1G41A

Crystal structure of hslu haemophilus influenzae
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
443
structure length
334
Chain Sequence
SEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTVGKEVDSIIRDLTDSAMKLVRQQEIAKNRLIDDEAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKKGEYSGADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT SHOCK PROTEIN HSLU
publication title Structure of Haemophilus influenzae HslU protein in crystals with one-dimensional disorder twinning.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Chaperone
total genus 116
structure length 334
sequence length 443
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1g41A02
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1g41A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g41A01
4KSBA 1FUKA 4E03A 3H0KA 2XZPA 4JT2A 4M1MA 5FBRB 2BOVA 5AJVB 1G20E 1WXQA 2X1VA 4HZIA 2FFBA 3RVBA 4DSNA 4DVGA 4TL6A 5DI3B 1YZLA 4FWTA 2Q3HA 4D0NA 3TH5A 4FWGA 2ZR7A 5DI3A 2W6JA 4C3ZA 2VQSA 2J87A 1Z0DA 1BH2A 4LC0A 3AVOA 3BB4A 2ZRMA 3CR7A 3UK6A 3CH5A 3PUVA 5HCIA 1SKYE 2YWGA 2A9KA 2LKDA 3K9LA 3EA0A 3QG5A 4UNQA 2L2DA 1I2MA 2IWRA 1EFUB 1QHHB 4MRNA 4ITRC 3MG9A 1XEFA 1VTKA 3MJRA 1XTSA 1EFUA 1QHHA 2WZJA 1M7GA 2IUSA 2V1XA 2IC5A 2VP9A 4C0SA 1CBUA 3QF7A 5EP1A 4LJ5A 1RIFA 2CVFA 3IPYA 5CYOA 3ZS9A 1E69A 2V9PA 2JP7A 2OHFA 3B2EA 5FBQB 2G0NA 3FFBA 3KTAB 1II9A 2KE5A 4AIIA 2KB0A 3TSZA 5AJYA 1R10A 3QOFA 1WQ1R 1Q12A 4NMMA 3KTAA 1CJUC 3KZ1E 4OKSA 3ADCA 1X8LA 1MABB 1XX6A 5KYKA 1J2JA 1EWRA 5G53C 4M2LA 4F7WA 1NY6A 1LW7A 1MABA 1ZM4A 2VYFA 1PUJA 1O87A 4M4SA 4H1UA 3T61A 2W0SA 1E9DA 3MLEA 4M22A 4OQMA 3SN6A 1P62B 1G3QA 4V03A 3A4MA 4GNKA 2XNSA 1JECA 3G0HA 3A8TA 3HWSA 1QZMA 3CKLA 4JL6A 2VHUA 1X8JA 1DAKA 3C14C 4GPTA 4LHXA 3T35A 2O8CB 1BOFA 1AM4D 1AS2A 4LV8B 4QGHA 3LVQE 1YE8A 1Z8FA 2O8CA 3N5CA 3R9XA 5CB8A 1KJZA 1NBMD 1WDTA 3B1XA 1MO6A 4IEIA 2R6FA 3KUDA 1E3MA 4PQRA 1HT1E 1E2GA 1RC8A 1VCNA 1D2NA 4QHTA 2A5FA 2H57A 1UKEA 3QXXA 3LCVB 4LI0A 1YLAA 4DLVA 2JJ8A 2RGBA 1QVRA 2O0JA 2OUKA 2TMKA 2VL7A 2GWHA 3CBQA 2DHYA 1US8B 2C78A 1CU1A 2WPDA 1AZTA 2OAQ1 3IO3A 5FL7D 4ZV4A 2PJRA 5FPHA 1UPTA 3ZZUA 2JZ0A 3BE4A 1HA3A 3EZ7A 1NIPA 1TEVA 4WZBE 1KKLA 4N0DA 1ZBDA 2ZI5A 1Q0UA 1BKDR 4AYTA 4DUGD 1OXVA 2V7QA 3A37A 2ORIA 3SNHA 1NVVQ 4B3CA 1SVMA 2KWIA 3V9PA 3U7HB 2LVAA 3VKWA 3EPHA 2HWJA 4MYHA 1Q02A 1E2JA 3AVTA 1PVOA 4OQXA 1E9CA 1R2QA 1WE2A 1ESNA 2XGJA 1ZM9A 2WMOB 1UAAA 2RGXA 4BZPA 4TL8A 2ZJOA 2ZRJA 3RSOA 4F4CA 4CEHB 1YZUA 2AD1A 1CXZA 5J4VA 2QQEA 1UFZA 4F2LA 4RCYA 4CYMA 4M9SA 5DHFA 2OFWA 3U3OA 3THYA 3ASYA 2R6CA 4A36A 1Z0AA 4K8OA 1I4TD 1KNQA 4A0FA 2ERXA 1HV8A 4NDZA 4G5QA 1LS6A 1II8B 1V43A 4P4UA 1ZUIA 2J0VA 3VR2A 1HJPA 1RPZA 1KIMA 2C5LA 2G88A 5JWRA 2PX0A 4B3GA 3ZVMA 1FFHA 1II8A 4LPSA 2QAJA 3LH5A 2EWWA 2GXQA 3AVQA 3P20A 4HDCA 4BZXA 1G6HA 2ZUBA 3MJHA 3D6TB 3SYKA 2WHXA 1TR8A 4QBFA 1E0AA 1ETUA 3F3YA 2X19A 2HLDA 2CHQA 1GL7A 1LS1A 4JLVA 2J7KA 4P4SB 2HCBA 5FTJA 2YOHA 4IKEA 4RFSB 3B1YA 2ZRAA 1X37A 1TQ6A 3B5JA 3GFTA 1KSFX 4P4SA 3O8CA 1N5LA 4LJAA 3FVQA 4V0MA 3DOFA 4PPQA 3QENA 2OSBA 3OEHA 3I3SR 1VIAA 4Q1DA 4V0LA 3SC3A 4NPHA 1W47A 5FUWA 2QGZA 4BLSA 2BMFA 4IDOA 4QNRA 5FPYA 2FSFA 3T06B 4FN5A 4YC7A 5KNDA 2ZYUX 4WIAA 1XJQA 4L15A 4HUTA 3VNUA 1KI6B 1KK1A 2Q3FA 1DE0A 2REBA 5BQ5A 1YRAA 4HAUA 1XEXB 1CEEA 1LF0A 1KI6A 3QBTA 4HAXA 1E79D 2IYXA 1GG2A 4Z8XA 1PLKA 3AQ4A 3UWOA 3VR1A 1XEXA 5DISB 4ARZB 3LV8A 2MR9A 1ZM2A 2OESA 3AF3A 1FZQA 1NN5A 3HYTA 2V1UA 2VF7A 4ARZA 5E7MA 4HYYA 3NDBB 3R9IA 1FPMA 3EXAA 1W4AA 4A2QA 3SOPA 4IVPA 1R5BA 2DYKA 2HJGA 4RCZA 1KI9A 2XOKA 4GSYA 3IBGA 5EZ6B 2VSXA 2GXUA 1G21E 4OK6A 1JALA 3CX6A 4EFLA 3MSXA 1XBTA 4D82A 1D6JA 1J8MF 1VHTA 2RGGA 4MUBA 2GF9A 5JZVA 4LK2A 2MGWA 4QGGA 1ZU4A 4Q4AB 2QZ4A 3UG7A 4GOJA 2PT5A 3M4YA 4W5HA 1WBDA 5TB5A 4I81A 1ZCBA 2EWVA 4Q4AA 3NHBA 2YKGA 2VP0A 1WBBA 4YLGA 3HPQA 2D2FA 1EFCA 1N6NA 5JCPA 3IILA 3BBZA 2JEOA 4QC2A 1YKSA 3R9WA 5JFGA 4R98A 2X2FA 3ZVNA 3K8YA 2UKDA 3A4LA 521PA 4UJ3A 4ASUA 2IHBA 1HQYE 4UNSA 4YMVA 1SVOA 5TXGA 2QORA 4B33A 4M1KA 3EX7C 1P73A 1KSJA 4KJZA 1W46A 4G5OA 5CK5A 1WB9A 2OG2A 2CCKA 3A4NA 2FV8A 3P32A 3LBHA 3PV0A 1DV0A 2NTYC 3PEWA 5HKKA 1KYIA 3Q9LA 4B6FA 4LY6A 2B3TA 2KBEA 4C9BA 4P4TA 3S1AB 2A2ZA 4TYQA 4TQUS 1BS1A 1P2UA 1XEWY 2D4HA 3NXSA 4L8GA 4NH0A 3S1AA 3PG5A 4C0BA 2V54A 5LBIA 4HLQB 2XX3A 4JLKA 4EQ6B 2RGNC 4MQBA 3A1VA 2FX3A 3T6PA 5SZIA 3K53A 4LJ8A 4PPFA 5TV2A 2R65A 2WTUA 2HF9A 5SZJA 5JJIA 1NNEA 1VCIA 4BZQA 1QF9A 2HUPA 1I2DA 1Z2CA 4US1R 2O0HA 4PQFA 4AWXA 4BLPA 4MRRA 2FDCA 4Z54A 1C4OA 3BB1A 2IYTA 1I4LD 1XTKA 3AH8A 2ZR9A 1G291 2YV5A 5CJ2A 2E1RA 2OV2A 4LYJA 1X3SA 2FFAA 3SHFA 3ZZ0A 4DDVA 2G9NA 4Q5IA 4XTCS 2XTZA 4FXPA 2BCGY 2R6AA 1JXMA 2ZYWX 2LBCA 2DPXA 1M2OB 3EARA 1MR3F 4QM6A 4LV5B 4EPVA 2QU8A 2HJVA 1F6BA 4A0GA 1N6OA 2BBSA 2H17A 1E2EA 2J7PA 4BFVA 1TX4B 2F1HA 4KFRA 1OPXA 2IYZA 1S96A 2YC4C 3DM5A 4M9XA 4LYAA 1NJGA 2MSCB 2QPTA 2XNDA 2KNVA 3EZ9A 1NV8A 2KBFA 3T34A 1E96A 1XMSA 1CJMA 4B3FX 1XTRA 1ZNXA 5JI3E 1F4IA 3KJGA 3FKSA 1XD9A 4UNRA 4KCGA 3GLFB 1G8GA 1ZNZA 2YZ2A 2W58A 1G8HA 4PAMA 1P75A 4HLCA 4BFZA 3OIVA 3GLFA 2E87A 3NBXX 1L4YA 1JEDA 4B2PA 2W6IA 1W0JA 4MH0R 1CKEA 3B8HA 3L0PA 2ECKA 3FMOB 4H9GA 2O8DB 3EC1A 2ZJYA 4Q02A 1EG7A 2F9MA 3CZQA 1UF9A 1K5DA 2QTVB 5JLJA 2O8DA 2OFOA 4X8MA 3AGQA 3QF4B 4PXAA 1NY5A 1ZIPA 3AGPA 4N0EA 2XTNA 3CH4B 3QF4A 3FKQA 2OBLA 3EPLA 5LDDC 4B71A 4AKHA 5H70A 5K8IA 1NL3A 2GAOA 2VHCA 1GL9B 2PCLA 3VTKA 2GJKA 4WW0A 2AL7A 5E4FA 1TUEA 2JDIA 2N46A 4PO8A 3SU8A 3TAUA 4EJSC 1Z0FA 3CRVA 5HCNA 1J70A 1E2MA 2Z0MA 3RS7A 1XZPA 1SXJC 1BYIA 2CLDX 3KQUA 2XSZD 4YDSA 2REXB 1UBCA 2BHRA 2JY6B 2ZRFA 3AF0A 3H2YA 1E0KA 4ZCLA 1XXHB 1L4UA 2FU5C 1YVDA 3B85A 2H7VA 4M1SA 3VR3A 4II7A 3MWJA 2ZSFA 4U5XA 1KDPA 3DO6A 4NYJR 5JHHB 1XXHA 1ZM3A 2F6RA 3E21A 3M6AA 3LQRA 5EE0A 4B35A 3EG5A 3PUYA 2RHMA 1NMYA 2ZXUA 4TSFA 1HURA 4US0R 5KDLA 4IOMA 3A1SA 3P4YA 4PQYA 4Q4JB 5EUQB 1DG1G 3QXHA 2FZ4A 2HDNB 5FOUA 4DT1B 3SJCA 3L0SA 1NLZA 1TUIA 3GCGA 3AM1A 4Q4JA 4C7OB 3O47A 2A5YB 2G1KA 3TRFA 3UMSA 2I3BA 1NP6A 3WMGA 4BLTA 4RJLA 1CTQA 4C7OA 2BIFA 4TL7A 4URXR 3IO5A 3WYAA 1AKEA 4A2WA 4LJ6A 3FRHA 2ZEJA 3Q5DA 2IXGA 4POAA 3ADBA 1XP8A 3HYRA 5FTNA 4QHSA 3EAQA 3VHLB 2VHJA 1CR4A 2JJ1A 2EFCB 4IDNA 2XJ9A 3EWSA 3RS3A 4KODA 4ZDKA 4XJXA 3CRW1 1YZQA 5H1YA 1FX0B 2VO1A 1N5KA 1Q1BA 2UZIR 4AC9A 4ZKDA 1RVDA 4JSTA 4MA4A 1Z08A 1FX0A 1N2CE 4D4JA 1G64A 3WMEA 2BBOA 1QG4A 1Z0JA 2CL0X 2IUTA 1OSNA 1R7RA 2VSOA 3AKYA 3BAFA 2HYDA 4NYIR 2ZSAA 1G19A 1P6XA 3I72A 3C8UA 3L8ZA 3EPJA 4DCNA 1P60A 1D2EA 5AUOB 1NKSA 2R6GA 2A7QA 4PX9A 1GM5A 1JJVA 1VG8A 2PZFA 5G41A 2OXRA 1JJ7A 2EFEB 2J46A 3KKMA 4XD7D 2VPPA 3W6NA 1XJ0A 3FE2A 4TMVA 2H8KA 3LO5A 1AN0A 1Z22A 1GRRA 5KSZA 1H65A 1KTVA 1TU4A 4OHXA 2WZQA 2GCOB 3QG1A 1U8AA 4GI7A 3SJBA 1G7TA 1MRNA 1NLYA 2K0BX 4R9UC 3PUWA 1C1KA 2WJJA 1EWQA 2GCOA 1OKKD 1T0JB 5EE5B 2EJSA 5FTMA 1E2KA 3FFAA 2QG6A 2H5XA 2G1JA 3KXKA 3R8CA 2QP4A 5JEDA 3U7EB 4LUCA 5C2JB 3K9PA 3QEOA 4QJ3A 2GXSA 5KNBA 4RD1A 4YMTA 4G1UC 4QNMA 1FUUA 2Z6VA 1GTVA 3E5HA 4M1YA 4Z51A 3DKVA 5HR5A 1OH7A 3QSYA 5BYKA 3R7WB 4HUQB 1XPOA 1IXSB 2A30A 3IIMA 3WBKA 2I1VB 2CP8A 4EFMA 721PA 1QRAA 1JR3A 4EPWA 3ECCA 4UXHA 4HUQA 3R7WA 1IXSA 3BFKA 2JASA 2FZLA 4HATA 3K70C 4QRHA 3AUXA 2GNOA 2QTFA 1FNMA 3FOZA 1W36B 5DH9A 5D3MB 1AS3A 4JT4A 3I1FA 1DARA 1ZD1A 2JJ2A 4C0QC 4QJ4A 3NC0C 3AF2A 2FE4A 2IEZA 3K0EA 4TQAA 4RZ2A 1BVSA 2YWFA 2QMUA 3OE7A 4JS0A 1CUKA 2WWFA 2ZRKA 3T5DA 3O8DA 2GEUA 3WYFA 4OQFA 4D25A 2C03A 3KL4A 3SFVA 2JIZD 2WWXA 2WVJA 4DDUA 1VDLA 3RAPR 2JLUA 2WOJA 1S4QA 2N42A 4FINA 5KUTA 1OFHA 3NC1C 2QN6A 5FI1B 1KSHA 2GJ8A 4KITB 1OTRA 4CGZA 3MUFA 4JLPA 5EXPA 1XZQA 4KYUA 4DLYA 4TZ0A 4P3YA 2J59A 4PHGA 2V6JA 4A0HA 3K0SA 3AKDA 3VX3A 2QAGC 1U0HC 1TQ2A 421PA 3D3QA 5TDHA 4FMCB 3U2QA 1G3IA 2GCNA 4Q9LA 3WNDA 4ZDJA 5BYJA 4IDQA 3UATA 2OOBA 4D2IA 4OHZA 3ICQB 1DS6A 4KVGA 4G3OA 1XTJA 3BWDD 2BWBA 3TIFA 4ZI2A 3I8SA 3EWAA 3W5IA 4HLDA 8OHMA 4OYHA 3X2SA 1W0KD 1A5TA 3PUZA 2Z43A 4PTLA 1G17A 2WAYA 1QDEA 2ORVA 3CPEA 4MUAA 5EE9A 4HLUC 3F92A 1XTQA 2YINC 3JZAA 2EQBA 2PMKA 4A82A 1WA5A 1CULC 2AFIE 2ZAMA 1N0WA 3A36A 1VCOA 4WP2A 1P5ZB 1GILA 2FPKA 4A92A 3CR8A 1Z5ZA 2FSGA 2GVDC 1NV9A 5CIWA 3N70A 1FNNA 1KNXA 1TQ4A 2J1LA 4AD8A 1CJKC 4NU0A 2XEXA 5C46F 2FOLA 2AN9A 3CF0A 3AB3A 1NLFA 3DEFA 2DAIA 2REOA 3BIFA 4G3XA 4UNPA 3WY9A 1T0HB 5HPYB 1RRFA 4I1SA 3KQLA 1LF5A 3IHLA 4LGMA 1ZRHA 4BEBA 3O8RA 2QBYB 2GTPA 2YHSA 2YNMA 3X1WA 2C77A 3QQ5A 1N0VC 4GDFA 1XWIA 2IWHA 2ZJ8A 1NN1A 4JYCA 4OJKA 2QBYA 5DSZA 3VR4A 1VYVA 2EKFA 1ZYUA 4K46A 1NBMA 1CR2A 5J5CA 1E0JA 2CHGA 1W1WA 1G18A 5AJZA 3QPUA 4P32A 2ZRBA 2W0MA 4GRAA 1E2LA 5M04A 3BXZA 3WXMA 1L8QA 1G7RA 3E70C 3IQWA 4DBGB 4EPTA 1Z28A 1E1QA 2CVHA 1E9RA 2QMHA 2GDJA 3SR0A 4O0MA 5FL7A 2AX4A 2OCYC 1XNJA 5IHPA 1IJFA 2GHIA 2WJYA 3G5UA 4Q4HB 4CIDA 2BV3A 1A7JA 2PLFA 1AQUA 1EGAA 2PLRA 2QMEA 4DUGA 2B92A 1W2GA 3P4XA 4Q4HA 3WP1B 4QBGB 1P4SA 5FBLB 4NL4H 1B23P 1KO7A 3MRSA 3MGCA 2QRZA 1WR1B 4DSOA 1NVWQ 4S2EA 5C18A 2Q9AA 2NO7A 2BEKA 4B2IA 2X77A 3PITA 4PSVA 2QUZA 3K0CA 4PAOA 3CZPA 1JQLB 3DHWC 4A1FA 2MSEB 2CNWD 4XIGS 2QNRA 3TVDA 3QPWA 5DGXA 3OZXA 2BC9A 5CLLA 1EFTA 3TUJC 1X86B 5JWOA 2ZR0A 4DSTA 3SYNA 4XWOA 221PA 3ZD7A 1OH5A 1WJ7A 3AEZA 4ON9A 3Q8XB 4RD0A 4IJMA 1M8PA 2DZLA 2LVNC 3CUEF 2DENA 1JQJC 1E2DA 4LSGA 1IM2A 3REFA 1NI3A 1OB5A 3W5JA 1N5JA 1V5WA 2ZRCA 4MRPA 1OXXK 2XTMA 4M9QA 3ZLJA 5JSZB 2O25A 4AKGA 1ZNWA 1SHKA 2JCSA 4FMDB 4JVLA 4TMZA 3T15A 2LCFA 4NCHA 4BFSA 1OH6A 1DELA 2NO9A 3C5CA 1SG9A 1KZGB 3AP2A 3RS2A 4MGKR 3LA6A 1G8YA 1ESMA 2V8OA 2KNAA 5J4HA 1TEXA 4HAWA 1QZEA 4D81A 4X8OA 1KAGA 2AHOA 2ZIAA 4A9AA 1HT2E 1AA9A 4TLBA 2FN4A 5DN6D 2DHRA 1GAJA 1GOTA 4Q9KA 4XWAA 3X1XA 2OE2A 1XPRA 1J7KA 1HTWA 1M1YE 2QGNA 1S3SA 5BN4A 3ZQ6A 2V6IA 1YR6A 1Z63A 3SDZA 1PGYA 1SKYB 3V4RA 2G3YA 2QEQA 2HYIC 1US8A 3NBZC 4AYXA 2P5TB 3VKHA 2JLSA 2ZS8A 2VP5A 1M34E 1JB1A 1WRBA 2WSSD 3MFYA 5E3HA 4UQOA 4Q9IA 4OHVA 4AG5A 4XH9B 5H8WA 2NO0A 3OFND 3AKCA 3HR7A 1YRBA 1DO0A 2H5EA 4YMUA 1KY2A 1PLJA 3PEUA 1E79A 3K0CC 1KSGA 1EK0A 2F43B 2WWGA 1YR7A 4URWR 4PZZA 1OE0A 1Z6GA 4XVRA 4XWKA 5DYIA 2F43A 4IEEA 2J3EA 4NKRA 2AKYA 3LXRA 4FIDA 4PSKA 4C2TA 4UN2B 1YHNA 1NG1A 1COWD 2AK3A 1JPJA 1SVLA 4B6EA 4M0LA 4CEHA 4OK5A 2C04A 5DNYB 2NO1A 1W4CA 3GQBA 2XB2A 3DKPA 4TLAA 1NVUQ 4BASA 4BRWA 5FPKA 3T1VA 1UEJA 2IYUA 2OAP1 2R9VA 2H92A 2QY9A 3HDTA 4Q1CA 2F1RA 3QKRB 3VR6A 5IF9A 3GLIB 3RWMB 3U3MA 4DCSA 1MRSA 5CDFA 4Q7MB 1AGPA 3T1OA 1AKYA 4Q00A 1IN4A 3QKRA 4PPGA 3ZH9B 3GLIA 2CJWB 3B1WA 3BS4A 4M1OA 4RY2A 2JZ1A 4G5RA 4A8JB 2QPAA 2PZGA 5JMTA 1G5TA 4KFUA 3OHMA 2GZHA 2CJWA 3LD9A 4KHZA 4A8JA 4F4JA 1VG1A 2V4ZA 1EX7A 5KTYA 4D26A 4RFSA 1GITA 4ZIRB 1N6HA 2FWRA 4YMSA 2YVUA 5AK0A 5JI2E 2YWHA 3NH6A 1E9AA 3GP8A 4KU4A 3V00A 4U02A 4DRZA 1IY0A 1Z6TA 1FOEB 1Q3TA 1P2VA 1U99A 1MO5A 2G83A 2PH1A 3BBPA 3C4JA 4QFMA 2HEIA 2IYWA 1JI0A 4D6PA 1TF2A 3D31A 2FH5B 2DZNB 4Q21A 4BEJA 2ZRHA 2BVNA 1E1RA 1P9NA 1RFLA 4Q1AA 3RSLA 3GPLA 3QUSA 4GMDA 3UKDA 4YXWD 1KK3A 2Z4RA 3FHTA 2FSHA 1ZP6A 1KAOA 2IS4A 4TLCA 5GVRA 1R0XA 4X8HA 3ZGXA 1VYUA 3GJ5A 1G3RA 1LVGA 1UADA 2YC2C 1KI2A 4O2RA 1GL6A 4FWHA 5L3QB 2NO6A 2CE2X 2VA8A 3PVSA 1ELOA 2ODEA 3LDAA 3CNNA 1MH1A 1DEKA 4GP6A 1VEJA 1BIFA 1G5RA 2OLJA 3X1ZA 4LRTA 4RD3A 3KXLA 4R2IA 4KYIB 2YOFA 5E95A 1R5OA 3SI7A 2JY8A 3J81k 2FEOA 1OAIA 1F3OA 4A2PA 1DAHA 5TMPA 1ZW6A 1Q21A 1TAGA 3EW9A 4NZYA 4DCTA 2RGDA 4E07A 2IXEA 3GJ7A 2RMKA 2FJUA 3KXIA 3BGWA 3ZZTA 4EIWA 4URVR 4ESHA 3SZRA 1SXJE 2MMCA 2ZJBA 1HH4A 2OO9A 1GKUB 1DG3A 2OFXA 4F91B 1HYQA 3T5GA 3BORA 2O8EB 2R2AA 4Q01A 3HU1A 3N2EA 3WYGA 4DDWA 4JJZA 2VRWA 1U2RA 4EUNA 1OQYA 5EXSA 1PUIA 2IBMA 3EA5A 3HJNA 4QXAA 4A0RA 3QXJA 2O8EA 2P6NA 1CR0A 1T5LA 3A1WA 2DAGA 1OFUX 1W2HA 3ZYCA 2B8WA 1S0UA 2DWZB 1OIWA 4LDJA 2VIIA 1E2HA 2RHDA 2FNAA 4RZXA 4MYUA 5HZKA 5JRZA 1JXOA 4PAQA 4QGFA 2ONJA 1IN5A 1VPLA 5L3RA 2OLKA 2DWQA 4DEXA 5DLQC 4LHVA 4KXFB 4EPRA 4DB4A 2HAKA 1MN3A 1F2UB 3TE6A 2DVWB 3OF5A 4CRWB 1HUQA 1OXSC 5EZ5A 1F2UA 1S1MA 1Y3AA 2GA8A 2D74A 4LHYA 4GL2A 2C99A 1G7CA 4XTRA 5L8VA 3FRIA 3Q7PA 4JL8A 5E7JA 3B89A 2OBMA 5P21A 4KV9A 4CEJB 1ZM7A 2CHVA 1GUAA 2FPLA 3LLMA 4A6XA 3F8TA 2GJAA 3OEHD 3CRRA 2XSZA 2GK7A 3BH7A 4CEJA 3K9GA 4I1OA 4PFSA 2IYSA 4EQ6A 1XJCA 3LBIA 4TQ9A 1WF3A 1TTTA 4LZZA 3TKLA 4BE7B 1XCGB 1U0LA 4G5GA 4MGZR 5GADl 5BW8A 4TN1A 1U8YA 1QHSA 1FMJA 2LKCA 4HB0A 1ZAKA 1EFHA 4IFEA 2DFLA 1E9FA 3PUXA 2ZJZA 121PA 4RZ3A 4KO8A 1FP7A 1E6CA 1IY1A 5AWFC 2FSIA 5FOWA 4DEYA 4Q03A 4B73A 2Q21A 4JLNA 3SQWA 3LW8A 3IPXA 2DFNA 3NEYA 2W2TA 3VAAA 1KDRA 2MMGA 4A3VB 3U5ZB 1K8RA 3OIYA 3H4MA 1QHIA 4JLOA 2FFQA 2ZQ5A 5CITA 1W4BA 4PC3A 3DMNA 4AKIA 1GDDA 2BEJA 2IX3A 4D0GA 2ZJAA 1SVSA 4UJ5A 2GVZC 4G01B 3ADKA 4ACAA 1G7SA 4Q1FA 3IEVA 2ONKA 3FB4A 4GMXA 4NCJA 3HPRA 5LD2B 4BLQA 1WP9A 3ICEA 3MWLA 1LFDB 2ZSBA 5KOYA 1A2BA 1SVKA 4B43A 1OXUA 2GZAA 1RRGA 2F3TA 4MYCA 3UPUA 4IOLA 1RJ9B 1W44A 4AY2A 1T5IA 1QHGA 3MMPA 2ODNA 4QL3A 1G8PA 2QSYA 2H1LA 5FOSA 1P3QQ 3L0IB 2NPFA 3CF2A 2R0IA 1ZUNB 2XITA 3BH0A 2V6ZM 1RJ9A 4HB3A 1GWNA 5LPNA 4QHYA 1D9XA 5EE3A 4ASUD 4LC1A 5F2EA 2ORWA 4N3NA 5JS8A 4EAQA 1U94A 2GBLA 1TF7A 2C9OA 2OZEA 4RFVA 4F4IA 2G3QA 4UXJA 1H8HD 2JLQA 2PZEA 4XD7A 3TQCA 5GVSA 1AIPA 1N25A 2ANBA 4FCWA 2JLVA 3RYTC 3TW8B 3K9HA 2BM1A 5CIQA 1NVMA 3B13B 1IQPA 2WSMA 4RD6A 1OF1A 4JLDA 2GJ9A 1OHHD 1OKKA 3CO5A 1LV7A 3QXSA 1E2PA 1LTQA 1U90A 3U44B 3HP1A 4NCNA 4CT5A 4W7SA 4IFBA 4D4KA 5K8LA 2GK6A 3LAWA 4OL0A 2YOGA 5HZHA 2F9LA 1DOAA 4PC6A 1U8ZA 1RW4A 3QPVA 1E0SA 3IECA 1DAGA 3OESA 4DZZA 4TT3A 1GFIA 4UNNA 3QVVA 1SXJD 4DT1A 2ZU0C 2QE7D 2DI0A 1IN8A 1II0A 1W5TA 4DB2A 2ASEA 5J4LA 1Q22A 2WM9B 3CONA 4TMWA 1NVXQ 3UXMA 4D4MA 1Z0KA 2J0SA 2IUUA 3B1VA 3VFDA 1W4RA 2GEDA 3U3KA 5ELXA 1E2IA 3QEJA 2PEYA 1Q57A 4TWZA 1FW6A 3ZIAD 1KMHB 4D0LB 1E9SA 2WIAA 1Z6AA 1MT0A 5FI0B 5KPDA 2CK3D 1KO4A 4Q4LA 1WGLA 1GNRA 2LVOC 1JR3E 1BMFD 2GAAA 3M1IA 4EPXA 4ZDIA 1GKYA 1UM8A 1P72A 3FKSD 3FMIA 1IHUA 1QVAA 4NBSA 4NYIQ 2JIZA 5K8UA 3HR8A 1UFQA 5FR2A 2OILA 4OJQA 3UANA 1S9DA 1CIPA 3NHAA 3L8YA 4QG7A 5ANRB 1X1SA 1R8SA 3IKJA 3LY5A 1T6OA 1XD8A 1W0JD 3Q85A 5JJLA 4PO1A 1RE0A 2RCNA 4URZR 4LV6A 4BLRA 1Q1QA 4GOXA 3VLFB 4BPBA 3LWNA 3NBYC 4JYBA 2ZREA 4C4PA 3PXGA 4DLWA 2GJSA 2IT1A 1PZNA 2Q9BA 1RRPA 5JHGB 2RGCA 4KSCA 3TVTA 1JAIA 1UEIA 2Z83A 3NBFA 5F9HA 1XPUA 4LCBA 5DHAA 3A1UA 4NYMQ 3W6OA 5A5GA 2OCPA 4TTQA 2LVPC 1QHXA 2DR3A 5CJPA 2IW3A 4TYYA 4URUR 3RHFA 3BJIC 4MKGA 4DLXA 4CDGA 1W48A 3T1QA 4GP7A 3SQXA 3TMKA 1D9ZA 3ETLA 4KI0A 5HE8A 1LB1B 4MDFA 3ZVRA 4M1WA 1W0KA 5FBWB 2VHTA 1NSTA 3GEIA 3U61B 3R8FA 3PFIA 2Z5FA 1J99A 3AP1A 2B7BA 1L2TA 3QI2A 1JEEA 3KJIA 3GFPA 3W3ZB 2G0TA 2ZYVX 2OT3B 1NF3A 2XXAB 2AK2A 1M7HA 4F1IA 1JNYA 3EIEA 5G3ZA 5BXQC 4ZI3A 5KDOA 3VMFA 1G5PA 4NONA 4ZPXA 4TSFD 3SEAA 1G3MA 2CWBA 2D7CA 4LPKA 2KJQA 2DAMA 1ZMWA 1XF9A 1KI8A 4WBSA 5D3MA 2D06A 3THXB 4PSAA 2BDTA 5G40A 2NPIA 4Q9HA 2B7CA 5JBQA 1T3LA 2I4IA 3TBKA 3THXA 1FQJA 1OT3A 2HXYA 3OEED 3PEVA 3TW4A 3LNCA 4ERNA 4ZCIA 2IS2A 4QOSA 3QIAA 2QQ0A 3KQNA 4GZLA 4QM7A 1KK2A 1P9RA 1G4AE 1G4UR 4TLDA 4WVFA 4BFXA 3K0AB 4AI6A 4HZUB 1D2MA 1VCMA 1KOFA 5UKDA 5JECA 3DZDA 3K0AA 3K70D 4HZUA 2JJ1D 1NMZA 4V0NA 2GESA 3SE0A 2DAKA 4Q7JB 4DLUA 2V3CC 4JN6A 1J8YF 2ANCA 4RKEA 4G0NA 1T9HA 4B3XA 3IGFA 2YYZA 2HCJB 3FGNA 2L4EA 2AWOA 2OO7A 2GZDA 4C0AC 2OCAA 4DSUA 1E2FA 5KSYA 5IK2D 5J40A 2N1BA 1N6KA 1XTIA 3IIJA 4UXIA 4XSHA 4DXAA 1BYUA 2JLXA 2ZETA 2FPMA 4B34A 4BLOA 1U9IA 4IVQA 4LHWA 4JBWA 1ZVQA 3GLHE 4HEOA 1EX6A 4YQFA 3MCAA 1OIXA 2QT0A 3WBJA 4MDEA 1ZMVA 4G5SA 4WA7A 2FEMA 3W6PA 4XVQA 2QP9X 3Q7QA 1ANKA 1NSFA 2Q6TA 4H1VA 3A58B 1E2QA 3DOEA 2CMKA 1IN6A 2WJHA 2K9DA 5DO9A 2DWPA 3W90A 1QHNA 3LW7A 2KNZA 2F7SA 1R0YA 2ZSEA 2VP6A 3DMDA 4LYHA 3G82C 2JLRA 4TMKA 4FCVA 5IDVA 2PBRA 4OK3A 2CNWA 2O8FB 2F3RA 4KBGA 5FUXA 5E7IA 1GO5A 1AGRA 1ONBA 5H68A 3TGPA 2FFHA 1DO2A 1YZNA 1T8TA 1XFAA 3C5HA 1T8UA 4NTZA 2JUJA 3AP3A 3GEEA 3AVPA 1W36C 4BQSA 1TU3A 2ZUDA 2ODBA 1ZJ6A 3GJXC 4JMPA 4NP6A 3SJAA 4Q18A 3BK7A 2BWJA 2ZTCA 2BBTA 2IYRA 2OM2A 4LJ7A 3RRZA 4Z1MD 1VQ1A 1G1MA 2ZTSA 2H16A 1IAQA 2WICA 3N2IA 4KAXA 3ZD6A 1GSIA 1VMAA 4BECA 3Q3JB 3B78A 2BCJQ 2F1IA 1YR9A 4LWZA 1JR3D 4KBFA 3L82B 3GJ4A 1JR6A 3FE3A 2KI5A 3U60B 5JWHA 3CWZA 3RRMA 1GRNA 2PL3A 3M0EA 821PA 1UBEA 2RGAA 2WOOA 4MRVA 5A0FA 1FP6A 1OV4A 5CLQA 4JVMA 1IFYA 2ZRDA 1XDBA 2IK8A 4OI0A 1XRJA 5DN6A 5KPJA 1OYYA 2ATXA 2D3WA 3NTUA 4TYWA 4ZO4A 2R62A 4WAUA 3VU9B 1KK0A 3I5YA 1NN3A 4Q7KA 4NCIA 4E09A 5FPTA 4WXRA 1S1CA 2IYLD 3VNVA 4L9SA 2HT1A 4F93B 4FI3C 4OHWA 2ZE8A 3EZFA 2QHOB 4ILEA 2WWYA 2WJIA 3CPHA 1S2MA 4EPYA 2ATVA 4AK9A 4V02A 3B60A 2UZ3A 3DL0A 2OEPA 2WSSA 3BB3A 3H1TA 4FMCF 3QKTA 3BFVA 3KX2A 5B2ZA 5C1BA 5B64A 2C9CA 3OFNA 5AJXA 3X1YA 4XVUA 1E9EA 4GBMA 2PJZA 2IXFA 2EYQA 4GFDA 3IIKA 4JVSB 2ZI3A 2P67A 3SYLA 3SHWA 3HU3A 3O8BA 1Z6XA 5AUQA 1YZKA 3GLGB 1WGNA 1AK2A 3C15C 621PA 1H8ED 2HV8A 4HEJA 4EKDA 1COWA 2O0KA 3QNUA 1N6LA 4HI0E 3ZJYA 3GLGA 4CEIB 1XU4A 3U3JA 2AWNA 3OAAD 1JAHA 4ESVA 4CEIA 3GJ8A 2W00A 3CB4A 1QG2A 1A2KC 2EFGA 2PT7A 4L9WA 4CVNA 1IJEA 4B76A 4B75A 1XMVA 1TNDA 1GZSA 1E2NA 1A1VA 3KKNA 1MV5A 4LJ9A 2JAQA 1GVNB 3TNFA 5JCZA 1RRCA 1EFRD 2FGJA 1CF4A 2GXAA 4R2HA 4JBXA 5JRJA 3WHLA 6Q21A 1M7BA 2SHKA 4GT1A 1Z07A 3GJ6A 2AFHE 4IOJA 4B2LA 2QP3A 5JSZA 2IEYA 2KHHA 4PC1A 3TQFA 5F3WB 3KDSE 1S3GA 4TL9A 3TSOA 2ZJ5A 3LX8A 2WWIA 4ABYA 1VG9B 2VP4A 1O3YA 3T12A 1UKVY 1ZNYA 3IHWA 3QKSB 2A78A 4MITA 5FL3A 1SULA 4MGYR 1CLUA 2AXNA 4WOPA 4OI4A 3TR0A 3QKSA 1SZPA 1ZC4A 4K81B 3MWKA 2XAUA 5CDFE 3FYHA 4TTRA 1IOZA 1GNQA 2JY5A 1KDTA 2RB4A 2CLSA 3GLIE 4TLEA 3RABA 5F9FA 2BMEA 2YJTD 2ZI4A 5KDDA 3BH6A 5KSPA 1PJRA 4AYWA 2FMXA 2DWOA 5B58C 2CCJA 4D80A 2FG5A 2C8VA 1VEKA 3JZMA 2JLWA 3E46A 2JA1A 2P65A 4YXWA 5DFLA 5FUYA 3C41J 5KSOA 2ZRLA 3IUYA 3REGA 1OH8A 2X2EA 4V0ME 1W5SA 1E1QD 2OOAA 5EXXA 2KRKA 1DAMA 3IEUA 3I32A 4HAVA 4CZ2A 2ZVQX 2W6JD 1ZCAA 2QSFX 5EP4A 4Q7LA 4TMXA 1V92A 4JJKA 1TF5A 1PLLA 3KJEA 3QBVA 1UJ2A 1VKJA 3CLVA 4OBEA 1FTNA 3KKQA 4JKIA 2ZPTX 2ZS9A 5FTLA 3B82A 5LB4A 1BO6A 2ZI9A 2R6DA 1U81A 1NVVR 2RRUA 3KB2A 1L7VC 4FWIB 2ZI6A 2XZOA 2DB3A 3RC8A 1QHYA 3CNOA 1S8FA 3EIHA 2RAPA 3IBYA 5SZKB 4A6PA 3DDCA 1VDZA 1ZMUA 2GRJA 3H4JA 1Z06A 2B6HA 1G3UA 3MD0A 4MYTA 4Q66C 3ND8A 4Q9JA 3KUCA 5KU1A 3LFUA 5GJVC 4B32A 3PQCA 1UDWA 3FDIA 3NKVA 4M21A 1OLOA 1K5GA 3THYB 4IHQA 1KO8A 2PMDA 4HB2A 3U7FB 1G16A 5DYGA 1U98A 3PEYA 4E22A 4YDHB 2ZS7A 2QT1A 1T6NA 3CNLA 4TZ6A 1DAFA 5DI9A 2QA5A 4FMDF 4NHOA 4FCTA 4RD2A 4DBLC 3NDPA 1SVIA 3KKOA 2GETA 3KJHA 2ZE6A 5HTKA 3BFXA 3CW2A 5F98A 2DCUA 4UKDA 4L4UA 1HE1C 1XCMA 4AKEA 3F5FA 3KB1A 1NMXA 4ZIRA 1XB2B 1KJYA 2JGNA 4PC7A 4DLZA 5LB2A 4DHEA 1XB2A 3X1DA 3CX7A 4DLRA 1KO1A 2F55A 4IDPA 4KLNA 1XMJA 2GF0A 3QY0A 4KLZA 3UWKA 4PZYA 4QBHA 3UMRA 1MO4A 1PV4A 1RZ3A 1UBFA 5BN5A 2DBYA 1MKYA 2QSZA 2ZITA 2JLZA 2A5JA 5DE3A 2AKAB 2L0XA 3ND9A 3PJRA 1C7YA 2I1QA 2WPDD 4GOKA 2BKUA 2Q0HA 3I4LA 3I62A 4LJ4A 5AUPB 2WKPA 4Q47A 5L3QA 1ZINA 4HB4A 1IONA 1UBGA 1FQKA 2XB4A 1MO3A 2EYUA 1YQTA 2V7QD 4EDHA 3I5XA 2O5VA 4WZAE 3U4QB 2EKKA 5EE1A 4DIDA 3FMPB 3AVYA 2GEVA 1F48A 3U4QA 1WHCA 1HQCA 2ZROA 1DVRA 2WBLC 1Q1EA 1GRQA 3OIUA 4JBYA 1A4RA 5GJWC 2VH5R 4ZDWA 2RGNA 1VIYA 1T4GA 4LBZA 3LCUA 3L0OA 3LRPA 2ZSDA 4JLAA 3VX4A 3RLFA 2MROB 1TTEA 3ADDA 2IHYA 1OIVA 4R7ZA 1Z2AA 1SHZA 3W3AA 4A8JC 1T3SA 4XSGA 3Q72A 3CPJB 2FA9A 3B9QA 2F1JA 2Q3MA 3AF1A 3R20A 1CRPA 2BKEA 3H84A 1VG0B 1OYWA 4JSYA 3SFZA 1B0UA 3KFXA 5L3SB 3LQQA 2C98A 5BWMA 2IYYA 1C9KA 4BWYA 4PHHA 3AVVA 2JY7A 2QMOA 2XZLA 1KKMA 1R5NA 1YJ5A 5CK4A 5L3SA 4B48A 1X8KA 2QM7A 4BRUA 3FTQA 5IT5A 1NJFA 1E9BA 1ZC3A 1YZGA 2KSQA 2WKRA 1IBRA 4M53A 2JATA 2WWWA 2HLDD 3U7GA 3B6EA 3MHVC 1D5CA 4J0QA 2O52A 4TYNA 2CL6X 2QROA 4RD4A 1N6IA 3EZ2A 3WRXC 1T43A 2CEAA 3GLFE 4B74A 3QJYA 4Z8YA 2VSFA 3LLUA 4WXPA 3PR1A 4KFTA 2P3SA 1IY2A 3LXXA 1H8HA 4FD2A 5FOTA 3W8NA 1DADA 4C0HA 1AQYA 3QE0A 4RZUA 4KFSA 3LX5A 1SGWA 5FR1A 4D4LA 1T3HA 5EP2A 2WIBA 1WIVA 2C96A 4PHFA 1DPFA 4TYPA 1CR1A 1AJEA 1XMIA 3HU2A 1TQDA 3KQHA 1CRQA 2J0UB 3IHPA 3P26A 1OHHA 5EXTA 1VECA 2ZU6A 4WZ6A 4DDTA 3NWJA 3RS0A 1KDOA 4HAZA 2J0UA 1TADA 1E1RD 1G41A 5EJEA 4MKHA 2ERYA 4EJSB 1M6NA 1E99A 4NCKA 2IYQA 3VR5A 2VEDA 1SXJB 3CF6R 4O25A 3BD9A 4EJSA 3WHKA 3AV0B 2QENA 3TSWA 3U6BA 4PO9A 3H86A 4C0KA 5AJWA 1SXJA 1OFTA 1QZXA 3FHOA 2GILA 2QE7A 2HF8A 4LBVA 4C0LA 4US2R 4O2LA 3RRYA 4I4LA 1CP2A 5FOXA 3ZS8A 5J4KA 2EU8A 1XXHE 1ODFA 1R0WA 2XOKD 3EC2A 4BFYA 4Y0AA 2CE7A 1J90A 1CJVC 3KFVA 2AD5A 1MOZA 2C2HA 2B21A 4RSGA 3TUIC 3AJIB 3KKPA 2WAXA 1NRJB 2DFKB 4Q19A 2WWHA 3ZIAA 3IDQA 3WMFA 1IN7A 2NQ2C 4JVNA 1XEWX 1ZD8A 3RS5A 3Q5EA 1QBKC 1NN0A 3B7GA 3GJ0A 2CK3A 2P6RA 1C1YA 3A1TA 3CWQA 1BMFA 4RKFA 4BFWA 2J0QA 2BJVA 2EFHB 5BN3A 3RS4A 5IRCD 2WV9A 1KI3A 3ZDQA 2B8TA 5JS7A 3CRMA 2HT6A 3I73A 1WMSA 4TMTA 4RVCA 3KQKA 1GP2A 4OQLA 5K8TA 3LBNA 3VKGA 4Q1BA 2CBZA 4AG6A 4JL5A 2NMVA 3EIQA 3LVRE 2MJ5B 5CYPA 4B3BA 2OXCA 3SBEA 3I61A 3P1JA 2VP2A 1KJWA 4DJTA 1KY3A 2IS1A 4GZMA 1ZD9A 2QRNA 3DM9B 5HE9A 4MGIR 3GD7A 1G8FA 1OW3B 2C95A 4LRWA 3UIEA 2Y8EA 1W49A 2Z4SA 5HKKD 4DKXA 3BC1A 3WNBA 4M9ZA 3ZVLA 3FMFA 4NYJQ 4IRUB 3B1ZA 2NG1A 4QJ5A 3AF4A 1R8QA 2QNJA 1YZTA 2EW1A 4DC9A 1SQ5A 3VHXA 2J9RA 3E1SA 2CLCX 5FOVA 3BERA 1DBSA 2DZOB 4LOAA 2NIPA 3U44A 4U00A 2AR7A 4L16A 1XD2B 3GJ3A 1YR8A 1ZMXA 2XJ4A 3RRNA 5KNCA 4B44A 1Q20A 2ZVPX 2PX3A 4BUJA 4C0JA 3DPUA 2ZRIA 3NH9A 1KI1A 1XD2A 2P2LA 3K1JA 2C9YA 4PANA 4B3DA 4ZCMA 1E94E 1TPZA 1Z83A 2JNHA 4DCUA 3AVWA 1N0UA 4A15A 1E98A 1Q3HA 1DAIA 4MKIA 3AVXA 3EPKA 4OQNA 1S9HA 3K09A 1TL7C 3ASZA 1OFIA 4MKFA 4B47A 5TY0A 1Z3IX 1Y63A 2ODWA 3RANA 2L4FA 2VBCA 2IS6A 3NIBA 2WKQA 4LHZA 3TLXA 2CCGA 3SS8A 2J7PD 2ZANA 1JBKA 4W9MC 1Z0IA 4PZLA 4URYR 2P0EA 2XNDD 5LD2C 1KMHA 2WJVA 3OEEA 5FPSA 2NGRA 3I8XA 3K9NA 1W7AA 2V55B 3W8RA 1F2TB 1RYFA 2D62A 4HDQB 3FWYA 1HE8B 3K70B 5KO2A 3AVUA 1IXZA 3EZ6A 3L43A 4V0KA 1VG5A 1KHTA 1F2TA 4LBWA 1GIAA 2GBLC 1Q44A 2G6BA 2DNAA 1KO5A 2DY1A 3RDPA 2W6ID 1P3JA 1AIPC 3WNCA 1IXRC 3GEHA 2CXXA 1P9WA 4PHTA 4QGAA 5J47A 2QM8A 1X6VA 5TVKA 4S35A 2ZRPA 4GEWA 2QPOA 1KGDA 4DWJA 2ZUCA 5FFMA 1DAEA 2RKOA 3I92A 1D8TA 2ZTDA 4IXNA 3W34A 4YMWA 5IK2A 1XCPA 3UG6A 4DIEA 2ZAOA 1N6RA 1EXMA 2IF0A 2W2VA 4C30A 3UMFA 2BMJA 3V4FA 1M74A 2NZ8A 2GCPA 3CM0A 4JZKA 3B9PA 3TK1A 4A4DA 5KHOC 1HY3A 1TMKA 4L5BA 2A3RA 2NOAA 4IW3B 2LVQD 2EFDB 2MSDB 5GJCA 3GFOA 2JDID 4ZKEA 4X8LA 5D3QA 2BWEA 2BBWA 1F60A 3QKUA 4V0OA 4DLTA 2EVWX 4QKQA 4OHYA 2J5XA 3D8BA 3PCRB 3ZQJA 2QAGB 2W2XA 3PIRA 4LRSA 1NIJA 3K09C 1JPNA 3JVVA 2QAGA 5EP3A 2FGKA 2ZE5A 4JKYA 4NYMR 4PR0A 5FBVB 4F92B 3QXCA 2K5UA 3DVLA 5CM8B 1G9XA 3CX8A 4BGDA 2XXAA 1KI4A 2BJWA 4FMBB 1NG9A 3CIOA 3RNLA 3NG1A 5G3YA 4LBYA 4F38A 3W9YA 1P61B 4I1VA 1E4VA 4Z1MA 2JLYA 4TT3D 3MAAC 5B30A 2CL7X 2IL1A 2X8AA 1OJLA 2IF2A 4AURA 1NKTA 5JJKA 2D7DA 4LX0A 2DFTA 4PC2A 4CF7A 1GKIA 2OBNA 2ZE7A 1P2SA 1EESA 4HLUA 4I99A 1E4YA 4PPNA 3RC3A 1R0ZA 5A4JA 3T1TA 1R6BX 2AXPA 4NE2A 4Q48A 5JEEA 2R8RA 2J45A 4W5WA 4YONB 4MRSA 1E32A 5FTKA 3NEJA 4KVAA 2A5GA 3F0TA 1YU9A 1P7CA 4OI2A 4DLSA 2ZI7A 5C4MA 4Q7JA 1Z47A 1KI7A 5EQTA 4HAYA 2G77B 1G6OA 1Z29A 1ZIOA 2ZYTX 4ACBA 2NZJA 1ZUHA 4FW9A 1RKBA 3BOSA 2E9SA 3AUYA 3C7KA 4IDHA 4Y0VA 1CS4C 5AR1A 1SKQA 5FUVA 4OI1A 4P0TA 2PEZA 1LNZA 5EUMA 1OXTA 2W83A 1NBME 1VEGA 2P6UA 4IXMA 4E5UA 2QTHA 2QI9C 2J41A 2OCBA 4Q1EA 2UVQA 4BFTA 4IVRA 4QBIA 3NVAA 4LYFA 2A5DA 2WJGA 3K0FB 5DIFA 3TAHA 1ZU5A 5FH9A 2YWEA 4P33A 2D2EA 2ZRNA 4W5JA 2RGEA 3K0FA 4CT4B 2RH5A 5C4GB 5CM9C 5CB6A 4JLBA 2O8BB 1GNPA 1HEIA 1H8EA 1ZV1A 3TUZC 4N1AA 1N6PA 4R71A 4HSEA 2O8BA 4TTPA 2O8FA 3U6KA 4U7DA 1UKZA 3RWOA 3THWB 3OAAA 1KZ7B 3CRQA 4FWDA 5SZHB 2CDNA 2VTKA 2DKLA 1OKSA 2LTUA 3DZ8A 3P27A 3QVUA 1VYTA 2IYVA 4JLMA 2GKSA 3THWA 3GMTA 2PCJA 2Q9CA 1X1RA 3BRWD 1K6MA 3JVUA 1R4GA 3SJZA 3A6PC 1Y8GA 1I4DD 1FTSA 1DTSA 3VQTA 4LJYA 4DCVA 2FF7A 5AUNB 3FHCB 5L3VA 1A82A 2H18A 1EFRA 2VHQA 3WRYC 2DAEA 1AS0A 3E2IA 2BM0A 3L2OB 5GJBA 1SVWA 2P5SA 3GLGE 3FPAA 4IOKA 3MWYW 2LWIA 1U0JA 3K9OA 3OIWA 3U3RA 2ZRGA 1FMLA 4XOIA 2QL6A 3WP0A 1CJTC 1WCV1 1Z6YA 1N5IA 3TR5A 5J4YA 1W36D 1RYHA 4C2UA 2IA5A 2JJ2D 4M8NE 1KMQA 2BMDA 3D7MA 4HDOB 5TARA 4BFUA 3KW6A 4O3MA 3C16C 3EASA 3SBDA 2HXSA 1T91A 2WMNB 4P31A 4JIMA 1OB2A 2VF8A 3THOA 1P2TA 3OE7D 4CW7A 2ZJ2A 4EFNA 2VLIA 3VU9A 2ZM5A 1U9IC 1VHLA 1FL9A 4I1UA 3IQXA 3GLHB 4GITA 1N3BA 1UKYA 1AZSC 1LY1A 1UDXA 2R44A 1R4AA 3PENA 1F5NA 4JLJA 5B57C 3ONWA 4M1TA 1Q1ZA 3GLHA 3TJZA 3AKEA
chains in the Genus database with same CATH superfamily
3T6KA 2XZPA 4PZEA 2W4QA 3TRHA 1TCUA 1J33A 3HBMA 3TH5A 1XDDA 3P0RA 4H7KA 4LXGA 4HX5A 1D7AA 2UYGA 3PUVA 2C4TA 3L6CA 2R87A 1MH9A 2A0KA 3TSAA 5T4EA 4R1QA 3E15A 4DQ0A 4I5SA 4GOOD 2I2XB 3TD6A 2E89A 2VUTA 4RMIA 5M2QA 3B2EA 4NRWA 1WQ1R 2XI4A 1P29A 1YE9A 1MABA 2OV4A 3QFHA 1FRNA 2TMDA 5THXA 3A25A 1KQ3A 4OQMA 2UYYA 3CUVA 4QPNA 3ZBUA 3R9XB 3W1WA 2WD9A 2NAFA 3AG5A 4BZZA 2WY2D 3R5FA 4HADA 1NBMD 5CCXA 4IP0A 4XPIA 5TF4A 4MP3A 1U3WA 3HJCA 3JQ6A 2LXEA 3DWIA 1IUPA 2Q6KA 3PRYA 4YHBA 1J56A 1R8JA 3T3IA 4BAZA 4DRYA 2W2LD 2PGJA 2MYPA 1M6YA 4E11A 2J3DA 5A06A 4QDUA 3WKAA 1IHXA 2DECA 1USUA 1Q02A 4M54A 5I3ZA 5G0WA 1ZZGA 5CGZA 5JIBA 1HDIA 3RSOA 1PT5A 2JI6A 1EIJA 1TZBA 4ZCQA 3WZMA 2PX0A 5DEOA 1CRLA 1TR8A 2X19A 4P17A 3M3DA 3H9UA 2GWRA 4F7DA 4PPQA 4MZDA 3AWDA 3Q6MA 3KQMA 3IP9A 2VCHA 5E6SB 1I3KA 4WKBA 1YI1A 4XLTA 4B5KA 4Z8XA 1PR4A 2MR9A 3EUEA 3QKWA 1W76A 4OLAA 3NPMA 3FNEA 1J20A 1JALA 2W11A 1JX6A 4MUBA 1YFKA 3AJEA 2DHQA 3KTOA 4E2YA 5AFSA 1ZN9A 1SKMA 2C5AA 3ITNA 3IILA 3BBZA 2V0NA 2OCXA 4EFKA 2IHBA 3M7GA 2BGLA 1V95A 5CK5A 3OICA 4JBGA 5HKKA 4B6FA 3WJ7A 1JG3A 4TQUS 4DA9A 3NTVA 3ET4A 4RJKA 4YRTA 1YFZA 2ZP1A 3ODGA 1SUBA 5SZJA 4AMYA 1QF9A 1Z2CA 3OZVA 2IYTA 1XTKA 3SHFA 1GCGA 1P4HA 4DGSA 2OCGA 3FKJA 3GU3A 1YB4A 2NUTB 2F1HA 3EVNA 4DW8A 4QOHA 4G63A 3VDMA 1WTAA 1ZNZA 4K6OA 3GLFA 3NBQA 2W6IA 4O8ZA 5JMWA 4H9GA 5AJTA 2ZWAA 1K5DA 4DR7B 4OX9B 1BE1A 1XT6A 5K6AA 3VPGA 5TPZA 3MK6A 3CH4B 4PCVA 3QF4A 3L7NA 1EVEA 3QVGB 4IGKA 3VTKA 4MUHA 4BPRA 2CYBA 2K4MA 1UBCA 1EGHA 3OWOA 4OX9M 3DBLB 4BO6A 4M1SA 4XM2A 2VTDA 1S5PA 2B34A 1BD3A 4A8HA 1ZGBA 3EHDA 2HDNB 4WI1A 5LFAA 2PO7A 4OQQA 4FFOA 4V39A 1O1YA 2Y2UA 3ADBA 4OAPA 2Q5QA 3BD6A 5AVZA 1AU9A 4JSTA 4R41A 1Z6QA 2XZTA 1UBJS 4RFLA 3HEBA 4XUDA 4LF5B 2AX3A 1VG8A 4ZQFA 2RBEA 2WU1A 3PDHA 1KTVA 4OHXA 1QGZA 1MRNA 4Q3OA 3FUWA 4QXRA 2Q3EA 3WLQA 5JPDA 2EJSA 1A76A 1QDTA 1RHRA 4MUKA 4OMUA 1EMDA 4LF5M 4R7TA 4R1TA 5C2JB 5D86A 5A5VA 4MEAA 1JA1A 1MVOA 1QV6A 3L5OA 2ZBGA 3QSYA 3SC2B 4EFMA 2E7ZA 3JQ9C 3G17A 3DA1A 4JT4A 3KYBA 4Z4CA 1HO3A 3NDRA 3K0EA 4MS1A 1KBOA 4QTXA 1R6AA 3KQQA 5DWQA 3T5DA 1Q14A 4DA0A 2M9MA 3A7DA 4D25A 4DDUA 4UARA 4LRUA 4Y9RA 4AJIA 5DTJA 2YASA 3A3YA 4FLMA 2IYFA 2IRWA 4KYUA 1XZQA 4DLYA 3ORYA 3AKDA 2ZVJA 1NVGA 4D3FA 1TQ2A 4AZVA 1JKIA 4FMCB 3C6BA 4PIPA 5CHYA 2OOBA 2Q3BA 3Q15C 5DNDA 1V8FA 3HGIA 4NF2A 2V7GA 4PFJA 4HLUC 4I8OA 2ODQA 1KHHA 1KQNA 2YW2A 1Y80A 1YI8A 1F5SA 1Q91A 1NJ1A 3IJPA 4QGSA 1MJGM 1N5MA 1QIEA 5I9IA 3G1UA 1HMYA 2J4FA 3HCNA 2YJGA 2FUKA 2J4DA 2YJ3A 3X1WA 1Z82A 4LVCA 4GDFA 3IXMA 1PR0A 2BAGA 1DX4A 4Q4CA 2QBYA 1FU8A 2DXIA 3QJGA 2HQRA 3QITA 4QFBA 3ID6C 4ZOQI 5M04A 4DG8A 5MGBA 3EAGA 3M6WA 3BIWA 3O4JA 4UZSA 2PLFA 3N7AA 1O6ZA 4QUEA 4XLZA 5F7JA 4O4HB 3LU1A 2KA6B 1PN3A 4IRXA 2VS1A 1BCRA 1W5FA 4YJ2F 2NO7A 2NV0A 3PITA 1OLXB 4RHTA 1RZVA 5DGXA 3KPWA 3PZRA 4RTLA 5JBIA 1IG0A 3QFFA 3ZX4A 1JYFA 1R6TA 3GLTA 1M0WA 3GJSA 1IPEA 4Y2XA 3SEQA 5BN4B 2CXSA 3HHWA 2IYAA 2XRYA 3TQTA 1NW9B 4BIMA 1KPGA 4IHKA 1LI4A 4AZSA 1QCYA 2FPWA 4Y2UA 4AYXA 2PG3A 3U7QB 2QV7A 5E3HA 3H1FA 2HJWA 1KSGA 3CLUD 3BMNA 2YFHA 2NYAA 4P86A 2J3EA 3GDGA 1HDOA 2IGTA 4RDCA 4R8LA 4RTRA 4B6EA 3HCPA 3H2BA 4LF8B 3MF4A 2AFHA 1PR1A 1EP3B 1C7EA 4HMPA 2DPGA 3DKPA 1T8RA 5KMGA 4Y1FA 2OHVA 3ZVKA 3HWX1 5TPWB 5DB4A 3BMCB 3B1WA 1QHEA 3ZWDA 1JU3A 3D5QA 1PGOA 4LF8M 5AVRA 2RHJA 3SVZA 3QU7A 4R05A 1J1IA 4A1OA 2CJXA 2BDEA 4ZIRB 4TGLA 2NX2A 1IC6A 2CXPA 3M6LA 4BNTA 2BVNA 4GKVA 3KD2A 2EKQA 2VDLB 3LYAA 1GNVA 1MX5A 4LZNA 5EJFA 4X1KB 2FSHA 3R3JA 1I24A 1QPGA 4FWHA 2CE2X 1T4CB 5IXJA 4D8UA 4KYIB 4KXYA 1F3OA 3CNHA 3L7YA 2IUEA 3N8DA 4ZI7B 4ZYVA 4YCBA 2QX8A 3G0OA 5ER9A 5BYBA 5B6JA 2P7IA 4M83A 3QXJA 4BMCA 1MA0A 4CG1A 4ZQHA 1QPBA 2DWQA 3UENA 5DLQC 3Q9NA 2GNAA 3K0HA 5ILGA 1HUQA 3QLVA 3F7TA 3KUXA 2VRCD 2NYUA 4KV9A 2CHVA 4CLRA 4KR6A 4IKPA 5LZ7A 4RPLA 1IBLM 4BE7B 1XCGB 2CWWA 1A69A 2AMVA 1J0DA 4TN1A 1U8YA 2OV3A 4HB0A 3QWIA 3DLCA 3WTCA 1VJTA 3F4LA 4HPXB 1E6CA 2FSIA 4P4GA 3PNPA 1ZN2A 3MJCA 3NALA 1FP1D 4EW1A 1ADCA 5CITA 5JNLA 1DFIA 4BOYA 1JBQA 2IX3A 1LSSA 3R1IA 3A4IA 5ALXA 4OQPA 1HDEA 1SC6A 1A2BA 5CT8A 2PS0A 3WGOA 4WADA 3I2FA 1SD2A 1GWNA 1NBIA 3FCEA 4LOLA 1OVGA 3T41A 3TZEA 3K9HA 1IQPA 1QH1B 5CCBA 2RGWA 1ZOIA 3WGQA 4ZMSA 5DU2A 2NUPB 2ZATA 4HEA6 3OTIA 1DEAA 4ZCRA 2P0AA 2X9GA 3SYTA 1F3LA 4CM3A 4X6LA 2QE7D 2ASEA 1T29A 2WM9B 5IJXA 1NM5A 3MCTA 3VSAA 2AFRA 1ISIA 2IUUA 4MHOA 4NX2A 4R5HA 1IDOA 4TWZA 4ZO8A 4WXEA 4MUNA 1CUXA 1K4KA 3RIEA 3HA2A 3NJ8A 3FMIA 4WPGA 4NYIQ 4YMHA 1S9DA 3SMPA 5JAPA 1GZVA 3F90A 3PGMA 1T6OA 1T1JA 4QQ8A 2HJSA 4NE7A 2DETA 1W4LA 1P0MA 4JYBA 3NCHA 5FBKA 3VO2A 5BVHB 4F8YA 1PZNA 4U8HA 3PWZA 1EUDA 3H2JA 3SOZA 3EZLA 4URUR 3AUKA 2NPOA 4KI0A 3GI1A 5ETJA 1Z4PX 4OGWA 1J99A 5CH5A 3CCFA 4ZFNA 4R54A 3L8MA 1JI3A 1TAQA 4LPKA 3IULA 2HTEA 2A9OA 5EVJA 4ZGBA 1N2CA 3F4BA 1S2NA 1KK2A 2UXCB 4ZYWA 1VCMA 3RS9A 3K0AA 2POQX 2GESA 5CEJA 1OXBB 5LLTA 2YV4A 3AL3A 5KSYA 2NTNA 4Y2PA 1XTIA 3IIJA 2Y68A 4B34A 2WJ3A 4BLOA 5FSWA 2XPCA 4WA7A 2CYCA 3M2PA 2XQKA 5IWAB 2VNKA 4H1TA 1B8PA 4EZIA 2UDPA 4FDLA 3FDZB 1EQAA 1P19A 1UQTA 1JU4A 2FFHA 3LYUA 4YRLA 4LF7M 1A4XA 3SXUB 4JLSA 3SJAA 3T8YA 4L08A 2EKDA 5J63A 4C0WA 2ZTSA 2CSUA 1M2VB 2G09A 3L82B 2KI5A 3RVDA 3SSMA 5KC8A 2WOOA 3QU5A 2I3AA 3RE1A 1E3JA 3BQNB 3S5UA 4LHSA 1E4EA 2Q8NA 2BH2A 2ALJA 4E09A 5F77A 1S1CA 5LKRA 3I4VA 4HXGA 5HMMA 1UMBA 4EPYA 3DL0A 5K03A 3G2HA 4FZRA 1Q19A 3IDAA 1V8ZA 4PG7A 2DEUA 4KJXA 2P67A 5I7FA 4ZARA 4KXMA 4F2WA 3ILXA 2XBUA 3E3AA 2Q62A 1L5WA 2LVBA 1JAHA 3P9QA 1GLNA 1IJEA 3UAWA 4B75A 1F2VA 1MV5A 2GD6A 1EXVA 4JNCA 2EP5A 3PC8A 2FGJA 1HFJA 1TKRA 3ZCSA 1D6SA 1CETA 4B2LA 2YBDA 1TZMA 3ZOZA 4PC1A 3KDAA 4TRNA 4Y6LA 4OHKA 3LY9A 3PWTA 5ELMA 4K81B 4TM8A 4C7KA 3BGIA 1UT6A 2FPXA 3OVMA 4AU1A 3VGPA 1NFQA 1TKCA 3NB0A 4N48A 5REQA 2ZJ7A 3IAXA 3QBVA 1M6EX 4A6EA 4ZCSA 3BQMB 1ZMUA 2GRJA 1L7QA 4X63A 2YQ5A 3E7PA 3QWFA 4NSRA 1DC8A 4E5PA 2VWQA 3AHHA 2BM8A 4GRDA 3TRJA 1ZD5A 3EGDB 5BPHA 3ZIUA 1M1YA 4EMBA 3CW2A 3P2JA 4NENA 1M1NA 4DHEA 2QUIA 2X4DA 3C5WP 2GNPA 3ZY3A 1ZXBA 2CZCA 1TCCA 1FXWA 1S8AA 4OAQA 2WLSA 3PJRA 4OA5A 4HLNA 4NOLA 4ZK6A 3HA3A 1L5LA 3KVNA 1RPNA 4JI5B 3CYFA 2JZNA 5BVGB 5LP1A 3OP4A 1T4GA 3VX4A 3GLQA 3W3AA 4A8JC 5BQPA 1M2KA 4DCCA 3PT5A 1R4MB 5IUJC 5KCZA 1COZA 1ZC3A 3ISVA 1JFVA 3CEAA 2OWDA 5FTWA 1OWPA 2IIQA 4KFTA 3N0WA 1AQYA 1LGYA 2F4VB 2RH8A 3BIJA 1G21A 4CQMA 3VR5A 2XOEA 1DIOB 2IOHA 3BD9A 4O25A 4EJSA 3U6BA 4PO9A 2WT4A 4CM6A 2A9QA 3WWZA 4M0WA 4FNOA 2F4VM 3FFWA 1R0WA 2XOKD 1DC3A 1B3RA 5C53B 1YWGO 4MW6A 5JCXA 3ABQB 2WB2A 3Q9UA 1BU5A 1Q15A 3AFGA 2P4SA 4OQLA 5EHNA 2CBZA 1RWXA 5B2FA 2BEWA 4LK3A 2YJNA 2C95A 2BSAA 3FVWA 4RNDB 2H54A 3R6LA 2Q99A 4UDNA 1MP0A 4ZXFA 2HK8A 4L16A 4B44A 1KOJA 2R45A 3FOBA 1E94E 2PMEA 2CMGA 1BX0A 1AF7A 1QUFA 1RKQA 3EMBA 4HFRA 1K9SA 1OFIA 3I76A 3L5KA 3GT3A 1TKBA 3NIBA 3EXIA 2FOXA 1BVRA 2J7PD 4W9MC 1XQ1A 3A3OA 4URYR 1O95D 3P9YA 2YXEA 3I8XA 2XMBA 1H23A 2PGNA 3AVUA 3I5UA 3DYBA 3K1AB 1YI0A 2I9PA 3WNCA 4EHNA 1H3NA 2RKOA 3W34A 3U6DA 1QH0A 4REOA 1XCPA 2X3FA 4YT8A 5DV9A 4XDGA 3WLEA 3FCOA 2D2XA 2VZ8A 3FD9A 4GIPA 3SKYA 1JIKA 5L9AA 2I6QA 2N9UA 4KQ9A 3DTNA 3X3HA 5BMVF 4C6RA 1NIJA 4EI2A 5EP3A 1JMVA 1G9XA 3NIDB 3WLJA 4BC1A 1N4AA 2FQ1A 3FLBA 3QLTA 4NC6A 4H16A 2IXDA 3IEMA 4I1VA 2C3UA 1S6YA 3PHCA 4MW9A 4CF7A 2DC1A 1A9RA 4O63O 3OCWA 3GDFA 1E4YA 4MQMA 4PPNA 2VUSA 3RC3A 2ET6A 1T13A 3P9CA 2RKBA 1SEPA 4UUMA 4UM9B 2ZI7A 3L1JA 1I0ZA 1AO3A 2J3KA 5LQDA 5ITWA 3IBFA 1VA5A 3T3GA 2RHCA 3DT9A 4ZAGA 3MS7A 3TAHA 4K0RA 2B2NA 2OBYA 3Q8MA 2CV2A 3TUZC 1CRZA 4XGRA 4U7DA 3THWB 1KZ7B 3CKMA 3DBVO 2YUIA 2OCIA 3AO0B 2GKSA 3GMTA 2J08A 2HDOA 1RI2A 1RYYA 3EGIA 2GCIA 3T3HA 5EIHA 5GJBA 2HSDA 1RHMA 1OI2A 4BWVA 3WP0A 4L75A 1KMQA 5TARA 4IHJB 1FTQA 4KLCA 1QO9A 4J1SA 2ZM5A 4FSDA 4FONA 8LDHA 3PENA 2AS0A 3D2BA 2V03A 1YIDA 1VCHA 2YVAA 1LJUA 1QANA 3DMRA 5DI3B 4ZZIA 5LNK6 1GQ2A 3K1TA 2GYYA 1UWCA 3UK6A 3OMWA 1YQGA 1I2MA 1PZMA 1EFUB 1A04A 4RF1A 2Z5VA 3QWHA 1EXDA 1RIFA 5TSDA 2IZ5A 1JDUA 5HCUA 3KTAA 2PT6A 4IQ4A 1EWRA 3A4YA 3OM1A 4J1NA 5B6PA 4IO1A 4HPWA 3NHJA 4YP0A 2OMKA 4CI9A 1ZQ1A 1BJTA 2YUTA 1QZMA 3H5IA 3C14C 3L1KA 5DM70 2XA2A 1YE8A 5ALOA 1A1SA 2H57A 1TIKA 3AI2A 2NSLA 2OUKA 1I7PA 3CBQA 4HDNB 5KREA 3LW5F 4PYQA 1UBMS 3FWKA 4QDKA 1U2ZA 4D9JA 3V9PA 3V7WA 3ESYA 2V97A 2HU5A 1ORHA 3PNYA 3DOIA 1UAAA 4S12A 2ZTHA 3OCCA 3MRXA 3U6PA 3IV6A 3OBIA 5IANA 1USGA 4A36A 1WUKS 5A3JA 4A0FA 4IBIA 3AF5A 3AJRA 5KQSA 4BV9A 1I0LA 1YQWA 4R40A 1UUFA 3H13A 4HDCA 4JODA 4L4XA 5A5EA 4E12A 3N8NA 3FMVA 2CHQA 1M6VA 2AXQA 4RFSB 3VMMA 1X37A 1KSFX 1KEEB 1N5LA 2D1TA 4YV2A 5L7TA 4CFZA 4F45A 2QGZA 1VJ1A 4IDOA 1X3LA 3RLIA 3D7LA 3VNUA 4OD0A 2Q3FA 5DP2A 4ZZ3A 3HM2A 2REBA 1CHNA 4NBUA 1KI6A 1U1CA 2IYXA 3UWOA 3LV8A 1OMOA 1DCTA 3QE2A 2Z3XA 5DLEA 5GKNA 2PL5A 3LGXA 2HJGA 4GSYA 1RQNA 4A7PA 4FFWA 4OFBA 1TYAE 4HO1X 2GF9A 5HA5A 3PXUA 4DMGA 4I81A 3EXG1 2HAEA 5AQEA 1TLLA 1GA4A 3R8XA 1S2LA 3PQEA 2BMWA 1VB5A 2OG2A 1P44A 5NULA 3KSUA 1XLTA 1UC4B 3FPLA 3JRNA 5CG1A 1FFEA 1A96A 1XNQB 4MQBA 4UCQA 1SCUA 3T6PA 3IIEA 5CT9A 4PX2A 2HF9A 4MS3A 3ABIA 1ZISA 4BLPA 5CT6A 3PTAA 3BB1A 4ND8A 1G291 1IM5A 2RH4A 1X3SA 4CIYA 4DDVA 5DK6A 2BCGY 2R6AA 1MR3F 4DDKA 4K40A 4KQMA 5BW6B 3VJMA 3SKVA 1WJGA 1NV8A 5L53A 4BO3A 1U4SA 1ZRNA 3U4MA 5ALFA 2AG1A 4YQZA 1IVNA 3NR2A 5IS2A 7ADHA 2NZYA 1ZH4A 1P0CA 2VQEB 1UOOA 2ZJYA 1NHWA 2FW9A 3HN2A 4OHCA 2GD1O 4KXNA 4BJ1A 2C8LA 1TM5E 2C88A 1YDWA 4HMOA 3SU8A 1VHQA 2VQEM 1Z4KA 1UC9A 3PWKA 2FU5C 1YVDA 5JVDB 1QVZA 1Y1SA 2E4XA 3F3KA 2DX7A 2IU6A 4DBZA 1NYTA 5B12A 4BYGA 1CTQA 1QQAA 4TL7A 1EK1A 3FRHA 4POAA 5DBEX 4QHSA 3EAQA 16PKA 5DCWA 4ZKDA 3RQIA 2VSOA 1OX4B 1X7ZA 2X6QA 3L8ZA 5DHPA 1OZ0A 2BZ1A 4PD2A 5KYNA 3BK1A 4CLOB 4MV7A 2XVZA 3QTLA 4QWMA 1AN0A 4RPHA 5KSZA 4J1TC 2CHFA 1JEQA 2PSDA 4Y9TA 4MIEA 3D5TA 3RSQA 2V7WA 2QM0A 4CIWA 4Y9DA 2CNOA 3SXPA 2PBLA 2CP8A 1MLDA 1ZIYA 3ECCA 2ZULA 2JASA 1CX9B 1NBEA 4NJMB 4CKWA 3HVKA 1J5XA 4Z2AA 1GYRA 3E81A 1WKVA 3R7DA 1M9NA 2IEZA 2MR5A 4OQFA 2QMQA 4WOBA 1TJ4A 2WWXA 4ZT2A 3AHEA 3ESCA 1T0PA 4JN6B 2WM3A 4WDQA 4R8VA 4IIDA 4HFNA 3VVBA 4A0HA 3EMKA 3VX3A 2QAGC 3R41A 1N9GA 2H7YA 3PQFA 3JAKB 2YFKA 1QF7A 2HQSA 3I8SA 2IEGA 1RADA 5E2AA 4GBED 2B1JA 4ZEXA 1G17A 5DXFA 3EVZA 3JZAA 1CD5A 5FA6A 4MROA 2ZAMA 3AFMA 1KQOA 1QX3A 3HY3A 2FPKA 3OLWA 1Z5ZA 3GRYA 3NAZA 5DGTA 1B8NA 1Z45A 4W5RA 3TEFA 5T4FA 1DMSA 3BA6A 1Z39A 5HPYB 1K63A 1NAIA 1VI6A 1Q7TA 2V3WA 1EINA 4DPKA 2ZJ8A 3F8SA 4JYCA 1VYVA 3MMSA 2DBRA 3TWKA 2M1ZA 4ZOAA 1LX7A 4ZZ2A 1Z4QA 1ZFNA 1EGAA 3IPCA 1B23P 4HNGA 3DC7A 2JIQA 3NHFA 2H2AA 5CG2A 4BNNA 2WVAA 3B8EA 2NWQA 1ESDA 1D1TA 2E18A 1H42A 2DENA 1USIA 2B1GA 4HV4A 2M60A 2YWCA 1N77A 3WAKA 3WYDA 4Q9KA 4WMLA 1SIWA 1ID8A 1YD7A 5FUMA 4MLCA 1XRMA 1R6VA 2XUZA 1NUSA 1M10A 1USKA 4IY1A 1PEYA 1PLJA 5FO0A 2F43B 4NMWA 5KVVA 2ID4A 1OE0A 1K4MA 4AIRA 1VMEA 3HBLA 1EVZA 4ITVA 3CVYA 4I4TB 3MJTA 3HLTA 4GI2A 2PPVA 5DNYB 3TLKA 4O2AA 2NO1A 4ZO6A 4RJ2A 4XM1A 1RPAA 2K2QB 2KX7A 2YMMA 5IKXA 4BO8A 5BSKA 3G5AA 3OJCA 4GAEA 4Z0HO 3CA8A 3DO5A 4LE2A 4A8JB 4LNUA 2QQFA 3DHVA 2APLA 1R3DA 1IB0A 2IE8A 5BT9A 4B4WA 3AEKB 4NBRA 3RJ5A 1NQVA 4WZBA 3EFHA 2I7DA 3BZUA 1TZKA 5IJZA 3EVEA 5ITTA 3RGPA 3RSLA 1QYRA 4ECEA 3KYCA 1DEKA 4GP6A 2OLJA 4FHFA 3MGGA 4ZQIA 2WQZA 4YBZA 1ZW1A 2YOFA 5E95A 5G1OA 5BV8A 4JFRA 3ELYA 3UA4A 4DCTA 4CETA 1IY8A 1FNSA 1SQSA 3KXIA 4UM8B 2EP7A 4LRQA 4BO7A 3KU4A 9MHTA 4Q9NA 2O8EB 4B6RA 1ULZA 4H4CA 2P5YA 3D0RA 3D8SA 4J76A 3D9QX 1QQTA 1DKPA 5L3RA 2HKJA 1SURA 2M6LA 3PGJA 2E4AA 1OXSC 2RFLA 1Q1AA 2B69A 1BJRE 1M33A 3F8TA 3K9GA 2IELA 5C9ZA 3L25A 5DRYA 3T4XA 1W94A 2LKCA 3WDSA 1VKOA 3SJUA 2ZJZA 1K7XB 1MNQA 4XA8A 1P7ZA 4JLNA 4TV8B 4RCVA 1K8RA 3W2IA 3B7NA 4D9GA 1T15A 3PYMA 4CTMA 2ZJAA 3ADKA 2CNLA 4JOSA 1FDRA 2GZAA 1GNLA 2XZUA 4MYCA 3L4JA 3NBUA 4QL3A 1G5HA 4CQLB 3T7CA 2YTZA 5CD1A 4JEIA 3E61A 4EHHA 5ALHA 4I8XA 1O97D 1FDIA 3MYYA 1WCIA 3HP1A 3G8YA 3BSYA 3L8DA 2JAWA 1JE1A 2P2GA 3WL3A 2JFFA 5M29A 3BE6A 5D7BA 1A7KA 1J09A 4D4MA 2PFGA 4X7PA 2X8BA 4J8PA 2QOEA 3HXLA 4DLAA 1Z2EA 2QTAA 1KO4A 1JR3E 2QUAA 4ZAXA 5A2QA 4MV5A 1C4WA 4K6FA 4QNNA 3OOJA 3GY0A 1P91A 5EHZA 4JUDX 4GZ5A 1Q5PA 1ZEMA 3ITEA 1Z2PX 3KS4A 1RRPA 4TUYB 3TVTA 2KDLA 5FBZA 5CJPA 4Y6GB 1ZEJA 4EUFA 2XCRB 1MN6A 1LB1B 4M1WA 1Z0UA 5TMDA 2VHTA 5B36A 3RAJA 2UXBM 3EMVA 3W78A 3NUQA 3VMFA 4TSFD 4QD3A 1EM8A 3G79A 1Z5NA 4PNHA 4UUOA 3TXYA 4NK5A 2HM7A 1ZN8A 4CNQA 4QM7A 2PRYA 2VJBA 2BD0A 3TFQA 4KNVA 3DNMA 4G56A 4YBRA 2XWSA 4REQB 2JJ1D 4KR9A 2HCFA 1VOTA 5JNVA 1FSPA 2JLXA 4JBWA 2H0QA 1EX6A 1OIXA 1BWRA 1XHBA 2COKA 1K0FA 1W2WB 5DZSA 4XJVA 2DWPA 3ELDA 1PBNA 4KBGA 5E7IA 5CH3A 5C5IA 3AP3A 2ODBA 1ZJ6A 1UEXC 1B15A 4Z1MD 1KGSA 4LNHA 2CWDA 4KBFA 1GZHB 3X44A 2MYNA 3ND5A 4PZUA 1KK0A 4OOFA 5AKIA 2Q2NA 4WXRA 4FCCA 4Z86A 4L9SA 4AJNA 1O4VA 2NSDA 5DGIA 2GEFA 1CJSA 1R8YA 1E9EA 4PFQA 2ZIEA 5B37A 1EGVB 1SO8A 1Z74A 4QDOA 1G6Q1 1R0KA 3BF8A 3ESQA 3GLGA 3OAAD 2XNHA 2W00A 2E6UX 4B76A 3W8DA 1XMVA 5NLLA 4M9CA 4DRXB 1GQSA 1EH5A 2IY7A 3WLIA 1IHOA 1FRQA 4DVJA 2ZVDA 1NF9A 4IFTA 2W2KB 3FNGA 4RTQA 3MBOA 5IN5A 3C8MA 2XAUA 2P2DA 1M5UA 3GLIE 5EL0A 2V0GA 1X9IA 1K7FB 4D80A 2JA1A 3MS4A 1JAXA 1JWAB 1VGRA 4HVTA 2PE5A 4RQUA 1K66A 2PZJA 2YXBA 4JJKA 4QYXA 4HX9A 1JVSA 4AICA 1FTNA 5EJMA 2ZPTX 4EI9A 4HDRA 4MJXA 3RC2A 2V3VA 1V1JA 3BTOA 3PIIA 1LWOA 4HNUA 5KU1A 4ENPA 4EELA 3C3WA 3MBIA 1GDTA 1GKKA 2PMDA 2NSYA 4QOFA 5C4IA 3VJKA 2ZJ6A 5GQSA 4MKRA 2ZBPA 4LOJA 3E22B 4EGQA 4N9QA 1XA3A 3LL4A 4RKRA 3AHFA 3M6MD 3L4BC 5H3LA 1B42A 5ICCA 4LVOA 3QY0A 3RQSA 1J1ZA 1PDOA 4G09A 2C5BA 2L0XA 4W8HA 4GOKA 1ZRSA 3REQB 1WU7A 1QDLB 4HRYA 2JAOA 1H2YA 1YQTA 2V7QD 4ARUA 3HUEA 4MCJA 3NW9A 3LCUA 3L0OA 1ZD3A 2QMYA 4OYYA 4MEJA 1TTEA 4PIVA 4UU1A 5K0ZA 1X94A 2FA9A 2P68A 4F85A 3H84A 4DM7A 1QO0A 1TXGA 1K1EA 4MUJA 3AVVA 2JY7A 3TCXB 4FLEA 2P8SA 3SS9X 5E4YA 2NSJA 3MHVC 4TYNA 3AX6A 2PWAA 1SGWA 1T3HA 5AK6A 2VLBA 4PHFA 1D0VA 1NA5A 5CAEA 2ZRQA 1DFGA 1TLTA 4WZ6A 3RIHA 1E1RD 4PRKA 4YRMA 4MKHA 4TSKA 3HYNA 1EE9A 4IMRA 1JLKA 3VUFA 3H3FA 5JDIA 2J6HA 4Y0AA 3KFVA 3ZWNA 4Q19A 4KI7A 1WDLA 3RS5A 3ZYZA 2BGJA 4V1CB 2J0QA 3BCHA 4RIIA 3V32A 4WKCA 3ZDQA 4UHFA 2BFNA 4RHXA 4O4LA 4LXQA 3V34A 3C87A 5J58A 3HJUA 4GGPA 3FDJA 4MGIR 2GN8A 3PQDA 1KMCA 3H42B 4FOPA 4R31A 4AQYB 3OPNA 4M9ZA 3AF4A 3G85A 1JS1X 1WUHS 3O82A 2GAIA 4PSCA 4C0JA 4RTJA 1KI1A 4DR7M 4B3DA 2Q0XA 2F5NA 5EWJA 5MFZA 4AQYM 1Q3HA 4ZHQB 4MKIA 2GT1A 4F84A 3AERB 2XVXA 1JKMA 4MKFA 5FULA 3R40A 3WB9A 1MC8A 3MINB 3QFTA 4LHZA 5ED4A 4R9RA 1IUNA 2C4WA 4S1WA 4AAYA 3H2HA 2VK8A 2A1IA 5LC1A 3B6JA 2RI0A 2IQIA 3D3WB 3KC2A 3DV9A 4GEWA 4DMHA 1LC3A 1EFVB 1LPMA 3U6MA 2C7PA 3WYNA 1JHYA 3SQMA 2YMLA 3O4GA 3KOWE 2EVWX 3USCS 1FYEA 1VDMA 2QAGB 1WHTA 1VJ5A 3U39A 1V96A 4JKYA 3Q87B 2YJ6A 2H2GA 4YXFA 3B6KA 4H1WA 1W6UA 1GD1O 2PD6A 4YAIA 4DWWA 2V4MA 4GUAA 4DSZA 1P2SA 3FPBA 3HS3A 4RJJA 3K32A 3QV1A 1GZ7A 3EJ6A 4JT8A 1VL6A 5J2UB 1Y6RA 4PEVA 1O94A 4S1OA 1WKBA 4LJRA 3EGXB 3I9LA 4ZODA 3V8BA 2JAUA 1IQ0A 4Q6BA 1HR0B 4IQFA 5ENZA 3HKCB 3W8FA 2EJVA 5CM9C 2AEEA 4KAFA 2P30A 3ANYB 1EJ2A 1H1DA 1O5TA 4L9AA 2FVYA 3P27A 1I3LA 2Q9CA 3MOIA 3RUFA 1HR0M 4JI4B 4G0QA 3WGYA 3TOSA 3E2IA 3JASB 4EJ2A 3K9OA 3U3RA 2GFQA 1CJTC 1WCV1 2H9YA 1ZXXA 4YRAA 1QRDA 1Z17A 3IXQA 1JH9A 4JI4M 4Y6RA 4DJFC 1P2TA 1F8FA 4YDQA 2Q4DA 3FN4A 3JQRA 2OPHA 2R8PA 1D0MA 1GXSA 1KY5A 1MO2A 1LK5A 1XZGA 1W88B 1QWOA 3OI7A 5AJVB 3WYCA 4OQDA 1T5TA 2R25B 4PG8A 2VTBA 3H1BA 4I08A 4E2WA 4EZEA 2D2VA 3OTQA 3JPWA 2CSXA 4A5OA 1DBQA 3MG9A 4BEVA 4R0NA 2QD3A 2VP9A 2AB0A 3ZC3A 4ARBA 3BWVA 3ZS9A 3O6VA 2OHFA 3K4PA 1II9A 4ME6A 1M54A 4CTNA 3OD5A 1CJUC 1H1LA 4G65A 4U0JA 3TSCA 1CDOA 1ZM4A 2H1RA 1JMYA 2VT7A 4M22A 1XOIA 4U5QA 5H4HA 4JL6A 5LYJA 4AUKA 1D0IA 5GP1A 4LV8B 1T9AA 5C8YF 2VDUE 1K92A 1MO6A 3C6XA 3TRDA 4WBXC 3BILA 3AIIA 1UKEA 3QXXA 4AB1A 4H7PA 3ZV6A 3G5MA 3VYWA 5CT5A 5JSQA 3ZZUA 2JZ0A 5FV7A 5JAMA 1ZESA 2RC5A 3A9CA 3A37A 2O5RA 4B3CA 1SVMA 3U7HB 3GA5A 5K0CA 3CVVA 1SHLA 5D85A 3I9NA 4E4YA 2ZJOA 2ZRJA 1EB9A 1JFTA 1D4AA 2QQEA 1E3QA 1Z5OA 2BKVA 2UZAA 4JI3B 4OH1A 4FKBA 5JU6A 1V43A 1Z68A 1UBSB 1KYYA 5DNAA 5I7SA 3MJHA 1WW8A 3UN1A 2I2DA 3WVNA 1M1ZA 1U9YA 2RI1A 3V9AA 4P4SA 4Y2VA 4JI3M 2OSBA 5G1PA 2CFSA 2OD7A 4RF0A 4YC7A 2RARA 1P0FA 2BP7B 2IW1A 5BQ5A 2HF2A 1PZEA 3AQ4A 1QTNA 4ARZB 4ESEA 3WQHA 3T7DA 1NN5A 2DJ5A 4MWDA 5LYYA 2CJPA 5KZMB 1FPMA 4IVPA 2PBZA 3CX6A 4X85A 3E0QA 3JATA 5AVKA 3ROQA 4QUBA 2PT5A 4UCWA 1PS9A 1EE8A 4YLGA 3M89A 5CX1B 3VV3A 4UQLA 2GVNA 3ZWKA 1Y9DA 5IBPA 3JSAA 5ITVA 3ZH2A 5B4UA 1YDEA 1TMYA 3HEMA 4LJLA 3JVEA 4N0QA 3ZU6A 3JD3A 5LQMA 1KYIA 2ZFUA 2BYTA 1YNOA 3R76A 4M87A 1QIHA 1ZY2A 3VKFA 1KEVA 5LBIA 1A8IA 1PJ4A 4R8RA 1H0HA 4RHYA 3VDQA 4XQGA 3WLKX 1DWUA 4RW0A 4D9KA 2V1CA 4YUVA 5FAKA 2XADA 3CINA 2DSNA 2G9NA 2WD8A 1VRVA 4K26A 3J80S 1VE9A 4A0GA 5IEJA 4QECA 1L7XA 1GPDG 4WECA 2KNVA 3T34A 1XELA 2FLVA 1T9ZA 2PKYX 2UZ1A 2X5NA 3NKFA 4JDUA 1VPDA 2XHEA 2YZ2A 3CUUA 4IKOA 4L6IA 3QWBA 1Z5AA 2IEIA