA 2Q3MA 3W34A 4H1VA 3ZQ6A 2WWYA 1EWQA 3N70A 4TL8A 2WKPA 5F9HA 5K8IA 3U3MA 1NNEA 5CDFE 1UKYA 2BMJA 4QM7A 1DO2A 1ZAKA 3K0FA 2RGAA 1HH4A 3NBYC 4TSFD 3R8CA 5IK2D 3KFVA 1IJFA 5DIFA 2G1JA 2DWOA 1BYUA 1N6OA 4B44A 3TVTA 3DKVA 2FZLA 2VRWA 2P2LA 3LX8A 1EG7A 3NKVA 3P32A 4OK6A 4XWOA 2CLCX 4KLNA 5E7IA 4CT5A 2ODEA 4DBLC 3Q8XB 2WSSA 4PAQA 4GNKA 1T0JB 3A1TA 4D80A 5DH9A 1Z47A 2JJ1D 3WP0A 3X1YA 2AN9A 4BFVA 4LY6A 4E07A 1XPRA 3T1OA 1T4GA 2J59A 3QEJA 3A6PC 1VG8A 4TYWA 4UNPA 3WRYC 4CW7A 1Q1ZA 3P20A 4US1R 3IGFA 5E4FA 1CJMA 1Q3TA 5L3RA 1GL9B 1KI2A 2YWFA 4O0MA 5J5CA 1CIPA 4LJAA 5AJWA 1W4CA 3CRMA 2I3BA 3T35A 2EQBA 2IYVA 1NLFA 1UKZA 4QFMA 2C78A 2H7VA 3GLHA 3HPQA 1P2UA 1ZIPA 4Q21A 1KO5A 1DADA 3GFPA 4PO9A 2CEAA 3CRQA 4JJZA 521PA 1XEXA 3BB1A 1H65A 1BS1A 5KO2A 2HUPA 4QBHA 3PQCA 2I4IA 1T0HB 1R0ZA 1C9KA 2YWEA 3RLFA 5KOYA 4NBSA 2OCPA 5AJYA 3CX6A 1P2TA 2ZSBA 1W36D 2IYQA 1B23P 1K5DA 2X8AA 4ZCLA 1X8JA 4LUCA 4WA7A 4F93B 4A2QA 1R8QA 3GLIB 1GAJA 2H18A 4YXWA 3KXIA 2AD1A 4QNMA 1HT2E 4DLVA 4GRAA 1CR2A 3M1IA 3FGNA 4TT3A 2J0SA 3BFKA 2VO1A 4LYFA 3Q7QA 4JBXA 1E2LA 4DWJA 1CULC 1JECA 3L0IB 4Q1FA 5GJWC 4HAVA 4KYIB 4WZBE 3KUDA 1YVDA 4HSEA 4CEHA 2R2AA 3VR4A 4JYBA 2IHBA 4HAYA 5FBWB 5DI3B 1COWD 4DIDA 2CHVA 5EQTA 3WXMA 5EP2A 3WP1B 2FPMA 2PH1A 3AUXA 3NC1C 3BJIC 4FCWA 4Q4AB 4XH9B 1GDDA 1JPJA 4GSYA 2VSOA 1Z0KA 1JB1A 1JJVA 1DAKA 4BLRA 3PUZA 2P3SA 3AP3A 1KOFA 3SBEA 1ZM4A 2FX3A 1OHHD 4WW0A 4JLMA 4C0JA 1S9HA 1ZU5A 1LY1A 2VEDA 1TNDA 1KI6B 1A2BA 1WXQA 1ZNWA 3B1WA 2ERXA 1GFIA 2VLIA 2WMNB 1ESNA 3GQBA 3SBDA 4KXFB 2J0UA 4C0HA 5H8WA 1FTSA 4JVNA 1FPMA 4G5RA 1G5TA 1Z0IA 3OE7D 2WWHA 2VP0A 3GFOA 1AN0A 1G7TA 2Q9AA 3B82A 3WRXC 3H86A 1DARA 2HXSA 3BXZA 3TMKA 2B8TA 4URXR 4IEEA 4KFRA 5AK0A 5JWHA 5GJBA 5DO9A 3W5IA 4YLGA 4D26A 2ZR9A 5LPNA 2DPXA 1E99A 2WZQA 3IKJA 2C96A 2W6IA 3IIJA 1UEJA 1YR8A 2ZJ2A 1KI1A 4C9BA 1DG3A 4EPWA 2YNMA 1KI3A 3EPLA 1U90A 1T3SA 5FOTA 3H4MA 2IYLD 2AK3A 2W2VA 3QXSA 4KSBA 4OQLA 5IDVA 5KNCA 3GPLA 3OAAD 1NJFA 4DLSA 4NYJR 3U44A 1ZUNB 2ONKA 2YV5A 4QGFA 1DO0A 2W2XA 2R62A 4W5WA 1OIWA 4C30A 3AVXA 1YE8A 2IF2A 4BFYA 4LHVA 1WB9A 3Q9LA 4BFZA 3SN6A 4NP6A 1TU3A 1VYUA 4Z8XA 3PEWA 1L4YA 3PCRB 3CNNA 2BBWA 4LK2A 3VHXA 1KJWA 4MYCA 3RNLA 1G5RA 1G41A 3U61B 1G8HA 3CH4B 2CCKA 4QJ4A 2ZRPA 3AB3A 3CZPA 4FN5A 2F3RA 5J4VA 5HZHA 2WTUA 4IVQA 2V8OA 1P4SA 1KKLA 3SJCA 2OG2A 4YDSA 2QAGB 4OQFA 4OQMA 5CB6A 1QVRA 5H68A 1OV4A 2FSHA 2LWIA 2IWHA 3R8FA 3GJ4A 2GF9A 2V7QA 1J2JA 2CHGA 4Q4HB 4ZKEA 2YC2C 3VR2A 2XEXA 2ZE8A 3AQ4A 4NONA 2XNDA 3SU8A 5DYGA 4EQ6A 1CF4A 3NHAA 1Q0UA 3TW8B 2AHOA 2PMKA 3OIVA 1T8TA 4GFDA 4LSGA 3P27A 1OH5A 5JEEA 4BQSA 1GOTA 3TVDA 4LHZA 4PR0A 3Q3JB 4RZXA 1SVIA 1NLZA 2CCGA 1XD2A 1UJ2A 1YZNA 3QG1A 4XVRA 4B76A 2W58A 3X2SA 2VP6A 3M6AA 3W6NA 4DDVA 1KO4A 4PAOA 4DLRA 1MRSA 1DAHA 1X86B 1AS2A 1JQJC 5JS7A 1NVWQ 1HE8B 1E1QA 1ZNYA 2GETA 3PUYA 5C46F 4HZUB 3DO6A 4HATA 3UG6A 3C41J 4IFBA 821PA 2WBLC 3K09C 1N5JA 3TSOA 3THYB 2G3YA 4WXRA 4BECA 2PLFA 1WCV1 3BGWA 3W8NA 2C5LA 2F9MA 4OKSA 1TEXA 2FGKA 2ATXA 1IY0A 4KV9A 2CXXA 4BRUA 3JVVA 3QQ5A 2ZAOA 1CJUC 5JMTA 5LB4A 5J4HA 1XCPA 2CJWA 4ZDKA 5JHGB 5L3QB 1P60A 2A5JA 2O8EB 1TPZA 1GNRA 3CUEF 3K9HA 1TX4B 1ZJ6A 1A1VA 4DHEA 4M1KA 1YRBA 2GA8A 4LYJA 3HWSA 3HYRA 2RGEA 2MMGA 3SFZA 1TTTA 1SVOA 4MRVA 3N2EA 2OFOA 1TF7A 4A2PA 2WKRA 2ZJ5A 4B3XA 3Q7PA 1OE0A 1R0XA 1F2TA 3GFTA 4UXHA 1Z2AA 1Z6TA 2BMEA 3HU3A 4PZYA 2PZGA 2O0HA 4HAZA 4LBWA 2X77A 1MV5A 4O2RA 3VMFA 4B73A 4AK9A 3BC1A 1SKYB 3EWSA 5BQ5A 1E94E 2JDID 1E9DA 1Z6YA 3RS7A 3ZJYA 3PJRA 3QKRA 4IDPA 4V02A 4KLZA 4PC7A 1S4QA 2FEOA 3KTAA 1X3SA 3BWDD 2HLDA 3QOFA 1P75A 4XWAA 1D2EA 5FUVA 4UJ3A 2FFBA 4B74A 3NWJA 1N6LA 3LBIA 3RRZA 1NL3A 4Q9IA 5SZIA 4RD3A 3TE6A 3ZVMA 2VHJA 3GLGB 4HLDA 5J4KA 4YMSA 1VECA 4DLTA 4BFTA 2HEIA 1I4LD 1P5ZB 1UADA 2ORWA 4OBEA 2N42A 3O8BA 3A58B 3BH0A 3A1UA 3K1JA 2ZI3A 3K09A 1RIFA 2N1BA 4XIGS 2ONJA 5CJ2A 4IXNA 4HB3A 2H5EA 4MH0R 3UPUA 3RS0A 1IBRA 3T1QA 3OEEA 5DGXA 3DZ8A 3FB4A 4E03A 2W6JD 1E9CA 2NPIA 1MO6A
chains in the Genus database with same CATH superfamily
3EVGA 3DONA 3IEMA 2GXSA 4M1WA 5DHSA 2PMWB 5LLSA 2B7CA 5CITA 2H4HA 3QBEA 2O0LA 5UKDA 1LPPA 2FUCA 1OFIA 1W0CA 2H4WA 3NHMA 4TVKA 4GL2A 2WJHA 2CYCA 2Z09A 5TQ0B 4QQRA 5JI2E 3IUJA 4HEA1 4M9SA 4B82A 2O07A 4ZVUA 4YAOA 1EBBA 2LUOA 5HIJA 2J41A 3PKIA 2PPLA 5ALPA 3RAFC 3EVZA 2C9ZA 1A9QA 4UAJA 1BDJA 1KEEB 2C98A 2GT1A 1I3CA 1OVGA 3NT4A 5KAPA 1G60A 2H1RA 2OV1A 1VHTA 3L04A 2FWAA 1BW9B 1XQVA 2YUTA 5FBRB 5LDDC 2V7WA 1I5EA 2XHEA 1RR6A 4JOBA 2R66A 3LZCA 1NLMA 2Z95A 2HMAA 3T5PA 3OJXA 2VSNA 2HXYA 3HTXA 1UWLA 1ZK0A 4QVGA 1MZVA 3K5HA 3KHSA 4HNGA 3MS2A 4MMZB 5CT6A 1NBOA 2C99A 3WGGA 4B5LA 4DSUA 4P86A 3MINB 3S55A 3ESDA 4H35A 1QYRA 4KITB 3S99A 3F8SA 2B2CA 1A7KA 4P7BA 3AHIA 1JR3A 5FAKA 4FR5A 1UP6A 3ND9A 2ODQA 2A9JA 4DLPA 4QC2A 2ZIUB 3HFRA 3WGOA 5E3HA 5MFZA 3OEWA 1I24A 1J1ZA 3UJ3X 4MQFB 5A4KA 1R9JA 1PVDA 4C21A 2Z0MA 3HEBA 3WRVA 1K88A 3A7DA 1N9GB 1JIQA 5D7NA 4B7ZA 2P7HA 2ZR8A 1JTVA 4MR8A 2PUEA 5HRUA 4YRDA 1Q1BA 3FPHA 3PC8C 3AFOA 4I1PA 1XROA 2JI4A 3D0RA 4NNPA 2ZZKA 1VE5A 1YGYA 2HK7A 1XL0A 2DF8A 2HPVA 3MFYA 2YCLA 2V74B 4TMVA 3NTVA 1H1TA 1WLYA 1WDMA 2YVUA 1GG5A 4X1KA 5L6LB 2IU6A 1A8PA 1RD4A 2I0FA 4G5HA 3G0HA 2VUIB 3ILSA 4C0AC 1GG2A 1KYTA 2WJJA 3QLJA 4RGYA 5E9JA 4AZ0B 4G4JA 3VR5A 4CUJA 1PNRA 1OI4A 3GVXA 3AF2A 4GSLA 3LUKA 4I1VA 3W8EA 2EBWA 5CB8A 3K71B 2QN6A 3T4EA 3I6MA 2N75A 1A72A 2V7BA 4DV3B 1Y89A 3HA3A 3R77A 4PU0A 3NPMA 1VL1A 1B74A 1HYHA 1LKZA 1J2EA 4JAVC 5DYWA 3UK2A 3AKZA 3WLEA 3UYLA 5I01A 3JYQA 1MJGA 4LTMA 5BMVF 3ZKWB 2V6FA 1I6KA 3AO0B 2OUKA 5COQA 3IAM6 4ANFA 3KLPX 1W88B 3JYHA 3MGAA 3BMQB 3HJBA 4AJ4A 3K3PA 1P6QA 4M54A 3ZW9A 2NTNA 1BJTA 4IDCA 1QHSA 3Q8WA 4YJ3B 3I53A 3FNIA 1Z5UA 3IS3A 2FE4A 2HHCA 2X1VA 3D6UA 1J1IA 4HFJA 4IFTA 4PBSA 5D01A 9MHTA 1IQ0A 1UOOA 4A2WA 2L19A 5CTAA 2R6AA 3OMLA 2IP1A 5CVTA 2H59A 3TLGA 2AQKA 1UKVY 4JEUA 4QQNA 1G6KA 3JQ8B 2JJ8A 2LIPA 5DHRA 3G5LA 2BT4A 2JEOA 3ZU3A 5HGJA 4NMWA 4MB2A 3WL8A 3FOCA 5JO9A 4EG6A 4CIBA 4MA5A 2WABA 2VT3A 1RHKA 4L9SA 4PHCA 1J8YF 4MS4B 4DR6B 3R7LA 2JEZA 4K28A 4XVUA 5EZSA 2JG3A 5CRIA 2BFDA 2XT0A 2YOHA 3QP9A 4ZQHA 4EA6A 3AR2A 3QXHA 3T41A 1D1TA 3GVHA 2HCRA 2Q8PA 3GK3A 3FYDA 4CMGA 4Z54A 3QUCA 5B4VA 3UXMA 3Q5EA 2YXEA 1ZCJA 3EHDA 4QDKA 3L0CA 4NARA 4TVBA 4RM3A 4TN1A 4YRZA 2P0AA 1NVVQ 3CVVA 1B8NA 1WZIA 4DVJA 4NOLA 1Y6FA 4GWGA 4ETMA 2VDKB 3FI9A 1ID1A 3KAQA 2GH1A 2PS1A 4HMPA 4YUXA 3T7RA 1Z5PA 5ABPA 3IAHA 1ST2A 3DOUA 1H0HA 2HYDA 2Q5LA 3R0IA 4G0ZA 4JB2A 3TTWA 5AUNB 1JLMA 2FN4A 3QFCA 1COWA 5ILQA 3C4JA 1JU9A 1SXJD 2LE0A 5SYAA 1X3LA 1UPTA 3C6ZA 4PM4A 4XWGA 1WB4A 3EEOA 3EPPA 1G8GA 5B1IA 1A8SA 3BYZA 5BVHA 2HHHB 1T9CA 1JT9A 1L7NA 2JGLA 2Q6LA 1BH6A 5HE8A 1IM5A 2AI2A 1C9JA 2ECOA 2FPSA 3FZEA 2CSXA 1E2EA 4P4TA 3JWGA 4ZCIA 3QLVA 2R44A 1T9AA 3U0VA 4ZP1A 3RSGA 2Z98A 1J8FA 4UOQA 3T34A 4B43A 3H9EO 4GMDA 5BNIA 4PFKA 1J06A 1RLIA 2OGWA 2IBMA 3U7GA 3BIFA 5FBHA 1DHRA 4WCDA 4JCCA 1L7MA 2W98A 2X6QA 4R2HA 2WDPA 4O4HB 1FVXA 1KJZA 3NIGB 4ZMSA 4AJIA 3PQDA 2NOAA 4EJMA 4K9OA 2I1LA 2XOKD 1RKUA 5CA1F 1RIIA 4R83A 2P4EA 2VYVA 3OH8A 3PYMA 5FWYB 3RV4A 4B7CA 4BEVA 1B6GA 3AY7A 1TO2E 4LMAA 2HF9A 3IAS1 3LO5A 3MN1A 3CR7A 4FHCA 1ADFA 3DZCA 4MV6A 4E31A 4XCXA 3FMPB 2B4TO 3ZV5A 1GPDG 1WF3A 2AIRA 1ZL0A 3OOYA 4FTWA 4RL6A 4AZWA 5ITSA 1J20A 1FQJA 1AB6A 4IVRA 3MT0A 3ZZMA 1HKUA 5REQA 4I4TB 2QRHA 4YJKA 4BLQA 3X44A 1ENZA 2C4KA 2QY9A 4A36A 3IALA 2FN7A 4H3HB 2BKEA 5AM2A 4FMCF 2BTEA 5FBLB 3BA6A 4EL0A 1W0JD 3L4KA 2LXNA 4U2DA 4LJRA 3OO0A 5I7SA 3UCXA 4X71A 1FS4A 3OQOA 4G0WA 4L51A 4L8LA 3VNUA 3ZIAA 1HFEL 1J70A 3DVLA 3FSRA 4GKKB 5FLXA 1O96B 4W7IA 1RAAA 5ALEA 1JDUA 3NH9A 5CFZA 5IM4A 1HDYA 1Q7GA 1ECJA 1X2BA 3QUBA 3WKEA 1JVNA 1EDOA 1JN0A 2ETVA 4KMOA 1XTTA 3U60B 3U7HB 1VMDA 2OCYC 4LZAA 1MQ9A 4L0CA 3ZWAA 1XEFA 2JIZA 1AXRA 4MQ4A 1CLUA 2JKVA 2ADMA 2QB5A 3GOHA 1BMTA 1DJQA 4IFEA 1WU8A 2FEMA 3FPLA 4J0HA 1QFJA 1KY4A 2EP5A 2X22A 3RRBA 2P30A 3U1BA 2X4GA 2E9SA 4DCGA 4WNCA 1KTIA 3FD8A 4LMBA 2UUPA 4H9GA 1SM4A 5KVSA 1SHLA 3MILA 4FWBA 3ABSB 4TMWA 3FUXA 1M7BA 3DMFA 4NBLA 4V03A 1II0A 4QU9A 1YVRA 4DARA 1ZLXA 1J8VA 2I03A 3CJRA 3N3BC 4QBKA 3KB1A 1NF9A 2C7OA 2BFBA 4A1FA 5CH8A 2RE8A 1KEPA 4YNBA 3KD3A 2X0RA 2DUMA 2VCHA 3DWIA 4S1NA 5C1BA 2XB4A 4Q5IA 3NETA 3ECAA 1I1OA 3H5OA 1QBKC 3GL9A 2JBHA 1R18A 3W79A 5LBTA 3K30A 3EVEA 4L0MA 3FPEA 1YZYA 2P5YA 3B89A 1PKXA 4NS4A 5ALQA 1A8UA 3IQGX 1L5NA 2P0YA 3LT4A 3I39X 2B4AA 3ETHA 5AW4A 1P7YA 2GJ8A 2JFUA 4M8NE 4KMSA 1U7OA 3QLUA 1SB8A 5ER9A 1GRVA 2ZLBA 5D84A 2Q4RA 3RSOA 3SQNA 2VTBB 3ZC3A 4X41A 5KINB 3OFJA 2R6R1 3E27A 1VMIA 3PQ8A 5F7XA 4G1EB 4QQFA 2I3GA 2IVFA 3BL8A 1G9SA 1QCYA 2DFPA 3SAJA 2OSVA 4RCYA 5LXTA 1M2NA 3B6EA 4G1MB 4WGFA 1JEDA 3NEAA 2IV2X 4BXOB 1QF6A 5BR1A 5HUJA 1DV2A 1E9AA 5TF4A 2N0SA 1FU8A 5B37A 1KAQA 1AK2A 2BM1A 1Q0PA 2GB4A 3EW7A 4DLXA 4RVGA 3A7EA 1TRHA 2IHYA 5A06A 1A7JA 2ESRA 1K6EA 2AJDA 2O48X 4P4GA 2HO5A 4RHUA 3V7NA 4NPAA 1W5EA 1U9YA 4CL3A 5EMNA 3L4SO 1CBUA 5HJEA 4AICA 5LLTA 3BREA 4FKMA 3ZBTA 4QDUA 4YUYA 2JH3A 3ANTA 1HT0A 3D8NA 4F5DA 1ISGA 1U0EA 3J7TA 4C6TA 5ICSA 3UGKA 1EPUA 3AEUA 4RTLA 2C2ZA 2FW8A 5FPSA 1RJEA 1WCIB 1Y7LA 1VDZA 1F6WA 3L0DA 4GWLA 4IR7A 1NVUQ 1Q74A 2EVWX 2HBQA 2IIQA 4U7TB 3FWYA 3SC2A 1OV6A 1F0NA 4KN9S 4CHGA 1RKXA 2AV6A 5JZVA 2B8NA 1QOZA 3BSSA 1I36A 4L95C 1OFTA 1LTHR 4UBNA 1UCFA 3GUUA 1ADCA 1JIJA 3JAKA 3VX4A 5KVAA 4YRSA 1MDBA 3C4VA 3RABA 3FPFA 5AJVB 4N0QA 4C0QC 4KAAA 5HP4A 1CRWG 3T8YA 3DFKA 3JY6A 3RT7A 3V34A 3NFYA 3T1HB 1GEEA 1MA3A 1U2SA 3H5LA 5AVKA 4YWJA 3JX9A 3AESB 5EJ6A 3R5XA 1VIVA 2ZBGA 3HUEA 2WHRA 4IOKA 5JSKA 3T3GA 3V55A 1KI6A 4NJEA 5JNLA 5EPOA 4Y7DA 3LPDA 5FUYA 1I13A 4OMDA 3IQWA 1W1UA 4DLKA 3PUXA 2P2ZA 3SBXA 4DWVA 1ONNA 4JC4A 2RGXA 2ZAGA 3PFWO 4P38A 3RSSA 4EGAA 3MCTA 5I4BA 2HT1A 1BNCA 1N5IA 4XVCA 1Z2PX 2CSUA 2ZT7A 3V46A 2XCLA 2JZNA 2YNMC 1YB4A 3IOMA 1XPJA 2YVLA 1DAIA 2B25A 4PO1A 3GEMA 1L4MA 1QORA 2EKZA 3MLBA 3ONWA 1XLTC 4IZHA 4JMPA 3RU3A 3UAWA 1IXYA 4P0PB 3I9V6 2AFHE 2C1ZA 3D4BA 1LS1A 1XDDA 2G1KA 3QWBA 3R3XA 4Z9XA 5C1IA 1W47A 3TINA 2MSKA 3RVMA 2E37A 5BSVA 4F72A 4NF2A 5DNWA 3U4AA 3TX6A 3OQHA 1E3IA 1T1EA 1TOAA 3OZUA 4RULA 1IMJA 3LA6A 3M6FA 1J00A 3DJYA 2DULA 2PX5A 5CPBA 4BJHB 3IR7A 4KK4A 3G6KA 5GADl 3KP1A 1TVEA 3I92A 1IN6A 3E7XA 3C2QA 4PSKA 1BU8A 5DK4A 3I12A 1BXKA 4EB6B 4IIJA 1BMQA 3I61A 1YC5A 1W9HA 4F12A 1ZN9A 2Q27A 4J0QA 3DCNA 1Z26A 3MUOA 1OXBB 3HE3A 4QX6A 4V0RA 4B3BA 4ZZ3A 2O8CB 4MTLA 3MIZA 4BNFA 2OBNA 3S8MA 1RI5A 2AX4A 1GILA 3LLVA 1K3TA 4MKGA 1E18A 3S6JA 5FV4A 2QU7A 4TTQA 6ABPA 1KVRA 1E2HA 3WL6A 4HDQB 1GKLA 4JJAA 1RM4A 2WJ4A 1WY5A 4AKTA 4B3TB 2OV3A 2VSYA 3P2OA 3FSGA 4ZN6A 1FW8A 5E3IA 3C6QA 1XR3A 3WDKA 4BO8A 4WAUA 1KEZA 2OPBA 3C3CA 1UH5A 4GC9A 4KI7A 1FDOA 3ANYB 3O1JC 4D5EA 1DJPA 3P2MA 4XUEA 5FA6A 4DJFC 3KZOA 3QTBA 4OMCA 2QKYA 3JALA 3VC7A 1DFHA 4U2CA 4LXUA 1U8EA 3WGHA 4LQDA 3V7UA 1TT7A 3R3VA 1DMSA 3GGCA 3GYBA 5HZGA 1EEHA 1PCXA 4RWZA 4BRZA 3TW8A 5DRYA 3MXTA 4MXDA 5IDXA 4RK5A 2AJBA 4G9EA 1M0WA 4PTZA 3DL2A 2VNJA 2AC7A 3IDOA 1N2HA 4MI6A 3UENA 2X0EA 2OFWA 3K9LA 2G07A 1GQFA 1M75A 2K4MA 3N1UA 4Q4CA 2H8KA 4RLQA 2DFLA 4ZGBA 1IXSB 4C7JA 1W34A 3UXYA 4P82A 3OETA 2PWPA 4MV1A 2IY8A 4EHIA 4K9KA 3B5JA 5DNEA 1GSHA 3UFXB 3IERA 3F5QA 3OTGA 4UBJA 4YALA 1S6YA 3HR4A 3PX3A 2QDKA 4MP6A 1DCFA 3DBHB 1JSCA 1EDDA 2WKWA 3KZ1E 1NTOA 3LYHA 4FGJA 4AF7A 5IASA 4JOQA 5FBKA 1U0LA 1FZQA 1SQGA 5C8XA 1E3MA 1R7RA 3AB7A 3CJQA 4XD7A 4ZEXA 2OBLA 2OOKA 4PYMA 3THYA 3ZY5A 2AGVA 3R1IA 4AJEA 4YV1A 2VJMB 5C7OO 2OBXA 3AETA 1W73A 4AG6A 3I42A 4PZ0A 1Y1QA 2I2BA 1XAHA 4G8DA 4GX1A 3ZVRA 2J87A 2NIPA 4K6FA 4UCXA 5CX1B 1Z73A 3ZHXA 3SHVA 2GS9A 3DDWA 2AH5A 2YY7A 5LJLA 1KFEB 2V6IA 4BX9A 2PUCA 5DXJA 5AMXA 3QX7A 1OC2A 3C5EA 9ATCA 1URPA 2HNAA 5B3JA 4PY2A 1JWLA 1DP4A 5K1ZA 2O8EA 3C5WP 3BD7A 3JVIA 4ER6A 4XIYA 2O4UX 4EMSA 1CF9A 3A05A 1NBME 3JD2A 3UK0A 3HLKA 4L6CA 2OZLA 1KQFA 1MX3A 1YQQA 2AFIA 3F98A 3LWDA 2ORIA 5CJPA 5HFAA 3VFDA 3MJFA 3COSA 1JEYA 2G08A 2YWJA 4LRYA 4NU0A 2H9IA 4JYCA 4H0FA 4WN9A 4G24A 4YCCA 1AXEA 2BFWA 4IQ0A 4MYHA 2PS3A 1L4KA 5G53C 2PMBA 4ZV9A 1H42A 3DPSA 2I67A 4ND7A 3H18A 1D07A 1JHXA 4I8IA 4RV4A 3WYAA 3VOAA 4BEWA 2C9OA 1VZ3A 2QK4A 3RIMA 4TVSA 1NVTA 3B5EA 3ZJ5A 4M0EA 1Z8HA 3BGDA 2FSFA 3ZCSA 5JBNA 2IHNA 5EWLB 4E46A 5C37A 3PUVA 2QTMA 3VJRA 2WMOB 4OGKA 4WZZA 4W5OA 1SN7A 4PONA 2EKLA 3K9FC 4LRXA 3WGNA 1UT5A 4KO2S 4LMPA 1K89A 4LHSA 2RB5A 3B6JA 3GLGA 1VTKA 2J67A 3OM1A 4D4IA 1YQEA 1S1CA 1V9LA 4JLDA 1LLCA 4FCCA 4AMZA 1IL0A 2ZJZA 4C0KA 1PJ3A 3C85A 3L7CA 1ADGA 2JANA 4HS9A 2ZIXB 2AOTB 2BBOA 2PEZA 3HV2A 4BNMA 2CV0A 1BQ3A 2H4ZA 3I01M 1IEQA 2QN9A 3R20A 2CUZA 4IJUA 1ULSA 1DEAA 3TLMA 4PNEA 2V4ZA 3I3OA 4MGIR 4UMVA 1KR5A 4O2AA 2BFFA 3H65A 5IS2A 3V1LA 1Y9JA 1RPZA 4DA6A 2MYUA 2PBZA 4H7PA 3KQVA 3EXHA 3FMIA 1CZUA 3GUYA 3ENKA 2ZUEA 2VI5A 1HDGO 2ZT5A 3ZY6A 2PLWA 2FF5A 1OF1A 4LY3A 1Y3HA 1YL7A 2GJKA 3V8MA 1DC5A 3FM9A 4QUAA 3EXFB 3CO0S 4ILEA 4WY5A 3I1JA 1NNLA 2BHRA 3FIJA 1XNGA 3FOEC 2BH2A 1HEYA 1QWSA 2GK4A 4YMGA 1FQKA 1NW8A 2D1YA 4Q02A 5ECGC 3VQTA 1P2DA 4E4TA 5M7EA 4DBVO 4KPEC 4D25A 4LJ4A 3O9MA 4FI3C 1RYFA 5LZ8A 4EFKA 1G19A 1T8PA 1ULBA 1Y42X 3NWBA 4Q7KA 4DCMA 2EKPA 1QVAA 1F4PA 1D0VA 1F8GA 3FPJA 4OX9Y 4QULA 1Z36A 3ZV4A 1NYRA 3AR6A 3MPOA 4PLTA 1MGPA 3BFXA 1CRPA 4UEOA 4CM9A 3OA0A 2GO7A 4N40A 1KOLA 1JH9A 3G1TA 2R7MA 4DV5B 1K8QA 4CEJA 2GOYA 2CF6A 4FYXA 3ZCTA 4C7VA 5LDHA 2HCJB 4KACA 3IPLA 1CHNA 5EJEA 1EA7A 1MW9X 1XJCA 2B82A 4PPQA 1TA9A 2R1TA 2OO7A 3TUJC 1Y6RA 2RHCA 2AD5A 3DFFA 3WGIA 2OKGA 2WNHA 2WSYB 5JPDA 2CZGA 3CWQA 1ULHA 1G3RA 2VAVA 1BMDA 2AVDA 5DM2A 3GLHE 1R0LA 1T0BA 4XWYA 1P5HA 2ZWVA 4JDUA 5IUKC 3RE1A 3PNYA 2ACWA 2PXCA 2VZ8A 2YMLA 1D6NA 1CQWA 1QIGA 2X58A 1WSAA 3ZV3A 3HKEB 1O95A 5A02A 1YC2A 1IN7A 1MAWA 4MVYA 3QSYA 1QFXA 2NTJA 3CUSA 1ZU4A 1ZSNA 5FF9A 2Z04A 3JXEA 1YQTA 3QITA 2Z9BA 5G0SA 2XCUA 4YXWD 4OYRA 4P08A 4AN1A 1ZK3A 4OGGA 2YJ4A 5DLDA 4DQXA 1UIMA 7YASA 3UAGA 5CM2Z 3K2QA 3K6JA 4X85A 3F7NA 4GE3A 1N34B 2FSVC 5CDHA 2ASVA 1V5WA 2IS6A 1H2XA 2K5UA 1C7IA 1E89A 5AVTA 1MC4A 4YCDA 1VKOA 1GA6A 2QXUA 4LWZA 4EK9A 1VDMA 5IDWA 1GM5A 2WWVD 5HCIA 2J9YB 1F12A 3HKCB 4MW9A 1GSAA 2JD0A 2WKQA 4G89A 1FMCA 1MB2A 4PBRA 4DJEC 2C7QA 5AW6A 1J7JA 5H3CA 1Y4SA 1ZVQA 5J1TB 3MMSA 3N87A 3BSFA 1AZSC 3COPA 4PVCA 2X0FA 4BQRA 2VJBA 1TAQA 4ZEWA 1M2KA 3HCCA 3JPWA 2NW6A 3KYJB 4QE3A 4Y0VA 2A0UA 1KQGA 3S28A 3KQWA 3L7JA 2A0XA 2I6SA 2SHKA 3MGKA 3RRNA 4QIHA 4ZI3A 1LX7A 1KDPA 1L4LA 2OOSA 3JQDA 4J0CA 1ECPA 1IB6A 1YZTA 3NHYA 4QPZA 2DJIA 3OC0A 4QATA 3AL3A 3KJHA 1NMXA 1EJ2A 2OAQ1 1U04A 5CM9C 1XA3A 2GCNA 1NIPA 2F4VB 4DZTA 2WUFA 3HK2A 3T0GA 2X40A 4IGEA 2IS2A 3DQQA 4IKEA 1NLUA 2ZXUA 3KC2A 1MH1A 2GFHA 1IRIA 2REQA 4O2BA 5DWVA 3HBJA 5IK2A 4BE9A 5BW6B 3M4XA 1E7QA 2G5TA 3O2NA 5CVVA 3SF0A 3STUA 4HRAA 3TQFA 4L8YA 4DMKA 3KQLA 2O5CA 2KPOA 2II6A 3HHPA 4TMFA 1L8XA 2YTZA 3QY9A 5B6PA 2QX8A 1NDUA 4MULA 3T0FA 1O0SA 1ZD3A 2DZDA 3D3KA 2NYAA 3QE2A 4KIFA 1AKWA 5P21A 5JY1A 4AXBA 3PDIA 4D46A 1QZZA 3HZRA 1UJ4A 3SDBA 5JJIA 4LNHA 1W44A 1YJAA 2J85A 3KQSA 3N9IA 2NTVA 1XTJA 5D5QA 1I7NA 3PDUA 3A4TA 4GR4A 3RYFB 1EVLA 3BBPA 4V0LA 3WJAA 4E5UA 2FZGA 3PGVA 4L6IA 2WOOA 5BN1A 2XCRB 1E2KA 5DM60 3ONDA 1MHTA 4MUBA 5AM3A 1XC7A 5JDCC 4L5CA 4RDHA 3IP6A 1RKBA 1L5YA 1PWYE 4KSCA 4XVHA 3WWCA 4GGMX 2XY4A 1Y1TA 3MIIA 1E3WB 4Q37A 3SQXA 3IFSA 1ULZA 4IBOA 2FMIA 1FVOA 4IVNA 3OPMA 5AJZA 4JA0A 2JIDA 2Z2YA 4EY7A 2IVZA 1CP2A 4F60A 2CV2A 1VE6A 2PL1A 4QG7A 3KZVA 5FYQA 1FQWA 1TT5A 1XU7A 3HDJA 3PFNA 2H5JA 5FEUA 1YMQA 3O9ZA 1RYMA 1CY7A 3NBQA 5FTNA 1MFZA 3U4QB 2RI1A 2RGBA 2WU0A 2GM5A 2R65A 1THZA 5FIUA 3IKTA 3IXMA 2B2XA 1AUVA 1WSBA 2Z4SA 3EWAA 4PXYA 5AOCA 4C4ZA 4DCTA 2WWWA 5A0VA 2CDCA 1OTXA 1SFRA 2PUTA 2QMUA 1OXVA 3I1YA 3IT0A 4TUYB 2GWHA 4CEHA 5ETJA 1PX0A 2B92A 3GXOA 1M66A 5F7OA 1U8TA 1I2BA 2I1VB 2OEPA 4FOPA 4P3KA 4YREA 3WMXA 4IQ8A 5ERGB 2G40A 2UYOA 1X94A 4NV1A 1PQWA 3M9LA 3OIWA 1DAOA 1YMUA 2EX0A 2NQ2C 2P5SA 2XF2A 4IHJB 4TV8B 2IU4A 3OUZA 5EA2A 4JT9A 3TZHA 3U7QA 4X45A 3ZNQA 1UT6A 3JZIA 1H22A 5DLYA 1XNJA 2BEWA 3VR2D 2JD2A 2QRVA 2IY9A 2YICA 3KWJA 1JAIA 1E4YA 1PAUA 3DEIA 3V48A 1LK0A 2IYAA 2JASA 3M4NA 1V8FA 3TJMA 2APJA 2DMRA 3AVPA 3ZTYA 1WPXA 2OM2A 2VT6A 5H9VA 5M34A 3VH3A 1DRWA 1WVMA 4KR7A 5HWSA 5E7JA 1U8YA 1ZM7A 3C39A 4A2CA 1PEDA 4HFRA 4ROTA 3KOYA 3INRA 4J03A 5EJ2A 1JDPA 1XTBA 3PB3A 3QLEA 2AFIE 4FW8A 4MW5A 1EGAA 1BU5A 1FFAA 3LTEA 1MN6A 3FTQA 3QPBA 4EPXA 2VUSA 4L02A 1M6EX 2RGGA 1RBQA 5KVCA 3NW9A 1ZEMA 4G0MA 3NWOA 2PT9A 3SK0A 2CXRA 3D3QA 4GMKA 4Q03A 4Y3UA 2X7JA 4G9BA 2QSUA 3NHLA 4D57A 2EF1A 1FFDA 1XZCA 2DQ4A 2ZI6A 4I1UA 4W82A 2I6XA 5K0GA 1NC1A 5DHQA 1VG1A 4YAWA 1Y8ZA 3M2TA 1O08A 1M1NB 1PFVA 3E7PA 1ZNQO 4XX0A 4F84A 1LPNA 2QTAA 2QBYA 2Q7OE 1E64A 3F6CA 2E85A 1V8PA 2JRCA 3VSBA 2H1FA 2V3WA 1FRZA 1S2GA 2QJFA 4E5YA 5JHHB 3NVMB 4EX7A 2PKEA 3FGZA 4OLJA 2PGOA 3UMVA 5HR5A 3O6VA 5EZQA 2DR3A 3DL7A 1I1NA 5DYIA 5ELMA 4QUJA 3PHIA 1W5BA 4GVXA 3MWDA 4LSZA 2DWQA 3FVVA 3EEQA 4KI0A 3VU9A 5EVJA 3WLRA 1E6CA 2PS9A 4JYZA 2IDZA 1HFWA 2BFCA 2CLSA 1JNYA 2X9NA 1N5LA 1IOLA 1UDCA 2LD4A 1QH1A 1A5AB 2ZTLA 4F3TA 4EGJA 4CF3A 2X4LA 3LRTA 4TOIA 3KVOA 5MGNA 5CIYA 4QU8A 1FP6A 1GRNA 1E5TA 2JNWA 3MLAA 2R00C 4GLLA 3TS1A 4W5QA 3E0QA 3IPXA 3HU2A 3FDZB 2XLCA 2WUEA 3E35A 1KO7A 4OTZA 2YDXA 4YPOA 5DP2A 5I3CA 2E3JA 1JG2A 2LVBA 2PUVA 3B1XA 5KJ1A 1TK9A 1X7ZB 2W2LD 2BDEA 4KWCA 1DKMA 1M8JA 1P1CA 2DUUA 3WKAA 2B3TA 4MQLA 1HYQA 2ECKA 5IBRA 4QWMA 3VI4B 1AS3A 1C80A 4HB0A 1IVYA 2Y2UA 3VDQA 2PRKA 3VR0A 1XD9A 5DLQC 2I7TA 1YJ8A 3CLRC 2UZ3A 2ZE7A 1QTIA 3H5AA 3JD3A 4TMKA 4QTUB 2VQ6A 5BSWA 4NWIA 4RE5A 4HLCA 1EK0A 2BTQA 1P2GA 2PCJA 1BXZA 1F48A 3I2KA 3TXAA 1KK3A 2DTDA 1G8PA 4DIUA 3IHWA 2IIBA 1TADA 1P7VA 2V6MA 1AURA 5B55A 5JAOA 3EODA 4GRIA 4P34A 1PUXA 1LFDB 3P4YA 3SKXA 3PEYA 2NZJA 3GRAA 2ZROA 2O8BB 5KEIA 1CUFA 3QY0A 4WBSA 4DGSA 1GNQA 4U8GA 1TJ4A 1PGQA 4P93A 4WKCA 2EWVA 3LS2A 2UKDA 4EKGA 3HDHA 5DDIP 3UPDA 2XWJI 2SBTA 3KQNA 4AQ7A 4W5TA 3QOXA 3H6HA 3LCRA 4IEFB 4XJTA 1ZMRA 4KLCA 4WXYB 3F2IA 5IJ9B 1SKUA 2UYQA 3AHHA 2VAXA 1MO5A 2VDWB 3OLCX 1WS6A 2EBUA 3ELWA 2Y27A 5JE8A 3ZI0A 1NKSA 1XWFA 4XFKA 1FCJA 4BMNA 4F4FA 1A9PA 3F2VA 3QIAA 4KXWA 2O8FB 5G0VA 5GJVC 3GELA 4WOJA 2ZBRA 3GJTA 4K86A 2PL5A 3ZHUA 1ULAA 3CU5A 3KZMA 1O94A 5LYJF 1YCFA 2BEKA 2O7RA 3L1KA 4UHKA 4BUZA 721PA 1X77A 1XRNA 5BQOA 1PUJA 3GRUA 1QIMA 1WY7A 3FGOA 2NUTB 3DHWC 3EE6A 4JX9A 3W3ZB 4EMUA 4ARIA 3JRWA 4HNHA 3W9YA 4OHWA 3UJ7A 4DNQA 2DXIA 3EGVA 1EUDA 2CL7X 2F64A 2NU7A 4FN4A 1Z83A 4U1RA 1U0TA 3T9BA 3WLQA 5JALA 5IEBA 3D4PA 3GP5A 2W2TA 2PSHA 4D6YA 1U1CA 1CQZA 3TEJA 1UBNA 1ZSYA 4CG3A 4PIPA 3DBVO 1KSFX 4AJHA 1NUPA 5G02A 2CMGA 3H84A 4UEQA 1KPHA 1K8RA 3AUAA 3W9UA 3S7TA 3MJEA 3PHLA 3KOWA 5CXUA 1NR7A 4JI0B 1J56A 2WM8A 3V4FA 2FHPA 3CWZA 3FDFA 2BM0A 4MVWA 3VYTB 4DC0A 1IAVA 3TN7A 3KQUA 2VNHA 2X8LA 3NOQA 3UAZA 4DMLA 5K0EA 3X1XA 2RCNA 2W37A 3OP4A 1CZHA 2FPPB 1V4NA 3D0KA 4P53A 1OLXA 2Y1KA 2PT5A 4FNGA 2G9NA 1WWKA 1S96A 1AV7A 3I04A 3Q11A 5EFZA 4TS4A 1Z0DA 2A1UA 3EOAI 3RRYA 4B0PA 2DPHA 4BNIA 1PFGA 3D6MA 3C1UA 4NYMQ 4DY4A 2EKDA 1UZLA 3HSYA 5CYFA 2A9PA 1K66A 1TAGA 3HS3A 3L3BA 5FFNA 2F43B 3EH1A 2SKDA 1G6OA 4J6EA 4O4JB 2P5TB 2QLLA 3HCNA 2V1UA 4MQ5A 4ECEA 4XARA 1P0MA 2QZ9A 7REQB 3DFIA 3DE2X 4CIVA 2G8NA 4GPAA 4ZK6A 3EAGA 3DTVD 5AVQA 4Q9LA 2RAPA 4US0R 2PANA 2CYBA 3KQHA 1DWUA 1UFVA 4FZVA 1KC1A 1M6HA 1MOZA 1NMEA 2P3QA 1J9GA 1JFRA 3BPSA 4ENQA 4QODA 2BEUB 3ZWXA 4RDCA 4F8YA 1W4AA 3KKEA 4J16C 4Q15A 1ZAYA 1RWMA 1IXZA 1XCJA 3N2ZB 4MGHA 4UUQA 3EGIA 4E09A 4RH3A 2BD0A 1M5UA 4Z9AA 1XGKA 3FF1A 2ZWAA 3STYA 1US8A 1ZUIA 4FFSA 1UBHS 4NBKA 1SUAA 3P4XA 4TKZA 3EIHA 1TZJA 1W4ZA 3V7WA 4NXMB 1DGQA 3LLMA 5J40A 1ZBDA 5DHUA 4E22A 2J45A 1AHIA 1NQTA 4ZOCA 3LV8A 4KAXA 5KAMA 1YDHA 2FR1A 4C0BA 4NHOA 4RTQA 2I2XB 2XMDA 1JHQA 1IHUA 1JKFA 1MIOB 1B8OA 5G4LA 4DJJA 4DNOA 1VIAA 2JVKA 1GGMA 3T9DA 1ONSA 3AM5A 2PZFA 1ZMBA 2OB1A 2JATA 4F4HA 5KNBH 1OX4A 1P0PA 4QYWA 2WDZA 5K6AA 3WGUA 4BQFA 5LP1A 3AM4A 4NY1A 3B1FA 2Q2OA 2B1GA 2XVXA 1UAGA 3FOWA 1IWBB 3VNVA 2CNKA 5I4IA 3T5GA 1Y6JA 1SXIA 5F7ZA 3S68A 2BY4A 5AM5A 4UC0A 3S2FA 4KXXA 3TW4A 5DCUA 1V1RA 4N9WA 5DCLA 3TW0A 3U37A 3VKUA 4EDHA 4ZTZB 2AQIA 3GEHA 4B35A 5B58C 3N2NA 3RAPR 1SCQA 3UKJA 1CRQA 5FTWA 3MG9A 3W6PA 5HJ5A 3E2IA 3PWSA 1JDNA 2O1SA 2OHFA 1CB0A 1TKBA 3PIDA 4W9NC 5A4DA 2ECPA 3EK2A 4L8VA 4DCCA 1UJ6A 1JG1A 3ANMA 2OZEA 1OX6A 3G85A 3NUQA 3N5CA 3T7JA 2X6RA 4X93A 4IS2A 3ILHA 1E0DA 1PU2A 1GR0A 2HLNA 3BHMA 3ZHRA 4CM6A 3BD6A 1P31A 3Q10A 4IINA 1I0LA 2NU9A 3EISA 4RTPA 1J07A 3BH7A 4QZVA 2DBYA 2NGRA 2ROQA 4KTTE 1U8FO 1N25A 1DNPA 2E7ZA 4HNQA 2VAWA 4IJWA 4JBHA 3CSDA 1SOMA 2DP4E 4FHDA 4ESVA 2BZ1A 3GJRA 4LXIA 1D1SA 4D3YA 1M1ZA 4ML3A 4XI9A 2PQ6A 2KQUA 3F5FA 3PDJA 4QAQA 2RCYA 1KQPA 4U7DA 3WRYA 1S8OA 3M33A 3QK7A 8GPBA 3GBPA 4KTVE 1NI3A 2QVXX 2I29A 1CIVA 4FGZA 1LRJA 2PSJA 3JVEA 2C58A 2QTGA 2OPHA 3STVA 3HXKA 2A0YA 4N5LA 2F3SA 4GOJA 4UM5A 2WT4A 4XTCS 1LJLA 4AMGA 4N3BA 4ES6A 1TQ2A 4R6WA 2PS0A 1C1DB 3MWEB 2J5RA 3W2HA 1QANA 4Z99A 3UMBA 3GPDG 2NZWA 1WB5A 3RUIA 2AZMA 3ACCA 5IUNC 4U2GA 4XVQA 1DV1A 1U5BA 3U13A 4JT8A 4U2BA 3OY7A 1DXOA 5AR1A 1QOPB 1W52X 1ZGGA 2HUNA 3KU1A 1WQ1R 2VATA 3MMXA 3U7RA 2ZRAA 1VCMA 4OHUA 4EIWA 1FSZA 2GEVA 3E9RA 3TXXA 4N82A 3VKVA 1IEVA 1RE0A 4K6OA 1T2DA 1SXJC 2QYHA 1BHSA 1GPJA 2VHCA 4MUIA 5FWXA 1DAFA 3OZIA 2I66A 3OHPA 4MWSA 2A6PA 4D43A 2AG8A 4JSYA 1G3UA 1RRMA 3TBKA 4LRSB 4RF5A 3IODA 1DG9A 1Z06A 4E2XA 5KYUB 2PD3A 3K1YA 4UEJA 4WUVA 1EWYA 1VXOA 2EJWA 2XMZA 1UQRA 5JCPA 2AX3A 4KLRA 4B3HA 2FE1A 3N86A 3VNSA 2MJLA 2A3RA 3TK1A 2NTYC 1E60A 5BUCA 1DCMA 2P1DA 4OU5A 5DULA 3G9TA 5GVSA 1AV6A 4CN8A 2O1WA 4LZNA 2R6FA 3DEKA 2B6NA 4HZIA 4BL5A 1IQPA 3K9GA 1L6RA 4HX9A 1UBOS 1SNYA 2VPZA 2X8JB 3HFGA 3U9SA 1ESMA 1K86A 3T06B 3WGTA 5ICMA 1EFTA 4GBJA 3NKLA 4HQNA 4F86A 3VAAA 1MIHA 3EQZA 2X19A 1EGHA 4BFWA 5CB4A 2OWDA 3ICCA 1SQFA 4FILA 1WG8A 4JI6B 3EC7A 1CUXA 1WXIA 3FB1A 1KIMA 4I2NA 4UD6A 4X61A 1HEUA 4LGYA 4A0GA 1E6EA 4CL8A 1PJLA 3PHCA 2QU8A 1VE1A 4UUAA 1ML4A 4PHFA 5CFPA 4HDRB 4OL0A 1DRUA 4ZEVA 2C5AA 2C20A 2C04A 3RS8