1G4FA

Nmr structure of the fifth domain of human beta2-glycoprotein i
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
86
structure length
86
Chain Sequence
TKASCKLPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA2-GLYCOPROTEIN I
publication title Identification of the phospholipid-binding site of human beta(2)-glycoprotein I domain V by heteronuclear magnetic resonance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 8
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2000-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09014 Sushi_2 Beta-2-glycoprotein-1 fifth domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1g4fA00
1Z92B 1C1ZA 1TPNA 4B2SA 3KZJA 1GKGA 4DJZA 1TPGA 2JGXA 2CG7A 3ZD1A 1VVDA 1TPMA 1ZJKA 1U5MA 4CSYA 4WJG2 2UWNA 4B2RA 2KMSA 3ERBA 4PZ5A 3SW0X 1QGBA 4LOTA 2A55A 1OJVA 2MCZA 2B5ID 3OP8A 2YBYA 2BZMA 1E5GA 2RLPA 2V8EA 4ZH1D 1E8BA 3EJHA 1H04P 3GOVA 2JRAA 1E88A 2EC3A 1NWVA 5HYPA 2RLQA 3L89M 3RJ3D 4AYDA 1O9AA 2G7IA 2EHFA 2YRAA 5FO8C 3TVJA 3ZD2A 2W81A 2KRIA 2XWJI 1LY2A 3MQLA 1MD8A 1HFHA 4KKDA 1GHQB 2CG6A 2IZ4A 1HCCA 3IU3I 3M7PA 1G4FA 2O39C 3O8EB 1OJWA 2XQWC 5I0QB 3NFPI 4C16A 2QY0A 2RKZA 5JPMG 1G4GA 1Q3XA 2CKUA 4AYEA 1QO6A 1SS2A 3IX0A 1OK2A 1ELVA 4AYIA 3OEDC 1OK9A 2XWBF 1GKNA 1FBRA 2MCYA 2JGWA 4MUCA 1HFIA 2LOJA 3OXUD 1VVCA 1OK3A 4JHSA 4A5WB 4LOSA 4J38B 2WIIC 1H2QP 1CKLA 4YNXA 4IGDA 2RKYA 2XRBA 2XRDA 5HZPB 1QUBA 5HYTB 1OJYA 1GPZA 3KXVA 4F4OC 3ZRZA 4AYMA 3GXEA 1H2PP 1MD7A 1H03P 3T5OA 3INBC 4FXGG 1PPQA 4K12A 5HYUB 2RL0A 3CALA 2W80A 4ONTD 1OK1A 3R62A 2ERJA 2IZ3A 1SRZA 1UOTP
chains in the Genus database with same CATH superfamily
1Z92B 1C1ZA 1TPNA 4B2SA 3KZJA 2ZYCA 4N7EA 3NJAA 1GKGA 4DJZA 1TPGA 2JGXA 2CG7A 3ZD1A 1VVDA 1TPMA 1ZJKA 1U5MA 4CSYA 4WJG2 2UWNA 4B2RA 2KMSA 3ERBA 4PZ5A 3SW0X 1QGBA 4LOTA 3K3TA 4YIZA 2A55A 1OJVA 2MCZA 2B5ID 3OP8A 2YBYA 2BZMA 4PO7A 1E5GA 2RLPA 3ZLEA 2V8EA 4ZH1D 1E8BA 3EJHA 1H04P 3GOVA 2JRAA 3ZLDA 1E88A 2EC3A 1NWVA 5HYPA 2Y8SA 2RLQA 3L89M 3RJ3D 4AYDA 1O9AA 2G7IA 2EHFA 2YRAA 5FO8C 3TVJA 3ZD2A 2W81A 2KRIA 2XWJI 1LY2A 3MQLA 1MD8A 3F6KA 5DN5A 1HFHA 4KKDA 1GHQB 2CG6A 2Y8RA 2IZ4A 1HCCA 3IU3I 3M7PA 1G4FA 2I2LA 2O39C 3O8EB 3FGTA 1OJWA 2XQWC 5I0QB 3VWOA 3NFPI 4C16A 2QY0A 2RKZA 5JPMG 1G4GA 1Q3XA 2CKUA 4APLA 4AYEA 1QO6A 1SS2A 4BWCA 1RLHA 4MSLA 3IX0A 2X2ZA 1OK2A 1ELVA 4AYIA 3OEDC 3WSXA 1OK9A 2XWBF 1GKNA 1FBRA 3WSYA 2MCYA 2JGWA 4MUCA 1HFIA 2LOJA 3OXUD 2Y8TA 1VVCA 1OK3A 4JHSA 4A5WB 4LOSA 4J38B 2WIIC 1H2QP 1CKLA 4YNXA 3FGRA 4IGDA 2RKYA 2XRBA 2XRDA 5HZPB 1QUBA 5HYTB 1OJYA 1GPZA 3KXVA 4F4OC 3ZRZA 4AYMA 3GXEA 1H2PP 1MD7A 1H03P 3T5OA 3INBC 4FXGG 1PPQA 4K12A 5HYUB 2RL0A 3CALA 2W80A 3CI0J 1OK1A 4ONTD 3R62A 5DN4A 2ERJA 2IZ3A 1SRZA 1UOTP
chains in the Genus database with same CATH topology
1Z92B 1C1ZA 1TPNA 4B2SA 3KZJA 1GKGA 4DJZA 1TPGA 2JGXA 2CG7A 3ZD1A 1VVDA 1TPMA 1ZJKA 1U5MA 4CSYA 4WJG2 2UWNA 4B2RA 2KMSA 3ERBA 4PZ5A 3SW0X 1QGBA 4LOTA 2A55A 1OJVA 2MCZA 2B5ID 3OP8A 2YBYA 2BZMA 1E5GA 2RLPA 2V8EA 4ZH1D 1E8BA 3EJHA 1H04P 3GOVA 2JRAA 1E88A 2EC3A 1NWVA 5HYPA 2RLQA 3L89M 3RJ3D 4AYDA 1O9AA 2G7IA 2EHFA 2YRAA 5FO8C 3TVJA 3ZD2A 2W81A 2KRIA 2XWJI 1LY2A 3MQLA 1MD8A 1HFHA 4KKDA 1GHQB 2CG6A 2IZ4A 1HCCA 3IU3I 3M7PA 1G4FA 2O39C 3O8EB 1OJWA 2XQWC 5I0QB 3NFPI 4C16A 2QY0A 2RKZA 5JPMG 1G4GA 1Q3XA 2CKUA 4AYEA 1QO6A 1SS2A 3IX0A 1OK2A 1ELVA 4AYIA 3OEDC 1OK9A 2XWBF 1GKNA 1FBRA 2MCYA 2JGWA 4MUCA 1HFIA 2LOJA 3OXUD 1VVCA 1OK3A 4JHSA 4A5WB 4LOSA 4J38B 2WIIC 1H2QP 1CKLA 4YNXA 4IGDA 2RKYA 2XRBA 2XRDA 5HZPB 1QUBA 5HYTB 1OJYA 1GPZA 3KXVA 4F4OC 3ZRZA 4AYMA 3GXEA 1H2PP 1MD7A 1H03P 3T5OA 3INBC 4FXGG 1PPQA 4K12A 5HYUB 2RL0A 3CALA 2W80A 4ONTD 1OK1A 3R62A 2ERJA 2IZ3A 1SRZA 1UOTP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z92 B;  1C1Z A;  1TPN A;  4B2S A;  3KZJ A;  1GKG A;  4DJZ A;  1TPG A;  2JGX A;  2CG7 A;  3ZD1 A;  1VVD A;  1TPM A;  1ZJK A;  1U5M A;  4CSY A;  4WJG 2;  2UWN A;  4B2R A;  2KMS A;  3ERB A;  4PZ5 A;  3SW0 X;  1QGB A;  4LOT A;  2A55 A;  1OJV A;  2MCZ A;  2B5I D;  3OP8 A;  2YBY A;  2BZM A;  1E5G A;  2RLP A;  2V8E A;  4ZH1 D;  1E8B A;  3EJH A;  1H04 P;  3GOV A;  2JRA A;  1E88 A;  2EC3 A;  1NWV A;  5HYP A;  2RLQ A;  3L89 M;  3RJ3 D;  4AYD A;  1O9A A;  2G7I A;  2EHF A;  2YRA A;  5FO8 C;  3TVJ A;  3ZD2 A;  2W81 A;  2KRI A;  2XWJ I;  1LY2 A;  3MQL A;  1MD8 A;  1HFH A;  4KKD A;  1GHQ B;  2CG6 A;  2IZ4 A;  1HCC A;  3IU3 I;  3M7P A;  1G4F A;  2O39 C;  3O8E B;  1OJW A;  2XQW C;  5I0Q B;  3NFP I;  4C16 A;  2QY0 A;  2RKZ A;  5JPM G;  1G4G A;  1Q3X A;  2CKU A;  4AYE A;  1QO6 A;  1SS2 A;  3IX0 A;  1OK2 A;  1ELV A;  4AYI A;  3OED C;  1OK9 A;  2XWB F;  1GKN A;  1FBR A;  2MCY A;  2JGW A;  4MUC A;  1HFI A;  2LOJ A;  3OXU D;  1VVC A;  1OK3 A;  4JHS A;  4A5W B;  4LOS A;  4J38 B;  2WII C;  1H2Q P;  1CKL A;  4YNX A;  4IGD A;  2RKY A;  2XRB A;  2XRD A;  5HZP B;  1QUB A;  5HYT B;  1OJY A;  1GPZ A;  3KXV A;  4F4O C;  3ZRZ A;  4AYM A;  3GXE A;  1H2P P;  1MD7 A;  1H03 P;  3T5O A;  3INB C;  4FXG G;  1PPQ A;  4K12 A;  5HYU B;  2RL0 A;  3CAL A;  2W80 A;  4ONT D;  1OK1 A;  3R62 A;  2ERJ A;  2IZ3 A;  1SRZ A;  1UOT P; 
#chains in the Genus database with same CATH topology
 1Z92 B;  1C1Z A;  1TPN A;  4B2S A;  3KZJ A;  2ZYC A;  4N7E A;  3NJA A;  1GKG A;  4DJZ A;  1TPG A;  2JGX A;  2CG7 A;  3ZD1 A;  1VVD A;  1TPM A;  1ZJK A;  1U5M A;  4CSY A;  4WJG 2;  2UWN A;  4B2R A;  2KMS A;  3ERB A;  4PZ5 A;  3SW0 X;  1QGB A;  4LOT A;  3K3T A;  4YIZ A;  2A55 A;  1OJV A;  2MCZ A;  2B5I D;  3OP8 A;  2YBY A;  2BZM A;  4PO7 A;  1E5G A;  2RLP A;  3ZLE A;  2V8E A;  4ZH1 D;  1E8B A;  3EJH A;  1H04 P;  3GOV A;  2JRA A;  3ZLD A;  1E88 A;  2EC3 A;  1NWV A;  5HYP A;  2Y8S A;  2RLQ A;  3L89 M;  3RJ3 D;  4AYD A;  1O9A A;  2G7I A;  2EHF A;  2YRA A;  5FO8 C;  3TVJ A;  3ZD2 A;  2W81 A;  2KRI A;  2XWJ I;  1LY2 A;  3MQL A;  1MD8 A;  3F6K A;  5DN5 A;  1HFH A;  4KKD A;  1GHQ B;  2CG6 A;  2Y8R A;  2IZ4 A;  1HCC A;  3IU3 I;  3M7P A;  1G4F A;  2I2L A;  2O39 C;  3O8E B;  3FGT A;  1OJW A;  2XQW C;  5I0Q B;  3VWO A;  3NFP I;  4C16 A;  2QY0 A;  2RKZ A;  5JPM G;  1G4G A;  1Q3X A;  2CKU A;  4APL A;  4AYE A;  1QO6 A;  1SS2 A;  4BWC A;  1RLH A;  4MSL A;  3IX0 A;  2X2Z A;  1OK2 A;  1ELV A;  4AYI A;  3OED C;  3WSX A;  1OK9 A;  2XWB F;  1GKN A;  1FBR A;  3WSY A;  2MCY A;  2JGW A;  4MUC A;  1HFI A;  2LOJ A;  3OXU D;  2Y8T A;  1VVC A;  1OK3 A;  4JHS A;  4A5W B;  4LOS A;  4J38 B;  2WII C;  1H2Q P;  1CKL A;  4YNX A;  3FGR A;  4IGD A;  2RKY A;  2XRB A;  2XRD A;  5HZP B;  1QUB A;  5HYT B;  1OJY A;  1GPZ A;  3KXV A;  4F4O C;  3ZRZ A;  4AYM A;  3GXE A;  1H2P P;  1MD7 A;  1H03 P;  3T5O A;  3INB C;  4FXG G;  1PPQ A;  4K12 A;  5HYU B;  2RL0 A;  3CAL A;  2W80 A;  3CI0 J;  1OK1 A;  4ONT D;  3R62 A;  5DN4 A;  2ERJ A;  2IZ3 A;  1SRZ A;  1UOT P; 
#chains in the Genus database with same CATH homology
 1Z92 B;  1C1Z A;  1TPN A;  4B2S A;  3KZJ A;  1GKG A;  4DJZ A;  1TPG A;  2JGX A;  2CG7 A;  3ZD1 A;  1VVD A;  1TPM A;  1ZJK A;  1U5M A;  4CSY A;  4WJG 2;  2UWN A;  4B2R A;  2KMS A;  3ERB A;  4PZ5 A;  3SW0 X;  1QGB A;  4LOT A;  2A55 A;  1OJV A;  2MCZ A;  2B5I D;  3OP8 A;  2YBY A;  2BZM A;  1E5G A;  2RLP A;  2V8E A;  4ZH1 D;  1E8B A;  3EJH A;  1H04 P;  3GOV A;  2JRA A;  1E88 A;  2EC3 A;  1NWV A;  5HYP A;  2RLQ A;  3L89 M;  3RJ3 D;  4AYD A;  1O9A A;  2G7I A;  2EHF A;  2YRA A;  5FO8 C;  3TVJ A;  3ZD2 A;  2W81 A;  2KRI A;  2XWJ I;  1LY2 A;  3MQL A;  1MD8 A;  1HFH A;  4KKD A;  1GHQ B;  2CG6 A;  2IZ4 A;  1HCC A;  3IU3 I;  3M7P A;  1G4F A;  2O39 C;  3O8E B;  1OJW A;  2XQW C;  5I0Q B;  3NFP I;  4C16 A;  2QY0 A;  2RKZ A;  5JPM G;  1G4G A;  1Q3X A;  2CKU A;  4AYE A;  1QO6 A;  1SS2 A;  3IX0 A;  1OK2 A;  1ELV A;  4AYI A;  3OED C;  1OK9 A;  2XWB F;  1GKN A;  1FBR A;  2MCY A;  2JGW A;  4MUC A;  1HFI A;  2LOJ A;  3OXU D;  1VVC A;  1OK3 A;  4JHS A;  4A5W B;  4LOS A;  4J38 B;  2WII C;  1H2Q P;  1CKL A;  4YNX A;  4IGD A;  2RKY A;  2XRB A;  2XRD A;  5HZP B;  1QUB A;  5HYT B;  1OJY A;  1GPZ A;  3KXV A;  4F4O C;  3ZRZ A;  4AYM A;  3GXE A;  1H2P P;  1MD7 A;  1H03 P;  3T5O A;  3INB C;  4FXG G;  1PPQ A;  4K12 A;  5HYU B;  2RL0 A;  3CAL A;  2W80 A;  4ONT D;  1OK1 A;  3R62 A;  2ERJ A;  2IZ3 A;  1SRZ A;  1UOT P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...