1G41A

Crystal structure of hslu haemophilus influenzae
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
443
structure length
334
Chain Sequence
b'SEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTVGKEVDSIIRDLTDSAMKLVRQQEIAKNRLIDDEAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKKGEYSGADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT SHOCK PROTEIN HSLU
publication title Structure of Haemophilus influenzae HslU protein in crystals with one-dimensional disorder twinning.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Chaperone
total genus 116
structure length 334
sequence length 443
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1g41A02
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1g41A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g41A01
2JJ1A 4JL5A 1ZIPA 3LW7A 5FUXA 1S0UA 1WIVA 3ICEA 2W58A 5TDHA 3B89A 4HAYA 3FYHA 1OKKD 2FSGA 4MA4A 1TTEA 4BLOA 4F92B 4LI0A 4IFBA 1SXJC 1DVRA 2WJHA 4Q19A 1FQJA 521PA 1KI8A 1QDEA 4Y0AA 3U3JA 5J4HA 1MV5A 5L3QB 3H4JA 2CL0X 5SZHB 2J3EA 4WZAE 3WP1B 2JASA 3EZ6A 4D2IA 1CR1A 4JJZA 4G5OA 4LCBA 2ZRMA 4V0ME 4B43A 3SQWA 3Q72A 4FCVA 4XSGA 4DLZA 4QHTA 2EW1A 2BV3A 4UNQA 2G6BA 2OEPA 1GWNA 1YU9A 1KDRA 2GZDA 3MUFA 2HXSA 3FHOA 3QXJA 3WNDA 4A2WA 5EZ5A 4RD1A 1J2JA 4W9MC 2XB4A 2KNAA 2GCOA 1UM8A 1JALA 1P62B 1ZU4A 4EIWA 1YRBA 1OYYA 2H16A 1GG2A 1UDXA 2NG1A 1N0UA 2ZRGA 3CRVA 2JJ2A 3KB1A 4KV9A 4Q9KA 2R6FA 3OHMA 4PQFA 2LVQD 3AF3A 4WXRA 4B3CA 2IWHA 3IIJA 4WAUA 3N70A 4LHVA 1OTRA 4NCIA 1G3MA 1T4GA 1QHHA 2ZYVX 3QXXA 5EQTA 5EP3A 2R6CA 2YZ2A 4B44A 3V9PA 5FI0B 3SJZA 2QL6A 1JJVA 4OQNA 3V4FA 1W0KD 4V0KA 5JZVA 2F6RA 4PSKA 1T3LA 1KO1A 1LS6A 3Q85A 1ZMWA 3KW6A 2V6ZM 2IA5A 3AVXA 3CX7A 5GVRA 1ANKA 2ZJ8A 3BC1A 2H57A 4NCKA 5FOUA 1E9CA 3VX4A 1RFLA 1EXMA 4F4JA 5CIQA 2OLKA 5EJEA 1JAIA 3SJAA 1E9DA 2CHGA 1T0HB 4FW9A 3VKWA 2QAGB 3EC2A 1FX0B 4TL7A 2D74A 1LF0A 2DENA 2KRKA 1KAOA 3NIBA 4EPXA 2XXAA 1OT3A 3CX8A 3JZMA 5F9HA 1N0WA 3LLMA 5LB2A 1QBKC 1XDBA 1AS3A 4BFVA 1ZIOA 4HUQA 3G82C 4O25A 2QPAA 3LBIA 1U2RA 1PJRA 1WR1B 2OBMA 1SXJB 2B92A 1T3HA 2QM7A 1F2TA 4A9AA 4V0MA 4FMDF 3ZD7A 5DNYB 1ZNYA 3WYAA 2RHMA 2ZI4A 4ZIRA 4G0NA 2GVZC 4DSUA 1ZD9A 2QZ4A 3KUDA 3C5HA 2RAPA 2ZJAA 2HF9A 2ZRJA 5FUYA 1E2JA 2IYWA 5J40A 2OUKA 4JLNA 1AS0A 2O0KA 1G5TA 2V6JA 3TUIC 2MR9A 1LTQA 4DEYA 1UEJA 3OE7A 3K0SA 1CLUA 2OT3B 3BBPA 1UAAA 4URVR 2W6JA 2SHKA 3VU9A 2LBCA 3B1XA 3WY9A 3TK1A 3V4RA 1Q22A 2JLZA 4DBGB 3GJ3A 3H84A 3HR7A 4CT4B 1SKQA 2GXQA 4GOJA 2WAYA 3B6EA 5DI3B 5GVSA 2MROB 1KI2A 2NTYC 2OOAA 2B3TA 1OF1A 1S2MA 2WWGA 3U4QA 1G3IA 1JBKA 3UWKA 2W2TA 4N1AA 2ZS8A 4BLQA 1PUIA 5KSPA 4HLCA 3ZZUA 3OEHD 1QZMA 4QNMA 3RWMB 4DHEA 1SVMA 4WBSA 2GVDC 4KLNA 2HXYA 2VQSA 2ZR0A 3DEFA 2WPDA 3TRFA 5DIFA 3TUJC 1Q57A 2O25A 1QF9A 2C8VA 4GP6A 3IPYA 4OI4A 1ZNZA 1OE0A 3CRRA 4M1KA 3THWB 2P0EA 1OKKA 1Q1QA 2QT0A 2XNDA 3QXHA 5JSZA 4KVAA 1VYUA 4GMXA 2GEDA 4YLGA 4P31A 5FOXA 1OH6A 4FIDA 3IUYA 2K0BX 5CLLA 1SVOA 1KDTA 5FPSA 5DHAA 4AYTA 5GADl 1Z8FA 2F1IA 4A2PA 4AKIA 4A0HA 2DZOB 4LRWA 4F4IA 4GZLA 1X86B 1SG9A 2CVFA 5CJPA 4MUBA 4QG7A 4BLSA 3PVSA 2DPXA 5FUVA 4TMVA 2LVPC 4DDTA 4JVSB 2FZ4A 1Z6TA 3GP8A 2QORA 3TJZA 2AKAB 1NLZA 4BLTA 5FPHA 4OI2A 2J1LA 1Y8GA 3GJ0A 1KKMA 1R5OA 2EKKA 2RMKA 2ATVA 3EPKA 1IY1A 2GJ9A 1NG1A 3CW2A 1J70A 4HAXA 2ZJYA 1XZQA 4TYWA 3NXSA 1TQ2A 3P4YA 2RKOA 3PFIA 5TMPA 4GITA 3BH7A 1GM5A 2LKCA 1W36B 3W90A 1VG5A 1ETUA 1WE2A 1T43A 3U7FB 1OLOA 1UKVY 4HZUA 2Q3FA 3AQ4A 4ON9A 2W0SA 4PHHA 2PZEA 4P0TA 2OCPA 5KU1A 3BFKA 5CK4A 4NCJA 4DCUA 4CEHA 1BVSA 3QF7A 1HH4A 1XCMA 4RKFA 2AWOA 2DI0A 3NH9A 2ZROA 4KSCA 3VLFB 3D6TB 2I1VB 2JLRA 1I4LD 1V43A 4RCYA 4OHWA 4W5HA 4TN1A 1U90A 3Q5EA 2ODNA 3RS0A 4HB4A 4PFSA 1KKLA 2QBYA 3C41J 4OBEA 3G0HA 2KI5A 5FTLA 2QRZA 2O8BB 1WBBA 3AKCA 1E1RA 1BH2A 3IGFA 4HEJA 1PZNA 2DAGA 3VQTA 2R0IA 1KZGB 2IF2A 1UBEA 2YC2C 4QBFA 3KUCA 4KI0A 4N0EA 2QA5A 3QG1A 5BWMA 1XTQA 3MSXA 4B3FX 4C0QC 1U0LA 3SHWA 821PA 2NZJA 4Q7JB 3SR0A 4D80A 2JNHA 1DEKA 1EFTA 3LBHA 1K5GA 1YR9A 1VYTA 3QKTA 4P4SA 4IJMA 3KKOA 1U8YA 5E7JA 3KJIA 5CIWA 2ZXUA 2YNMA 3BWDD 3N2EA 1JB1A 4W5WA 2AXPA 3NBYC 4V0LA 3FPAA 2JP7A 1R0WA 4JL6A 4DKXA 4B3DA 3OIYA 3HYRA 2QP4A 4A8JB 1EFHA 4CGZA 4FD2A 2IYZA 3B1ZA 1YHNA 4NPHA 2NO6A 4G01B 4PR0A 4OHVA 4B75A 5E7IA 4C3ZA 4X8MA 5FOSA 1GUAA 2J7KA 4IFEA 2WICA 2ZU6A 2CBZA 1DV0A 1RW4A 2DNAA 3TQFA 1DAMA 3R7WB 1WRBA 4E09A 1E94E 2JDIA 4TL6A 3IEVA 4P32A 1XTSA 2WAXA 2GCPA 4F1IA 2V7QA 1HQYE 2I3BA 2DAKA 2FFBA 2QNJA 4LV5B 1EX7A 5BYJA 2QUZA 3UMRA 3QBVA 2CCJA 3CR7A 5KDOA 1EG7A 2J7PD 1WXQA 3MD0A 3O47A 1MKYA 1TF2A 5BQ5A 5CYOA 3SFZA 3GEIA 1GL7A 5FL3A 2HUPA 1WGNA 3LX8A 3TIFA 1G18A 1K6MA 2QTVB 5JBQA 3R8FA 1X1SA 3GJ7A 3TSOA 2P6RA 1D2MA 2FPMA 2MMGA 2HDNB 1L8QA 4CIDA 1KK1A 3Q5DA 2JY7A 4KBFA 2YHSA 4C30A 3THXB 1LF5A 3WBKA 4WP2A 1NP6A 2CNWD 1Q1ZA 4Z8XA 1XTJA 1A7JA 2YWFA 2G3YA 3EC1A 1Z0AA 3EA5A 2H5EA 1N6HA 3EZ9A 4RZ3A 2WZQA 5K8LA 3LH5A 2BMEA 3ZQJA 4M9QA 4MKIA 2BBTA 4DCTA 1EESA 4B34A 4JSYA 4ILEA 2CLSA 3S1AA 3AVTA 3F92A 2C2HA 3KTAA 1W4RA 2VP9A 3TW8B 1D9XA 2YWHA 1Z63A 2P2LA 1ZCBA 4ZDWA 4C0HA 4NYMR 4PC7A 4WZ6A 5TARA 2O8FB 1SVKA 3THOA 1QHSA 2ZRPA 4M9SA 3FB4A 2QEQA 3QJYA 1FOEB 3MFYA 4X8OA 4IDPA 1DELA 3GLFB 5ELXA 4RY2A 1E9BA 1SQ5A 3LDAA 2E9SA 3BB4A 1OIVA 1VHLA 2G3QA 1Q1BA 4KSBA 3EAQA 2ZUDA 4R2IA 1TU3A 4DLYA 2C9OA 2CP8A 2UZ3A 3Q3JB 3TSWA 4E5UA 2GDJA 1W48A 3W5JA 1OPXA 2WSSA 1W0JD 2QE7D 1P73A 2NO0A 1ZMUA 4U02A 3B9QA 1KY3A 1IJEA 4Z1MA 1CJMA 4M1SA 4MKGA 5DN6A 2CMKA 1HYQA 1R6BX 4B74A 1EFUB 1NBME 3DKVA 1NVVR 3KL4A 3L8ZA 1RZ3A 2VEDA 3JZAA 1CULC 4RVCA 3RLFA 4Q48A 3I8XA 4D0GA 2IYSA 2LTUA 2GJSA 1Z0IA 3DPUA 4Q7MB 4HAUA 1Z3IX 2GHIA 1XU4A 1GITA 2G0TA 2MJ5B 3WHLA 2HYIC 5EUQB 3DMNA 2FPKA 3EPHA 3EIHA 2JGNA 3CWQA 3EPJA 2XNSA 4EJSB 3A1SA 4XSHA 2Z4SA 3H4MA 1HV8A 2J0VA 2OHFA 1IXRC 1VCOA 4LC1A 4D4KA 3A58B 2JZ0A 4ZI2A 1EGAA 2ZIAA 1N6OA 5TVKA 3C15C 3PUWA 2QHOB 2C98A 2XOKA 3IDQA 2QMHA 3L43A 3LCVB 3AM1A 1P4SA 1P7CA 3A1WA 4UNNA 4TQ9A 2DAIA 1GL6A 3ZYCA 1G1MA 1ZMVA 4OJQA 3ZVRA 3KKPA 3X1YA 4TSFA 3I92A 5D3MB 3RSLA 3U60B 3I8SA 3L0PA 3PV0A 4OJKA 3RRNA 4B47A 1U98A 2QP9X 721PA 5M04A 1E2MA 3KJGA 1R5BA 4ASUD 4BLPA 2CJWB 3J81k 3OF5A 1DADA 4LYFA 2EU8A 4O0MA 1P61B 1GP2A 3SC3A 1U8AA 1E2PA 4BZQA 1HA3A 2OFWA 3SN6A 2DVWB 3DOEA 1T91A 3EASA 4URZR 2EFGA 2QSFX 3T35A 4B3XA 2IEYA 4DB2A 1E9RA 4X8LA 1I2MA 1T5IA 3M4YA 1YZTA 5AWFC 1IN7A 3P20A 1E79D 1IXSB 1YKSA 4A3VB 3MJRA 4TT3A 1OH5A 1KNXA 2QPOA 5IF9A 1VKJA 2DZNB 2B21A 4NYJR 4Q4JA 1EK0A 1NBMA 4EPYA 2FF7A 1CKEA 4XD7A 2HT1A 4KFSA 1WCV1 1OXXK 1ZM7A 3T6PA 2QPTA 2P5SA 5L3VA 2EFCB 1PLLA 2YWEA 1UEIA 2W83A 3LVQE 1FP6A 5JI2E 5EE1A 2ZUCA 3GPLA 2JAQA 1W2HA 4BFTA 1FNNA 4HUTA 1VPLA 2FG5A 3C4JA 5SZJA 2A5JA 2C95A 3HWSA 2O0HA 4QHSA 1KK2A 4LHYA 3IQWA 1P9WA 2RGXA 1Q12A 3I4LA 4HB2A 1GNQA 1E96A 5FTMA 1ZM3A 3PQCA 3CB4A 4NP6A 4XVUA 3QSYA 3KQUA 1KDOA 2OAP1 3FKQA 5L3SB 4PHTA 1QRAA 2JCSA 2ZE7A 3VTKA 3K9NA 3U2QA 3U7HB 1DARA 1VIAA 3E70C 4A15A 3BD9A 3GJXC 3PUZA 4TL8A 4KYIB 1Q02A 3SEAA 1OFIA 3IHPA 4LJAA 3CF6R 1X8JA 3K70B 4D4JA 2X77A 1ODFA 3BB1A 4G3OA 4LJ7A 3SNHA 2FWRA 2PX3A 3FMOB 1KYIA 2V4ZA 3QEJA 3QUSA 3QKSA 4A6PA 1YR7A 4MH0R 2ZI9A 2X19A 1NRJB 4CEIA 1G8YA 1CRQA 4G5QA 5FBQB 3UIEA 1E4YA 4JIMA 3LVRE 2NOAA 2F7SA 2H7VA 1KY2A 3OAAA 3QXSA 4P3YA 3QY0A 3AVPA 2QU8A 3AVQA 3VHXA 4IRUB 2FDCA 3UG6A 1E0KA 1KMHB 1DO0A 3X1WA 5L8VA 2D06A 1OFHA 3H2YA 2J0QA 1RC8A 1YLAA 1XD8A 2WBLC 2R6DA 3SOPA 1EFRD 1COWD 1PGYA 2CWBA 1R0YA 2WMNB 2HLDA 3HU1A 3KXKA 4LJ6A 2OBLA 2BMDA 5JJLA 3AP2A 3PIRA 3FE2A 1Z0FA 2B8TA 4HYYA 4MYCA 2V3CC 4TMTA 5K8IA 4B3GA 3DVLA 4CZ2A 4UJ3A 5LD2B 3U44A 1W5TA 1H65A 2WIAA 3O8RA 5J5CA 2Q6TA 3T5DA 3TQCA 1R5NA 2JJ8A 1XEFA 5C1BA 2D7CA 2QGNA 3SJBA 4QHYA 5DISB 4F7WA 4A2QA 2BCJQ 5EXXA 3WNCA 3KFVA 4I81A 2ZEJA 5FOTA 3M6AA 3QNUA 4AC9A 3MG9A 1OV4A 1C4OA 3EW9A 3P4XA 3SE0A 4E22A 2FSHA 3KKNA 4BFSA 5FH9A 3IKJA 3I32A 4P33A 3W3AA 1ZM4A 4DUGA 4QKQA 3ADCA 2CCKA 5KSOA 3RS7A 1AA9A 1TEXA 3KKMA 3BAFA 4KHZA 5FPTA 5E3HA 3FKSA 3QXCA 3B78A 3THYA 1HT1E 5C46F 2RHDA 4HB0A 1G64A 2IHBA 3QF4A 4BWYA 1QG2A 2JZ1A 1VCNA 4TZ0A 1II0A 3LFUA 2ANCA 3AUYA 4B73A 3K1JA 3K0FA 4AYXA 4JVMA 1W5SA 3K9LA 1G7SA 1E2LA 1E9AA 4QGGA 4URWR 3MGCA 5H1YA 3SHFA 3AJIB 4ZKDA 5TY0A 1BYUA 1UFZA 4Q1FA 3GLHE 4OI0A 3RANA 2OESA 2BJWA 2GA8A 3C14C 4UXJA 1R7RA 5HKKA 5KYKA 4DB4A 4V03A 4ZDKA 3RC8A 1S1MA 4HAWA 1NNEA 1E79A 1J90A 1KO4A 2ZSDA 5IK2D 3X1ZA 2HT6A 4G5RA 4MKFA 3K9GA 5HPYB 4MITA 4OQXA 1A1VA 4TMZA 4GZMA 4MYUA 2ZYUX 1GRQA 2J0UA 3C5CA 1MOZA 1FMLA 2ZRAA 3OIUA 5EP4A 2GCOB 2HYDA 4RD3A 4HAZA 4BZPA 2YKGA 2ZSAA 4L16A 4KODA 1TF7A 1XTRA 1WGLA 2ONKA 2XAUA 2CLCX 1G4UR 1T8TA 2WJJA 2ZRFA 3ND8A 2FJUA 4TLCA 1P2TA 1AZTA 3QVVA 5HE8A 5KHOC 1SXJD 2HWJA 1NVMA 1N6NA 3FGNA 4OQLA 4EUNA 4RKEA 4ERNA 1GKIA 2I1QA 1GOTA 1QZXA 3CRMA 3K0AA 1U8ZA 1NN5A 4LUCA 2QNRA 4MKHA 1OQYA 4KFUA 2DB3A 2KWIA 1QHHB 3LBNA 1FNMA 4J0QA 4QC2A 2XSZA 2YINC 3ZIAD 1XX6A 3FMPB 5JWOA 2V8OA 4A0GA 1HE8B 4IVRA 1J8MF 1G3QA 4ITRC 1A5TA 1D2NA 4L9SA 5G3ZA 5FOVA 2D3WA 3LW8A 2LVOC 1MO5A 3OEED 3PUYA 4NYIQ 4OYHA 5KPDA 2ORIA 2GESA 3KX2A 3QPWA 4X8HA 4D6PA 2AFHE 1RYHA 4M0LA 2JY8A 2GJAA 1FZQA 1R0ZA 2ZYWX 2PL3A 3IBYA 1G5RA 3WNBA 4B6EA 4ACAA 4UQOA 4LDJA 1S3SA 5HZHA 2QP3A 4K8OA 2J45A 1DAFA 2AXNA 3D3QA 2ZU0C 4LSGA 2WWYA 2F55A 2XXAB 1UADA 1N5JA 1H8ED 3PEWA 4I1OA 2W6IA 3GLHA 3EZFA 2BM0A 1S8FA 2H17A 4HUQB 4DJTA 2OM2A 4RFSA 3CPHA 3LLUA 1XD9A 1TQDA 1OXTA 4Q4HA 3CF2A 1TQ4A 4MRRA 4YC7A 1G8GA 3P27A 2DHYA 1DAKA 4XVRA 4ZIRB 1IN5A 1OW3B 4XWAA 4NBSA 3RNLA 1SKYE 1UF9A 1A2BA 2YOHA 2PCJA 4HSEA 2ZITA 2EWVA 5J4LA 4GT1A 2L4EA 4D81A 4QJ5A 1KI4A 1IQPA 1XEWX 4DLUA 5G41A 1WMSA 1KI6A 1Z6AA 3MCAA 4JLMA 4PPNA 4Q7LA 1RYFA 3E2IA 1CEEA 3CONA 1PLKA 3VU9B 2C03A 1Z08A 2QSZA 1ELOA 2QGZA 1CJKC 5FL7A 2BWBA 3ZDQA 2NZ8A 1AKEA 3IO3A 1H8HD 3QENA 2XJ9A 2IYQA 4NCNA 4ZI3A 1CUKA 2BC9A 3FRIA 1P2SA 2ZRLA 3WMFA 4FWGA 1D5CA 1E2DA 1IAQA 4PC6A 1MO4A 2QN6A 3NEYA 3U4QB 1Z0JA 3B60A 2REXB 2C96A 2IC5A 4BPBA 3SQXA 1CXZA 4JSTA 5BN3A 4BRWA 4GPTA 2K9DA 1ZJ6A 1QHXA 5HE9A 3GLGE 1FQKA 1NF3A 2AL7A 4AKEA 1DG3A 3V00A 2XJ4A 1KZ7B 3CKLA 4QFMA 4KU4A 5KPJA 1Z29A 2XB2A 1N5LA 1G8FA 3TUZC 4FMCB 1W36D 2GZAA 1US8B 5JECA 2B7BA 3AKDA 5JSZB 1HEIA 1I4TD 4RD6A 2QROA 2PX0A 3SYKA 4UNSA 2P6UA 3VNVA 2FU5C 1Z47A 1E2QA 4UKDA 2J87A 2WKPA 3SBDA 1X3SA 3N2IA 3W5IA 1ZCAA 4I99A 3GFPA 3TH5A 1XJ0A 4AY2A 2B7CA 4JMPA 1WA5A 1IXZA 3HJNA 4LWZA 4MRSA 2QRNA 2BBSA 4P4TA 1I2DA 1RE0A 1D6JA 4JLKA 1R10A 1ZD8A 1ZVQA 4KCGA 2FNAA 3F8TA 4IOKA 2R9VA 4EPWA 2O8EA 3BERA 3VX3A 1G21E 1JECA 3ZQ6A 5GJVC 4C0KA 4TL9A 5CM8B 5K8TA 4DCNA 1A82A 1DAHA 1QHNA 4HI0E 1X8LA 1M6NA 4KJZA 2A5GA 3RHFA 5EXPA 1DOAA 3AV0B 3NC1C 1G7CA 1ZAKA 3T1TA 1HY3A 1OXVA 3FTQA 1E32A 2YVUA 1NSFA 1TAGA 3T1OA 1S4QA 2HV8A 3B1YA 5EE3A 2QMUA 5EP2A 2GF0A 1RRFA 2NGRA 4TLBA 1Q1EA 5LDDC 1UKZA 2VHJA 5B57C 4OK5A 1XZPA 1YE8A 3QE0A 2XITA 2IWRA 2V6IA 5KSZA 1LS1A 3B1WA 4B76A 2IS4A 1QHIA 1IN6A 4BFWA 2WWWA 1E2FA 5AJWA 2FV8A 1E99A 3U6BA 3IQXA 2V1UA 3T15A 2YC4C 4DIEA 5J4VA 4ZCMA 5CK5A 1TTTA 3GLGA 2FSIA 2CDNA 4LBZA 1G3UA 4U5XA 2YOGA 5JWHA 3GLIE 1XMVA 1Z07A 1ZYUA 2HJVA 2ODBA 4JKYA 5DI3A 3FE3A 1YZQA 2BMJA 5FR1A 1M7HA 1D9ZA 2IS2A 2JIZD 1R4AA 1OIXA 5EZ6B 2OBNA 2FFAA 3ZD6A 3AP1A 3R8CA 3H1TA 1QVRA 2QBYB 3P1JA 4DC9A 3KQKA 3TLXA 3QBTA 4DWJA 4JLAA 1RVDA 3WMEA 4US1R 1P60A 4TYNA 5EXTA 3TVTA 3VR4A 1L2TA 4A0RA 5JS7A 1U0HC 2EKFA 1NVUQ 1W0KA 4FINA 4TQAA 4KITB 4DCSA 2K5UA 1XWIA 3PEUA 4US2R 2IL1A 3UKDA 4A36A 3ZLJA 1Q3TA 3T12A 2BM1A 5E7MA 5IRCD 2B6HA 3TAHA 2CE2X 1OXSC 1NIJA 1II8A 4YMTA 2BEJA 2IYVA 4ESHA 1NI3A 4IDHA 4NH0A 5BXQC 3LD9A 4MYTA 4E03A 1CBUA 3WRXC 4MDFA 1JJ7A 5AJZA 2FH5B 4PZZA 2G88A 5LPNA 4ZCLA 1VG1A 3DM9B 2QY9A 1HT2E 3QKUA 2RH5A 3O8DA 2JLWA 1VEGA 1KO8A 2GXSA 2L4FA 1LY1A 2VP4A 2WWHA 4Q01A 1ZUHA 4TTQA 2GJ8A 4IOMA 3U3RA 1XBTA 5FI1B 3HR8A 4G5GA 1E3MA 4LPSA 1WDTA 3DMDA 2IXEA 3DOFA 1B23P 2BOVA 3E21A 1NJGA 1GIAA 3RYTC 3AEZA 4FWHA 1VTKA 4C4PA 4KO8A 1BOFA 1GL9B 3MJHA 3OZXA 1S9DA 1II9A 3FRHA 1S3GA 2YYZA 2C78A 3EZ7A 3HP1A 3IEUA 3SYLA 1Q20A 4ZV4A 1LV7A 3GLIA 2H18A 2OFXA 5FPKA 3MWJA 4HLQB 4JLDA 4M4SA 1VIYA 3N5CA 1YR6A 3ZZ0A 2ZAOA 4HDCA 3GCGA 4PANA 1IY2A 3UMSA 4ZCIA 2JY5A 3DL0A 3AF4A 2CHQA 5IT5A 2WTUA 2JLUA 1PUJA 1JNYA 2VIIA 4O3MA 2QQEA 5AUQA 4D82A 1XXHB 4ESVA 3OFND 3NTUA 5HCNA 4YMVA 1RRCA 1U9IC 3OEHA 3S1AB 1UJ2A 4GFDA 1KI1A 2VP5A 3KTAB 5JLJA 4HAVA 2GBLA 2C5LA 4QRHA 1OKSA 1R0XA 4PAQA 2WOOA 1R8SA 1IY0A 1E2HA 1OB5A 2KNVA 1P9NA 5FPYA 5JHGB 2O8BA 4K46A 1E6CA 2FX3A 4RD2A 4Q1BA 1DS6A 4AKHA 3GJ4A 3VR5A 1VG8A 1OFTA 1XJQA 4LYHA 3T61A 3VR1A 1OHHD 4F2LA 3LQQA 3AVOA 2MMCA 4RD0A 5DSZA 4DT1A 3G5UA 2XTNA 3W8RA 4C7OA 2O8DA 2A5YB 3ZGXA 3NKVA 3I5XA 4QM6A 2G77B 1L4UA 1G17A 1G20E 2HCJB 2VH5R 4V0NA 2DFTA 1SVIA 1SVLA 4RJLA 2CK3D 2RGAA 1TU4A 4NONA 1MT0A 4JBXA 1G8HA 4UNPA 4QOSA 3BXZA 4W7SA 1SVSA 3U3MA 1KK3A 5D3QA 1P3JA 1YVDA 2JIZA 3L0OA 3P32A 2JLXA 5JHHB 1E4VA 2XZPA 4V0OA 2Z6VA 4HLUC 3TNFA 4EPVA 3RWOA 3I1FA 2ZJBA 5JI3E 2IXGA 1MABB 2Z43A 1G3RA 3AVUA 2NMVA 2YJTD 3B85A 2NQ2C 3BOSA 1CJVC 4FMCF 1JR6A 1XF9A 2IYLD 4LY6A 1JR3D 1X1RA 2JLYA 1N5KA 3LA6A 3ECCA 4RCZA 1YZUA 3W34A 4D0NA 1XCPA 2ORWA 1GRRA 4LYJA 1TL7C 2ZR7A 2AR7A 2OCYC 3AF1A 4W5JA 3BJIC 3CPJB 4CT5A 5KTYA 3HPQA 4N0DA 5AJXA 2BMFA 2FOLA 1D2EA 1NL3A 1ONBA 2G1JA 5UKDA 4OI1A 4GL2A 3AUXA 3JVUA 1MO3A 2G83A 1KI7A 4L8GA 1VEJA 1VQ1A 1FUUA 3AF0A 1P72A 1W4BA 4BUJA 2Y8EA 4I1SA 1XPUA 2VSOA 1S1CA 1MRNA 2Z0MA 4RZXA 3K70D 3BIFA 2ZUBA 4S35A 1HUQA 4Q5IA 4U00A 3MRSA 2WJGA 1OIWA 4PC3A 5FBWB 3UANA 3Q8XB 1WHCA 3SS8A 3UK6A 2WWXA 4Q4JB 4E07A 3UXMA 1T3SA 4XWKA 2VSFA 2ZRHA 4JLVA 1XP8A 1VECA 2QQ0A 3C7KA 2H5XA 1G9XA 1G4AE 2A5FA 4M53A 4QBHA 1AGPA 3CH5A 4AURA 1U9IA 5B64A 1G19A 1NY6A 1AM4D 4CEJA 2QTFA 5B30A 4QNRA 3DM5A 4XIGS 1NVWQ 3TBKA 4XTCS 1IFYA 3A4NA 1OAIA 1N3BA 4OK3A 4A82A 3I3SR 3K8YA 2W00A 621PA 3EG5A 2ZJOA 5AJYA 3I61A 1EFUA 2Z5FA 3KZ1E 4I4LA 3NHBA 2GETA 4PHGA 4XH9B 2RB4A 1JEEA 1ESNA 2KBEA 2Q3HA 5JJIA 3OFNA 3FVQA 3T1QA 4AI6A 1KJWA 1XMIA 2ZRIA 1HURA 1BKDR 2ODEA 1N6PA 3F5FA 5CDFE 4YMUA 2OO7A 1CU1A 4DDUA 3KXIA 2J7PA 4HLDA 1P5ZB 1UKEA 3ADKA 2C77A 2BDTA 3L2OB 3ONWA 2GAAA 2J9RA 2FSFA 4JL8A 4YMSA 1F2UB 3A6PC 1KOFA 1EX6A 2OSBA 3BS4A 4ARZA 3QKSB 2VSXA 1N5IA 2FN4A 2Q21A 3NBFA 2IW3A 2ERXA 2WKQA 4Q4LA 4DEXA 2JLVA 5G40A 1KGDA 4IDOA 3X1XA 2JLQA 2WJVA 4M1OA 1NMZA 4XVQA 2ZRCA 2UZIR 4CEIB 3GJ5A 2KB0A 1ZD1A 1ZMXA 2XZLA 1JEDA 5FTNA 4D26A 5C18A 5H68A 1T0JB 1OHHA 2CNWA 1E2NA 3R20A 1YZKA 2VF7A 4FN5A 4JLBA 2C99A 3WRYC 1GZSA 1MR3F 4QJ3A 3EIEA 4OHZA 5IHPA 4G3XA 3D31A 2AK2A 4HLUA 2IHYA 4R71A 4PZLA 4NDZA 3RS3A 3E46A 2BIFA 2QMEA 2VHUA 4Q03A 4TQUS 4UN2B 2A78A 3IHWA 4AKGA 2A7QA 1R8QA 1XEXA 3WP0A 2VTKA 3NDPA 4WW0A 5KDLA 5AUPB 2IYXA 2JLSA 1RJ9A 4Q66C 1G6OA 3AP3A 3VFDA 2Q9AA 2BHRA 3U44B 2Z4RA 5BN4A 4NU0A 1P9RA 2JEOA 4ZKEA 5FBRB 2R62A 5B2ZA 3ZVMA 1BYIA 2F43A 2LWIA 2DFKB 1ZBDA 3CNLA 1E2GA 4MQBA 4Z51A 1IXSA 3IHLA 2D2EA 2BVNA 2DYKA 5EE9A 2REOA 4Q4AA 1N6IA 4WXPA 3W6OA 2VHQA 2ATXA 1F6BA 4PSVA 4Q9HA 4D4MA 2X1VA 1W0JA 2QE7A 2ZSEA 3OIVA 3PXGA 2GEVA 3DHWC 4H9GA 3GD7A 2WV9A 3ZJYA 1JR3A 3CRQA 2RGEA 4QGFA 5CDFA 1EFCA 2IUSA 3THYB 4WOPA 1XMSA 4GP7A 4C2UA 2ZVPX 3QF4B 1C9KA 5FOWA 3QKRA 1Z0KA 4M1YA 3RAPR 3CF0A 2WSMA 4GRAA 3ZZTA 2XGJA 3TSZA 2CL7X 3LY5A 1Q21A 4A0FA 2NO9A 2KNZA 3VAAA 1W1WA 4MUAA 1E9FA 2QENA 3FDIA 1K8RA 1GVNB 2O52A 1F60A 2PEYA 1S96A 5C2JB 3FOZA 2D7DA 4IOLA 2ZRDA 1XEWY 4MGZR 2MGWA 5TB5A 4JT4A 4BRUA 1DAEA 1KAGA 4IVPA 2R6AA 5FR2A 4B48A 4LPKA 1DAIA 3DZ8A 4TMXA 2PT5A 3ADBA 1DAGA 1C1KA 2AD1A 2FEOA 1FTSA 3K53A 4QGAA 4LJ4A 4YMWA 4II7A 4RZ2A 1NN1A 1MO6A 4EDHA 1N25A 2F9LA 2O5VA 3FWYA 3HU2A 2J0UB 4M21A 1KJYA 2IXFA 2ZR9A 4PC1A 3IECA 4DDWA 1QG4A 1LFDB 3AH8A 4PAOA 1NG9A 4ASUA 1W4AA 1JQJC 4Q9IA 1N6RA 3HU3A 2WJIA 1NLFA 1AQYA 3R9WA 1AQUA 3I62A 1HTWA 1SHZA 4EQ6A 2ECKA 2ZRKA 4JVNA 2J41A 4MGKR 4PO1A 4DSTA 3K0AB 3PENA 4B33A 4JBYA 4AG6A 4IXNA 2F3RA 1GNPA 2IYUA 2UKDA 4UJ5A 4MGYR 4BE7B 1CRPA 1KI9A 1XB2A 2ZTCA 2R2AA 2VHTA 3B2EA 1XD2A 2OCBA 3ETLA 1YZGA 2WVJA 2EQBA 3F3YA 1W47A 3OE7D 2PMKA 2W6JD 4PX9A 3ZH9B 3ASZA 4LJ8A 1GTVA 1VCMA 3K0EA 3VKGA 3CNNA 2IYTA 4LV8B 2JUJA 1WQ1R 3AKYA 1E69A 2J5XA 1FW6A 3LXRA 1CJUC 1R2QA 4PQYA 2O8CA 2VYFA 1W4CA 1ZV1A 3RABA 2MSEB 2A30A 2KE5A 2H92A 1CS4C 4GOXA 4WIAA 4DLWA 2FGKA 4TYPA 4FI3C 3GLHB 4M1MA 3CX6A 4A4DA 1NKSA 4DSNA 2EJSA 3B8HA 1WF3A 2PT7A 2QAGC 2VP6A 2ZREA 4IEIA 3AVVA 2YOFA 4LX0A 1M1YE 4Q4HB 3KQHA 1OH7A 4P4UA 3SU8A 3KQNA 2PJZA 2WPDD 1I4DD 4JN6A 3K09A 1G5PA 2H1LA 4QGHA 1OSNA 4MGIR 4DZZA 4PC2A 4C0LA 3LO5A 3QVUA 2XNDD 4L9WA 2DBYA 5L3RA 3UATA 4V02A 3VR2A 3BGWA 3PEVA 1P2UA 2ZE8A 4GDFA 1QHYA 2DFLA 2GWHA 4C2TA 3RDPA 4F93B 1KI6B 2JATA 2HCBA 3EWSA 4Q1CA 2IF0A 4BECA 2EVWX 4XJXA 5EE5B 3CH4B 3L82B 3QI2A 3EARA 1CIPA 1KK0A 3K0CC 4OK6A 3AGQA 1Z83A 4QBIA 4JLPA 1T8UA 2VHCA 4H1VA 4MYHA 4LRTA 2FGJA 1DPFA 1NIPA 2ZRBA 3NDBB 1RPZA 4LYAA 4FWIB 4WA7A 1E1QD 5EUMA 4HDQB 3TW4A 2DAMA 3KQLA 3ZVLA 3JVVA 4D25A 1F2TB 1EFRA 4GI7A 4EKDA 1COWA 3A1TA 1DE0A 2FFQA 1J99A 4O2RA 5JCZA 5K8UA 2ZE6A 1CTQA 1IBRA 1XTKA 1AN0A 1CF4A 4DLRA 3U7EB 1UBFA 4BASA 3ICQB 2DZLA 4DCVA 1O87A 1TUEA 2P6NA 2VRWA 3GQBA 3KKQA 5TV2A 2G9NA 2EYQA 4NYMQ 5L3QA 2CEAA 4KBGA 1BS1A 4Z54A 4M22A 3OESA 5JMTA 4RZUA 5J4YA 5SZIA 4Q21A 4B2LA 2PH1A 1M7BA 2X2EA 3TR0A 2A2ZA 1SXJE 1NSTA 4UXHA 3PEYA 3IILA 4K81B 4TYYA 1O3YA 2CE7A 3B13B 3MHVC 4PZYA 1ZUIA 3BH6A 2RCNA 2BJVA 1E9SA 2EWWA 2QI9C 1IJFA 3TE6A 2GK6A 1KHTA 4MDEA 2L2DA 5DHFA 3W3ZB 5H8WA 2ORVA 3A4LA 3A1VA 3PR1A 5DE3A 4AG5A 3BRWD 3E1SA 1TUIA 1UKYA 4L5BA 2F1JA 1C7YA 1SKYB 4GBMA 4UXIA 4HEOA 1W49A 3CWZA 4PTLA 4AWXA 2O8EB 1NVVQ 1OB2A 3CNOA 1IM2A 1OH8A 3R9XA 4OKSA 1KDPA 1TF5A 4NCHA 4NTZA 4Q18A 4BFXA 1KI3A 2REBA 1TMKA 1VEKA 1EWQA 5LBIA 1E1RD 3TAUA 2WKRA 1TNDA 5EP1A 3ADDA 2E1RA 2IYRA 2R8RA 1L7VC 1RRGA 2ZI6A 5A0FA 2FMXA 2GEUA 3GMTA 3CO5A 1SVWA 1CR0A 1PV4A 1TR8A 4LZZA 1G7RA 4OHYA 5FTKA 5IK2A 1AJEA 1E0JA 1E0SA 5JEDA 5KNDA 2HEIA 3LX5A 2IK8A 1A2KC 2QAGA 4DXAA 4L4UA 1FX0A 2GKSA 4DLXA 1W36C 3GLGB 4PSAA 1F4IA 2WZJA 1GDDA 4OQFA 2XTMA 2D4HA 1Q44A 1ZC3A 3CBQA 3I73A 3FHTA 4CYMA 3U5ZB 4JS0A 2C9CA 1P6XA 1SXJA 1Q3HA 2PLFA 3NBXX 5H70A 4B71A 2JDID 3BE4A 3CPEA 3X1DA 5CM9C 2OXCA 2ZSBA 2D62A 4U7DA 3A8TA 2V7QD 2ZE5A 2N46A 3EZ2A 2IUTA 4CDGA 3U7GA 5GJWC 3ZIAA 3LWNA 1CP2A 4B32A 3QEOA 1FTNA 2PEZA 3K0CA 5C4MA 1GSIA 2ASEA 2GBLC 5IDVA 5DH9A 4HZUB 1X6VA 3IIKA 3E5HA 2J59A 1N6KA 5CJ2A 3OEEA 1IOZA 5E95A 3NVAA 3K9HA 1JI0A 3LV8A 1US8A 4CEHB 4NYJQ 3T1VA 1HE1C 1D8TA 1KNQA 4BGDA 2WIBA 4IHQA 1II8B 2F1RA 4BEJA 1PVOA 1N6LA 3RRZA 3GJ6A 5FFMA 4AIIA 4PHFA 3W6PA 4LJYA 3A37A 4WVFA 2QSYA 1Y63A 1P2VA 2AWNA 4GSYA 5HR5A 4OL0A 3AGPA 1NN3A 4M2LA 1H8EA 1JXOA 1QVAA 5GJCA 5DI9A 4TLDA 4AK9A 1BIFA 2GTPA 2NIPA 1T6NA 2AD5A 2V55B 5DYGA 2ZPTX 4PAMA 4Q02A 1ZRHA 4B3BA 3KFXA 4N3NA 3C8UA 2VPPA 1W7AA 1E1QA 2DWQA 5KUTA 3H86A 2IUUA 1KTVA 1AKYA 4A8JC 3BBZA 2WOJA 4MRNA 4CRWB 1IHUA 2Q9BA 5JCPA 2GF9A 2MSCB 3IIMA 4G5SA 3O8BA 3THWA 1KMQA 1LVGA 3AVYA 1JPJA 1M8PA 1G8PA 4P4SB 4TLAA 2FE4A 2VP0A 5FUWA 3EA0A 3U3OA 3CM0A 1FP7A 4PO9A 4TTPA 4ABYA 4BQSA 3I5YA 1EWRA 4XWOA 2ZQ5A 3VNUA 4H1UA 1OXUA 3Q7QA 1U0JA 3GLIB 2XEXA 4EPRA 3B9PA 2LVAA 4KFRA 2WSSD 5J4KA 2QAJA 2BBWA 3BH0A 4CF7A 3SI7A 2KHHA 3IPXA 2TMKA 5BN5A 4QM7A 3EXAA 2BKEA 4Z1MD 1H8HA 3PUVA 1BMFD 5DN6D 3AF2A 5JJKA 1JQLB 2RGNC 4TMWA 3W9YA 4NKRA 3CUEF 2DHRA 3KJHA 3FMFA 3Q7PA 4LOAA 2FEMA 1BO6A 1M7GA 3WYFA 1V92A 1NLYA 1ZC4A 1E9EA 2A3RA 2OFOA 3WHKA 2P65A 4M8NE 1YZLA 3EWAA 3I72A 4B35A 4TZ6A 2G1KA 2WWFA 2ANBA 3U3KA 2QTHA 1G41A 4YXWD 1LB1B 2CCGA 4IOJA 2F9MA 4XTRA 3SDZA 4B2PA 1VHTA 2O0JA 2EFEB 4GOKA 1ZU5A 2ZJ2A 4LV6A 1XXHE 1XMJA 5CB8A 1V5WA 5JWRA 4JYBA 1ZINA 4A1FA 2XOKD 1W2GA 3C16C 1WP9A 1U81A 4HDOB 3ZS8A 3MWYW 4F91B 2X8AA 3VR3A 1T9HA 1NMXA 5BW8A 5F98A 2OV2A 2F1HA 4ACBA 1ZUNB 3M1IA 4DT1B 1UFQA 2VF8A 1IN8A 1KSFX 2L0XA 1OJLA 2IYYA 3GEEA 2CL6X 4R2HA 4BLRA 3SZRA 4TSFD 3D8BA 5JS8A 4C7OB 2O8DB 3VMFA 1P75A 3WMGA 3KJEA 4Q1EA 2ZYTX 4JLJA 2GK7A 2VA8A 2DCUA 4MRPA 3T5GA 1XPOA 1KO7A 3Q9LA 3TMKA 5KNCA 1NMYA 2IT1A 4TTRA 2GAOA 2ZTSA 3SFVA 3TKLA 1IONA 4YONB 3RS4A 3UWOA 3CIOA 1QZEA 3GFOA 3RS2A 3TVDA 5G53C 3T34A 1ZW6A 3SJCA 3RRYA 1YJ5A 4OHXA 2F3TA 2XTZA 1M34E 1KJZA 1X37A 3K9OA 2FA9A 4TT3D 1WBDA 4NYIR 1MH1A 4IXMA 4Q7JA 1TX4B 2C04A 4LHWA 2Q3MA 121PA 1Y3AA 2NO1A 1NBMD 3NC0C 4XD7D 2A9KA 3WYGA 2JY6B 4KLZA 4JKIA 4NZYA 4AYWA 1YRAA 4IW3B 4R9UC 2X2FA 2RRUA 2PZGA 3GEHA 4RFVA 4M9XA 1KSHA 1UBCA 1VYVA 3T06B 4L15A 3GLFE 2BCGY 4EJSC 4ZDIA 4B6FA 4A8JA 4S2EA 2ZI3A 1M74A 4PQRA 4DLSA 2XX3A 4IKEA 2LVNC 2VO1A 4HB3A 4R98A 4JT2A 4Q9JA 1RKBA 2NPFA 2VL7A 2OOBA 3R7WA 1W46A 2OILA 3A4MA 4EPTA 4BFZA 2ZJ5A 5F2EA 1M2OB 1XXHA 3NWJA 4NL4H 2VBCA 1SHKA 2Z83A 3PITA 1XRJA 3UMFA 3DO6A 4LGMA 3KDSE 4Q47A 4LJ5A 3OIWA 1HJPA 1U99A 2C9YA 4EFMA 1FMJA 1Z28A 4MRVA 2RGBA 2QT1A 2IS1A 4HATA 1TEVA 2RGNA 4DBLC 2PLRA 1YZNA 1G6HA 4EFNA 4Z8YA 5E4FA 3B1VA 1R4GA 3MLEA 3MAAC 1GAJA 3THXA 4JYCA 1Z22A 3CR8A 1C1YA 3OAAD 2ZTDA 3MWKA 4Q9LA 1JPNA 2YWGA 3FFBA 3QIAA 4CEJB 3H0KA 2KJQA 1HQCA 3QPVA 4NHOA 1DTSA 1A4RA 2W2XA 4Q7KA 3F0TA 5AJVB 4C0JA 5AUOB 5B58C 1XFAA 2AN9A 2PMDA 3FHCB 1Q0UA 1L4YA 2HAKA 1BMFA 2IEZA 1RIFA 3P26A 2CLDX 4FXPA 2QM8A 4C0AC 2DR3A 3CLVA 3PG5A 4LK2A 1XPRA 5TXGA 1NV9A 4LHZA 3FMIA 1OFUX 2HLDD 4A6XA 1YQTA 2ZM5A 2R44A 1FFHA 3SYNA 2Q9CA 4M9ZA 1TADA 1CR2A 1MRSA 2E87A 3QOFA 3LAWA 3WXMA 2O8FA 1XJCA 3CZQA 4Q00A 5A4JA 8OHMA 4D0LB 5FTJA 1VDZA 1Z6XA 2ONJA 3GLFA 3QPUA 1KSJA 2LCFA 4UNRA 2P5TB 5CB6A 3X2SA 4D4LA 1GNRA 1S9HA 4QXAA 1TPZA 3RSOA 4ARZB 4YXWA 4GMDA 4YQFA 1CR4A 1OYWA 1MABA 2QMOA 2GZHA 2W0MA 1Z2AA 3K70C 4DUGD 1XCGB 1KO5A 1UPTA 1VG0B 1F3OA 1F48A 2WWIA 3PUXA 2A5DA 3REFA 3FKSD 4RSGA 2IX3A 2GXAA 4TWZA 5DLQC 3RVBA 5KDDA 3M0EA 2GNOA 2QG6A 1X8KA 3TR5A 4R7ZA 3REGA 4C0BA 5A5GA 5AR1A 4DSOA 2J46A 1ESMA 1GRNA 2DWZB 4URXR 3VKHA 1AGRA 2AKYA 1JR3E 2ZAMA 1LW7A 2GRJA 2JA1A 4KAXA 1N0VC 2RGGA 1U94A 2LKDA 3EIQA 4KXFB 5F3WB 3R9IA 2RGCA 2ZRNA 1XEXB 3HYTA 421PA 1NV8A 4I1UA 2J0SA 1G7TA 2V9PA 3RS5A 1RJ9B 2ZANA 2NO7A 5FBLB 5EE0A 2P67A 3BK7A 2GJKA 3U6KA 4TYQA 5HCIA 5GJBA 4EJSA 2HF8A 3LRPA 5EXSA 2ZI7A 3DKPA 4Q1AA 5HKKD 2F43B 3NEJA 1K5DA 5JEEA 3ZVNA 1DO2A 4AD8A 4ZPXA 3KXLA 4OQMA 4Q4AB 3L0SA 3LNCA 5KO2A 3IO5A 1AIPC 2CVHA 1AZSC 4LBWA 2YV5A 4PPGA 1E2KA 4O2LA 4CW7A 5LD2C 5KNBA 3QQ5A 4FWTA 4LRSA 1E2EA 1NVXQ 3D7MA 4FCTA 4IVQA 3NG1A 2ZS9A 1E98A 5LB4A 4B2IA 5D3MA 5KSYA 2WMOB 2JJ1D 3TGPA 1N2CE 3AB3A 2V54A 1T5LA 2I4IA 4WZBE 2CJWA 1XTIA 4FMDB 5JRZA 3QKRB 3BFXA 2CK3A 3LQRA 1B0UA 1G16A 1VG9B 1VDLA 4BEBA 5CITA 1ZM2A 4Y0VA 2DAEA 1Z2CA 4LC0A 3KB2A 1KIMA 1UDWA 1WB9A 2XSZD 4DIDA 2FPLA 4PXAA 1PLJA 3GJ8A 3CRW1 3UPUA 2MSDB 1LNZA 5CYPA 5SZKB 5DYIA 1KSGA 4CVNA 1Z0DA 4FCWA 3K09C 2R6GA 1FL9A 3MWLA 2ZJZA 4A92A 4F38A 4URYR 1GFIA 2ZS7A 4JVLA 2EFHB 4PO8A 3PJRA 4QL3A 1UBGA 3AKEA 1RRPA 1F2UA 2PZFA 5DFLA 2DWPA 3WBJA 4BZXA 4RD4A 3L8YA 4G1UC 3FFAA 4HZIA 1MN3A 5F9FA 5DO9A 5BYKA 4I1VA 2BWEA 2JJ2D 4TMKA 4EFLA 1Z6GA 4US0R 4C9BA 2GXUA 1FUKA 1Z5ZA 2KBFA 2W6ID 1J7KA 3K0FB 4NMMA 4ZO4A 3U61B 2N42A 5CLQA 3ND9A 3AVWA 2CXXA 1WJ7A 4M1WA 4ZDJA 1W44A 5L3SA 1TQ6A 4YDHB 2OO9A 1J8YF 1VMAA 2BKUA 4EQ6B 2IS6A 1JAHA 5DGXA 2GILA 4KFTA 3HDTA 3ASYA 2OAQ1 4LJ9A 1E2IA 2KSQA 2VP2A 2V1XA 2RGDA 2H8KA 4IEEA 1XB2B 3LCUA 1GKUB 2NPIA 4EAQA 1XD2B 4F4CA 1IN4A 3EX7C 2G0NA 2OZEA 4URUR 2ODWA 4BFUA 5FBVB 2OCAA 1G291 1ZNWA 2DFNA 1YR8A 2ERYA 2WJYA 4GNKA 4PPQA 4QJ4A 6Q21A 1GKYA 4IDQA 1Z6YA 3B82A 4JZKA 4NE2A 3PCRB 2CHVA 2FFHA 4DDVA 4QBGB 2ZSFA 4DRZA 2DKLA 5FL7D 2N1BA 1XNJA 1QHGA 1NJFA 3B7GA 2EYUA 3HPRA 2XZOA 3O8CA 2UVQA 5AK0A 5AUNB 3CZPA 4IDNA 2O8CB 1KMHA 3MMPA 5J47A 1SULA 2AX4A 3RC3A 3ZS9A 2DY1A 1ZM9A 4TLEA 1T6OA 3VHLB 4DVGA 5KOYA 1SZPA 1ZNXA 4FMBB 3BFVA 4LBYA 1VCIA 5C4GB 2AFIE 3BORA 3W8NA 3NHAA 3K9PA 1GILA 5JFGA 1DG1G 2BWJA 4Q1DA 3L0IB 1SGWA 1Z06A 3IBGA 1NN0A 2AK3A 3QG5A 4M1TA 4DLVA 2OXRA 1AIPA 1JXMA 3W6NA 3B5JA 2Q0HA 3LXXA 3BB3A 5ANRB 2P3SA 4JJKA 1P3QQ 5P21A 1NKTA 1E0AA 4JBWA 4LHXA 5G3YA 3SBEA 4FWDA 3DZDA 4KYUA 4XOIA 2ZETA 2ZVQX 3GFTA 3NH6A 2IBMA 4KVGA 2HJGA 4LBVA 4YDSA 4PPFA 2OLJA 221PA 2WHXA 3DDCA 2VLIA 5HTKA 3RRMA 1NY5A 2W2VA 2WM9B 4BFYA 2GCNA 1AK2A 1FPMA 2D2FA 1AS2A 4GEWA 4C0SA 2AHOA 1GO5A 1CJTC 2R65A 2DWOA 2ZI5A 4JLOA 3VR6A 4DLTA 3EPLA 1DBSA 5JRJA 4RFSB 2EFDB 3A36A 2B8WA 1F5NA 2OG2A 2BEKA 4POAA 2PCLA 2FZLA 2BBOA 2PBRA 2OE2A 3NBZC 5HZKA 3A1UA 1ZP6A 3UG7A 2PJRA
chains in the Genus database with same CATH superfamily
4B7GA 2JD0A 1S0UA 3HVIA 3FF4A 1CLEA 3IVMA 3KQYA 3LUPA 4BL5A 2NUBA 3JS5A 521PA 2OO3A 4L5AA 1LQUA 2CL0X 4ZI7A 2C9DA 4RVOA 2DY0A 2EW1A 1R6TA 3R5FA 1EK2A 3QBDA 2UVPA 3N8DA 2R6R1 4ZZ1A 2AZTA 1HYEA 3R9XB 4LHVA 1SCKA 4C7JA 1QHHA 2ZYVX 1YSCA 1UZLA 4PSKA 3HYCA 3Q8GA 3L6OO 4KQIA 3Q85A 1FTQA 3RASA 3S7ZA 2IA5A 2O2YA 4OW0A 4NSNA 3SYRA 2Z04A 5ITWA 2OD7A 1FX0B 5IDYA 2DENA 3FZNA 4YA6A 2BNKA 5F9HA 3LLMA 4BFVA 1ZIOA 3MB8A 4O25A 1VGRA 1YONA 3P2MA 4CFYA 3ZDAA 1EE1A 3H2GA 1CE8A 1L4KA 2VAMA 3DOUA 3BWVA 4CXMA 2AR9A 3OKPA 1Q2XA 4FFLA 1GSOA 3IB6A 2RARA 2XWBF 3DLBA 2B3TA 1JBKA 2W2TA 1CQJB 4ND4A 4MWGA 1K5PA 5KC9A 2W6OA 1B76A 3HX3A 1CEXA 4UU0A 1QUFA 2GVDC 4YLEA 2OCLA 3S40A 1C8BA 4KVAA 5SY9A 1VYUA 3KOYE 3V80A 3GD5A 3KOZE 5FPSA 5DHAA 2GO1A 4AKIA 1Y6GA 3IEXA 4P93A 3NGLA 3A45A 3OX3A 1NJ2A 2X5XA 4D8UA 2X9VA 1Z75A 4FGUA 3TBFA 2RGRA 3BL8A 2RI1A 1T8WA 1OBHA 2LRHA 4I4TF 2XTJA 5IM5A 4OVZA 4ZARA 2P3OA 3R3JA 1DBQA 5ALTA 3EVZA 4MNTA 4REOA 3QMWA 3CUTA 3WL5A 2ZROA 3HJCA 4N48A 2H63A 4KZKA 1UZUA 2VHYA 1SUIA 4K9LA 2I8AA 4ARUA 2JGRA 3AKCA 2J6BA 5JADA 4G1MB 3K5HA 1MQ9A 1VMKA 1YR9A 4BNTA 3JRXA 2JP7A 4BAZA 2J0EA 1KYQA 4TSRA 2YHBA 2NO6A 1GXSB 4BE9A 1XZBA 4JGIA 3LY7A 4W9NC 4D98A 5BXYA 1AQJA 4GZ3A 1QAQA 5H16A 1U3UA 1USUA 1CQZA 2BEVA 2R5FA 2JIQA 3KYDA 5JMOA 4PPYA 4K9MA 4Z8XA 3KJFA 4ZOBA 4RZ3A 2DRIA 1JQBA 1P6UA 2CLSA 3AVTA 2YTZA 3TXYA 3AFIA 3RSGA 3ESBA 1N2IA 1QJ4A 4PC7A 5TARA 3SOZA 1MG5A 1SQ6A 3UF0A 3Q9SA 3MAGA 4RADA 4EG7A 3B9QA 3DUFA 1L8AA 3GBSA 5JY6A 2ATEA 2R8YA 3IOYA 4COKA 4UDYX 3WLOA 3MJEA 2B9EA 2GBIA 3I9FA 1KQNA 4QD3A 2HYIC 1X38A 3WWEA 2BGWA 1FFWA 4FZ5A 4IHAA 1J09A 2WDZA 4WCFB 3IVGA 2ZIAA 3PDJA 2Y77A 3TLCA 1N34M 3X1YA 3KTOA 3K35A 3U60B 2XDWA 4B47A 2ETXA 4Q9DA 5EUCA 2CFTA 1SZCA 2Y1EA 4O0MA 1P61B 4NJOA 1HA3A 1SRRA 1EBUA 3SN6A 3P20A 3KT0A 4A6DA 2RHTA 3TOXA 4NYJR 1S2LA 3TGWA 3U6QA 1QQ7A 4MW4A 4ZC1A 1UEIA 1FP6A 3VNAA 2JCYA 4UASA 2J4CA 2GD6A 4YXFA 2O0HA 3TQIA 3CN7A 1Q12A 4NHEA 3B20A 4OXQA 4C04A 2XZFA 1LV8A 1U3TA 2CXRA 4BP8A 3DF9A 3IHPA 1BCSB 1HMYA 3BMOB 1EE8A 2RHGB 4WZBB 3TE7A 3DVAA 1E1LA 4A0SA 4P3YA 2QU8A 3BIXA 1C9YA 1GTZA 1RC8A 2QX9A 2Z3XA 1J1IA 4UTXA 4N8DA 1PL8A 1PJQA 4NAUA 2OBLA 3KZKA 2ZIFA 3J80S 2FQ1A 3BDVA 4TMTA 5JDIC 2I91A 4UHJA 4A2QA 3H42B 2YZ7A 4WERA 4A8HA 1C4OA 3IKJA 5LZ5A 4W63A 4MZDA 2IIBA 5BOVA 1X70A 5I6DA 1ZD5A 4RDIA 4JBGA 1P39A 4ZJPA 1VCNA 1W5SA 4QU8A 1I1HA 5HS6A 2WU0A 3QEMA 4CN9A 2RKBA 4L73A 1E79A 1J90A 1E7MA 5IK2D 2R46A 4YAKA 4IZ6A 1GLNA 2ODPA 3K32A 1JLHA 4JJ6A 4R2MA 4TMZA 3MM4A 4GZMA 4IPTA 4OHUA 4Z6KA 5EP4A 3GQ5A 2KQUA 4WESB 2WJJA 3QX7A 5CD9A 4URFA 3NETA 1IN1A 5F5NA 1I1NA 2G25A 3HBAA 3ROMA 1T8PA 3RIEA 5DOZA 1D2NA 2GPAA 4F71A 1Y3DE 2IV3A 3KR0A 1YA4A 4G1VA 2WYVA 3CEPB 3B7QA 1Z0SA 1YK1A 2YMLA 3SVTA 5DU2A 1FVFA 1GG9A 4UUNA 2Z5LA 5K6RA 3G2OA 3Q3CA 4NBSA 4UVDA 3TXXA 1MB2A 2CXNA 4WACA 2M5ZA 1MVLA 2YWBA 3E2IA 1Z08A 4B7XA 2D5LA 4EHLA 4OMDA 2Q1WA 3DBVO 4HEHA 3N8HA 4TMYA 1PJ4A 2IC5A 4JSTA 2Z3ZA 4PCLA 1K6IA 1M1NA 1DG3A 5LQCA 1HSZA 4WXEA 1W36D 3SKVA 4RD6A 1U3VA 4H31A 4B3MB 1DZIA 3BXXA 4WXMA 3CT4A 1GU1A 4RA9A 3UA4A 2O2JA 2B7CA 1USIA 1VRWA 4G86A 1AKUA 4FSXA 3WWOA 2FMTA 4L4YA 2WU3A 1M6NA 3LK6A 4X3OA 3VZPA 3RRFA 1T1SA 1I6LA 3AY3A 3V8BA 2FVYA 4TLBA 2RGWA 5HBRA 4JEIA 5B57C 4IQGA 3LK7A 4IIEA 2D5AA 5BMVA 3INRA 2OYSA 4ERXA 1XA0A 1NQXA 5JWHA 2REQB 2OQVA 5FR1A 1X74A 2PQ6A 2Z2ZA 2I03A 3DFZA 3D6FA 5BNTA 3WMEA 4US1R 3TVTA 4BNVA 4P7JA 1U0HC 4MUNA 4TQAA 1GL3A 4DCSA 3U6LA 1XWIA 3EBPA 1NHGC 2RH4A 3SNKA 3T9CA 3AZQA 5E6JA 4PCAA 1FDIA 3OHPA 1JJ7A 4PZZA 2VEOA 2QV7A 2CLMB 5K0BA 4FYWA 1NJ1A 2XB8A 3U3RA 3EDYA 2QT9A 2JEYA 4K6HA 1ZWKA 3DLPX 4JB3A 2HMWA 4EY6A 2W2NA 4B3SM 4JY7A 1G2PA 3HP1A 3IV9A 2C78A 3U6SA 1A2QA 3N5CA 2TYSB 2ZAOA 2BKVA 3DL0A 1S4MA 3HWRA 5AUQA 4MB2A 1EVEA 5LC1A 3NTUA 4PQGA 1APBA 1U9IC 2GI4A 3V1TC 5AKZA 4NENA 1GNSA 3ND6A 4KTVE 3EBLA 3TEMA 3RFUA 3IUBA 1J8DA 3ZHTA 3L6CA 4DTCA 5ECDA 2E89A 5HS4A 5DSZA 1Y3IA 4JAVC 4LVUA 1NONA 1DIGA 3LWZA 3GMDA 2PLNA 3KVRA 4HPXB 4C3UA 1UDAA 5T3YA 1K3FA 2CK3D 1G8HA 4W7SA 1QQBA 4GKVA 4UBMA 1PAUA 2Z6VA 1O58A 1WCXA 4B09A 3BOSA 1IOLA 2JS7A 4JJ7A 2FJPA 1N5KA 1ZJZA 4CMEC 1NJ6A 3V4LA 2VDKB 4RPLA 3NDRA 3MFQA 4RPKA 3KZXA 3ILHA 2FOIC 4NR0A 3JATB 3C5WP 3S7TA 3WLKX 4MVJM 4LG2A 3BIFA 3AV3A 4S35A 3MRSA 2WJGA 4E33A 4GVXA 1IBSA 3LGXA 4Z3OA 1QX3A 4DBVO 1EAMA 1M5UA 2BKAA 4BB0A 3ZJTA 4XTCS 5A7GA 4XH9B 3G02A 2HIAA 3VV3A 2KBEA 3T1QA 1KJWA 1HURA 1QV6A 5EJ6A 3F5FA 1CU1A 2XY4A 3S28A 1VBNA 2D5IA 3PXUA 3VNVA 4IDOA 5JNTA 1QYIA 4CEIB 4MRAA 4BKRA 1NZJA 2HMAA 2BF7A 2VF7A 1GZSA 3HKDB 3ZW7A 1GU7A 5B1YA 1JIJA 4JLSA 4ZAYA 2QMEA 2VHUA 2HGZA 2YBDA 2P0YA 1XEXA 2VTKA 3NDPA 1CUCA 5AUPB 1GEEA 5C53B 3GPDG 4AN4A 2XGOA 1WZIA 1FDUA 1TRKA 3DA1A 3BGIA 1BYIA 1ZBDA 3VKUA 4ZI5A 1OD6A 4KJXA 1XO1A 2Y1FA 1F6BA 4B6RA 4AZTA 4UHFA 4HQKA 3R7FA 5GIOE 4MMXB 3TECE 3MTQA 2OBFA 4L5CA 3ZZTA 5TGZA 4C88A 2J9FA 2HA2A 4PBTA 3UPTA 1K8RA 1M0WA 5A06A 5F33A 1T3ZA 4NMHA 5EFOA 3GLKA 1CW2B 3K8ZA 3CURA 2A3NA 1K8XB 2F90A 2IDMA 1XDWA 1AV7A 1G5FA 2C20A 4J1SA 1Z7BA 4O1MA 5MN6A 5ILQA 4FE4A 2QQ8A 4PAOA 4NDAA 1DX6A 3K16A 4NPCA 3EDRA 3IP7A 1SHZA 4JVNA 4DSTA 5B3LA 4Y2UA 3HG7A 3BGDA 5HIAA 1PR9A 4EB3A 3FYUA 3OTWA 1CNMA 3K0EA 1IEVA 4JC4A 4UCWA 1BZYA 4UOQA 3IP8A 2MSEB 1PN3A 3BRQA 3N2LA 3JASA 1QCCA 1K06A 4MKZA 2PJZA 5FOQA 4GGOA 1RAIA 4WA8A 3VR6H 2VDWA 2Y9PB 3RC9A 2HB6A 3D1LA 4L9WA 5C51B 3BGWA 3GT7A 2PH5A 2E85A 2R2GA 4XJXA 4REQA 1FNCA 5EUBA 5GM2A 1NIPA 1Z5NA 2O2DA 5EUMA 3TQRA 3LFTA 4RHFA 2MH8A 1G9TA 3H11A 1CTQA 1IBRA 3I2HA 4KK3A 3GMSA 1TUEA 3V8MA 1P1IA 4CF3A 1EBBA 2F5OA 2X2EA 1SXJE 3MPUA 4K81B 1TB4A 3ZGYA 4U2BA 5DE3A 2EIXA 3TLZA 5LQNA 3HJUA 4LZLA 4HEOA 1O2DA 4DSAA 2JNWA 2BDUA 1KDPA 1L5OA 1KI3A 3O4VA 2R8XA 4XARA 3HDHA 5ITTA 4BQPA 5HA5A 1RM5A 3ZXYA 1RHJA 3JYPA 3CO5A 5AVKA 5KYGA 5FTKA 5BOSA 4DXAA 4DQVA 1XA3A 2C5AA 3EYAA 1D03A 3CBQA 1Q44A 4Q39A 5FLYA 3TW6A 2PNFA 1BE0A 1IL0A 1X1QA 4F8EA 2JVKA 3LWNA 4BRSA 4OLFA 3WTBA 2Q27A 4FYHA 4TSKA 5CJ2A 2GJ4A 1WR8A 5B55A 4CEHB 4NYJQ 4G4OA 4PU0A 1I1QB 1N3IA 4X7MA 2VK8A 4WVFA 3HVJA 3KOXE 4DZTA 3PYLA 3ZQKA 3C3WA 2TS1A 5AVWA 3J7AS 3LHDA 1PV2A 3T38A 2I3DA 3JQ9A 1NBIA 1SC1A 1V3VA 3GAFA 3AVYA 4CMIA 4RNAA 2ZQ5A 3O3MB 4BX9A 2LV8A 1GUZA 2WSEF 4EVIA 5B7QA 2XEPA 1TYCA 4RF5A 4OYYA 4BJ5A 3PUVA 4KC0A 2AS0A 3PGMA 4J3JA 1JQLB 3ZUGA 3CUEF 2IEDA 4LOAA 1SBNE 2BLLA 1FDSA 4B7ZA 1VA4A 2G8LA 4YXWD 1JSZA 4LFCM 2DAPA 4YH1A 2J4FA 4JR0A 2R4QA 1R0BA 2ZJ7A 2JGIA 3N0WA 4UC0A 2OV2A 3G17A 1V37A 3EN0A 1MLDA 3VMFA 1P75A 2XV1A 4W1RA 2F8MA 4Q1EA 1HM5A 2XMDA 2BMAA 2ZTLA 5ALZA 3SFVA 5CW2A 1P33A 5H81A 1QDRA 3RS4A 1WXDA 3L1IA 4MX8A 2AVNA 1T35A 3DBHA 4NI5A 4AZFA 4CGYA 4IBIA 8CATA 1RT9A 2OCGA 4Z0NA 3T06B 3WK6A 3FOFC 1PJ8A 4IIHA 4IKEA 4LIPD 4R98A 1RKBA 2ZYSA 3LT0A 3ZDZB 3GCXA 2PR7A 2ZYGA 2EZTA 4NL4H 3DT6A 4GR5A 3C1TA 3AM3A 4BNZA 3O94A 5KJ1A 1ZESA 4B3HA 3HBJA 2H0RA 1WMFA 3UTDA 1RXUA 1SBTA 4J3FA 3PQ3A 3RI3A 4JYCA 3MWKA 5C5IA 3KPUA 3CG4A 1XFAA 3FHCB 4RQAA 1L4YA 1JIQA 3U1TA 4M1ZA 5TXGA 3PYXA 2ZYDA 1WJGA 2G04A 4PEVA 3LAWA 1XJCA 4REZA 1A76A 2QLBA 4KRYA 1A96A 1L7QA 1IBLB 1GNRA 1S9HA 4W7IA 2XQIA 3RVKA 3K70C 1SD5A 2EKDA 4ZU6X 3G0CA 4R4JA 2IP1A 3DKIA 5M7EA 2CNOA 4K1XA 5DLQC 3S2FA 2ZUSA 4DSOA 1Z25A 3PNMA 5LP6F 1IUPA 2VJMB 4OXRA 1E7QA 2GJKA 2F00A 5BN4B 4FFRA 2WG2A 4B3TM 3K2BA 4IDBA 3M9LA 4ZVKA 4RM3A 3MA0A 4IVQA 3ZIUA 2PRYA 1WKBA 5D3MA 3SC2A 3NFRA 4AF8A 4R8RA 4FSHA 3V7NA 3LQKA 4HFRA 3CVUA 2V54A 4O4JB 4OU7A 5CA0A 1E4EA 4NRWA 3ODPA 5FWYA 1AA6A 2YJ6A 4RTKA 2DAEA 3EISA 1RXSA 1M8FA 1E62A 1IHDA 3ZCUA 3K09C 1SQGA 2IOFK 3UCEA 4N8SA 5IJZA 1XZJA 3P5SA 4G56A 2HL6A 1CWUA 3RR2A 1XVLA 1D6MA 4YDHB 1RM4A 1UC9A 1LDGA 3WAJA 2H8KA 2JBWA 5SYMA 4N7RA 3PA6A 2G0NA 2H2GA 1V1MA 2DFNA 4P6VF 3N8KA 3CVYA 4NXMM 4QGSA 1G98A 5AK0A 4IDNA 4MUIA 4DV4B 1VLZA 2DY1A 4IF6A 4MP8A 3BORA 4MR8A 2TMGA 1BVHA 4YECA 1SH7A 2AK3A 4DLVA 3L7BA 1YOVA 1G8MA 1XRPA 4EZEA 5P21A 2JLCA 3OQ6A 1CUYA 4P58A 1QHEA 5KREA 5IHXA 2L18A 3EXIB 4AP5A 4DV1M 1GO5A 3SAUA 4LRTB 1M6EX 1R9NA 4YGYA 5JNVA 2BBOA 1JZQA 1UBNA 4JL5A 3W5BA 1F4VA 4FFBA 4F92B 3NASA 4MQUA 2YV3A 3VSEA 2HA0A 2JASA 4YROA 3P71T 1CR1A 2C97A 4G4NA 4DLZA 3B7NA 4QU9A 4QFBA 4W9MC 3R9KA 3PP8A 1PS9A 4RHCA 2WTAA 1YRBA 4BVFA 5IT9S 1KOJA 1I94M 3S2EA 2YZ2A 1WBJB 3CVWA 3OJEA 1LS6A 3HLKA 1ZMWA 2GKGA 1C3OA 3X2EA 3CNBA 3L6EA 2WW8A 3FNEA 3UBMA 2OD9A 3EC2A 4J7UA 4IFTA 3QW4B 3PXXA 4G67A 4C14A 3Q1LA 1XDBA 4X3CA 5T4BA 3SSOA 2C42A 3ZD7A 4FMDF 3QE4A 4LNAA 2HF9A 3GA5A 1H9CA 1F14A 4PFKA 2GYWA 3QFRA 1EVJA 1S3IA 4CT4B 5HNKA 2WAYA 1KBZA 5AYVA 3JX9A 5D7NA 3HTXA 4MQ6A 3EMBA 3PX7A 1QZMA 1SWVA 2VQSA 1I7DA 2C8VA 1QF9A 4UMEA 3CRRA 3WIEA 2VPWA 2HV9A 4Q9NA 3VR5D 1NU6A 5IVIA 3BMQB 4A0HA 1V6AA 2F5SA 4EYKA 3SHVA 3BDAA 1C3LA 2OQRA 3WGJA 1A7UA 3VNQA 1J8VA 3TL6A 3B6MA 2ROQA 4HAXA 1VKRA 2AA3A 3QA9A 4P5DA 4J3NA 3O4RA 3E82A 1MAAA 1N8NA 4FQ8A 4NCJA 1PFYA 3DE1X 4O4LF 4KR7A 4YDQA 4B2YA 4W5HA 4OHWA 1LCIA 3Q5EA 1WVGA 3B70A 5JXJA 4LGVA 3NQ41 3U31A 4P4NA 2VTBB 5JFTA 3T1YB 1ZDMA 4QBFA 4N0EA 3SX0A 3MSXA 4BPRA 4D80A 3KOUA 3W6ZA 4W5WA 2WD9A 1TCBA 2R00A 3VKFA 3C7AA 4B3DA 3BMXA 4QBTA 1YHNA 4GP9A 4C3ZA 5FOSA 1LDMA 4DV3B 3IEMA 3TQFA 3R7WB 4HG2A 2JDIA 3DVSX 5K3CA 1SBZA 4EYSA 3OFSA 5LMZA 5DRTA 5HF6A 3C24A 4DR2M 4Q93A 4BV3A 3RU3A 4CKZA 2Z08A 1ZGCA 4RLFA 3TZ6A 3OLCX 3IC5A 1Y7IA 1W6UA 3OQIB 2WZQA 5K8LA 3HU5A 1OWMA 1GY8A 2BFBA 4ILEA 4BUZA 4KQ6A 4NJEB 4EGSA 1KF0A 1KAEA 4GYKA 3VA7A 1HG1A 3WRVA 2ZUDA 3W5JA 1Q15A 2O5RA 1H0RA 4EG3A 2VBGA 1EUDB 1CJMA 2PSDA 2WU8A 4RVCA 3O31A 3TWKA 4DLAA 1WHTB 3HY5A 2ET6A 4OF4A 4M0FA 3H4MA 5JY1A 4EY8A 3ETNA 1T6ZA 2NW6A 3IDQA 1JL3A 4C07A 1P4SA 5JJ5A 1QE0A 1G71A 4MUEA 4KT0F 5AKYA 1QTIA 4EJMA 3J81k 5E3JA 1QPZA 1AKVA 3UFXB 2QRMA 4AS1A 3LCRA 4RELA 1ULBA 2KX7A 1I2MA 3M4YA 3HB9A 4PXSA 5AWFC 4TT3A 5FJIA 3MJRA 4RF1A 1YFLA 2HT1A 3RRJA 2C0PA 3DZKA 1VL0A 5EE1A 3GRCA 1FYXA 3LC7O 2FG5A 2OPFA 3AQIA 1GNQA 3G2KA 4NP6A 4J7AA 2C2YA 3MINA 2AOUA 5FA5A 3PQ8A 3N2KA 1QMGA 2O0MA 2QTNA 3B7PA 3UJDA 2X1MA 4G2TA 3QUSA 1CVRA 2AEEA 4D6YA 4E21A 1G1AA 1MGPA 5IX8A 3UIEA 3RFWA 3UG6A 1OLSB 1OFHA 1OC4A 2A9PA 3RD5A 4RABA 4N41A 1COWD 1ZIDA 3KXKA 2F2TA 4DQUA 3W78A 2AE2A 3TJRA 5DHTA 3ZHRA 1H65A 2WIAA 3HLYA 3E35A 2NU8A 4LF6M 2D7CA 2QRJA 3KFVA 1OV4A 1SPXA 1FUYB 4PHCA 2A88A 3PI7A 1E61A 3KKMA 2NUAA 2M1ZA 5C46F 1HEYA 3SMSA 1X9HA 9ATCA 2OKGA 2Q1XA 4QOFA 2BD0A 3IE0A 5CBPB 4F5EA 2P9ZA 3DE5X 2PL5A 2DQKA 2XKAA 5HKKA 1CY1A 1I2ZA 1JQ5A 2FW8A 3HGIA 5DULA 4O0LA 2LNDA 1B8OA 3NBKA 3ZWOA 2XUGA 4MITA 2YIJA 5ETJA 3FNGA 4IQ0A 1H2ZA 2HYDA 1SZJG 1UR5A 3USCS 2CLCX 2RDMA 1AZTA 3QBEA 3D4OA 5D5PA 3B5EA 2NTJA 3TR6A 1QZXA 4RK1A 2KWIA 4QT0A 4QC2A 2W7TA 5DIZA 1G3QA 3C7DB 5FORA 1LJLA 4MI6A 1IG0A 1UFVA 3T9AA 1A88A 4EG4A 2OV6A 5AKEA 1YJ8A 2R18A 4BP1A 1Q0LA 1XYYA 4LMBA 4FMPA 1JHPA 3CPHA 4BUCA 2WP8J 1QCZA 1TQ4A 1N2ZA 1J9EA 2YOHA 4EI9A 2IYAA 4G65A 1IQPA 1RYEA 3ICOA 4Q7LA 4D0SA 1FDOA 4XCVA 3O8QA 4QVKA 1QZUA 1B1CA 1EDDA 2AG8A 4RVDA 1J1ZA 4X5OA 5K7SA 5BR8B 5AK5A 3IELA 1NF9A 4AJIA 1IHYA 1EEHA 1FTYA 3NUGA 3CKLA 1N5LA 3VU1A 5LP6C 3CRNA 1ZONA 1OIZA 1US8B 2NU6A 1O0BA 2X0EA 3RF6A 5LMNB 2H00A 3I9OA 3RROA 3ROFA 3EJWA 4DPKA 1Q39A 2BE7A 9MHTA 4AY2A 4N03A 3ELBA 2G80A 5TF0A 2L42A 3TTUA 1YB1A 4EG5A 5GJVC 4GGMX 1DRJA 2HZBA 4R8LA 4CG1A 5EXPA 4P81A 4DOMA 4IHJF 2NGRA 1WPQA 4NOMA 5IAGA 1HI9A 4FN4A 1E2FA 3RVMA 4QAQA 1TTTA 4DILA 3R0XA 3D6VA 4QUEA 2Q07A 3N6RA 3DR5A 3R8CA 3EVNA 2J3IA 1P2DA 3OM0A 2IL1A 3O82A 3L1VA 3PHCA 4EHBA 3SARA 3I09A 4ENWA 5DX1A 3LPNA 2BL4A 4OAPA 1X80A 1YDWA 1QGOA 1H1LA 4LE0A 1YZVA 3P2YA 1RBYA 3FDFA 3F9CA 4LNUA 4J0CA 2Q3BA 2JAOA 3NV9A 4FWHA 2CBGA 4HH1A 2OHOA 4HQFA 4OXYA 1K5HA 2NT4A 5HHTA 2O3RA 2Q0SA 3ZZ0A 2FRDC 2YXEA 4YAUA 1TH4A 4YAGA 4D82A 1XQ9A 1U28C 3D4LA 1IBKM 4QDKA 1ZOSA 2J3JA 3ZV3A 5FPYA 2HSJA 1OU0A 5TT1A 2AR0A 2ZQZA 1TUGA 3W8RA 4C7OA 3ZK9A 4BQOA 1BQ4A 1TAUA 4NONA 1ABEA 2CWWA 2WINI 2I8CA 3CVVA 1JQEA 5TQVA 2XRFA 3FUUA 4JB0A 3U48A 4DC1A 3P96A 4ZICA 1K6JA 3ZHOA 1BW9B 2OYCA 5EIBC 2P6MA 1U9CA 1YZUA 1L1ZA 5TMBA 1NVDA 3PR3A 5CYFA 5BQPA 2VT6A 3V1NA 1KFCB 2GEJA 2CJPA 4Z1OA 3AZPA 3JTMA 3KM0A 5M29A 3VPGA 3Q8XB 2P78A 5E6RB 2HCFA 1RZUA 4Y6PA 4BMSA 1P7ZA 4QBHA 4AURA 5AW1A 5B64A 1QQTA 1NY6A 2Q6VA 3S2UA 1WB5A 5F64A 2DTEA 4K9QA 2RIRA 3I61A 2BRUC 2Z5FA 4FFMA 4F3YA 4FT2A 4HDMA 4JV5M 4AICA 2Y20A 1XMIA 5FIUA 2XF3A 1VL8A 4KPEC 4YJFB 4BO9A 4JL8A 2OSBA 2WKQA 2JLQA 2UZIR 1QZ3A 2RAVA 2V0CA 4X1YA 3DC7A 4XGRA 1JQDA 4I1PA 1WG8A 5EQFA 4G3XA 3LYUA 2YL2A 1PG2A 2A78A 3IHWA 3HB0A 5KNBH 5BSWA 1XKQA 1X7HA 5EZQA 2BHRA 3KE9A 3HZZA 3UXHA 2IYNA 3GFSA 2Q4TA 3CHYA 1JR3A 4QGFA 1Q84A 3ORYA 3IP9A 3YASA 5FOWA 4ARAA 5HDQA 3CF0A 1CK4A 5BQFA 1CY6A 3LG2A 1H3NA 3AU8A 5BPHA 1EFVB 1NNSA 7REQB 1DAEA 2GQFA 2FPGB 2KXEA 4OU5A 4AY3A 1TM3E 4EDHA 1WO8A 2FQYA 2NVUA 3WMRA 3I62A 1NVMB 2R8OA 5DASA 3PNKA 4AG6A 3RBZA 2P35A 3IIEA 3P2KA 3ZWXA 4TTSA 4OXIA 4F85A 1YZGA 1LK7A 2D0DA 2PMKA 5LA6B 3H5AA 3ASZA 4LJ8A 4YRBA 4EVQA 4JUFA 4IZHA 2AG1A 2EEZA 1E69A 4C5AA 3AEKB 4KHPB 5DGIA 2JFFA 5A3JA 1VP9A 1TECE 1KFEB 3T41A 4JMLA 1ST3A 2AXQA 4RKYA 2HJSA 4JSRA 2GK4A 3DG9A 1RI3A 1LU9A 1X7XB 5H4GA 4HDNB 3PTLA 1EK1A 3OQMA 2GN0A 3NAZA 3RTDA 2GWHA 2I55A 2JCGA 1RABA 2X9LA 4E4TA 3CH4B 2Z30A 4X7RA 1QRTA 2FR1A 3DLTA 3WLAA 1EUCA 5LLTA 2DAMA 3HXTA 1F2TB 5F73A 4OUDB 1GA4A 3H5VA 2WAAA 2A0UA 3HGQA 4U4AA 1XOIA 3GWGA 5FT9A 5DCUA 4WRRA 3RJ5A 1WDMA 4Z0PA 4FX5A 4AWXA 1PR3A 4CR6A 4FFPA 2AG5A 2IHUA 3ILXA 3X1KA 1THTA 1KDVA 3U3ZA 3RSZA 2CJFA 2WKRA 3ADDA 1ISMA 3EA4A 4DV2M 3LL4A 1RVV1 4HTAA 1D7AA 2JKZA 2JFXA 5JEDA 3VK7A 3COJA 4OVKA 3SSNA 2DETA 3LQ2A 5IBCA 4QUBA 3OLVA 3TF5A 1ODCA 1PDOA 1P6XA 3ITDA 1TJNA 2PSJA 2GCIA 2N46A 4IY1A 4CJXA 1FTNA 1UAGA 5HRAA 4R3DA 4ANFA 2IXBA 3PS9A 1NPTO 5ADVA 1HZZA 1II8B 2OXFA 3PKJA 3WIBA 2FR8A 4PVDA 3TW0A 3VYSB 2VZ9A 3OU6A 3LF1A 4EA8A 2GEKA 2ZB3A 1L5MA 2VPPA 2NTNA 4TRJA 4CFZA 4DPMA 2Q9BA 3OEWA 2K4MA 3HCOA 3ZH2A 3RKRA 3CM0A 1GV1A 1GZ4A 2UUBB 2BUCA 3FGZA 1NRWA 1YZYA 2FHPA 1Y4DE 4O2BA 2HMTA 1MJGA 4HN4B 4LMPA 1OREA 3KJHA 4TN5A 3HEBA 3IG8A 2ZLBA 5C1IA 3AY7A 4TZ6A 4I1RA 1G41A 3UHOA 3FNQA 2HK8A 3TOZA 3LGAA 3ABOB 3UZUA 2XOKD 2OENG 2V4MA 1ZUNB 4NFHA 4U8GA 2VF8A 3DDSA 2P5UA 1T9ZA 1L5NA 4JLJA 3IDFA 3OCJA 2IIPA 3ER8A 4CKEB 2CW5A 4OHXA 1RD4A 2FA9A 4YT8A 2Q3MA 1NBMD 4TYMA 4I9HA 3WYGA 1PWEA 3QPCA 2PZGA 4RFVA 4YJ2B 2X9NA 2BGTA 2QL7A 2YZMA 5CCBA 2CLOB 2BSQA 3ZWWA 2DE0X 5IAKA 3E3OA 2LDXA 1TYDE 3HZOA 4LJ5A 4MRVA 4Z49A 3R5JA 1AT1A 3SBOA 4D57A 2YWXA 2ZG6A 3L26A 2N35A 3MAAC 1Z22A 4MPJA 1B73A 1WZ2A 4PLYA 5FLXS 3ET5A 1FSZA 3E7PA 1IVYA 2R44A 1U7WA 1MRSA 5EI5A 1KP2A 2XNKA 3CZQA 5JQGB 1L6IA 1FBTA 5D3ZA 3ANLA 4DUGD 2KEBA 4FT4A 2WWIA 1CUAA 3FKSD 4ENUA 4CKBA 4ECAA 4QT4A 1EWTA 4YYZA 4YCMA 3OLXA 2H1RA 4F60A 2RGCA 4JUDX 1QDUA 2QL5A 1H4TA 1N7GA 3KAPA 2JBHA 2RK3A 4PVCA 1TCUA 2PANA 3IVRA 4OY3A 4LBWA 4CW7A 3VYTB 1KJ8A 3I9NA 5F5XA 2FUKA 4FJ0A 2WMOB 3C3AA 1JVSA 2CJWA 3BFXA 4RF3A 5EA2A 2QR3A 1V4BA 4BEBA 1UDWA 2WVHA 5DYIA 1NP3A 1RRPA 2GHRA 2BM8A 3UNXA 5K0JA 3KAKA 5KKAA 4DMRA 4CM5A 2WJPA 2FQXA 2UU9M 5J63A 1Y8AA 3AVWA 5FPPA 4KFTA 1Y1SA 4N5IX 2CSXA 3E9ZA 4F4CA 1OBFO 2OZEA 1A9XA 3P9NA 1ZNWA 4Y7CA 1YR8A 1Z6YA 3EGEA 1SKMA 4DDVA 1IWBB 1R6VA 2WF6A 3SVZA 4RMHA 2VBFA 3MMPA 5ES3A 3DZHA 1ZNXA 2NX2A 4ND5A 3TZHA 3DR3A 1NN0A 1JA0A 1XSEA 1HGXA 5KJFA 4Q0MA 3AESA 4LKRA 4DG5A 3II6X 3NB0A 2AI1A 4KVGA 5CU7A 4HXGA 5LWQA 2ZKIA 3CX3A 3W67A 4TV8B 3WL6A 3HB1A 4UDNA 3L4BA 2QMQA 1HDOA 3V7UA 3VR6A 3PJGA 3JAWA 4DLTA 2HBYA 3DNMA 3CNHA 3MYYA 2PCLA 4P82A 3Q11A 2FZWA 1ZIPA 4X66M 4TLLB 4MA4A 1DVRA 1XYGA 3OF3A 1MV5A 1T5TA 5ICEA 4G0QA 2ZRMA 1P7WA 3QJ5A 5A9SB 1Y8QB 3GWZA 2OEPA 3N5KA 3WNDA 2X0JA 2ZSJA 3IXLA 1IUKA 3ORHA 1OYYA 3CRVA 4H6WA 5AM4A 1NX6A 5FI5A 1YRQA 1RS0A 1O97D 5JZVA 1Q7CA 5KQDA 4YP6A 4XYGA 2ST1A 2H57A 3U6MA 3NALA 3RE1A 3SJAA 4PICA 4YEDA 4KLRA 3VSBA 2FKAA 1P9LA 3NIBA 3IPRA 2HU8A 1N0WA 2OFFA 3MGKA 3E5RA 1BU5A 5JSHA 5H5JA 3FPHA 4AZ0B 3V48A 3C7TA 4UMDA 5KO3A 5JCOC 1T2NA 1D8AA 1GA1A 3A9WA 2PZKA 4RTOA 4DEYA 3DKRA 4LQDA 2OT3B 2SHKA 5KJCA 3V4RA 5F5LA 1Q22A 2FWPA 4L57A 4V2UA 1OZGA 2EGUA 5GVSA 2A0YA 3B3JA 3U4QA 5IKEA 3KHSA 3RUEA 4B31A 3UOWA 1IHPA 1X42A 1RQPA 3RJZA 4MYSA 1ZHFA 3GN1A 3BN3A 1V95A 3UJ6A 3P9CA 5CLLA 5DX0A 5JVDB 4HY3A 3DFMA 3COZA 1ZIYA 3UJAA 3MMNA 1MC4A 1YWGO 4RV9A 5KQLA 3QU4A 2DPXA 3BJZA 3GP8A 2K6GA 1U0NA 5K6AC 4E5SA 2FQWA 6ABPA 1N5RA 4IBKA 3ZCTA 4YCSA 1JWLA 1DKPA 2EJCA 4EF5A 1ORTA 2LKCA 1WE2A 3U7FB 5FEUA 2NV2B 4HZUA 3ABZA 4PZPA 1GDTA 3H9JA 2DQZA 2JFNA 5AJTA 3C87A 2ZIXB 4I3HA 3DZFA 3N0TA 5KYWA 3A3PA 2HQSA 1OWPA 4H7PA 1TYAE 1C30B 2X4LA 2FUG1 2J3HA 4MV4A 1X7ZA 2GPYA 4ER7A 3NHJA 4BQIA 3SR0A 3W0LB 1QIIA 1DB3A 4YASA 2H0QA 1Y7HA 2B5VA 4KXLA 5ENZA 4JL6A 1IM8A 1NBEA 3RV3A 1MHPA 2P9EA 1KJJA 2JCXA 3IQEA 3JQAB 1KIAA 2WICA 1DRUA 2CBZA 3AEUB 4X85A 4MCJA 3CVJA 2HDOA 2FFJA 1FRZA 4L8LA 3ZCVA 1A98A 2QNJA 4MK4A 1EX7A 3ESRA 4MCHA 2AEFA 1TF2A