1G4GA

Nmr structure of the fifth domain of human beta2-glycoprotein i
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
86
structure length
86
Chain Sequence
TKASCKLPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA2-GLYCOPROTEIN I
publication title Identification of the phospholipid-binding site of human beta(2)-glycoprotein I domain V by heteronuclear magnetic resonance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 8
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2000-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09014 Sushi_2 Beta-2-glycoprotein-1 fifth domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1g4gA00
1GKNA 1Z92B 1E88A 2KRIA 2QY0A 5I0QB 1VVDA 2IZ4A 3IX0A 2JGWA 2MCZA 1HFIA 4F4OC 2UWNA 1G4FA 2RLQA 4J38B 3OEDC 2KMSA 2MCYA 2EHFA 3O8EB 3GOVA 4YNXA 3MQLA 2O39C 2W81A 1Q3XA 2JRAA 5HYPA 1OK9A 4IGDA 1QO6A 1TPNA 2V8EA 4PZ5A 4B2SA 1CKLA 4MUCA 1TPGA 3NFPI 3OP8A 3RJ3D 3ZRZA 1VVCA 2RL0A 4AYMA 3T5OA 1O9AA 1MD8A 3TVJA 4KKDA 2YBYA 3ZD1A 2RKYA 1ZJKA 2EC3A 4WJG2 2RKZA 1H04P 4B2RA 1PPQA 1LY2A 1FBRA 5FO8C 1SRZA 2A55A 3L89M 2JGXA 1SS2A 3INBC 3KXVA 2XRDA 3EJHA 2LOJA 1H2QP 4DJZA 2IZ3A 2RLPA 1H2PP 1OK3A 2W80A 2XRBA 1QGBA 4CSYA 4AYEA 1ELVA 4FXGG 4K12A 3KZJA 1GKGA 2BZMA 2YRAA 5HZPB 1E5GA 3GXEA 3SW0X 1E8BA 2CG6A 3OXUD 1H03P 3R62A 1GPZA 2ERJA 3ERBA 2B5ID 1U5MA 1TPMA 3CALA 4LOTA 1HFHA 4JHSA 1NWVA 2XWJI 1GHQB 2CKUA 5HYUB 2XQWC 2XWBF 1MD7A 1UOTP 2CG7A 5HYTB 1G4GA 2WIIC 1OJYA 1C1ZA 4AYIA 4LOSA 4ZH1D 3M7PA 1OK1A 1QUBA 2G7IA 4C16A 3ZD2A 1HCCA 1OJVA 4A5WB 5JPMG 3IU3I 4ONTD 1OJWA 4AYDA 1OK2A
chains in the Genus database with same CATH superfamily
3WSYA 1GKNA 4APLA 1Z92B 3F6KA 1E88A 2KRIA 2QY0A 5I0QB 1VVDA 2IZ4A 3IX0A 3ZLEA 2JGWA 3VWOA 2MCZA 1HFIA 4F4OC 2UWNA 1G4FA 2ZYCA 2RLQA 3FGTA 4J38B 3OEDC 2KMSA 2MCYA 2EHFA 3NJAA 3K3TA 3O8EB 3GOVA 4YNXA 3MQLA 3WSXA 2O39C 2W81A 1Q3XA 2Y8SA 2JRAA 5HYPA 1OK9A 4IGDA 1QO6A 1TPNA 2V8EA 4PZ5A 4B2SA 1CKLA 4MUCA 1TPGA 3NFPI 3OP8A 4N7EA 3RJ3D 3ZRZA 1VVCA 2RL0A 4AYMA 3T5OA 1O9AA 1MD8A 3TVJA 4KKDA 2YBYA 3ZD1A 2RKYA 1ZJKA 2EC3A 4WJG2 4BWCA 2RKZA 1H04P 4B2RA 1PPQA 1LY2A 1FBRA 5FO8C 1SRZA 2A55A 3L89M 2JGXA 1SS2A 3INBC 3KXVA 2XRDA 3EJHA 2LOJA 1H2QP 5DN4A 4DJZA 2IZ3A 2RLPA 1H2PP 1OK3A 2W80A 2XRBA 3CI0J 1QGBA 4CSYA 1RLHA 2Y8TA 4AYEA 1ELVA 4FXGG 4K12A 3KZJA 1GKGA 2BZMA 2I2LA 2YRAA 5DN5A 5HZPB 1E5GA 3GXEA 3SW0X 1E8BA 2CG6A 3OXUD 1H03P 3R62A 1GPZA 2ERJA 3ERBA 2B5ID 3ZLDA 3FGRA 1U5MA 4PO7A 1TPMA 3CALA 4LOTA 1HFHA 4JHSA 1NWVA 2XWJI 1GHQB 2CKUA 2Y8RA 5HYUB 2XQWC 2XWBF 1MD7A 1UOTP 2CG7A 5HYTB 4YIZA 1G4GA 2WIIC 1OJYA 1C1ZA 4AYIA 4LOSA 4ZH1D 4MSLA 3M7PA 1OK1A 1QUBA 2G7IA 4C16A 3ZD2A 1HCCA 1OJVA 4A5WB 5JPMG 3IU3I 4ONTD 1OJWA 4AYDA 1OK2A 2X2ZA
chains in the Genus database with same CATH topology
1GKNA 1Z92B 1E88A 2KRIA 2QY0A 5I0QB 1VVDA 2IZ4A 3IX0A 2JGWA 2MCZA 1HFIA 4F4OC 2UWNA 1G4FA 2RLQA 4J38B 3OEDC 2KMSA 2MCYA 2EHFA 3O8EB 3GOVA 4YNXA 3MQLA 2O39C 2W81A 1Q3XA 2JRAA 5HYPA 1OK9A 4IGDA 1QO6A 1TPNA 2V8EA 4PZ5A 4B2SA 1CKLA 4MUCA 1TPGA 3NFPI 3OP8A 3RJ3D 3ZRZA 1VVCA 2RL0A 4AYMA 3T5OA 1O9AA 1MD8A 3TVJA 4KKDA 2YBYA 3ZD1A 2RKYA 1ZJKA 2EC3A 4WJG2 2RKZA 1H04P 4B2RA 1PPQA 1LY2A 1FBRA 5FO8C 1SRZA 2A55A 3L89M 2JGXA 1SS2A 3INBC 3KXVA 2XRDA 3EJHA 2LOJA 1H2QP 4DJZA 2IZ3A 2RLPA 1H2PP 1OK3A 2W80A 2XRBA 1QGBA 4CSYA 4AYEA 1ELVA 4FXGG 4K12A 3KZJA 1GKGA 2BZMA 2YRAA 5HZPB 1E5GA 3GXEA 3SW0X 1E8BA 2CG6A 3OXUD 1H03P 3R62A 1GPZA 2ERJA 3ERBA 2B5ID 1U5MA 1TPMA 3CALA 4LOTA 1HFHA 4JHSA 1NWVA 2XWJI 1GHQB 2CKUA 5HYUB 2XQWC 2XWBF 1MD7A 1UOTP 2CG7A 5HYTB 1G4GA 2WIIC 1OJYA 1C1ZA 4AYIA 4LOSA 4ZH1D 3M7PA 1OK1A 1QUBA 2G7IA 4C16A 3ZD2A 1HCCA 1OJVA 4A5WB 5JPMG 3IU3I 4ONTD 1OJWA 4AYDA 1OK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GKN A;  1Z92 B;  1E88 A;  2KRI A;  2QY0 A;  5I0Q B;  1VVD A;  2IZ4 A;  3IX0 A;  2JGW A;  2MCZ A;  1HFI A;  4F4O C;  2UWN A;  1G4F A;  2RLQ A;  4J38 B;  3OED C;  2KMS A;  2MCY A;  2EHF A;  3O8E B;  3GOV A;  4YNX A;  3MQL A;  2O39 C;  2W81 A;  1Q3X A;  2JRA A;  5HYP A;  1OK9 A;  4IGD A;  1QO6 A;  1TPN A;  2V8E A;  4PZ5 A;  4B2S A;  1CKL A;  4MUC A;  1TPG A;  3NFP I;  3OP8 A;  3RJ3 D;  3ZRZ A;  1VVC A;  2RL0 A;  4AYM A;  3T5O A;  1O9A A;  1MD8 A;  3TVJ A;  4KKD A;  2YBY A;  3ZD1 A;  2RKY A;  1ZJK A;  2EC3 A;  4WJG 2;  2RKZ A;  1H04 P;  4B2R A;  1PPQ A;  1LY2 A;  1FBR A;  5FO8 C;  1SRZ A;  2A55 A;  3L89 M;  2JGX A;  1SS2 A;  3INB C;  3KXV A;  2XRD A;  3EJH A;  2LOJ A;  1H2Q P;  4DJZ A;  2IZ3 A;  2RLP A;  1H2P P;  1OK3 A;  2W80 A;  2XRB A;  1QGB A;  4CSY A;  4AYE A;  1ELV A;  4FXG G;  4K12 A;  3KZJ A;  1GKG A;  2BZM A;  2YRA A;  5HZP B;  1E5G A;  3GXE A;  3SW0 X;  1E8B A;  2CG6 A;  3OXU D;  1H03 P;  3R62 A;  1GPZ A;  2ERJ A;  3ERB A;  2B5I D;  1U5M A;  1TPM A;  3CAL A;  4LOT A;  1HFH A;  4JHS A;  1NWV A;  2XWJ I;  1GHQ B;  2CKU A;  5HYU B;  2XQW C;  2XWB F;  1MD7 A;  1UOT P;  2CG7 A;  5HYT B;  1G4G A;  2WII C;  1OJY A;  1C1Z A;  4AYI A;  4LOS A;  4ZH1 D;  3M7P A;  1OK1 A;  1QUB A;  2G7I A;  4C16 A;  3ZD2 A;  1HCC A;  1OJV A;  4A5W B;  5JPM G;  3IU3 I;  4ONT D;  1OJW A;  4AYD A;  1OK2 A; 
#chains in the Genus database with same CATH topology
 3WSY A;  1GKN A;  4APL A;  1Z92 B;  3F6K A;  1E88 A;  2KRI A;  2QY0 A;  5I0Q B;  1VVD A;  2IZ4 A;  3IX0 A;  3ZLE A;  2JGW A;  3VWO A;  2MCZ A;  1HFI A;  4F4O C;  2UWN A;  1G4F A;  2ZYC A;  2RLQ A;  3FGT A;  4J38 B;  3OED C;  2KMS A;  2MCY A;  2EHF A;  3NJA A;  3K3T A;  3O8E B;  3GOV A;  4YNX A;  3MQL A;  3WSX A;  2O39 C;  2W81 A;  1Q3X A;  2Y8S A;  2JRA A;  5HYP A;  1OK9 A;  4IGD A;  1QO6 A;  1TPN A;  2V8E A;  4PZ5 A;  4B2S A;  1CKL A;  4MUC A;  1TPG A;  3NFP I;  3OP8 A;  4N7E A;  3RJ3 D;  3ZRZ A;  1VVC A;  2RL0 A;  4AYM A;  3T5O A;  1O9A A;  1MD8 A;  3TVJ A;  4KKD A;  2YBY A;  3ZD1 A;  2RKY A;  1ZJK A;  2EC3 A;  4WJG 2;  4BWC A;  2RKZ A;  1H04 P;  4B2R A;  1PPQ A;  1LY2 A;  1FBR A;  5FO8 C;  1SRZ A;  2A55 A;  3L89 M;  2JGX A;  1SS2 A;  3INB C;  3KXV A;  2XRD A;  3EJH A;  2LOJ A;  1H2Q P;  5DN4 A;  4DJZ A;  2IZ3 A;  2RLP A;  1H2P P;  1OK3 A;  2W80 A;  2XRB A;  3CI0 J;  1QGB A;  4CSY A;  1RLH A;  2Y8T A;  4AYE A;  1ELV A;  4FXG G;  4K12 A;  3KZJ A;  1GKG A;  2BZM A;  2I2L A;  2YRA A;  5DN5 A;  5HZP B;  1E5G A;  3GXE A;  3SW0 X;  1E8B A;  2CG6 A;  3OXU D;  1H03 P;  3R62 A;  1GPZ A;  2ERJ A;  3ERB A;  2B5I D;  3ZLD A;  3FGR A;  1U5M A;  4PO7 A;  1TPM A;  3CAL A;  4LOT A;  1HFH A;  4JHS A;  1NWV A;  2XWJ I;  1GHQ B;  2CKU A;  2Y8R A;  5HYU B;  2XQW C;  2XWB F;  1MD7 A;  1UOT P;  2CG7 A;  5HYT B;  4YIZ A;  1G4G A;  2WII C;  1OJY A;  1C1Z A;  4AYI A;  4LOS A;  4ZH1 D;  4MSL A;  3M7P A;  1OK1 A;  1QUB A;  2G7I A;  4C16 A;  3ZD2 A;  1HCC A;  1OJV A;  4A5W B;  5JPM G;  3IU3 I;  4ONT D;  1OJW A;  4AYD A;  1OK2 A;  2X2Z A; 
#chains in the Genus database with same CATH homology
 1GKN A;  1Z92 B;  1E88 A;  2KRI A;  2QY0 A;  5I0Q B;  1VVD A;  2IZ4 A;  3IX0 A;  2JGW A;  2MCZ A;  1HFI A;  4F4O C;  2UWN A;  1G4F A;  2RLQ A;  4J38 B;  3OED C;  2KMS A;  2MCY A;  2EHF A;  3O8E B;  3GOV A;  4YNX A;  3MQL A;  2O39 C;  2W81 A;  1Q3X A;  2JRA A;  5HYP A;  1OK9 A;  4IGD A;  1QO6 A;  1TPN A;  2V8E A;  4PZ5 A;  4B2S A;  1CKL A;  4MUC A;  1TPG A;  3NFP I;  3OP8 A;  3RJ3 D;  3ZRZ A;  1VVC A;  2RL0 A;  4AYM A;  3T5O A;  1O9A A;  1MD8 A;  3TVJ A;  4KKD A;  2YBY A;  3ZD1 A;  2RKY A;  1ZJK A;  2EC3 A;  4WJG 2;  2RKZ A;  1H04 P;  4B2R A;  1PPQ A;  1LY2 A;  1FBR A;  5FO8 C;  1SRZ A;  2A55 A;  3L89 M;  2JGX A;  1SS2 A;  3INB C;  3KXV A;  2XRD A;  3EJH A;  2LOJ A;  1H2Q P;  4DJZ A;  2IZ3 A;  2RLP A;  1H2P P;  1OK3 A;  2W80 A;  2XRB A;  1QGB A;  4CSY A;  4AYE A;  1ELV A;  4FXG G;  4K12 A;  3KZJ A;  1GKG A;  2BZM A;  2YRA A;  5HZP B;  1E5G A;  3GXE A;  3SW0 X;  1E8B A;  2CG6 A;  3OXU D;  1H03 P;  3R62 A;  1GPZ A;  2ERJ A;  3ERB A;  2B5I D;  1U5M A;  1TPM A;  3CAL A;  4LOT A;  1HFH A;  4JHS A;  1NWV A;  2XWJ I;  1GHQ B;  2CKU A;  5HYU B;  2XQW C;  2XWB F;  1MD7 A;  1UOT P;  2CG7 A;  5HYT B;  1G4G A;  2WII C;  1OJY A;  1C1Z A;  4AYI A;  4LOS A;  4ZH1 D;  3M7P A;  1OK1 A;  1QUB A;  2G7I A;  4C16 A;  3ZD2 A;  1HCC A;  1OJV A;  4A5W B;  5JPM G;  3IU3 I;  4ONT D;  1OJW A;  4AYD A;  1OK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...