1G41A

Crystal structure of hslu haemophilus influenzae
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
443
structure length
334
Chain Sequence
SEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTVGKEVDSIIRDLTDSAMKLVRQQEIAKNRLIDDEAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKKGEYSGADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Haemophilus influenzae HslU protein in crystals with one-dimensional disorder twinning.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Chaperone
molecule keywords HEAT SHOCK PROTEIN HSLU
total genus 116
structure length 334
sequence length 443
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1g41A02
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1g41A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g41A01
4FWGA 1DPFA 3LBNA 1U8ZA 1YQTA 2ODEA 3K0AA 4HATA 1HYQA 1Z47A 1TPZA 4DKXA 4ESHA 3R9WA 3U7EB 4G5OA 5DI3B 4KU4A 1N0WA 2QTFA 3CRW1 3QXXA 4GL2A 1CULC 3AVQA 1QHIA 2P2LA 4KI0A 1Z3IX 3WNDA 4HB0A 2QSYA 2Z0MA 4UXHA 2CVHA 1TNDA 5A5GA 2ATVA 3ADCA 2HYIC 2EKFA 3TE6A 2EWWA 2VSOA 3D8BA 3PG5A 4BZXA 2RGAA 4GP7A 4PSAA 1FP7A 1CTQA 3LXXA 3V4FA 4LJ6A 3CIOA 1Q20A 1UM8A 3NBZC 3NC0C 4NE2A 2D2FA 4QHTA 4POAA 3AGPA 3IIJA 2FPLA 5DI3A 1SVKA 4HLUC 3CF0A 2IUSA 3G5UA 2BMDA 1MRSA 3WXMA 3LNCA 2O5VA 1J7KA 1WDTA 2BEJA 3S1AA 2VPPA 3VX4A 1AGRA 4BLQA 4LJYA 1FQJA 1HE1C 4OK5A 1U9IA 2KJQA 4Q7JA 4XWKA 3OEEA 1Q21A 3SI7A 1TQ6A 3SQXA 1AJEA 2DFKB 4ERNA 4CVNA 4JYCA 4O25A 3IUYA 2AXPA 4PZLA 2GK7A 1JB1A 4OBEA 5K8IA 2JEOA 3WMEA 4JSYA 3QXJA 3A4NA 2NO1A 5DFLA 3D6TB 4ZKEA 3OIYA 2DAEA 3IPYA 3I92A 2RCNA 3GEIA 4JMPA 1P5ZB 4C0AC 3U4QB 3QG5A 2O8CA 1VHTA 3VLFB 1SHZA 1OB2A 2J59A 2OO7A 5FTNA 5HCNA 4G01B 3K0FB 4IOLA 1P2TA 3ZDQA 2VHCA 3WBJA 2L0XA 3NHAA 1A2KC 1QG4A 3TH5A 4B3XA 1KK3A 3TRFA 1UJ2A 1ZINA 1U0LA 1QHHB 4JSTA 5CK5A 3T1OA 4M2LA 1Q1EA 3LLUA 4Q66C 4A36A 4LYFA 1ZV1A 1WB9A 1M6NA 3X1WA 2VTKA 4AWXA 3A37A 1G8PA 4WOPA 2C5LA 1UFZA 3KL4A 3MD0A 2EW1A 2GWHA 4DLTA 4DLWA 4K46A 4LI0A 4ARZA 1ZMWA 1CU1A 2G77B 3TQFA 2C9CA 4QJ4A 4CEIA 2PCJA 2ZYTX 1R0WA 1HEIA 2C78A 2ZSBA 4ZDKA 2ZJ5A 3CX8A 2R65A 3EA5A 1NLFA 5KSZA 5A0FA 2QU8A 2ZITA 2O8FB 1NVWQ 4OI1A 4EPYA 3QXHA 3R9IA 3JZMA 1JPNA 1SULA 2D7DA 1E2KA 1NV8A 4IOKA 1GL9B 3IBGA 1RRPA 1Z6XA 2JA1A 2QMEA 4FINA 1S9DA 5EE0A 3BBZA 3HPRA 1XJQA 4GBMA 1G1MA 2CCKA 4IOJA 2ZYUX 4DEYA 4GOXA 4PPGA 4OHYA 3BE4A 3VKWA 4P31A 1IOZA 1G8FA 2F9MA 1SVMA 2D2EA 2NOAA 4C2TA 1KI1A 4DSUA 1HE8B 1AK2A 4OHXA 4HAUA 1N5KA 4IEIA 121PA 3W3ZB 2ZTDA 2FOLA 1BVSA 1KO7A 3BERA 3GEEA 3MJRA 1E2IA 3HR8A 3U6BA 1FMJA 1S4QA 2CJWA 2QMUA 1LTQA 4MYHA 1PGYA 4PXAA 3TSOA 4Z1MD 3PQCA 2VQSA 2QI9C 3M6AA 5FPSA 2B7CA 3CWZA 4IDQA 2G9NA 1E0AA 3SYLA 1NY5A 2WAYA 4NYJQ 4JL8A 4GFDA 2WJYA 2UZ3A 2ZSEA 3ICEA 2HLDD 3U2QA 1NVVR 4TZ0A 2A3RA 1T91A 5L3VA 4PHTA 2BWJA 4CYMA 2WPDD 5TMPA 3I3SR 1D6JA 4LJ4A 2BKEA 4B32A 3FPAA 5BXQC 4F92B 4IXNA 2JATA 3AVOA 3KFVA 5KNDA 4Q47A 4PANA 3VX3A 1NRJB 1T3HA 1Z0IA 3C5CA 2L4EA 5HE9A 1W36B 2WSSA 4O3MA 1NIJA 2RMKA 1KI6B 1NVVQ 3TUZC 2REOA 4MGZR 1Q3TA 1KKLA 3AKYA 2J46A 4AK9A 1OKKD 1YZUA 2UKDA 3UMRA 4P3YA 5CM9C 4AIIA 1E2FA 1VG0B 2PT7A 1R10A 1OKSA 4JVMA 4CGZA 1DAHA 3U6KA 4RCYA 1IY1A 3KJGA 4LHVA 4B3BA 5FL3A 3BB4A 4FCWA 1N5JA 1W0KD 1U8YA 4A82A 4D80A 1SVLA 2H57A 2ZRAA 1X1SA 4BLSA 1N0VC 1R0XA 2QM7A 1VKJA 4X8MA 2J7PA 4R2HA 1WRBA 5JS7A 2ZUBA 3RAPR 1W2HA 2QGZA 3EIQA 1TEVA 5L3RA 1G291 5L8VA 2XZLA 4GITA 5KTYA 2V7QD 3GJ7A 1H8HA 2J0QA 3PUVA 3L0OA 1CJVC 4TWZA 4P33A 2PLRA 4EJSB 2DB3A 5EP3A 1H65A 1P6XA 3D7MA 4TYYA 1JR3D 5E4FA 1TU4A 1ZMXA 4XVRA 4F4IA 3KTAA 4DDUA 1WP9A 3L2OB 3THYB 1QHHA 2WKQA 2IK8A 2JCSA 2AFHE 3C7KA 2FU5C 4IXMA 3ZS8A 2BIFA 2WPDA 1UKYA 2VF7A 3O47A 2Q9BA 2QMOA 3CR7A 3TBKA 3LBHA 2O8DB 3A1UA 2UVQA 3BRWD 3IBYA 1MH1A 2NO6A 2XXAB 4ZI2A 1CKEA 4Z51A 4QHYA 4JL6A 2GVDC 4KODA 5BQ5A 1TADA 1KHTA 2I3BA 4BUJA 2OFOA 4ZI3A 1PUIA 4KVAA 5F98A 4JLOA 3C16C 3N5CA 5FOUA 1V43A 5FUVA 4KFTA 4Q5IA 3W6OA 1ONBA 2PZEA 3IPXA 4HSEA 3B13B 4W5JA 3QE0A 2ANBA 4BFTA 3BB1A 1PUJA 1WGNA 4PZZA 1AS2A 1KJYA 1TQDA 4DT1B 2OFXA 4Z1MA 2IUUA 4LY6A 1ODFA 3TSWA 4PC6A 3ZD7A 4QC2A 2W83A 4I1VA 4EPRA 5LD2B 3VQTA 2EWVA 1RW4A 4R7ZA 1XDBA 4UNQA 1OQYA 4MKHA 3ND9A 5H68A 4W5HA 4DCUA 2BEKA 2QORA 3W5JA 3DMNA 5E7MA 1KYIA 2HUPA 2MMCA 5F9FA 5DN6A 3PUZA 4RZUA 3SHFA 3VFDA 4NPHA 3ZZTA 2P6RA 1TAGA 4TSFD 2JLXA 4CRWB 1FTNA 3U3MA 2G1JA 4PZYA 3TKLA 4P0TA 2WWIA 4TLAA 2Q0HA 2CJWB 3GCGA 2VRWA 5CITA 4DLYA 1II8B 4XIGS 2WOOA 3UWKA 2GXAA 1T3SA 1G3MA 2GZDA 4F7WA 3VNVA 2IHBA 3QXCA 1X37A 4QJ5A 2EFGA 1ZNXA 2ZR0A 2AWOA 4PHFA 5LPNA 1E2HA 2ZIAA 4YMVA 3KJIA 3QPUA 4ZKDA 1M7GA 5DH9A 4JIMA 2WOJA 2FPKA 3P32A 4US2R 2CNWD 1JNYA 3AVXA 2QP4A 4FXPA 3FDIA 4ASUD 1OV4A 3L8YA 3ZJYA 1E9DA 5FI0B 3BBPA 4YMSA 1CXZA 1NLZA 2CK3D 4K8OA 2GCNA 5TXGA 3LLMA 5G41A 2F1JA 1X3SA 1QRAA 4UNNA 4GT1A 1CR2A 2YKGA 3W3AA 3HPQA 5EZ6B 1QF9A 3EIEA 1JALA 2AK2A 2D3WA 2ZSAA 5E95A 4TL6A 1JPJA 1R6BX 1J8YF 1KZ7B 1KY3A 1Z0JA 5D3MA 4DC9A 2IS6A 3CWQA 2JY6B 2F43B 5EJEA 3F3YA 5B2ZA 1TF7A 4PQFA 3MFYA 4QHSA 2OLJA 2QE7D 4BECA 2VP4A 3EAQA 1Q1QA 3CH5A 1E9SA 5EE5B 4KYIB 4XSGA 2MMGA 2NMVA 2DAKA 2CP8A 1TEXA 5AJWA 5DYGA 2FFAA 2ZJZA 2WWGA 4EFMA 2FA9A 2BM0A 1XMIA 2RGXA 3P26A 4TMTA 1E9AA 4KV9A 3RS0A 3CF6R 1FP6A 4EJSC 1E1QA 1BMFA 4NH0A 2XOKD 1E94E 1P9RA 3FHOA 5SZIA 1B0UA 2BBOA 4LYJA 2MR9A 2OFWA 3AJIB 1SVSA 3KQKA 1NSFA 1E0SA 3VR6A 1NJFA 2P6UA 4I4LA 5KPDA 2O8BB 1FNMA 4H9GA 4URYR 4DSNA 4RY2A 2BBSA 3SNHA 2REBA 3EXAA 1Q44A 1GTVA 1SXJE 3B1WA 3EZ6A 1K6MA 1EX7A 2XXAA 4ACAA 4MQBA 5IHPA 2AR7A 3GLIA 1R0ZA 2ZRDA 3CNNA 3LWNA 4Y0AA 4DRZA 5FBVB 4M53A 2ZRHA 4URZR 3LRPA 1NI3A 4G3XA 4N0DA 4U5XA 4UN2B 1OHHD 1ZUHA 2GRJA 3BFKA 3LCVB 1DAFA 2XB4A 5CLLA 2OCBA 3LQQA 1WR1B 2A5JA 4BE7B 3KUCA 1DO2A 3F0TA 4V0LA 5FR2A 5JWRA 1TTTA 2XB2A 3WHLA 1CR0A 2VF8A 1CIPA 1O87A 4HAVA 1VCIA 2AXNA 3EZ9A 4LV8B 4P32A 4NBSA 4FWTA 1G8YA 1Z08A 2JLSA 1RC8A 2VEDA 3AVWA 2WTUA 4JVNA 2GDJA 1DARA 2WWXA 2NQ2C 3U44A 1G18A 2GKSA 1CUKA 4DXAA 5EXTA 4G5GA 3CPEA 3KXIA 2GVZC 1W5TA 2ZJOA 4M9SA 3T5GA 2V1XA 2B21A 4Y0VA 3DPUA 4JLVA 1G41A 3VHXA 2GF9A 2VO1A 3RSOA 2LVQD 1XF9A 2V4ZA 1RRFA 4LGMA 1ZAKA 2RGGA 3R7WB 1CBUA 1ZW6A 1UEJA 3PUXA 4Z54A 5IF9A 1JEEA 2AWNA 4U00A 1OIXA 4BEJA 3ZVNA 1XBTA 2VSFA 1XB2B 1M34E 2L2DA 3ZH9B 3IHPA 1XU4A 2QPAA 1XZQA 4KO8A 4V02A 2HEIA 2QAJA 4M1OA 1M7BA 4Q4JB 1ZNYA 3BS4A 1OXVA 3GLHE 5FOTA 4RD1A 1L7VC 3HP1A 5JI2E 1IN6A 2HF9A 5SZKB 5P21A 1VEKA 3ECCA 2Q21A 1W47A 4EPXA 2NPFA 3THOA 4GZMA 1SXJC 1YJ5A 3OFND 4MYCA 1OW3B 3T35A 1Z0FA 3E2IA 1YU9A 3WHKA 3ZVMA 2W0MA 1T8TA 3AV0B 4J0QA 5JLJA 2K0BX 4RFVA 4TL9A 3LX5A 1M1YE 5KSPA 2GXUA 2KE5A 2AD1A 1E2EA 4HB4A 4DJTA 2IYUA 4HAWA 4XWOA 5FOVA 3KQLA 5D3QA 4QNRA 4OHVA 4EDHA 1K8RA 1PVOA 5FL7A 2VP2A 2PJRA 3PENA 2FPMA 4K81B 1KJZA 3CW2A 4A0GA 2C2HA 5C1BA 1E2NA 2NO9A 2EFDB 1II0A 1L8QA 2GZAA 1ZM3A 5EP4A 5FTLA 3TLXA 2DKLA 1R4AA 5DNYB 2VHJA 4OQNA 4KCGA 4MGKR 3CPHA 1QHNA 1WJ7A 3RANA 3TVTA 4BZQA 3LY5A 1MN3A 2ANCA 2JZ1A 4GRAA 3TK1A 1E2MA 2JLQA 1TL7C 4MKFA 1L4UA 2RH5A 4TTRA 3K70D 3GP8A 1IN5A 1QDEA 3AQ4A 4G0NA 2ZJYA 2GJ8A 2XEXA 1A4RA 1DADA 1P9NA 3F8TA 1JR3E 3D3QA 3D31A 4FMBB 3KUDA 3BK7A 2A5DA 2JP7A 4F1IA 4AI6A 4JLPA 1OXXK 1IQPA 4M9QA 3K0FA 4P4SA 5AJXA 1JQLB 2X2FA 3NWJA 2O8FA 3AEZA 1NN5A 3BH7A 1ZBDA 4U02A 1ZC3A 3ZQ6A 4F2LA 1VYVA 1H8HD 5BWMA 3SN6A 5G40A 2JJ1D 4DCVA 4OK3A 4BPBA 2OCPA 1QZMA 3K9LA 2BMJA 4OI4A 4TN1A 2CHGA 2J0VA 3FMFA 1OSNA 1DE0A 3ADDA 1E98A 5LD2C 1ZNZA 2LKDA 4O2RA 4BRWA 3ADKA 4BQSA 4N1AA 4IDPA 2DWPA 4OI2A 1AKYA 1N6LA 3AUXA 1VPLA 3W8NA 2OXCA 3QVUA 1K5DA 2R6AA 3FTQA 3QKRA 2K9DA 2QL6A 5KYKA 2H5EA 1Z0AA 2DENA 2R6GA 4A1FA 4IDOA 1F2UB 2CHQA 1PZNA 4PQYA 4D0GA 1KGDA 2DWQA 2ERXA 2GA8A 1KK1A 3K0AB 2A2ZA 1NVMA 1HH4A 2ODWA 1UPTA 5EE1A 2PX3A 1XTJA 4CZ2A 3THYA 1E79D 3U3JA 4PTLA 2YC2C 4LCBA 3OIWA 5KUTA 5UKDA 3ETLA 2ZE5A 1FUKA 4MA4A 4DUGD 1OH5A 3BJIC 2V3CC 2JAQA 3OAAA 1P7CA 3B1ZA 4FCVA 3I61A 1SVOA 1WMSA 3I8SA 2HCJB 4DDWA 4RCZA 3B6EA 2VHQA 3A1WA 4LYAA 5KO2A 1CLUA 1MO3A 2P65A 2GEDA 2ZRMA 2GJSA 1V5WA 2QTVB 3C5HA 1EFRA 1DVRA 1S2MA 5LBIA 3AH8A 5KSOA 1E32A 4MGYR 1NJGA 5FPTA 3QI2A 1IFYA 2D4HA 1XB2A 3R7WA 3IO5A 1GKUB 4C4PA 3X1ZA 1P73A 3QBTA 1US8A 1GRRA 2ZI7A 1G5TA 5B30A 1XCGB 2OAP1 4NP6A 1DG1G 4AKEA 3HU3A 5JJLA 1DAGA 1XTKA 4QGAA 3CNLA 2HT1A 4TZ6A 1KI9A 2QNRA 2FFQA 4DT1A 2KNVA 4IDNA 5FPKA 2CHVA 1R7RA 1S3SA 3A4MA 2DWZB 1Z83A 2Q3FA 5GJBA 1E2DA 2PL3A 3J81k 4Q4JA 2ZJBA 1S3GA 1XP8A 2P67A 1AIPC 3KJHA 5G3YA 3GJ4A 4JKIA 2R62A 3BGWA 2QE7A 1XTQA 4B33A 4BRUA 4CEJB 3HU2A 1HV8A 3KKMA 4AC9A 3U61B 1E2LA 2IYXA 4JLJA 4B34A 4CW7A 2ZYWX 4CF7A 2YWFA 1US8B 2W6IA 5FL7D 2J0UB 4NMMA 1Z63A 2OOAA 2NZJA 2RKOA 4IFEA 1XEWY 3UG7A 3W8RA 3I72A 2HWJA 2IYYA 4TL7A 2WMOB 3VHLB 2DZNB 4Q18A 4LBZA 4OKSA 3GFOA 4JYBA 3FRIA 4Q9IA 1ZUNB 1E9EA 2EU8A 4RZ2A 1E9CA 4LHYA 5LB4A 3GD7A 1DO0A 2H18A 1NV9A 3ZIAA 2J87A 3ZIAD 4TMXA 5JWOA 4LBYA 5FBWB 4A2WA 1OXSC 4B73A 4WVFA 2BBTA 3KKOA 3DKPA 4D4LA 4MUBA 3Q5DA 1NSTA 3GJXC 3L8ZA 3EPHA 1BS1A 2L4FA 1CEEA 5KDLA 3QPWA 4DBGB 5L3QB 5IT5A 2AHOA 2R6FA 3FOZA 3CB4A 4D0NA 2I1VB 4A92A 3I5YA 2IYZA 3QOFA 5LDDC 2OUKA 3Q72A 2VHTA 4V0OA 3B1XA 4D6PA 2X2EA 3TUIC 3PITA 4ZIRB 5CYPA 3B9QA 3FE2A 3BH6A 3SC3A 4UQOA 3NDPA 3KDSE 1E2QA 2HAKA 1XWIA 1F60A 1G21E 3E70C 3QKSB 1T8UA 5DHAA 5J4YA 1HUQA 4B3GA 3C14C 1G4AE 2ZR9A 1Z06A 4NYIR 2J41A 2QPOA 3C8UA 3K9GA 2IYRA 3RWMB 2CE2X 2OZEA 5JRJA 3IQXA 4JLDA 2V6JA 3AVYA 3IEUA 2X77A 1JR6A 4JBXA 2FV8A 2JDID 4HB3A 3TIFA 3EWSA 4F4CA 3IHLA 3CBQA 1EG7A 1P9WA 4QG7A 2DY1A 2ZI9A 4MKGA 5F2EA 4B71A 3QF7A 4HUQB 1X86B 2YVUA 1LW7A 1BYUA 3QKRB 4LX0A 4XVQA 3BFXA 2IYLD 2ERYA 3L82B 1CJKC 4IVQA 4DEXA 3OEED 4HLCA 4US1R 1VEJA 1P4SA 2H7VA 3MGCA 1C1KA 4D2IA 1WBBA 3RLFA 3IO3A 4TQUS 3QXSA 4DLSA 3CRQA 4NYMR 3U60B 3SJZA 1R5BA 4OJKA 4EQ6A 1N5IA 3VR2A 3CF2A 4MRVA 3FE3A 3ICQB 1C7YA 1XJ0A 2PZFA 5H70A 2WWHA 3TJZA 1PV4A 1XZPA 2VP6A 1VECA 2W00A 2A30A 5LB2A 4C0BA 2IXFA 4PO9A 4KAXA 3DOEA 2QNJA 5FBLB 3ZZ0A 4AG6A 4XTRA 1ZIOA 4A8JC 1V92A 2F7SA 4KYUA 4LWZA 3BD9A 1GG2A 3EC1A 3LCUA 4L5BA 3DZ8A 1YR7A 2C95A 4ACBA 2WKPA 3RDPA 2JGNA 4QM6A 2DHYA 1JJVA 2BWBA 221PA 3KZ1E 1G17A 4GMXA 2CK3A 4ZPXA 3F92A 1P2SA 2GF0A 3CONA 1T9HA 3M0EA 5DISB 3RS3A 2XNDD 1M7HA 3H84A 1E69A 2OBLA 4F4JA 3THWA 1UF9A 4XVUA 2J1LA 2WWWA 1R8SA 3GEHA 1NVXQ 2ZJAA 4LHWA 2KHHA 2I4IA 5KDDA 5JI3E 3GFTA 4N3NA 4QRHA 1XMSA 1KNXA 4Q4AA 5FTJA 2BVNA 2IYWA 3TMKA 3WP0A 2JLZA 2ZAMA 1J90A 521PA 2IHYA 2XX3A 2IXEA 1KMHA 2ZVQX 1KO4A 2HJVA 3KX2A 4DLUA 3FGNA 1KZGB 3RHFA 4XH9B 5J4KA 2HLDA 4PSKA 1DTSA 4URXR 4U7DA 1HT2E 3TAUA 5H8WA 2QQEA 4MRNA 5JJKA 1S96A 2VSXA 1GILA 1ZIPA 4KBGA 4LYHA 5SZJA 4EJSA 1WBDA 4CEHA 1MABB 1W36D 3LQRA 1U90A 1CJUC 1G7TA 1KI8A 1T5LA 4JLNA 3EASA 5AJVB 1E3MA 4V0MA 3UK6A 2KNAA 1W4CA 3MAAC 3E1SA 4QGFA 1GSIA 4C0KA 1ZVQA 2W2XA 1NVUQ 4FMCB 5JRZA 3FFAA 1GNQA 2O8DA 1G7CA 1MT0A 2O0KA 4BFXA 5FPHA 2DAIA 2NTYC 1HY3A 5AWFC 1E96A 3RS7A 3ZVLA 5BN4A 2YJTD 5CJ2A 3SU8A 2F1HA 3PV0A 2F43A 2DFNA 1IY0A 1SXJB 1NN1A 3K0EA 1T5IA 4LV6A 4KLZA 2O0JA 3EPKA 3PVSA 1DAIA 2FWRA 2YINC 1ZCAA 1Q1BA 1A1VA 2QZ4A 2HXSA 4BLPA 4E03A 4NCNA 4TQ9A 1OT3A 2NO0A 2DZOB 3N2IA 3NBYC 4YDSA 3LXRA 5M04A 1XPOA 1TR8A 3BAFA 4JL5A 4OQLA 4HZUA 3TGPA 1N3BA 4UXIA 5JECA 4NYMQ 1W49A 3OHMA 4LBVA 2E9SA 1Z2AA 1E1RA 1IHUA 4E07A 4B6EA 4EFLA 1Z6TA 2ZRFA 5IRCD 3TW4A 3CRRA 1KI2A 1X6VA 2OSBA 2WZQA 5FUWA 1GFIA 2KSQA 3T6PA 1OFIA 1Z6GA 3GJ0A 2R0IA 1DAMA 4Q9HA 1YHNA 1RIFA 2DWOA 3FKQA 3VR1A 1KO1A 1OF1A 3DEFA 1PLJA 2FEMA 2DHRA 4YXWA 1OYYA 1ZUIA 4G5QA 1Q02A 3JZAA 2J7KA 4C9BA 3I62A 5JSZB 2GK6A 4JZKA 1KMQA 2G1KA 2JZ0A 2IF2A 3G0HA 3Q9LA 4C0QC 1E2GA 1JEDA 1II8A 2GILA 2ZS7A 3Q8XB 3WNBA 4YMTA 2BKUA 5DE3A 3PFIA 1BKDR 5E7IA 1I4LD 1KDOA 4NZYA 5K8TA 5FI1B 5A4JA 2SHKA 5DHFA 2GEUA 1GIAA 1RZ3A 3K70B 1ZMVA 1MRNA 3F5FA 5DO9A 4EQ6B 2H16A 4KJZA 2WVJA 4V0ME 4GOJA 1JXMA 3MWJA 1NKSA 4ILEA 3UANA 3THXB 4B44A 1LS1A 1OIVA 2IXGA 4QBGB 2KNZA 1JAIA 2OT3B 2UZIR 2ZUDA 3B9PA 5FUYA 1M8PA 3FB4A 3I32A 4OYHA 3AM1A 1T0JB 3FFBA 2WSSD 1G16A 4KXFB 2J0SA 4XJXA 3K8YA 3CZQA 5IK2A 2YWHA 4TLDA 2YV5A 4YMUA 5AUPB 5CLQA 2QT0A 2V6ZM 2C77A 2C9OA 3CPJB 3NG1A 2J9RA 1VDZA 3EPLA 1CP2A 2WJIA 2J45A 2FGKA 4TT3A 2BV3A 2RGNA 1XXHE 3C41J 4B43A 2ORWA 3RS2A 4ZV4A 2OLKA 1RVDA 1XPRA 3I1FA 4JVSB 4WZBE 3SJBA 5TVKA 2DYKA 3DM5A 1WXQA 1KI4A 1NMYA 2E1RA 4LPKA 5EE9A 4LV5B 2CLDX 2ZI4A 1U9IC 2WJVA 5JHGB 3O8CA 4B76A 3G82C 1I4DD 1CRQA 2IF0A 2OBMA 4A2PA 2RGDA 2VLIA 4Q02A 4Q1DA 1JQJC 4DSTA 1YR8A 1ESMA 1FFHA 1VCMA 1XEWX 4A6PA 2ZSDA 3ZVRA 4C0JA 5JS8A 1HJPA 5DGXA 3RYTC 1U81A 3DZDA 1G5PA 2CLCX 1XEFA 3EZ7A 2MGWA 4Q7KA 5E7JA 3RRZA 1XEXB 3DL0A 4CEHB 4HDQB 1UKVY 4Q4HA 2Q9AA 1OHHA 3Q7QA 3T34A 4CEJA 2JJ2A 2DAMA 2MJ5B 3A36A 1JI0A 1FZQA 3S1AB 1G64A 4MKIA 1RRGA 4Q1EA 1KKMA 1LB1B 1WE2A 4Q7JB 3E21A 3LAWA 3K9NA 3X1DA 3UIEA 4DB4A 2DR3A 4M9XA 1CRPA 3B7GA 1AS0A 1D2EA 4P4TA 4AD8A 1NBMA 4QM7A 2AD5A 2HYDA 4P4UA 5DIFA 3K0SA 2PEYA 2IT1A 4BFWA 1SKQA 2QT1A 5FPYA 4LK2A 2IBMA 3FHTA 3QKTA 1Z29A 4ZDJA 2F1RA 1W0JA 3I4LA 5DSZA 3RVBA 4F38A 1VG8A 1U98A 1ZP6A 4TYQA 4PFSA 3TR0A 4L8GA 1BMFD 3U7GA 2O8EA 3U44B 4IOMA 4YDHB 2DPXA 3VTKA 4UNPA 3T1VA 2BJWA 1SXJD 3MSXA 2ODNA 3R8FA 8OHMA 2HCBA 4IEEA 2JDIA 4EFNA 4GZLA 2P3SA 2QSZA 1UBGA 3M1IA 2JIZD 1UKZA 3T61A 4LHZA 4JS0A 3IKJA 4YMWA 3GLFA 2A78A 1XFAA 2QRZA 2ZXUA 5CYOA 2YNMA 1ZU4A 2F9LA 3ZQJA 2GHIA 4ZIRA 2OILA 1H8ED 1WHCA 3CRMA 1OTRA 1BIFA 1IAQA 5CDFE 3N2EA 3PIRA 3O8BA 3A1TA 1QHGA 4HAXA 2PEZA 2HXYA 4OHWA 1RRCA 1SVIA 2V1UA 2VP5A 4X8HA 2XZOA 1DAEA 4L9SA 1ZM7A 1VCNA 4IJMA 4UKDA 1U2RA 1RJ9B 1XD2B 2OE2A 5L3SB 3OE7A 5J4HA 3W6NA 1XMVA 3K70C 3RS5A 3W90A 3GLGB 3VR5A 1SZPA 3DMDA 5GVSA 1SGWA 1GZSA 6Q21A 2OXRA 1VG1A 4LC0A 4NCKA 2W2TA 3NEJA 3N70A 2QM8A 1E9FA 1VDLA 3CLVA 2GXSA 3E5HA 1ZMUA 1AQUA 2FSGA 2CNWA 1RPZA 2WIBA 2HF8A 1WA5A 3QF4A 1NG1A 4YQFA 1BOFA 1QVAA 3SBEA 2YOGA 1F2TA 1KI7A 5JMTA 5TY0A 4BFUA 2ODBA 2CWBA 2YZ2A 4PC3A 4EPVA 4HUQA 2Z6VA 2BJVA 4ITRC 3SBDA 1ELOA 1XCPA 1ZNWA 1GM5A 2FDCA 1G3RA 1VQ1A 2CBZA 2JJ1A 2DFLA 2QAGA 1EGAA 4LRWA 2DBYA 2W6ID 2DNAA 1G7RA 4M8NE 3REFA 4URVR 1P2VA 1T3LA 1J70A 5EXPA 4TMVA 2FF7A 2CCGA 3AF3A 1DS6A 2RGEA 2R9VA 1JBKA 1Z0KA 2XZPA 1CR1A 2R6CA 2ZRPA 5KPJA 4Q00A 5AR1A 4HAYA 4TMKA 4Z8YA 2N46A 4V03A 2FH5B 1IXSB 1XJCA 1ZCBA 1TMKA 4W5WA 2G0TA 1LVGA 3VNUA 4S35A 2V7QA 1P3QQ 4Q4LA 4Q1CA 2JLWA 4QBHA 5BYJA 1QHSA 1N25A 2VIIA 3BB3A 4NCIA 5CM8B 5FBRB 5ELXA 3Q85A 5GJVC 3PR1A 2W6JD 2ZI3A 3WYAA 2GAOA 2B8WA 2ZRNA 1C4OA 1E4YA 3H0KA 4PAOA 4QFMA 3B5JA 3SOPA 1II9A 3WMFA 1NY6A 1KI6A 5FOXA 4KITB 2YC4C 1XEXA 2P5TB 1R5OA 4HLQB 4LSGA 1KDRA 2F6RA 3OEHD 3EPJA 1KSFX 1MO4A 3AP1A 1U8AA 3MMPA 2ZE6A 1SG9A 4NYJR 2XNDA 2W6JA 2GESA 2ZU0C 1MABA 1I2MA 2IL1A 1VEGA 5HKKA 3P20A 5L3QA 4AKGA 4LJ7A 3K9OA 1GAJA 4A0FA 2G3QA 1W0JD 3FRHA 2PT5A 4I81A 3WYGA 4WZ6A 1WIVA 1TQ2A 1Y3AA 3CR8A 2DCUA 4GSYA 4KLNA 2ZU6A 1HURA 2ZPTX 3B82A 3W9YA 1GOTA 2CE7A 2ZE7A 4IFBA 5GVRA 3GLGE 1MKYA 5CDFA 2VH5R 3RRNA 3TW8B 5KNCA 4MH0R 2QSFX 1AZTA 3ZZUA 3WRXC 2XITA 2J7PD 1EWRA 4FN5A 2KB0A 1DELA 3CRVA 4A8JB 1AN0A 2JNHA 5B58C 5AJZA 4M0LA 1RYHA 1FQKA 4BEBA 4AY2A 3H1TA 4RFSB 1G8HA 4BFSA 4A9AA 821PA 2JLUA 1N6OA 4QKQA 3U7FB 3AKDA 2P6NA 2Y8EA 3BORA 1ZD9A 3U4QA 3EA0A 3PXGA 4HYYA 5FH9A 3BOSA 4AURA 3ZYCA 2IS2A 2H5XA 2WWYA 2RGNC 2BWEA 2WM9B 3JVVA 2WWFA 1SKYB 3RNLA 2PMDA 4MYUA 421PA 2ONJA 1A7JA 5B64A 2MSEB 2WKRA 4QOSA 1XCMA 1W46A 3WP1B 2DVWB 1AS3A 1N6HA 2J3EA 4D4JA 3RABA 2WZJA 3EW9A 3K0CC 3H4JA 2GJKA 3SE0A 2OG2A 4TTPA 3T12A 3OE7D 3NTUA 4BGDA 5ANRB 2ZM5A 2D7CA 2JJ2D 1G19A 2OCYC 2QY9A 2HV8A 2C8VA 4Q9JA 1OYWA 1OPXA 1W4AA 4TL8A 3GQBA 1F2UA 3I5XA 2XSZD 2JUJA 1W4BA 1NKTA 3NKVA 2RAPA 3SDZA 4C3ZA 1EFUA 4UJ5A 4FMDB 2QPTA 4TMZA 2QN6A 1NL3A 1ZM2A 3TSZA 2B92A 4RD0A 5C4MA 2QBYA 3OIVA 3U3RA 1P60A 1TF2A 4FMDF 4NCHA 2V54A 1QZEA 2FJUA 4HUTA 2J5XA 3WY9A 4MGIR 3CNOA 3EWAA 4NTZA 3Q5EA 3A58B 1C1YA 1OXTA 2YOHA 3CZPA 1XRJA 2AK3A 5EP1A 5CB6A 2LBCA 4DCTA 1IXRC 2JY8A 3R8CA 3AF4A 2FMXA 4M21A 4PPNA 4TT3D 1CF4A 1FMLA 3PUYA 4E22A 5J4VA 4HI0E 3WMGA 2ZSFA 4DCNA 1ZM4A 3QG1A 1RKBA 2R44A 2VHUA 3OIUA 1GRQA 5JCPA 4C7OA 2ZE8A 2XJ9A 4Q1BA 2DZLA 2R8RA 3KKNA 4GP6A 3C15C 4WXPA 2QG6A 2OESA 4YLGA 4PC7A 5SZHB 1Y8GA 2GXQA 3W5IA 3BIFA 1YRAA 5G53C 4B6FA 1UAAA 3LVQE 4ASUA 1OFUX 2RGCA 2NZ8A 5FFMA 4ZCIA 1E2PA 4PHHA 4A3VB 2FFBA 3DM9B 4LUCA 3ZLJA 3MLEA 1F5NA 1S8FA 1G5RA 5KU1A 2FGJA 2GJ9A 1S0UA 1AIPA 4C30A 4TMWA 1T4GA 1E9BA 1ANKA 4R2IA 4M4SA 4PO1A 4WA7A 4URUR 2LVAA 3IDQA 4LJ5A 3RRYA 3AVUA 2LTUA 5EXXA 1A2BA 4DWJA 5IK2D 4GEWA 4B74A 3C4JA 1MO6A 1OFTA 3EZFA 1R0YA 1IBRA 4TQAA 2IWHA 2DAGA 3QVVA 1LF0A 4AG5A 5DLQC 2XTZA 4GPTA 2ZRCA 4LJAA 3MWKA 2N42A 3LFUA 4YXWD 2H8KA 4M1YA 2YYZA 1FL9A 4UJ3A 4CT4B 1YZKA 5KHOC 2G88A 3THWB 2VBCA 2O25A 1G9XA 5FOSA 4TLEA 2FEOA 3SYKA 5KOYA 4LJ9A 2G6BA 3THXA 3QNUA 3UWOA 5HPYB 5JFGA 3O8DA 1N2CE 2WJHA 2X19A 1X8KA 3QY0A 1KSHA 3NVAA 2F3TA 1DOAA 1C9KA 2LCFA 1R4GA 1AZSC 1AKEA 2B6HA 4RSGA 4QGHA 2F1IA 4O0MA 721PA 1HQYE 3X1XA 2NIPA 3SS8A 3PEUA 2BDTA 4PAQA 4C2UA 3NH6A 2X8AA 1ZD8A 2N1BA 4PPFA 3IEVA 2C98A 4Q1FA 2GZHA 1Y63A 4QBFA 4Q21A 1M74A 1YVDA 2GBLA 1U94A 1T6NA 2H17A 1VG5A 3UPUA 2KBFA 3BXZA 3W34A 1AA9A 2GNOA 2QEQA 1AGPA 3HU1A 4DDTA 3HR7A 1JECA 5FTMA 2I1QA 3KKPA 1P2UA 5JEDA 2Z4SA 2XJ4A 3LH5A 4PX9A 1TTEA 1TU3A 3LVRE 2CCJA 5DYIA 1E79A 1KIMA 5HR5A 1RJ9A 1XD2A 2VL7A 5L3SA 4RD4A 1OAIA 4HAZA 2V6IA 2W58A 5FOWA 2QMHA 4M1MA 2P0EA 3GLGA 2Z43A 3QF4B 2JASA 4URWR 2W2VA 1NBME 1GKYA 1Q57A 4DLZA 2MSDB 1OXUA 2VA8A 1E1RD 3FYHA 2NG1A 4A4DA 4XD7A 1Z2CA 3LW7A 2V8OA 1XNJA 4PHGA 5EE3A 1EFCA 3LA6A 5EUMA 4L16A 3FMPB 3NDBB 2Q9CA 2ZETA 1UEIA 3VMFA 2ORVA 3SQWA 2Z5FA 2E87A 621PA 3ZD6A 4IVPA 4JLKA 1H8EA 1ETUA 4AYWA 3MCAA 4AYTA 4DSOA 2QTHA 2IYTA 1OKKA 4KBFA 4B3CA 5D3MB 1E0KA 3H86A 1E1QD 5DI9A 2LVPC 1E0JA 2CVFA 3KXLA 3SZRA 4C7OB 1IN8A 3Q3JB 2CXXA 2QP9X 5B57C 2XGJA 1EXMA 2G3YA 1PLLA 3WYFA 1TF5A 1YZQA 1KNQA 4JT2A 4LHXA 5JWHA 3KQNA 4JLBA 2KBEA 3K09C 1J8MF 5C4GB 2LVOC 1SVWA 1N6KA 3K09A 2IUTA 2RRUA 4DLVA 3KQHA 4DLRA 1NIPA 4KFRA 4PR0A 1YRBA 2BMFA 1HQCA 3CH4B 2B8TA 3FWYA 4LPSA 3GLFB 3U7HB 4HLUA 3T15A 2WIAA 1RFLA 1KO8A 2ZJ8A 2R6DA 3CX6A 1P75A 1NG9A 4FMCF 1Z6YA 1N6IA 3H2YA 1DBSA 4HB2A 3AP2A 4XD7D 2QRNA 2CEAA 4FCTA 4LRTA 4G3OA 4WIAA 1G7SA 3AKCA 2BC9A 5BW8A 3L43A 3QSYA 3PUWA 1IJEA 2BM1A 4FWDA 2RHMA 3AVVA 4HZIA 1B23P 2PBRA 3KFXA 3DDCA 3NIBA 2BCJQ 3IILA 4AYXA 5GADl 2ZI5A 4C0SA 4MITA 2B3TA 2FX3A 1ZU5A 3B60A 4Q9LA 4ON9A 4Q03A 1JR3A 1BH2A 2QENA 1QVRA 4L15A 2XOKA 2JLRA 1KJWA 3AKEA 4JKYA 2ZROA 4M1WA 2ONKA 4GDFA 2JY7A 1HA3A 4FIDA 4OQMA 1FNNA 1GITA 4BFZA 1D9XA 2RHDA 3TAHA 4UXJA 1QBKC 3SEAA 5KDOA 4QL3A 3KQUA 4WW0A 4M9ZA 1AM4D 1Z8FA 2H92A 1N0UA 2Q3HA 4I1UA 2EYUA 4Z8XA 3AP3A 1YKSA 1BYIA 4Q19A 1COWA 3TQCA 1W0KA 2FZLA 1LY1A 3K1JA 3EARA 1ZM9A 4IVRA 2A5GA 4M1SA 4MRSA 2KI5A 2JIZA 4CIDA 3QEOA 2GCOB 1P3JA 3CUEF 4R71A 3X1YA 4WBSA 1NMXA 4JT4A 1FUUA 4W9MC 3Q7PA 1FX0A 1O3YA 3O8RA 2H1LA 5CB8A 1P61B 4QXAA 2AX4A 3NBXX 3K9HA 4TLBA 3OF5A 1ZJ6A 1GP2A 1N5LA 1F3OA 1GDDA 2BHRA 3VAAA 2OOBA 1WF3A 2NO7A 2FZ4A 1G6OA 2V55B 3LX8A 2QA5A 5KSYA 4BLRA 5KNBA 5JZVA 5K8UA 2XNSA 1FTSA 4PO8A 2CLSA 1YZGA 1CJTC 1YLAA 2A9KA 5GJCA 1KDPA 3P4YA 1EWQA 4X8LA 1KMHB 3PJRA 3U5ZB 3MWLA 5F9HA 3PCRB 1NN3A 3IGFA 5TV2A 2CDNA 4D4MA 2ATXA 2PCLA 4I99A 4EKDA 4PC1A 1COWD 4Q7LA 4RD2A 1G8GA 1UBEA 3QKUA 3PEWA 2VYFA 1TQ4A 3HJNA 1JXOA 1NMZA 3HYRA 1SHKA 2ZEJA 2RB4A 1JAHA 1YZLA 4BFVA 4A15A 4KSBA 4A2QA 1IXSA 4IDHA 1RE0A 2AL7A 2TMKA 3PEYA 4NL4H 5EXSA 4RZXA 2ZANA 2QP3A 3UATA 1UDWA 3SJAA 4DBLC 3IQWA 1L2TA 1VHLA 4ZO4A 4B2IA 4PC2A 4CT5A 4FW9A 5HKKD 2WJJA 3P4XA 4XOIA 3DOFA 1GVNB 1X8LA 2J0UA 2REXB 4NKRA 4XTCS 4MYTA 1KOFA 3MJHA 2AN9A 4XWAA 3CKLA 3FKSD 4KVGA 3UMSA 4Q1AA 2CL7X 4DIDA 4LJ8A 1P72A 1RYFA 1I4TD 5C46F 3RSLA 3CO5A 2FSFA 4ZCMA 2ASEA 1IN7A 5CIQA 2EKKA 1KK2A 5CIWA 3B2EA 3GMTA 1IM2A 2FG5A 4B3FX 2Z4RA 4G5SA 4HZUB 2F55A 1EK0A 4H1VA 1OH7A 3B78A 2EQBA 1G3QA 1K5GA 1Z22A 2OBNA 4M1KA 4OQXA 4RKEA 1XTIA 3SYNA 3KW6A 1EX6A 1KSJA 3NHBA 1EFTA 4IRUB 1W36C 1FOEB 1BO6A 1Q12A 3T1TA 3H4MA 3ONWA 3FHCB 2OCAA 3KXKA 4WAUA 3RRMA 1XTSA 3REGA 5AUOB 5C18A 1QHYA 2GCPA 2X1VA 4WXRA 4YONB 5FUXA 1N6PA 3GJ5A 1WCV1 3DKVA 4JBYA 4Q4HB 4EPTA 1EFRD 3QKSA 2O8CB 5HZHA 1P62B 2D62A 3DVLA 1W5SA 1SKYE 2G83A 3AVPA 4O2LA 3DHWC 4NCJA 2GBLC 5H1YA 2WICA 1J99A 3NXSA 4OJQA 1DAKA 3BH0A 5FR1A 2MSCB 3GJ8A 2KRKA 2EFEB 4PAMA 2R2AA 2ZVPX 2YOFA 4EPWA 5CK4A 3ZS9A 3MRSA 4RJLA 1Z0DA 3OAAD 3UG6A 2IEZA 1NN0A 1LFDB 2PX0A 2W0SA 4RFSA 4DCSA 3V4RA 5JEEA 1GL6A 2PH1A 4DB2A 1ZYUA 5EZ5A 4Q7MB 3B1YA 4MDFA 2EJSA 2GEVA 2A5YB 3FMIA 3VKGA 5IDVA 3T1QA 1XXHA 4F91B 5TARA 2NGRA 4FI3C 1VYTA 5AJYA 2PJZA 2KWIA 4D0LB 2ECKA 2V9PA 1OE0A 2IYVA 1HT1E 3M4YA 3UMFA 5DN6D 3KTAB 4TTQA 2JY5A 2FN4A 1FX0B 2GCOA 1JJ7A 2K5UA 3EC2A 3OFNA 5HCIA 3RWOA 4II7A 1E4VA 4B2LA 3BFVA 2WJGA 1CJMA 1VIYA 1GNRA 1G20E 3B85A 4B35A 4DDVA 4MDEA 1YE8A 2ZRIA 5JCZA 4BFYA 1M2OB 2D06A 2PLFA 2EYQA 2ZYVX 4JJKA 2DFTA 4LDJA 2IC5A 2ZQ5A 3V9PA 1VYUA 1W2GA 4BLOA 4TYNA 1XD9A 1QZXA 5J4LA 5TDHA 4DVGA 2P5SA 2QAGB 3IIMA 2IEYA 1KK0A 3FMOB 4UNSA 5TB5A 3T5DA 1Z5ZA 3WBKA 4ABYA 4FWHA 1KTVA 2ZRJA 4BASA 2HDNB 1AQYA 4RZ3A 4JJZA 1R8QA 4AKIA 4Q4AB 4A0RA 2IS1A 4D26A 2ORIA 2RGBA 3I73A 1QG2A 1LV7A 1Z6AA 4G5RA 4JBWA 2A5FA 3DO6A 3NBFA 3B89A 4R98A 4BZPA 2BBWA 1MV5A 1OH6A 3WNCA 4NYIQ 1UBCA 2ZUCA 4ZCLA 2IYSA 5AUNB 4AKHA 4KFSA 1KI3A 2FSHA 1ZC4A 3TVDA 4I1OA 3MWYW 3U3KA 3AVTA 2BOVA 2ZAOA 1OLOA 3GPLA 1GWNA 1W48A 4QNMA 5BN5A 3TUJC 1A82A 3OEHA 1A5TA 1QHXA 2C9YA 3T06B 2ZRKA 3GJ6A 5BN3A 1KAGA 4LOAA 4DZZA 1OB5A 2OHFA 4LRSA 1X8JA 3A1SA 3TR5A 3SR0A 4IHQA 3NC1C 2HT6A 1NF3A 3CX7A 3GLHA 3MG9A 5AK0A 1G6HA 1XD8A 3K9PA 2OM2A 1CR4A 5JBQA 1IJFA 3FVQA 1ESNA 3QPVA 4JN6A 3VR3A 4FD2A 2WHXA 4RKFA 1SQ5A 4PPQA 5EUQB 4ARZB 2IS4A 3OESA 4WZAE 4KSCA 5CJPA 3K53A 3L0SA 2XTMA 3X2SA 4CEIB 1PJRA 4V0NA 1GUAA 1N6RA 1Z07A 4NHOA 4F93B 1IN4A 3UKDA 1Q1ZA 1UADA 2Q6TA 4B2PA 1XPUA 2GJAA 3R20A 4LC1A 3LO5A 1KO5A 2FFHA 3A6PC 2IX3A 2QGNA 1DG3A 2YWEA 5JHHB 1D8TA 4CDGA 1XTRA 2PZGA 1EESA 4PSVA 4RD6A 1VG9B 2XAUA 5FBQB 3LW8A 3AF2A 1EFHA 4M1TA 4LBWA 4UNRA 3K0CA 3L0PA 4RD3A 3BC1A 5K8LA 1LNZA 3AF0A 5FTKA 3VR4A 4NU0A 1KSGA 1ZD1A 2OEPA 4B75A 2VP9A 1S9HA 4D81A 4A8JA 2O0HA 3HDTA 1KDTA 4GOKA 4OK6A 4L9WA 4D4KA 4I1SA 1F2TB 1W1WA 3IHWA 3EG5A 1G4UR 2ZREA 4OHZA 4S2EA 1XX6A 4NDZA 2IYQA 1XXHB 2CL0X 3AUYA 4L4UA 3W6PA 3GLIE 3HYTA 4B48A 4B47A 4DHEA 1NBMD 3GFPA 4A6XA 4EAQA 2LKCA 5HZKA 3VKHA 2YHSA 1T6OA 3SJCA 2ZRLA 2IA5A 2WSMA 2BCGY 1I2DA 5J5CA 3QQ5A 1UBFA 2AFIE 4D82A 1KY2A 2JJ8A 2D74A 2OAQ1 3QBVA 4JVLA 2PMKA 3QUSA 3ADBA 3TNFA 4TYWA 3JVUA 2Q3MA 3KJEA 2C99A 1DEKA 4OQFA 3QJYA 4V0KA 4DUGA 2QQ0A 1GRNA 2ZJ2A 2GTPA 1YR6A 2G0NA 4HEJA 3VU9B 5EP2A 1Q3HA 1Z28A 3NH9A 4OL0A 1LS6A 3LDAA 5G3ZA 3B8HA 2ZTSA 4MRPA 1VTKA 4MUAA 2ZRGA 3R9XA 2MROB 2F3RA 2AKYA 2IW3A 3E46A 1T43A 1GL7A 4TSFA 1PLKA 4HEOA 4M22A 1MR3F 2C04A 1D9ZA 1MO5A 1YR9A 3RC8A 1YZTA 1W44A 3ZGXA 4N0EA 2JLYA 1G3IA 1UKEA 5J47A 1NNEA 1U0HC 1D5CA 2FSIA 4Q01A 4R9UC 2B7BA 2YWGA 1E6CA 2OO9A 1ZRHA 1GO5A 5EQTA 4Q48A 4RVCA 2GAAA 1HTWA 1N6NA 3A8TA 3AB3A 4PQRA 4TYPA 2EVWX 1F48A 4TLCA 2EFCB 1D2NA 2WMNB 1WGLA 3QENA 3SFZA 3GLFE 3RS4A 4W7SA 1W7AA 2A7QA 1E2JA 5F3WB 1U0JA 1TX4B 4IKEA 4B3DA 1UFQA 5GJWC 3ASYA 4G1UC 4YC7A 2ZR7A 1GKIA 3OZXA 3HWSA 4QJ3A 1R2QA 3GLHB 1FPMA 4X8OA 4BWYA 1T0HB 5J40A 2CL6X 1J2JA 1W4RA 3PEVA 4E09A 4C0LA 1X1RA 2QUZA 2C03A 2Z83A 2CMKA 2WAXA 2XSZA 4BLTA 1OH8A 1Q0UA 2LWIA 4GNKA 2ZS9A 4P4SB 2FNAA 2VP0A 2ZS8A 1XMJA 5E3HA 3EX7C 1U99A 4KFUA 1VMAA 3LBIA 4EUNA 2IWRA 4H1UA 4HDCA 2BMEA 3AF1A 4QBIA 2O8BA 4ESVA 2ZI6A 3KKQA 4ZDWA 1GNPA 4US0R 4KHZA 1E99A 5C2JB 3SHWA 3ASZA 2ZTCA 3IECA 4IW3B 2HJGA 3LD9A 1OJLA 3GLIB 3BWDD 3CM0A 1IONA 1LF5A 2O8EB 1D2MA 3L0IB 3P1JA 4HLDA 4ZDIA 3P27A 1OIWA 3EZ2A 3I8XA 4FWIB 4D25A 2C96A 3NEYA 3QEJA 3U3OA 4EIWA 4DLXA 2WBLC 4OI0A 4DIEA 5BYKA 1IY2A 3EIHA 1KAOA 5HE8A 1SXJA 2EFHB 3UXMA 2LVNC 1MOZA 4WP2A 3FKSA 2DI0A 1R5NA 1L4YA 1S1MA 1FW6A 1CS4C 1VIAA 2OV2A 3LV8A 2JLVA 1YZNA 4HDOB 4E5UA 4MRRA 3GJ3A 4XSHA 1F6BA 1VCOA 3A4LA 1UDXA 4GI7A 3MHVC 4NONA 4Q9KA 3V00A 1NP6A 2QAGC 3B1VA 3A1VA 3SFVA 4C0HA 4JLMA 1TUIA 2QHOB 3QIAA 4LZZA 1F4IA 1E9RA 1Q22A 4A0HA 2QROA 3KB2A 2QBYB 2GETA 5HTKA 1WQ1R 3WRYC 3AGQA 4JLAA 5JJIA 1G3UA 3VU9A 1EFUB 1OFHA 2AKAB 1TUEA 3IIKA 3KB1A 2ZRBA 2NPIA 1DV0A 1IXZA 4QGGA 2WV9A 2FE4A 3MUFA 1NLYA 2XTNA 1S1CA 3RC3A 3ND8A 4GMDA 2O52A 5AUQA 5JSZA
chains in the Genus database with same CATH superfamily
4E08A 3MS2A 1LTHR 4R16A 4RTOA 3AOGA 1YQTA 1WMFA 2P4QA 3SIRA 1HYQA 2CZGA 4TKZA 3VMMA 2VHEA 3U7EB 5DI3B 4H77A 3FMGA 5FLYA 3NHFA 1DC6A 1PJAA 1FVFA 2Z2KA 1TZ2A 3CRW1 4QFCA 5CFRA 1CULC 2DBRA 5HQTA 4CKCA 2PG3A 4LZOA 4ENRA 1NW5A 1Z3IX 4NFYA 1TTQB 1NJSA 3D7NA 1XSEA 4J0EA 4X95A 3FBTA 3AHDA 5A5GA 1M66A 2ATVA 1RLMA 2H0AA 3F46A 4BX0A 4YMHA 2EKFA 3K2EA 3TE6A 3EB9A 2P8SA 4GP7A 3G2QA 2VT6A 5BSEA 3LXXA 3V4FA 5IN4A 3L05A 2I2WA 3CIOA 1UM8A 1YRYE 3NC0C 4EGJA 4Y9TA 1ISGA 1QGUB 3DLPX 4POAA 4NRDA 1BCRB 5C34B 3L4BA 5JZOA 4HLUC 3CF0A 3RSQA 2IBTA 3WXMA 2ZAYA 2HCTA 2VTDA 2BEJA 3DA8A 1ZISA 1AGRA 2ICAA 4BLQA 2XKKA 2XF2A 1P77A 4LJYA 1XTZA 2J3QA 4QYWA 3LXMA 3CF6E 4QUHA 3QEBZ 1K97A 3PNYA 2B69A 1TQ6A 3SQXA 1AJEA 1JP7A 2V0CA 4CR6A 1T1GA 4O25A 2AXPA 4D3FA 1JB1A 2V9ZA 4J0HA 5KQLA 4JSYA 1B6RA 1YACA 1JHVA 1JLKA 2Q6IA 3W4KA 3D6TB 1B76A 3OIYA 4HDKA 4EY4A 3I92A 3U4QB 2X13A 4RYDA 3U4HA 2WVHA 3QG5A 2O8CA 3BMNA 5J1SB 1DKUA 1SHZA 1Y7TA 1DLIA 2EIHA 1DV1A 3DKKA 3Q15C 4MVJP 4RE5A 5HCNA 3TM4A 4F3RA 4IOLA 3I12A 1EZ1A 1P2TA 1ZH8A 2VHCA 2L0XA 4N5LA 3NHAA 5F4ZA 4A5OA 3S1LA 1R4ZA 3OM9A 4RMNA 1A2KC 5MN4A 4U4AA 3ABQB 3TRFA 1B3BA 1LKZA 4GMHA 4W9NA 2QN9A 4LRSB 1U0LA 2WU1A 1MH9A 5CK5A 3T1OA 3IAS6 1VB5A 3MGGA 3ZV3A 1ZV1A 3KPVA 1QAOA 1M6NA 2BFOA 4X24A 1AKWA 2VTKA 3Q3CA 3VU3A 3LUFA 4ZQCB 3A37A 3QVWA 1AGXA 3RTCA 3W5BA 2P3OA 3E7DA 1RTKA 4XYEA 1SIUA 3KL4A 3MD0A 2GWHA 2CNBA 4RKQA 3PWKA 4CFZA 1PBTA 3G8DA 2WE8A 2GRAA 3GLKA 3I4CA 3P9KA 4K46A 5DWQA 1ZMWA 4ARZA 4F96A 4BZQA 3UJNA 3H2JA 5LWQA 3C24A 4S2UA 1IJBA 5BSGA 2G77B 4MEAA 4KKVA 2PUHA 1EEHA 5JFTA 5KQSA 2C78A 3GRUA 1NNUA 3P2OA 1NLFA 1N9GB 1VI6A 2GEFA 2HK8A 5AI6A 3COZA 5KSZA 1P45A 3TCNA 2NU9B 4DNXA 2PKQO 2D7DA 4XYBA 4LF6M 1X13A 2L82A 4NV1A 2HGZA 4R9VA 2IV2X 1YI0A 3PC7A 3NUZA 3W7VA 1ZSYA 4KPYA 1ENYA 1G8JA 3HDJA 2QMEA 1ACLA 3R2JA 4PLVA 3ZUGA 4D8TA 4DRXA 2XUFA 3OQIA 2CGEA 1H2AS 3B70A 5EE0A 1T35A 3ROXA 2GN9A 5HKBA 3COYA 1CZHA 3HPRA 1XJQA 3FYUB 5ICSA 3SIWA 4A8TA 1PWXA 2XCQA 4PSDA 3OHSX 2ASVA 3JAMA 1JH9A 1T2UA 3OOJA 5LXTA 1XZAA 2EX4A 1ADFA 3KVRA 4R31A 3N3BC 3HYNA 4PBSA 3ROFA 2PO5A 3IAXA 4CJXA 2YRWA 3ONFA 1K3WA 3PRJA 3VKWA 1YDEA 4OB7A 2OAGA 4DR2M 2VCYA 2F9MA 1SVMA 2X4IA 2D2EA 2ZXFA 4D4HA 5IABA 3C97A 3ICVA 3EZLA 4M6WB 4DR3M 4OHXA 3BFPA 3SBXA 4O2BB 3UMMA 121PA 3IAHA 5U1PA 4Y1EA 3ST7A 3W3ZB 2QI9F 4MV4A 3JXEA 3A04A 1IZ9A 5JTUA 3HKBB 4D41A 3KRTA 2CJWA 2JFGA 3O1HB 4MYHA 3TSOA 1KL7A 2A67A 3OBIA 1Q7EA 2UZ0A 3PQCA 4GL4A 1EQUA 2AN1A 1F8GA 1HOTA 1NHGA 4URHA 4BO2A 3ISJA 2Q3EA 2B7CA 4RE6A 4BYMA 1WPGA 3HXLA 4XUCA 1E5DA 1FX1A 2IUEA 2X5XA 1N2EA 3ICOA 1JFSA 3M2PA 1NY5A 1EWTA 5JAMA 2UZ3A 5C7IO 4GX5A 5CLFA 4EMSA 1UDAA 3RJTA 4ILKA 1MENA 3SPXA 3ICEA 1XNHA 2HLDD 2P1ZA 2PZLA 5DT9A 2CMFA 2H2GA 4PHTA 1O94A 2R45A 4H7IA 2QX8A 2W6PA 5D5HA 5CB4F 4B7GA 3D2LA 3IP3A 5FIUA 4ALIA 2A1IA 3V5NA 4FPXA 3FPAA 4XM2A 1XDWA 1GHTA 1Y8QA 5CPBA 4F92B 4AN4A 2JFZA 2RGHA 2PKEA 3JV7A 3KJQA 4JROA 5KS2A 2FW9A 1A9RA 3HLKA 4NBVA 5EA2A 1OLUA 1UMCB 3C5CA 4EUFA 3PRHA 1HT3A 3WL5A 3B1KA 4OX9Y 1M2KA 3L49A 3QKIA 3E7FA 5KKNB 2VNHA 5I7HA 3ZGVA 4UMEA 3N6XA 1V4VA 4MVJH 3H9EO 3MGBA 4L74A 4I8XA 2O1WA 1VSBA 3N1UA 4P3NA 4TTSA 1YCDA 4V2UA 5IJ0A 1H2EA 4D0SA 4B0PA 1YQUA 4ZOCA 2GR9A 5L9AA 2FPPB 5EKXA 1VG0B 2PT7A 1E3LA 3SK0A 1R10A 3F5QA 4UUMA 5I9NA 2GX6A 4Y2SA 1DIRA 1D04A 3AUTA 3KJGA 1ISFA 1NUTA 1WKBA 2R1UA 3SATA 1N5JA 2HWXA 3BB4A 4IUBS 5U4QA 4B3BA 5IUJC 4BLSA 5JASA 5HKKD 4R3NA 2QM7A 3TIXB 3CPSA 1VKJA 2CLMB 4LYGA 1Z4PX 5E3JA 2RG7A 1GJTA 4E5NA 1PS9A 5G2OA 3O31A 3RAPR 1TEVA 1T0BA 1G291 3K0BA 4A7PA 4GITA 3GJ7A 3ORQA 1LGYA 4YJKA 2B6NA 2D7HA 2PZMA 5K4HA 4MQ6A 3L7OA 2DB3A 4ODIA 3DTYA 1SC6A 2IZZA 1G0OA 4EGSA 3CXRA 5DM4A 5EJ2A 3HP4A 2VNIA 4ALJA 1TU4A 4XVRA 1U6KA 2VQFB 2OHOA 3T3OA 1QMPA 3EDMA 3KTAA 3FTDA 2E49A 2QXYA 1QHHA 1Z4KA 3HXMA 2IK8A 1DQYA 3H9CA 3KPYA 4KFCA 1Z7YA 3ACDA 4LXTA 4Q4DA 3V97A 2Q4BA 4FIZA 2EZ4A 4IXMA 3U13A 3UAZA 2BIFA 2O8DB 1UKYA 2VF7A 3O47A 3AI3A 3GNTA 3A1UA 1YNSA 3IBYA 3D4BA 1MH1A 2NO6A 2F5PA 3OFSA 4EECA 1CKEA 4B7CA 3FSJX 4ZI2A 3K6JA 3TCKA 4QHYA 3SASA 2JIQA 2X8JA 3QMPA 4JVOA 3H5IA 5ITSA 3OEYA 5LN1A 4BUJA 2I3BA 5GONF 3A2MA 4ZI3A 1PUIA 3WJAA 1U0SY 5A1TA 3H3JA 5LA6F 4D5GA 4H3HB 1GNVA 2PBZA 1TVCA 3IPXA 3KXEC 2HTEA 4W5JA 3DYBA 4J94A 3QE0A 2OKCA 5A02A 4BFTA 2I6XA 2P9JA 4TKVA 3P0EA 1PUJA 1CK4A 3CMMA 1XV5A 2P78A 4M88A 3W5VA 1WEKA 1O94D 4MR8B 3WK5A 2QVYX 1ODFA 2PUTA 2XPCA 2BTQA 2QRMA 4QC2A 5EJAA 5AVWA 1Z17A 1JG1A 2IZOA 1TYAE 4CIZA 2G8NA 2OCGA 2PGJA 2PWPA 4EPRA 3BIWA 2XTJA 1TH3A 1M8JA 4BO5A 4LN1A 1PWHA 3I4YA 3RYFB 4R7ZA 3VK8A 4UNQA 4ALMA 2EIXA 1D4OA 1H6CA 1U7OA 1JFVA 3ND9A 4I5IA 4N3CA 4P53A 4W5HA 5DBOA 1JVBA 5ALKA 4BVBA 4WJLA 2AZXA 4AMYA 1CB0A 4KN9S 3U7IA 1AVTA 3PUZA 2GM5A 2Q46A 3VFDA 4NPHA 1ZGZA 2EBFX 1C7FA 3ZG6A 2PUVA 1KMIY 3TKLA 4HNAA 3TN7A 2BYTA 4UU1A 1LSUA 2M60A 5IM4F 4YMIA 1YDFA 3WHPA 2VDWB 4YMLA 3DMTC 5MDHA 3GCGA 3K7EA 5KO3A 3VOAA 4E6PA 1II8B 2PA0A 3MK31 3ZYZA 4MRMA 2WJZB 4O4LA 3UWKA 5K01A 1R6UA 4R2LA 3PKZA 2XZUA 2Y0QA 3I52A 2IHBA 4LG2A 2XZDA 1X37A 1UINA 3JWEA 3QXCA 2FEWB 1WB4A 1FYVA 4RHEA 4ZAXA 4ZMRA 3LL4A 3ZY2A 4AJLA 5JYCA 1UIRA 4RK5A 2WYIA 5LPNA 1N36B 4DR4B 3AV0A 2GPTA 2ZIAA 3DPSA 3KJIA 4GOLD 1IHXA 2B25A 3HDYA 3BXEA 3FLBA 1TPYA 3FZNA 4AXBA 3FTFA 1EA7A 3G85A 1GA1A 4B4OA 1ESZA 1FLDA 3MXOA 4UPEA 4FXPA 2V97A 3VU0A 4ASUD 1PYDA 1GXSB 2QLTA 2ONCA 5FI0B 3PX3A 2G07A 4LX8A 1X38A 3EIOA 2PUEA 1GZ7A 1G8AA 5BOSA 5IW8A 2BGLA 5IC4A 2VRCD 4K8OA 3SMSA 5G41A 1XTTA 3MTBA 4JQZA 4MRMB 4O4LB 5LQAA 2GN2A 4E7PA 3NW9A 4MTCA 1JQ3A 1ZVMA 1DBQA 4UNNA 5FEUA 1JXAA 4J43A 3NHKA 3I05A 1T9KA 4NAHA 4RULA 3EIEA 3WGVA 3GQBB 4TL6A 1CRZA 1JIUA 3ABOB 3U19A 2VYNA 1EVQA 5IAJA 4R01A 2F4VB 1Z0ZA 2N3ZA 2F43B 3EMBA 4G4SP 3D6JA 1MAVA 2J3HA 3CT4A 3EZXA 5CH5A 1TF7A 3QHQA 4PQFA 3FIUA 3MFYA 4A5SA 4KXVA 2O2CA 3UB3A 2FW7A 1Q1QA 4BWFB 3TWOA 4CMEC 3PX7A 2DLCX 1XO1A 4PICA 1D4AA 3GZTB 1LI5A 4V38A 2MMGA 2NMVA 5ALVA 5AJWA 1G2OA 2ZJZA 2ZTMA 4R9RA 4YRRA 1UMKA 2BM0A 5JO0A 1DUIA 3C9PA 3NGMA 4O4JF 5M3BA 3K92A 1U8TA 2QQ5A 3DMPA 4D56A 4BQIA 4UU0A 5B5SA 1QQBA 4NH0A 1E9VA 1P9RA 5KWIA 3RTEA 3CHYA 3T7TA 3FCCA 2VQ3A 5FSWA 3GZNA 3OC6A 5KYYA 3EIUA 4BXOA 2OFWA 4L4YA 3UYLA 3AJIB 4DDKA 3NFYA 4QOJA 3VKUA 4I4LA 2XD9A 3L6UA 1FNMA 4H9GA 2BHSA 1FDIA 4WZAA 5BN4B 1ENPA 4ARVA 5KSWB 4KE9A 4RY2A 2BBSA 1Y5IA 2UUBB 3CLTD 1Q44A 1CUYA 1H9BA 1K6MA 4AUKA 3DLCA 1K98A 3ILXA 2XXAA 1LDNA 3H5TA 4WX2B 4ZGBA 1CVIA 2P4UA 3LHDA 2ZRDA 2AOWA 2FZKA 3CNNA 4Y0AA 4DRZA 2ZRHA 4G3XA 4QX6A 3IR5A 3OPNA 4UM5A 3DHVA 3ORHA 3WWZA 2HWUA 5IT4A 3HCEA 1SHUX 1ZUHA 2W2PA 3M6UA 4J7UA 1GGEA 5BSFA 2JLVA 1SBHA 1ZCFA 3LQQA 4MW0A 1DFIA 3L6DA 5A9SB 4CU5A 3S5JA 1BRTA 1LQTA 3NBIA 3P0IA 2XB2A 4N41A 1NBAA 3C6ZA 3QELA 4DABA 2CB9A 5MN6A 2PQ6A 1CIPA 5K2MA 1H2XA 1VCIA 4DCJA 3B9BA 3F3KA 4MVJM 2XUQA 4NBSA 4KQJA 1G8YA 2JLSA 4P32A 3UMVA 4C04A 1ZH6A 2J5BA 4D9CA 1W2WB 2GDJA 1RI2A 3QMVA 4MUMA 1DARA 2ATCA 4OFWA 5EERA 2A4MA 2NQ2C 2QZZA 1EGVB 4XEHA 3V8PA 1RACA 2J5QA 3C8ZA 4G5GA 1P4GA 3KXIA 4X1IA 2GVZC 3ASVA 3A6FA 1W5TA 3N3AC 4AO8A 1V47A 2XMGA 4K2HA 4YREA 1NBEA 4C14A 3EMKA 3GWGA 3UJ3X 2LVQD 2H1WA 4YV2A 3PA6A 1VJRA 1KEUA 1RRFA 4G56A 5BRNA 3WGZA 1ZAKA 2RGGA 4E30A 1ISRA 5CB4B 4QRIA 3PUXA 1W96A 3DCIA 3TS1A 2HQSA 3ZVNA 1U8XX 3WGQA 4EQZA 3I8OA 2R00A 2L2DA 4P84A 4ZEVA 4RQBA 2P5YA 3BWYA 2Z3ZA 1V8BA 1PBNA 3CUVA 4FLFA 2JGIA 4JOQA 3UJ8A 1M2JA 4KNYA 3RTDA 4KPUB 1ZXBA 1VSTA 1HK7A 5AK6A 4RHXA 2NVWA 3H0EA 3WYBA 4NV3A 3FNFA 4Z0NA 3VNSA 2XMQA 3DQQA 1VEKA 1XG5A 2Q21A 1LPPA 4EPXA 3THOA 3IJEB 1YJ5A 4G0MA 5K0EA 1OXKB 4PTYA 4V1CA 1E3JA 3MWFA 2QNBA 3ZGZA 4TXMA 4XD2A 1BHQ1 1AQ6A 1Y4SA 1TJNA 3H6KA 5LJIA 1YI1A 3RE8A 3U5TA 4GR9A 4U63A 1M1YE 4F5YA 1QE5A 2AD1A 4HB4A 4DJTA 2X0RA 4ZYXA 2G1PA 3KQLA 4XWOA 4G4OA 2RC5A 5FOVA 2AJTA 5C8XA 1DEAA 1GYQA 2XE8A 2WG2A 2VP2A 2GQFA 4BE4A 4U6QA 3GUUA 1DIBA 5TEVA 4MW7A 4M83A 3CW2A 3EXIA 4HQOA 1I7DA 2C2HA 3O90A 3AHCA 4C0WA 1RZRA 3NIGB 3BJRA 1II0A 4PWZA 3LO8A 2GZAA 3BF8A 5AM2A 2HJHA 5T7BA 3ZE1B 1MX3A 3V1NA 3KOZA 4MV9A 3UMYA 2UYOA 1D0VA 2QJTA 4OQNA 3C3KA 4KCGA 1Y8QB 4HWGA 2H2WA 1XDGA 1VZ2A 3SDBA 3LY5A 1MN3A 3ANXA 3MOIA 4OQDA 3TVTA 1MQAA 2ANCA 3QYJA 4NBWA 5DEOA 2JZ1A 1AUQA 1R4MA 4GRAA 4TGLA 3TK1A 3VH1A 5AXBA 6CHYA 3B7ZA 1LDBA 2RH5A 4LC9A 5EZYB 3A6HA 1JDTA 3E3MA 4OEHA 4PVCA 4EHLA 1ADGA 3GB9A 3EEFA 1CQPA 2QM0A 3DXZA 4ZYWA 5ALEA 2ZJYA 5EHGA 4LF4M 1GSOA 1P9NA 1J24A 3LECA 2P9ZA 2P69A 4FMBB 4EKIA 2YY5A 3EGDA 4CE6A 1IQPA 5AJXA 4BHTA 1HQKA 1V5EA 2X2FA 3JQ8B 1S2GA 3NWJA 4UE3S 4QEKA 3BH7A 3ZNOA 2O8FA 1NXQA 1TT7A 1R6XA 1I8TA 3GOHA 3N86A 4F2LA 2ZGVA 4KYTA 1UJ5A 1Z5AA 3AKZA 3IQZA 5ECYA 2JJ1D 1M9NA 5FV4A 3ZU6A 1QWOA 2GSDA 3BHJA 1QZMA 3LP8A 4BO7A 4TN1A 1ILEA 2CWWA 3RTBA 1T2EA 3GPDG 5E1OA 4ZVMA 2LKDA 3V3TA 3O8NA 4O2RA 3ESCA 4OXXA 3WR5A 1SKAA 2BY4A 1FB5A 4N1AA 5E0KB 4DG8A 2DWPA 1EHIA 1W76A 1EXDA 1AKYA 1N6LA 1PL0A 1VGRA 2HFJA 2QLFA 1VPLA 3DAFA 3O9ZA 3PWZA 4MQLA 3FTQA 1R6VA 3QKRA 2K9DA 4F71A 2FFRA 2H5EA 3EULA 3VYTB 4X7PA 2OG1A 3SZMA 1FTYA 5EWLB 3ROZA 2EHJA 2PKYX 2XNCA 5JMOA 3GEMA 4PQYA 1PZNA 1L2DA 1JQ5A 4QUGA 4BWGA 2WSEF 1WW3A 4X65B 3K0AB 2D7JA 1AGNA 1HH4A 2H4WA 4YB8A 5EE1A 3THYA 3E5NA 3U3JA 1KYWA 3V2HA 2DE0X 2XODA 4LCBA 2YC2C 1Y8RA 2D54A 2PSSA 2R7LA 4OP1A 2VUUA 2FRXA 2ZE5A 3EC7A 3LGXA 1FUKA 1QRRA 2D1FA 1Z6QA 3ROEA 3VPDA 2YR0A 4JQCA 1YDGA 2BGJA 4DUGD 2VPWA 3V7WA 2E37A 4AZ0A 5BNTA 1MHPA 2JAQA 4RTMA 3KM0A 3R5JA 1O0SA 1GTG1 2FEPA 3B2NA 5A9TA 5C35A 2GUGA 3E53A 1SVOA 3I8SA 3D6FA 3KYCA 1ZLYA 4DDWA 3ESYA 1GGKA 5KEIA 1CY6A 3A1WA 3OT1A 4MQ5A 5EZSA 3WLNA 4QPNA 1CLUA 2P65A 3DW3X 3TPZA 2JNWA 3NZEA 4PRLA 4QQ8A 3SC6A 2HBZA 1V5WA 2AEMA 3UUEA 1Z8HA 4N7MA 1JGTA 4UTNA 4TKUB 2Z04A 3PJFA 3LGAA 5KSOA 1MW8X 3AH8A 5FPTA 3VR5H 3FNGA 4DG5A 4CETA 1IFYA 3VH3A 3IO5A 1G2PA 1X0VA 3X1ZA 4C4PA 1US8A 1GRRA 3UBTA 2H59A 2ZI7A 1G5TA 3HHEA 3LK7A 1DG1G 5LKAA 1U3GA 1GSAA 2ORED 1AE1A 3JWPA 3CNLA 4MW4A 4PYJA 1EE2A 3UVEA 1C1XA 4CCYA 3LLSA 3P0FA 4DT1A 2BFFA 1HLPA 4ZU1X 1YIAA 1YASA 2CHVA 1GPAA 1Y3FE 1MOPA 2XMRA 2DWZB 1Z83A 4KB5A 5HIAA 1WOYA 1TUGA 3JWHA 3NJ8A 1GRCA 2GMWA 4GUDA 3NASA 3VR3D 3JQ7A 4BLVA 1XP8A 3INRA 3J81k 4FDUA 1NOJA 1WTCA 2BKXA 1SBCA 2R62A 1V9LA 1WXHA 4JKIA 4Y6OA 4JXJA 3E27A 3STXA 3W7AA 2FN8A 3DVRX 4JK3A 4LXGA 3CN7A 4YIKA 1ZLXA 5ENZA 3EF1A 4AC9A 4EJ2A 5F1PA 2ZYWX 3DLTA 5CD9A 4CF7A 1US8B 3E9QA 5FL7D 1LBQA 3KO8A 3HH8A 3IOBA 3I6BA 1Q50A 3JPWA 2AF3C 3TLCA 3OKFA 2V5VA 3HEMA 1GG9A 3BXPA 3I72A 4HH0A 1CB7A 1ZXLA 5E4TA 2WMOB 3R7DA 1YSYA 2P9EA 2GLUA 2RARA 4QVKA 4OKSA 3EHEA 2I66A 4JQSA 2A58A 4Q9IA 4B6RA 3HCPA 3Q98A 1Y42X 4KACA 5A3SA 4OAPA 3GD7A 1UP6A 2QTLA 3IXMA 1DO0A 2H18A 1YC5A 3PRKE 4OLHA 4NNJA 3ZE6A 3ZIAD 4TMXA 5FBWB 1OXSC 3G2NA 1FS6A 4JSRA 5DCWA 3PNLA 5IJ0B 3F5SA 4UPDA 1RC1A 2VF2A 2YFHA 3GJXC 4LZLA 3RGWS 1UPUA 2L4FA 2BDUA 2YS6A 4Q9NA 1D7AA 1ZPDA 2AHOA 4NRVA 1NC3A 4JUIA 3TCXB 4IUYA 4ZVOA 1GA4A 4QZVA 5LLDA 5M34A 4Z2YA 3MSCA 3I5YA 3OF3A 1OPRA 3G5TA 3GYBA 3NP7A 3QOFA 3OHPA 3K8QA 1J1IA 3EGOA 3VPXA 5LMZA 4X20B 1QYRA 4D6PA 1G4HA 5B58T 4ZIRB 4PVDA 1R4NB 3AFMA 4AM8A 4IBJA 3A10A 3TZEA 1QH1A 3IT0A 4QXRA 3ZDEA 1F60A 3E70C 3F8SA 4QOEA 1NYRA 1N3YA 1T8UA 2G70A 3DMFA 2FZWA 1M3SA 1THZA 3R3YA 3ZWAA 1G4AE 1QZUA 2ZR9A 4YRPA 4B3GA 1GPWB 4C6TB 3K9GA 5DX8A 3WBFA 3R77A 2OZEA 3RK1A 2G28A 1P0QA 1UFOA 3ZWNA 2Y71A 1ODIA 2YXBA 3R5KA 1UDCA 2VRNA 3TIFA 3DEZA 4DMHA 3VV2A 2XGMA 2C58A 4F4CA 3IHLA 2JGAA 3OU2A 3CBQA 3TD6A 3L8MA 5CVTA 1P9WA 2VDKB 3ZDDA 5F2EA 4F6CA 4B71A 1SIOA 3M6IA 4XVQA 4YUYA 5HWSA 4OM8A 2AW5A 1KQNA 5KTOA 5KYTA 1SCJA 3K6RA 1C4KA 3GP3A 3M9WA 1MQSA 3AUFA 4HLCA 2ZVDA 1VEJA 1I1HA 2B34A 1ORDA 3B7NA 1NXWA 1KEVA 3QXSA 4EJ0A 3FETA 3W4IA 3U60B 4GOMD 4LI3X 3FWNA 4ID3A 1R5BA 2XD4A 4IIBA 4OJKA 2Y21A 4PNHA 4IHAA 3FE3A 5HKOA 1SURA 1YZYA 4KH1A 4QPDA 1E5VA 1N36M 1CUXA 1WP4A 2NTEA 1WZCA 4E2YA 2WZBA 1VECA 1AZLA 2A30A 4CGYB 4C0BA 5AVYA 1FFBA 3DOEA 4F3NA 4XDZA 3A6GA 5FBLB 1P5JA 4XTRA 1ZIOA 2Y0PA 1YMUA 1I2CA 1CFZA 1OMOA 2F7SA 1QK3A 1E1YA 1PZEA 3TFOA 3LCUA 1W5AA 5L6LB 3DZ8A 4QQNA 3ABSB 4CM3A 1I2ZA 5L95A 4ACBA 2NAPA 1XCOA 2FTKE 1K8XB 3HUDA 3O7WA 4GKVA 4HNSA 5KYXA 2DHYA 4AZ3A 1PK8A 1QGAA 1JHMA 1T5TA 1USGA 4KE7A 1KHHA 4UD6A 4Q4CA 3Q40A 3ZJ5A 4GMXA 4DTIA 5HNKA 4JAVC 1X7HA 3CONA 1P2SA 1UJ6A 1TDJA 4ETNA 1V48A 3THWA 4QFDA 4HH3C 2KZSA 1E69A 4UATA 4GVXA 4HDSB 1KXZA 2WWWA 4WURA 5LBTA 2O23A 4WPGA 5LA6B 4IVNA 2FCAA 2I4IA 4JJ7A 5KDDA 5JI3E 1TT5B 3GFTA 4QRHA 1XMSA 1KNXA 1KE1A 3MB5A 5DTJA 3JQFC 4KQIA 3L0CA 1NNUC 2CLHB 2OQVA 4FFLA 2CFIA 3COPA 4UZFA 5ALQA 1J90A 2J08A 1XMOM 2XMDA 1R66A 3A9SA 3PC8A 3ESQA 4GSLA 521PA 4DC0A 2AQKA 5DCUA 1KO4A 2HJVA 5CB4A 4F5WA 1I6WA 2BFEA 1T5HX 3FGNA 1FTQA 3I37X 3QPBA 3EGXA 4URXR 3IOCA 4QDOA 2OGUA 4YCNA 3IKTA 2P0AA 4JENA 5CT8A 1UBRS 2VSXA 1YBFA 1ZIPA 2C9DA 2ZT8A 4LYHA 2LBPA 5SZJA 4F84A 3ZU5A 2C7OA 1AQNA 1MABB 2JJYA 5EZYF 4RV9A 3LQRA 4MI6A 3GDWA 3GGOA 3MTJA 3OT4A 4UCFA 2GRUA 4FKBA 3UK6A 3KYDB 1QG6A 2J6BA 4YCSA 5BVGA 3VYWA 2BGRA 3OWXA 1U8FO 4FOTA 1NVUQ 4K40A 3WIVA 1SBYA 2I8LA 1KYXA 3KSUA 2Q3CA 1EINA 3A0UA 4OM7A 4WESB 1G7CA 4Y2RA 5E2BA 2DAIA 3FTCA 4YBZA 5AWFC 4PZPA 5T4FA 4RHYA 3W79A 4R8LA 3L6RA 1KEEA 2F43A 5HGJA 1IY0A 2X0JA 4BLUA 5B1YA 3WJ7A 4CHGA 2GNAA 3S0JA 1FRVA 10MHA 4KLZA 5EIEA 2O0JA 1A1VA 5DYNA 1BDBA 1UBNA 2FWRA 3A3KA 2XNHA 4ZVLA 1Z74A 1K7SN 4NCNA 3CTWB 4KIJA 3F71A 3V4ZA 5ICGA 4GMKA 4LGVA 3CF4G 1DGFA 4OQLA 3TGPA 3HU5A 3KQOA 3DVSX 5AKEA 1U9JA 3Q5GA 1XHBA 2PFGA 3BDVA 2F59A 2X0FA 1RYDA 4NYMQ 3WE7A 1YCFA 2C29D 3MUOA 4N65A 1ZGHA 3OHMA 3RGGA 1MQ8B 4PYLA 1G38A 1KAEA 3HXKA 4BX3A 2I8CA 4NU5A 1L5NA 1OBCA 4MJXA 3BRQA 4CV1A 2PS0A 4D3XA 4B6EA 3EW7A 5E6UA 1C9EA 1TJ4A 1NBHA 5IRCD 3TW4A 5IDQA 5KTMA 3CRRA 1X6VA 3BIJA 3T7RA 2LGJA 2WNHA 4QJIA 5FUWA 1IEWA 2WNSA 3RE1A 3T6PA 1Z6GA 3GJ0A 3X43A 4RJKA 5ILOA 4OQZA 3JAMS 3LI2A 3FJYA 1P1CA 5ALLA 1D0LA 2W5UA 4HWRA 1KO1A 3DEFA 3VR1A 2JKVA 2I4MA 2BFWA 1IZYA 3G9QA 1ZUIA 2GARA 3S6JA 4G5QA 2XI4A 2AS0A 4E32A 5AESA 2RH4A 5E6JA 1MV8A 1OY1A 1TRKA 1R8JA 1ML4A 3OJOA 2R6ZA 1GG5A 2G1KA 2XVAA 4JZKA 4TV8F 4J75A 1ORRA 2C84A 1K0UA 4JHLA 5ULLA 5BWCA 2GILA 4RNAA 2ZS7A 2PSJA 2GBGA 5DE3A 1N2CA 4XK8F 3JQPA 1I4LD 1C7QA 4NC9A 3T7SA 3WO0A 4DMGA 4ZZIA 1JEYB 5K8TA 1KJIA 4ZQBA 3HKBA 4PX3A 1Y81A 5F23A 1ZI8A 2ZBEA 2F8SA 1Q0SA 1EJ0A 1IM5A 1Z4QA 3KLBA 2PMEA 1Z18A 2R48A 1DKRA 1MRNA 1UOPA 2PS9A 4O2BA 5DGIA 2AE1A 2OV6A 1U28A 1WKVA 1IMOA 4LJSA 2V7XA 3DT6A 4JGGA 1H4QA 3II6X 1JXMA 1K82A 4KWEA 4MMYB 3EH2A 6PFKA 2W93A 1PQYA 5F33A 3HJFA 2ACEA 4JLWA 1YZHA 2Y1OA 3RV4A 4A10A 3AI2A 1T2CA 2UZIR 4IX1A 5E9WA 3Q9SA 4QU5A 2W9XA 3SQOA 1QYVA 1Q14A 2JFUA 3B9PA 3KC2A 3NRJA 1M8PA 3FB4A 3I32A 1IY8A 4Y9UA 1X80B 5FUYA 3TEMA 4BC0A 2BTEA 1N2CB 3FFBA 2WSSD 3RVPA 1G16A 4ZVRA 3VDNB 5JEDA 5IK2A 1RCFA 2I29A 3CZQA 2YWHA 4TLDA 3VZPA 2RK3A 3A4YA 4AY3A 2CXTA 5D3ZA 4ZI7F 5AUPB 1G21A 4ZRDA 4CR8A 3GUYA 1A8QA 2C9OA 3U3XA 2RI1A 1G63A 4AZTA 4YUVA 7YASA 3CS3A 3VO2A 2IPLA 1AO3A 2J9RA 2OZVA 3OZUA 2QIPA 3QM1A 4R2XA 2BEVA 1CP2A 3KOOA 2OHHA 1RKUA 2AN3A 5ALWA 5JSUA 4AX8A 2RGNA 3O8OB 1XXHE 4MVXA 5FA8A 5AVZA 4PG8A 1RPAA 2ORWA 3OCZA 3RS2A 4ZV4A 2OLKA 3ZU4A 5I5EA 4WZBE 3SJBA 1V41E 3KQYA 5TVKA 2DYKA 1J6UA 4DFDA 1KI4A 2BFDB 1KVQA 1QGOA 2E1RA 2HBRA 2VA9A 3GRKA 3O1JC 1H6DA 4R41A 4Z9AA 5EE9A 3U1BA 4C08A 3JD3A 1NDHA 5IAGA 4B76A 2A35A 1EIJA 1TKCA 2P2CA 2W6MA 4N5DA 1CEYA 1MPTA 4JI6M 3K8ZA 1QV9A 1SPBS 2PMBA 2PLNA 2VLIA 4L8RC 2FEKA 1N2JA 4IV8A 3UAOA 3PQDA 3WAKA 4DSTA 1ESMA 4FYMA 4JI1M 2QLJA 5JS8A 3INTA 3EVZA 5EQFA 5IYZA 1ZY2A 3CEAA 4NBTA 1JKMA 1T6YA 1UBOS 5KYWA 1Z5GA 1U81A 2WKSA 3RYTC 1C1DB 1G5PA 3L8EA 2CLCX 4Q7KA 4Z3KA 1XQXA 2IYEA 2P5TA 1XEXB 2A7XA 3DL2A 3QTLA 5CM2Z 1XZDA 3ZV7A 3DHNA 2Q9AA 3T34A 3FGPA 2AZMA 1SUCA 3TX2A 3G2OA 3A36A 1BEEA 1L5MA 2Q4EA 3M33A 3S1AB 4C5BA 1G64A 4WBNA 4B3SB 5JJCA 5CIYA 5DZSA 4NXMB 3AXSA 4FGWA 1SQSA 2VAWA 4FU0A 4HPJB 4JEUA 1I4OA 1Z88A 4M60A 4RNDB 2X3FA 2I2FA 1ZA1A 2IHUA 3MINB 4ZN6A 3LSYA 2PGLA 3UIEA 4DWWA 4M9XA 1M1YA 1DHRA 2V98A 3P97A 1P1BA 2XBUA 4QE3A 3WLIA 4HVCA 2NYUA 1F5SA 2FX5A 3GIWA 2AD5A 2VWQA 4Z86A 5EINA 3K0SA 3H42B 2AFRA 2IT1A 3NV9A 4RMIA 3NHYA 5D3KA 4A03A 3RC9A 1YB5A 2QT1A 1Z2PX 2WUEA 3CJTA 1MTZA 3KU1A 2HHLA 1MJ5A 2IBMA 3FPSA 1CZLA 5KQ8A 3OZIA 1C9NA 1UWCA 1S4MA 3E7WA 1EZZA 2Z9BA 3H5RA 1L7DA 4ZHQB 2FK7A 3BDIA 1VG8A 1CRWG 1DKMA 1U98A 2QD2A 3I45A 3NOQA 1ZH2A 4PFSA 4UM7A 4W6QA 4GPIB 1K3FA 4H1TA 3RVKA 5AQEA 3NHRA 1GNLA 2ODNA 3KZVA 3O8QA 3EWNA 4GX0A 4OJTA 4NULA 1UBGA 3M1IA 5B3JA 1UKZA 4XPIB 4IFIA 1L0BA 2QX6A 2O5RA 3IKJA 4HTAA 1I94B 4NZOA 1BKYA 1NXXA 2I4OA 2VK4A 5CYOA 4CIBA 4LS3A 1DC8A 4ANRA 1V8FA 3GAMA 3O2NA 5L7TA 5KJFA 1H8ED 1WHCA 2X9LA 3B6MA 3RCBA 4Z99A 1S2LA 1BIFA 1DSSG 1U04A 5FRDA 3OICA 4HAXA 1FNCA 1QHGA 2ZTHA 3EVDA 4RY0A 4ZP1A 5ED4A 2V1UA 2EKBA 4X8HA 1KQPA 2XZOA 3H18A 4Y9RA 1ZM7A 4N8SA 1VCNA 2GCEA 3FHJA 1TTPB 5ESDA 1YT5A 3TMYA 4RTRA 4R9SA 4X9XA 1JG2A 4DLLA 3W6NA