1G4KA

X-ray structure of a novel matrix metalloproteinase inhibitor complexed to stromelysin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
168
structure length
168
Chain Sequence
FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords STROMELYSIN-1
publication title X-ray structure of a novel matrix metalloproteinase inhibitor complexed to stromelysin.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 168
sequence length 168
chains with identical sequence B, C
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 2000-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1g4kA00
1OM6A 2WO8A 4CTHA 2OVXA 456CA 4EFSA 4GWNA 1QIBA 2MZIA 3EHXA 1RMZA 1BIWA 1XFYA 3LIRA 3LGPA 4XM8A 1YQYA 1KUFA 2W12A 1XFVA 4QKZA 1G05A 4I03A 5I12A 4WK7A 3WV3A 4IJOA 3VTGA 1AF0A 1GO7P 2WO9A 2I47A 3DPEA 1USNA 3EWJA 1JIWP 3HDBA 1IADA 4AUOA 3KWVC 3HBVP 1JKYA 2MZHA 1XFWA 2CLTA 4L19A 1CGEA 4GQLA 1IAAA 1KBCA 1PWUA 3P1VA 2XS4A 1CGFA 4FXYP 4H84A 1WNIA 3B2ZA 1ZS0A 3VI1A 2DW0A 1GKCA 1A85A 3F1AA 4AIGA 1J7NA 1XUDA 3N2UA 2JT5A 4DPEA 1YCMA 3F17A 1GXDA 2JIHA 1SLNA 1BUVM 2ERQA 2V4BA 3G5CA 1I73A 1O0QA 2JSDA 1BKCA 1JAOA 1RM8A 4H82A 1OS9A 1YP1A 1Q3AA 3F15A 3KMCA 3LJTA 3DNGA 1O0TA 1PWPA 2Y6DA 3F19A 2FV5A 1HFCA 3F18A 4WKEA 2X3BA 2AYKA 4AXQA 2K9CA 1ND1A 2OY4A 3OHOA 1GO8P 4IN9A 3EDGA 1K7IA 1AKLA 3LEAA 2SRTA 5CXAA 1HOVA 4H2EA 2A8HA 1JAPA 1BM6A 5LABA 2JNPA 1EUBA 4GR0A 1G4KA 5I43A 4IUWA 1HY7A 5D1SA 2HU6A 3KMEA 3L0TA 4GF1A 2TCLA 1ZVXA 3L0VA 5B5PA 2W14A 1DMTA 1R1HA 3ZUKA 4Q1LA 5I3MA 5CUHA 5JMYA 2E3XA 1BKCI 1CXVA 1GKDA 3HY7A 4HMAA 2J0TA 4PKWA 1I1IP 3ELMA 4JA1A 1ZXVA 1K7QA 1G12A 3N2VA 1A86A 966CA 1Y8JA 1HFSA 4ILWD 1XUCA 2DW1A 4JPAA 2ERPA 2OW0A 1Y0VA 5H8XA 4L6TA 3U1RA 1QUAA 2MLSA 3ZVSA 3KECA 2OXWA 1CQRA 4H49A 5D7WA 4PKQA 3UVCA 3BA0A 1GE7A 4GWMA 2Z2DA 4WZVA 3LIKA 1QJIA 3LQBA 4XM7A 4G9LA 4PKVA 1Z3JA 3OHLA 4A7BA 2DW2A 3LK8A 3AYUA 1SU3A 2YB9A 1BSWA 2POJA 2E2DA 5I0LA 3HBUP 1MMRA 3I7GA 4H1QA 3P24A 1MMBA 3LMCA 3GBOA 3RTSA 4DF9A 2MZEA 3AIGA 3F16A 3AYKA 1CAQA 1JH1A 1SLMA 2X7MA 1I76A 2W0DA 1GE6A 4L63A 1R1IA 3KEKA 1KUKA 1H71P 4I35A 2N8RA 3DL1A 1D8FA 3HDAP 2D1OA 3K7LA 4XM6A 3HB2P 2DDYA 3LUNA 4G0DA 5BOTA 1ZXCA 2OY2A 1PWWA 3EDHA 1R1JA 1MMPA 3LJGA 1D5JA 5D1TA 1UMTA 3DWBA 4GR3A 4ZR5A 1CGLA 4PKRA 1MNCA 4PKTA 3LQ0A 2OW1A 4JIJA 5L7FA 2CKIA 2XS3A 1PWQA 4ON1A 5BPAA 4XBHA 4WF6A 1BZSA 3Q2GA 1JANA 3NX7A 1FM1A 1K7GA 4H30A 2OZRA 4PKSA 2Y6CA 4JP4A 3KHIA 3WV1A 2KRJA 1GE5A 3LJZA 1XFUA 2W13A 4GR8A 1IAEA 1UMSA 1B8YA 1SATA 4DV8A 2OVZA 1C3IA 3Q2HA 1KUHA 1OMJA 2RJPA 1UTTA 4A3WA 2OW2A 5D3CA 1YOUA 1BKCE 1HV5A 4R3VA 1KUGA 3CKIA 1PWVA 3WV2A 3TS4A 1OM8A 1R54A 3TSKA 3O2XA 1QIAA 3DPFA 2USNA 3ZXHA 5I2ZA 3K7NA 3DSLA 3MA2A 1ROSA 1XFZA 1L6JA 5B5OA 5D1UA 2X3CA 1EAKA 3EDIA 1IACA 4DD8A 1B3DA 2K2GA 1G49A 1FLSA 1MMQA 5I4OA 4JQGA 3LKAA 1S4BP 1CIZA 2O3EA 1G9KA 2L0RA 1FBLA 1D7XA 1ZTQA 1JAQA 4PKUA 1QJJA 3SHIA 4FVLA 2DDFA 1ASTA 2AIGP 2OW9A 1C7KA 3HYGA 3LE9A 1XURA 1UEAA 3G42A 4J4MA 3O64A 3RTTA 2J83A 2OXZA 1OM7A 1SRPA 830CA 1QICA 1OO9A 2YIGA 3B8ZA 1JK3A 1KAPP 3E8RA 1IAGA 1OS2A 1ZP5A 1SMPA 2FV9A 2WOAA 3B92A 2RJQA 3HY9A 2OI0A 2PJTA 5D2BA 1D8MA 1BQQM 3LILA 1XFXA 4XCTA 2OXUA 2QPJA 1KUIA 3LUMA 1BUDA 1JJ9A 1EB6A 3USNA 2D1NA 3EHYA 1BQOA 4AYKA 2O36A 3I7IA 3KRYA 4WKIA 1Y93A 1AYKA 2W15A 1CK7A 4H3XA 1JIZA 4FU4A 4H76A 4FXQA 4GUYA 1HTDA 3TT4A 5L79A 2MLRA 4HX3A 2X3AA 1IABA 1C8TA 3EDZA 3V96B 3KEJA 1R55A 3TVCA 5BOYA 5CZMA 1UTZA 2EROA 1DTHA 2JT6A 1ATLA
chains in the Genus database with same CATH superfamily
1OM6A 2WO8A 4CTHA 2OVXA 456CA 4EFSA 4GWNA 1QIBA 2MZIA 3EHXA 1RMZA 1BIWA 1XFYA 3LIRA 3LGPA 4XM8A 1YQYA 1KUFA 2W12A 1XFVA 4QKZA 1G05A 4I03A 5I12A 4WK7A 3WV3A 4IJOA 3VTGA 1AF0A 1GO7P 2WO9A 2I47A 3DPEA 3DTKA 1USNA 3EWJA 1JIWP 3HDBA 1IADA 4AUOA 3KWVC 3HBVP 1JKYA 2MZHA 3DTIA 1XFWA 2CLTA 4L19A 1CGEA 4GQLA 1IAAA 1KBCA 1PWUA 3P1VA 2XS4A 1CGFA 4FXYP 1OZ9A 4H84A 1WNIA 3B2ZA 1ZS0A 3VI1A 2DW0A 1GKCA 1A85A 3F1AA 4AIGA 1J7NA 1XUDA 3N2UA 2JT5A 4DPEA 1YCMA 3F17A 1GXDA 2JIHA 1SLNA 1BUVM 2ERQA 2V4BA 3G5CA 1I73A 1O0QA 2JSDA 1BKCA 1JAOA 4L7AA 1RM8A 4H82A 1OS9A 1YP1A 1Q3AA 3F15A 3KMCA 3LJTA 3DNGA 1O0TA 1PWPA 2Y6DA 3F19A 2FV5A 1HFCA 3F18A 4WKEA 2X3BA 2AYKA 4AXQA 2K9CA 1ND1A 2OY4A 3OHOA 1GO8P 4IN9A 3EDGA 1K7IA 1AKLA 3LEAA 2SRTA 5CXAA 1HOVA 4H2EA 2A8HA 1JAPA 1BM6A 5LABA 2JNPA 1EUBA 4GR0A 1G4KA 5I43A 4IUWA 1HY7A 5D1SA 2HU6A 3KMEA 3L0TA 4GF1A 2TCLA 1ZVXA 3L0VA 5B5PA 2W14A 1DMTA 1R1HA 3ZUKA 4Q1LA 5I3MA 5CUHA 5JMYA 2E3XA 1BKCI 1CXVA 1GKDA 3HY7A 4HMAA 2J0TA 4PKWA 1I1IP 1XAXA 3ELMA 4JA1A 1ZXVA 1K7QA 1G12A 3N2VA 1A86A 966CA 1Y8JA 1HFSA 4ILWD 1XUCA 2DW1A 4JPAA 2ERPA 2OW0A 1Y0VA 5H8XA 1XM5A 4L6TA 3U1RA 1QUAA 2MLSA 1TVIA 3ZVSA 3KECA 2OXWA 1CQRA 4H49A 5D7WA 4PKQA 3UVCA 3BA0A 1GE7A 4GWMA 2Z2DA 4WZVA 3LIKA 1QJIA 3LQBA 4XM7A 4G9LA 4PKVA 1Z3JA 3OHLA 4A7BA 2DW2A 3LK8A 3AYUA 1SU3A 2YB9A 1BSWA 2POJA 2E2DA 5I0LA 3HBUP 1MMRA 3I7GA 4H1QA 3P24A 1MMBA 3LMCA 3GBOA 3RTSA 4DF9A 2MZEA 3AIGA 3F16A 3AYKA 1CAQA 1JH1A 1SLMA 2X7MA 1I76A 2W0DA 1GE6A 4L63A 1R1IA 3KEKA 1KUKA 1H71P 4I35A 2N8RA 3DL1A 1D8FA 3HDAP 2D1OA 3K7LA 4XM6A 3HB2P 2DDYA 3LUNA 4G0DA 5BOTA 1ZXCA 2OY2A 1PWWA 3EDHA 1R1JA 1MMPA 3LJGA 1D5JA 5D1TA 1UMTA 3DWBA 4GR3A 4ZR5A 1CGLA 4PKRA 1MNCA 4PKTA 3LQ0A 2OW1A 4JIJA 5L7FA 2CKIA 2XS3A 1PWQA 4ON1A 5BPAA 4XBHA 4WF6A 1BZSA 3Q2GA 1JANA 3NX7A 1FM1A 1K7GA 4H30A 2OZRA 2YUFA 4PKSA 2Y6CA 4JP4A 3KHIA 3WV1A 2KRJA 1GE5A 3LJZA 1XFUA 2W13A 4GR8A 1IAEA 1UMSA 1B8YA 1SATA 4DV8A 2OVZA 1C3IA 3Q2HA 1KUHA 1OMJA 2RJPA 1UTTA 4A3WA 2OW2A 5D3CA 1YOUA 1BKCE 1HV5A 4R3VA 1KUGA 3CKIA 1PWVA 3WV2A 3TS4A 1OM8A 1R54A 3TSKA 3O2XA 1QIAA 3DPFA 2USNA 3ZXHA 5I2ZA 3K7NA 3DSLA 3MA2A 1ROSA 1XFZA 1L6JA 5B5OA 5D1UA 2X3CA 1EAKA 3EDIA 1IACA 4DD8A 1B3DA 2K2GA 1G49A 1FLSA 1MMQA 5I4OA 4JQGA 3LKAA 1S4BP 1CIZA 2O3EA 1G9KA 2L0RA 1FBLA 1D7XA 1ZTQA 1JAQA 4PKUA 1QJJA 3SHIA 4FVLA 2DDFA 1ASTA 2AIGP 2OW9A 1C7KA 3HYGA 3LE9A 1XURA 1UEAA 3G42A 4J4MA 3O64A 3RTTA 2J83A 2OXZA 1OM7A 1SRPA 830CA 1QICA 1OO9A 2YIGA 3B8ZA 1JK3A 1KAPP 3E8RA 1IAGA 1OS2A 1ZP5A 1SMPA 2FV9A 2WOAA 3B92A 2RJQA 3HY9A 2OI0A 2PJTA 5D2BA 1D8MA 1BQQM 3LILA 1XFXA 4XCTA 2OXUA 2QPJA 1KUIA 3DTEA 3LUMA 1BUDA 1JJ9A 1EB6A 3USNA 2D1NA 3EHYA 1BQOA 4AYKA 2O36A 3I7IA 3KRYA 4WKIA 1Y93A 1AYKA 2W15A 1CK7A 4H3XA 1JIZA 4FU4A 4H76A 4FXQA 4GUYA 1HTDA 3TT4A 5L79A 2MLRA 4HX3A 2X3AA 1IABA 1C8TA 3EDZA 3V96B 3KEJA 1R55A 3TVCA 5BOYA 5CZMA 1UTZA 2EROA 1DTHA 2JT6A 1ATLA
chains in the Genus database with same CATH topology
1OM6A 2WO8A 4CTHA 2OVXA 456CA 4EFSA 4GWNA 1QIBA 2MZIA 3EHXA 1RMZA 1BIWA 1XFYA 3LIRA 3LGPA 4XM8A 1YQYA 1KUFA 2W12A 1XFVA 4QKZA 1G05A 4I03A 5I12A 4WK7A 3WV3A 4IJOA 3VTGA 1AF0A 1GO7P 2WO9A 2I47A 3DPEA 3DTKA 1USNA 3EWJA 1JIWP 3HDBA 1IADA 4AUOA 3KWVC 3HBVP 1JKYA 2MZHA 3DTIA 1XFWA 2CLTA 4L19A 1CGEA 4GQLA 1IAAA 1KBCA 1PWUA 3P1VA 2XS4A 1CGFA 4FXYP 4H84A 1WNIA 3B2ZA 1ZS0A 3VI1A 2DW0A 1GKCA 1A85A 3F1AA 4AIGA 1J7NA 1XUDA 3N2UA 2JT5A 4DPEA 1YCMA 3F17A 1GXDA 2JIHA 1SLNA 1BUVM 2ERQA 2V4BA 3G5CA 1I73A 1O0QA 2JSDA 1BKCA 1JAOA 4L7AA 1RM8A 4H82A 1OS9A 1YP1A 1Q3AA 3F15A 3KMCA 3LJTA 3DNGA 1O0TA 1PWPA 2Y6DA 3F19A 2FV5A 1HFCA 3F18A 4WKEA 2X3BA 2AYKA 4AXQA 2K9CA 1ND1A 2OY4A 3OHOA 1GO8P 4IN9A 3EDGA 1K7IA 1AKLA 3LEAA 2SRTA 5CXAA 1HOVA 4H2EA 2A8HA 1JAPA 1BM6A 5LABA 2JNPA 1EUBA 4GR0A 1G4KA 5I43A 4IUWA 1HY7A 5D1SA 2HU6A 3KMEA 3L0TA 4GF1A 2TCLA 1ZVXA 3L0VA 5B5PA 2W14A 1DMTA 1R1HA 3ZUKA 4Q1LA 5I3MA 5CUHA 5JMYA 2E3XA 1BKCI 1CXVA 1GKDA 3HY7A 4HMAA 2J0TA 4PKWA 1I1IP 3ELMA 4JA1A 1ZXVA 1K7QA 1G12A 3N2VA 1A86A 966CA 1Y8JA 1HFSA 4ILWD 1XUCA 2DW1A 4JPAA 2ERPA 2OW0A 1Y0VA 5H8XA 4L6TA 3U1RA 1QUAA 2MLSA 3ZVSA 3KECA 2OXWA 1CQRA 4H49A 5D7WA 4PKQA 3UVCA 3BA0A 1GE7A 4GWMA 2Z2DA 4WZVA 3LIKA 1QJIA 3LQBA 4XM7A 4G9LA 4PKVA 1Z3JA 3OHLA 4A7BA 2DW2A 3LK8A 3AYUA 1SU3A 2YB9A 1BSWA 2POJA 2E2DA 5I0LA 3HBUP 1MMRA 3I7GA 4H1QA 3P24A 1MMBA 3LMCA 3GBOA 3RTSA 4DF9A 2MZEA 3AIGA 3F16A 3AYKA 1CAQA 1JH1A 1SLMA 2X7MA 1I76A 2W0DA 1GE6A 4L63A 1R1IA 3KEKA 1KUKA 1H71P 4I35A 2N8RA 3DL1A 1D8FA 3HDAP 2D1OA 3K7LA 4XM6A 3HB2P 2DDYA 3LUNA 4G0DA 5BOTA 1ZXCA 2OY2A 1PWWA 3EDHA 1R1JA 1MMPA 3LJGA 1D5JA 5D1TA 1UMTA 3DWBA 4GR3A 4ZR5A 1CGLA 4PKRA 1MNCA 4PKTA 3LQ0A 2OW1A 4JIJA 5L7FA 2CKIA 2XS3A 1PWQA 4ON1A 5BPAA 4XBHA 4WF6A 1BZSA 3Q2GA 1JANA 3NX7A 1FM1A 1K7GA 4H30A 2OZRA 2YUFA 4PKSA 2Y6CA 4JP4A 3KHIA 3WV1A 2KRJA 1GE5A 3LJZA 1XFUA 2W13A 4GR8A 1IAEA 1UMSA 1B8YA 1SATA 4DV8A 2OVZA 1C3IA 3Q2HA 1KUHA 1OMJA 2RJPA 1UTTA 4A3WA 2OW2A 5D3CA 1YOUA 1BKCE 1HV5A 4R3VA 1KUGA 3CKIA 1PWVA 3WV2A 3TS4A 1OM8A 1R54A 3TSKA 3O2XA 1QIAA 3DPFA 2USNA 3ZXHA 5I2ZA 3K7NA 3DSLA 3MA2A 1ROSA 1XFZA 1L6JA 5B5OA 5D1UA 2X3CA 1EAKA 3EDIA 1IACA 4DD8A 1B3DA 2K2GA 1G49A 1FLSA 1MMQA 5I4OA 4JQGA 3LKAA 1S4BP 1CIZA 2O3EA 1G9KA 2L0RA 1FBLA 1D7XA 1ZTQA 1JAQA 4PKUA 1QJJA 3SHIA 4FVLA 2DDFA 1ASTA 2AIGP 2OW9A 1C7KA 3HYGA 3LE9A 1XURA 1UEAA 3G42A 4J4MA 3O64A 3RTTA 2J83A 2OXZA 1OM7A 1SRPA 830CA 1QICA 1OO9A 2YIGA 3B8ZA 1JK3A 1KAPP 3E8RA 1IAGA 1OS2A 1ZP5A 1SMPA 2FV9A 2WOAA 3B92A 2RJQA 3HY9A 2OI0A 2PJTA 5D2BA 1D8MA 1BQQM 3LILA 1XFXA 4XCTA 2OXUA 2QPJA 1KUIA 3DTEA 3LUMA 1BUDA 1JJ9A 1EB6A 3USNA 2D1NA 3EHYA 1BQOA 4AYKA 2O36A 3I7IA 3KRYA 4WKIA 1Y93A 1AYKA 2W15A 1CK7A 4H3XA 1JIZA 4FU4A 4H76A 4FXQA 4GUYA 1HTDA 3TT4A 5L79A 2MLRA 4HX3A 2X3AA 1IABA 1C8TA 3EDZA 3V96B 3KEJA 1R55A 3TVCA 5BOYA 5CZMA 1UTZA 2EROA 1DTHA 2JT6A 1ATLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OM6 A;  2WO8 A;  4CTH A;  2OVX A;  456C A;  4EFS A;  4GWN A;  1QIB A;  2MZI A;  3EHX A;  1RMZ A;  1BIW A;  1XFY A;  3LIR A;  3LGP A;  4XM8 A;  1YQY A;  1KUF A;  2W12 A;  1XFV A;  4QKZ A;  1G05 A;  4I03 A;  5I12 A;  4WK7 A;  3WV3 A;  4IJO A;  3VTG A;  1AF0 A;  1GO7 P;  2WO9 A;  2I47 A;  3DPE A;  1USN A;  3EWJ A;  1JIW P;  3HDB A;  1IAD A;  4AUO A;  3KWV C;  3HBV P;  1JKY A;  2MZH A;  1XFW A;  2CLT A;  4L19 A;  1CGE A;  4GQL A;  1IAA A;  1KBC A;  1PWU A;  3P1V A;  2XS4 A;  1CGF A;  4FXY P;  4H84 A;  1WNI A;  3B2Z A;  1ZS0 A;  3VI1 A;  2DW0 A;  1GKC A;  1A85 A;  3F1A A;  4AIG A;  1J7N A;  1XUD A;  3N2U A;  2JT5 A;  4DPE A;  1YCM A;  3F17 A;  1GXD A;  2JIH A;  1SLN A;  1BUV M;  2ERQ A;  2V4B A;  3G5C A;  1I73 A;  1O0Q A;  2JSD A;  1BKC A;  1JAO A;  1RM8 A;  4H82 A;  1OS9 A;  1YP1 A;  1Q3A A;  3F15 A;  3KMC A;  3LJT A;  3DNG A;  1O0T A;  1PWP A;  2Y6D A;  3F19 A;  2FV5 A;  1HFC A;  3F18 A;  4WKE A;  2X3B A;  2AYK A;  4AXQ A;  2K9C A;  1ND1 A;  2OY4 A;  3OHO A;  1GO8 P;  4IN9 A;  3EDG A;  1K7I A;  1AKL A;  3LEA A;  2SRT A;  5CXA A;  1HOV A;  4H2E A;  2A8H A;  1JAP A;  1BM6 A;  5LAB A;  2JNP A;  1EUB A;  4GR0 A;  1G4K A;  5I43 A;  4IUW A;  1HY7 A;  5D1S A;  2HU6 A;  3KME A;  3L0T A;  4GF1 A;  2TCL A;  1ZVX A;  3L0V A;  5B5P A;  2W14 A;  1DMT A;  1R1H A;  3ZUK A;  4Q1L A;  5I3M A;  5CUH A;  5JMY A;  2E3X A;  1BKC I;  1CXV A;  1GKD A;  3HY7 A;  4HMA A;  2J0T A;  4PKW A;  1I1I P;  3ELM A;  4JA1 A;  1ZXV A;  1K7Q A;  1G12 A;  3N2V A;  1A86 A;  966C A;  1Y8J A;  1HFS A;  4ILW D;  1XUC A;  2DW1 A;  4JPA A;  2ERP A;  2OW0 A;  1Y0V A;  5H8X A;  4L6T A;  3U1R A;  1QUA A;  2MLS A;  3ZVS A;  3KEC A;  2OXW A;  1CQR A;  4H49 A;  5D7W A;  4PKQ A;  3UVC A;  3BA0 A;  1GE7 A;  4GWM A;  2Z2D A;  4WZV A;  3LIK A;  1QJI A;  3LQB A;  4XM7 A;  4G9L A;  4PKV A;  1Z3J A;  3OHL A;  4A7B A;  2DW2 A;  3LK8 A;  3AYU A;  1SU3 A;  2YB9 A;  1BSW A;  2POJ A;  2E2D A;  5I0L A;  3HBU P;  1MMR A;  3I7G A;  4H1Q A;  3P24 A;  1MMB A;  3LMC A;  3GBO A;  3RTS A;  4DF9 A;  2MZE A;  3AIG A;  3F16 A;  3AYK A;  1CAQ A;  1JH1 A;  1SLM A;  2X7M A;  1I76 A;  2W0D A;  1GE6 A;  4L63 A;  1R1I A;  3KEK A;  1KUK A;  1H71 P;  4I35 A;  2N8R A;  3DL1 A;  1D8F A;  3HDA P;  2D1O A;  3K7L A;  4XM6 A;  3HB2 P;  2DDY A;  3LUN A;  4G0D A;  5BOT A;  1ZXC A;  2OY2 A;  1PWW A;  3EDH A;  1R1J A;  1MMP A;  3LJG A;  1D5J A;  5D1T A;  1UMT A;  3DWB A;  4GR3 A;  4ZR5 A;  1CGL A;  4PKR A;  1MNC A;  4PKT A;  3LQ0 A;  2OW1 A;  4JIJ A;  5L7F A;  2CKI A;  2XS3 A;  1PWQ A;  4ON1 A;  5BPA A;  4XBH A;  4WF6 A;  1BZS A;  3Q2G A;  1JAN A;  3NX7 A;  1FM1 A;  1K7G A;  4H30 A;  2OZR A;  4PKS A;  2Y6C A;  4JP4 A;  3KHI A;  3WV1 A;  2KRJ A;  1GE5 A;  3LJZ A;  1XFU A;  2W13 A;  4GR8 A;  1IAE A;  1UMS A;  1B8Y A;  1SAT A;  4DV8 A;  2OVZ A;  1C3I A;  3Q2H A;  1KUH A;  1OMJ A;  2RJP A;  1UTT A;  4A3W A;  2OW2 A;  5D3C A;  1YOU A;  1BKC E;  1HV5 A;  4R3V A;  1KUG A;  3CKI A;  1PWV A;  3WV2 A;  3TS4 A;  1OM8 A;  1R54 A;  3TSK A;  3O2X A;  1QIA A;  3DPF A;  2USN A;  3ZXH A;  5I2Z A;  3K7N A;  3DSL A;  3MA2 A;  1ROS A;  1XFZ A;  1L6J A;  5B5O A;  5D1U A;  2X3C A;  1EAK A;  3EDI A;  1IAC A;  4DD8 A;  1B3D A;  2K2G A;  1G49 A;  1FLS A;  1MMQ A;  5I4O A;  4JQG A;  3LKA A;  1S4B P;  1CIZ A;  2O3E A;  1G9K A;  2L0R A;  1FBL A;  1D7X A;  1ZTQ A;  1JAQ A;  4PKU A;  1QJJ A;  3SHI A;  4FVL A;  2DDF A;  1AST A;  2AIG P;  2OW9 A;  1C7K A;  3HYG A;  3LE9 A;  1XUR A;  1UEA A;  3G42 A;  4J4M A;  3O64 A;  3RTT A;  2J83 A;  2OXZ A;  1OM7 A;  1SRP A;  830C A;  1QIC A;  1OO9 A;  2YIG A;  3B8Z A;  1JK3 A;  1KAP P;  3E8R A;  1IAG A;  1OS2 A;  1ZP5 A;  1SMP A;  2FV9 A;  2WOA A;  3B92 A;  2RJQ A;  3HY9 A;  2OI0 A;  2PJT A;  5D2B A;  1D8M A;  1BQQ M;  3LIL A;  1XFX A;  4XCT A;  2OXU A;  2QPJ A;  1KUI A;  3LUM A;  1BUD A;  1JJ9 A;  1EB6 A;  3USN A;  2D1N A;  3EHY A;  1BQO A;  4AYK A;  2O36 A;  3I7I A;  3KRY A;  4WKI A;  1Y93 A;  1AYK A;  2W15 A;  1CK7 A;  4H3X A;  1JIZ A;  4FU4 A;  4H76 A;  4FXQ A;  4GUY A;  1HTD A;  3TT4 A;  5L79 A;  2MLR A;  4HX3 A;  2X3A A;  1IAB A;  1C8T A;  3EDZ A;  3V96 B;  3KEJ A;  1R55 A;  3TVC A;  5BOY A;  5CZM A;  1UTZ A;  2ERO A;  1DTH A;  2JT6 A;  1ATL A; 
#chains in the Genus database with same CATH topology
 1OM6 A;  2WO8 A;  4CTH A;  2OVX A;  456C A;  4EFS A;  4GWN A;  1QIB A;  2MZI A;  3EHX A;  1RMZ A;  1BIW A;  1XFY A;  3LIR A;  3LGP A;  4XM8 A;  1YQY A;  1KUF A;  2W12 A;  1XFV A;  4QKZ A;  1G05 A;  4I03 A;  5I12 A;  4WK7 A;  3WV3 A;  4IJO A;  3VTG A;  1AF0 A;  1GO7 P;  2WO9 A;  2I47 A;  3DPE A;  3DTK A;  1USN A;  3EWJ A;  1JIW P;  3HDB A;  1IAD A;  4AUO A;  3KWV C;  3HBV P;  1JKY A;  2MZH A;  3DTI A;  1XFW A;  2CLT A;  4L19 A;  1CGE A;  4GQL A;  1IAA A;  1KBC A;  1PWU A;  3P1V A;  2XS4 A;  1CGF A;  4FXY P;  1OZ9 A;  4H84 A;  1WNI A;  3B2Z A;  1ZS0 A;  3VI1 A;  2DW0 A;  1GKC A;  1A85 A;  3F1A A;  4AIG A;  1J7N A;  1XUD A;  3N2U A;  2JT5 A;  4DPE A;  1YCM A;  3F17 A;  1GXD A;  2JIH A;  1SLN A;  1BUV M;  2ERQ A;  2V4B A;  3G5C A;  1I73 A;  1O0Q A;  2JSD A;  1BKC A;  1JAO A;  4L7A A;  1RM8 A;  4H82 A;  1OS9 A;  1YP1 A;  1Q3A A;  3F15 A;  3KMC A;  3LJT A;  3DNG A;  1O0T A;  1PWP A;  2Y6D A;  3F19 A;  2FV5 A;  1HFC A;  3F18 A;  4WKE A;  2X3B A;  2AYK A;  4AXQ A;  2K9C A;  1ND1 A;  2OY4 A;  3OHO A;  1GO8 P;  4IN9 A;  3EDG A;  1K7I A;  1AKL A;  3LEA A;  2SRT A;  5CXA A;  1HOV A;  4H2E A;  2A8H A;  1JAP A;  1BM6 A;  5LAB A;  2JNP A;  1EUB A;  4GR0 A;  1G4K A;  5I43 A;  4IUW A;  1HY7 A;  5D1S A;  2HU6 A;  3KME A;  3L0T A;  4GF1 A;  2TCL A;  1ZVX A;  3L0V A;  5B5P A;  2W14 A;  1DMT A;  1R1H A;  3ZUK A;  4Q1L A;  5I3M A;  5CUH A;  5JMY A;  2E3X A;  1BKC I;  1CXV A;  1GKD A;  3HY7 A;  4HMA A;  2J0T A;  4PKW A;  1I1I P;  1XAX A;  3ELM A;  4JA1 A;  1ZXV A;  1K7Q A;  1G12 A;  3N2V A;  1A86 A;  966C A;  1Y8J A;  1HFS A;  4ILW D;  1XUC A;  2DW1 A;  4JPA A;  2ERP A;  2OW0 A;  1Y0V A;  5H8X A;  1XM5 A;  4L6T A;  3U1R A;  1QUA A;  2MLS A;  1TVI A;  3ZVS A;  3KEC A;  2OXW A;  1CQR A;  4H49 A;  5D7W A;  4PKQ A;  3UVC A;  3BA0 A;  1GE7 A;  4GWM A;  2Z2D A;  4WZV A;  3LIK A;  1QJI A;  3LQB A;  4XM7 A;  4G9L A;  4PKV A;  1Z3J A;  3OHL A;  4A7B A;  2DW2 A;  3LK8 A;  3AYU A;  1SU3 A;  2YB9 A;  1BSW A;  2POJ A;  2E2D A;  5I0L A;  3HBU P;  1MMR A;  3I7G A;  4H1Q A;  3P24 A;  1MMB A;  3LMC A;  3GBO A;  3RTS A;  4DF9 A;  2MZE A;  3AIG A;  3F16 A;  3AYK A;  1CAQ A;  1JH1 A;  1SLM A;  2X7M A;  1I76 A;  2W0D A;  1GE6 A;  4L63 A;  1R1I A;  3KEK A;  1KUK A;  1H71 P;  4I35 A;  2N8R A;  3DL1 A;  1D8F A;  3HDA P;  2D1O A;  3K7L A;  4XM6 A;  3HB2 P;  2DDY A;  3LUN A;  4G0D A;  5BOT A;  1ZXC A;  2OY2 A;  1PWW A;  3EDH A;  1R1J A;  1MMP A;  3LJG A;  1D5J A;  5D1T A;  1UMT A;  3DWB A;  4GR3 A;  4ZR5 A;  1CGL A;  4PKR A;  1MNC A;  4PKT A;  3LQ0 A;  2OW1 A;  4JIJ A;  5L7F A;  2CKI A;  2XS3 A;  1PWQ A;  4ON1 A;  5BPA A;  4XBH A;  4WF6 A;  1BZS A;  3Q2G A;  1JAN A;  3NX7 A;  1FM1 A;  1K7G A;  4H30 A;  2OZR A;  2YUF A;  4PKS A;  2Y6C A;  4JP4 A;  3KHI A;  3WV1 A;  2KRJ A;  1GE5 A;  3LJZ A;  1XFU A;  2W13 A;  4GR8 A;  1IAE A;  1UMS A;  1B8Y A;  1SAT A;  4DV8 A;  2OVZ A;  1C3I A;  3Q2H A;  1KUH A;  1OMJ A;  2RJP A;  1UTT A;  4A3W A;  2OW2 A;  5D3C A;  1YOU A;  1BKC E;  1HV5 A;  4R3V A;  1KUG A;  3CKI A;  1PWV A;  3WV2 A;  3TS4 A;  1OM8 A;  1R54 A;  3TSK A;  3O2X A;  1QIA A;  3DPF A;  2USN A;  3ZXH A;  5I2Z A;  3K7N A;  3DSL A;  3MA2 A;  1ROS A;  1XFZ A;  1L6J A;  5B5O A;  5D1U A;  2X3C A;  1EAK A;  3EDI A;  1IAC A;  4DD8 A;  1B3D A;  2K2G A;  1G49 A;  1FLS A;  1MMQ A;  5I4O A;  4JQG A;  3LKA A;  1S4B P;  1CIZ A;  2O3E A;  1G9K A;  2L0R A;  1FBL A;  1D7X A;  1ZTQ A;  1JAQ A;  4PKU A;  1QJJ A;  3SHI A;  4FVL A;  2DDF A;  1AST A;  2AIG P;  2OW9 A;  1C7K A;  3HYG A;  3LE9 A;  1XUR A;  1UEA A;  3G42 A;  4J4M A;  3O64 A;  3RTT A;  2J83 A;  2OXZ A;  1OM7 A;  1SRP A;  830C A;  1QIC A;  1OO9 A;  2YIG A;  3B8Z A;  1JK3 A;  1KAP P;  3E8R A;  1IAG A;  1OS2 A;  1ZP5 A;  1SMP A;  2FV9 A;  2WOA A;  3B92 A;  2RJQ A;  3HY9 A;  2OI0 A;  2PJT A;  5D2B A;  1D8M A;  1BQQ M;  3LIL A;  1XFX A;  4XCT A;  2OXU A;  2QPJ A;  1KUI A;  3DTE A;  3LUM A;  1BUD A;  1JJ9 A;  1EB6 A;  3USN A;  2D1N A;  3EHY A;  1BQO A;  4AYK A;  2O36 A;  3I7I A;  3KRY A;  4WKI A;  1Y93 A;  1AYK A;  2W15 A;  1CK7 A;  4H3X A;  1JIZ A;  4FU4 A;  4H76 A;  4FXQ A;  4GUY A;  1HTD A;  3TT4 A;  5L79 A;  2MLR A;  4HX3 A;  2X3A A;  1IAB A;  1C8T A;  3EDZ A;  3V96 B;  3KEJ A;  1R55 A;  3TVC A;  5BOY A;  5CZM A;  1UTZ A;  2ERO A;  1DTH A;  2JT6 A;  1ATL A; 
#chains in the Genus database with same CATH homology
 1OM6 A;  2WO8 A;  4CTH A;  2OVX A;  456C A;  4EFS A;  4GWN A;  1QIB A;  2MZI A;  3EHX A;  1RMZ A;  1BIW A;  1XFY A;  3LIR A;  3LGP A;  4XM8 A;  1YQY A;  1KUF A;  2W12 A;  1XFV A;  4QKZ A;  1G05 A;  4I03 A;  5I12 A;  4WK7 A;  3WV3 A;  4IJO A;  3VTG A;  1AF0 A;  1GO7 P;  2WO9 A;  2I47 A;  3DPE A;  3DTK A;  1USN A;  3EWJ A;  1JIW P;  3HDB A;  1IAD A;  4AUO A;  3KWV C;  3HBV P;  1JKY A;  2MZH A;  3DTI A;  1XFW A;  2CLT A;  4L19 A;  1CGE A;  4GQL A;  1IAA A;  1KBC A;  1PWU A;  3P1V A;  2XS4 A;  1CGF A;  4FXY P;  4H84 A;  1WNI A;  3B2Z A;  1ZS0 A;  3VI1 A;  2DW0 A;  1GKC A;  1A85 A;  3F1A A;  4AIG A;  1J7N A;  1XUD A;  3N2U A;  2JT5 A;  4DPE A;  1YCM A;  3F17 A;  1GXD A;  2JIH A;  1SLN A;  1BUV M;  2ERQ A;  2V4B A;  3G5C A;  1I73 A;  1O0Q A;  2JSD A;  1BKC A;  1JAO A;  4L7A A;  1RM8 A;  4H82 A;  1OS9 A;  1YP1 A;  1Q3A A;  3F15 A;  3KMC A;  3LJT A;  3DNG A;  1O0T A;  1PWP A;  2Y6D A;  3F19 A;  2FV5 A;  1HFC A;  3F18 A;  4WKE A;  2X3B A;  2AYK A;  4AXQ A;  2K9C A;  1ND1 A;  2OY4 A;  3OHO A;  1GO8 P;  4IN9 A;  3EDG A;  1K7I A;  1AKL A;  3LEA A;  2SRT A;  5CXA A;  1HOV A;  4H2E A;  2A8H A;  1JAP A;  1BM6 A;  5LAB A;  2JNP A;  1EUB A;  4GR0 A;  1G4K A;  5I43 A;  4IUW A;  1HY7 A;  5D1S A;  2HU6 A;  3KME A;  3L0T A;  4GF1 A;  2TCL A;  1ZVX A;  3L0V A;  5B5P A;  2W14 A;  1DMT A;  1R1H A;  3ZUK A;  4Q1L A;  5I3M A;  5CUH A;  5JMY A;  2E3X A;  1BKC I;  1CXV A;  1GKD A;  3HY7 A;  4HMA A;  2J0T A;  4PKW A;  1I1I P;  3ELM A;  4JA1 A;  1ZXV A;  1K7Q A;  1G12 A;  3N2V A;  1A86 A;  966C A;  1Y8J A;  1HFS A;  4ILW D;  1XUC A;  2DW1 A;  4JPA A;  2ERP A;  2OW0 A;  1Y0V A;  5H8X A;  4L6T A;  3U1R A;  1QUA A;  2MLS A;  3ZVS A;  3KEC A;  2OXW A;  1CQR A;  4H49 A;  5D7W A;  4PKQ A;  3UVC A;  3BA0 A;  1GE7 A;  4GWM A;  2Z2D A;  4WZV A;  3LIK A;  1QJI A;  3LQB A;  4XM7 A;  4G9L A;  4PKV A;  1Z3J A;  3OHL A;  4A7B A;  2DW2 A;  3LK8 A;  3AYU A;  1SU3 A;  2YB9 A;  1BSW A;  2POJ A;  2E2D A;  5I0L A;  3HBU P;  1MMR A;  3I7G A;  4H1Q A;  3P24 A;  1MMB A;  3LMC A;  3GBO A;  3RTS A;  4DF9 A;  2MZE A;  3AIG A;  3F16 A;  3AYK A;  1CAQ A;  1JH1 A;  1SLM A;  2X7M A;  1I76 A;  2W0D A;  1GE6 A;  4L63 A;  1R1I A;  3KEK A;  1KUK A;  1H71 P;  4I35 A;  2N8R A;  3DL1 A;  1D8F A;  3HDA P;  2D1O A;  3K7L A;  4XM6 A;  3HB2 P;  2DDY A;  3LUN A;  4G0D A;  5BOT A;  1ZXC A;  2OY2 A;  1PWW A;  3EDH A;  1R1J A;  1MMP A;  3LJG A;  1D5J A;  5D1T A;  1UMT A;  3DWB A;  4GR3 A;  4ZR5 A;  1CGL A;  4PKR A;  1MNC A;  4PKT A;  3LQ0 A;  2OW1 A;  4JIJ A;  5L7F A;  2CKI A;  2XS3 A;  1PWQ A;  4ON1 A;  5BPA A;  4XBH A;  4WF6 A;  1BZS A;  3Q2G A;  1JAN A;  3NX7 A;  1FM1 A;  1K7G A;  4H30 A;  2OZR A;  2YUF A;  4PKS A;  2Y6C A;  4JP4 A;  3KHI A;  3WV1 A;  2KRJ A;  1GE5 A;  3LJZ A;  1XFU A;  2W13 A;  4GR8 A;  1IAE A;  1UMS A;  1B8Y A;  1SAT A;  4DV8 A;  2OVZ A;  1C3I A;  3Q2H A;  1KUH A;  1OMJ A;  2RJP A;  1UTT A;  4A3W A;  2OW2 A;  5D3C A;  1YOU A;  1BKC E;  1HV5 A;  4R3V A;  1KUG A;  3CKI A;  1PWV A;  3WV2 A;  3TS4 A;  1OM8 A;  1R54 A;  3TSK A;  3O2X A;  1QIA A;  3DPF A;  2USN A;  3ZXH A;  5I2Z A;  3K7N A;  3DSL A;  3MA2 A;  1ROS A;  1XFZ A;  1L6J A;  5B5O A;  5D1U A;  2X3C A;  1EAK A;  3EDI A;  1IAC A;  4DD8 A;  1B3D A;  2K2G A;  1G49 A;  1FLS A;  1MMQ A;  5I4O A;  4JQG A;  3LKA A;  1S4B P;  1CIZ A;  2O3E A;  1G9K A;  2L0R A;  1FBL A;  1D7X A;  1ZTQ A;  1JAQ A;  4PKU A;  1QJJ A;  3SHI A;  4FVL A;  2DDF A;  1AST A;  2AIG P;  2OW9 A;  1C7K A;  3HYG A;  3LE9 A;  1XUR A;  1UEA A;  3G42 A;  4J4M A;  3O64 A;  3RTT A;  2J83 A;  2OXZ A;  1OM7 A;  1SRP A;  830C A;  1QIC A;  1OO9 A;  2YIG A;  3B8Z A;  1JK3 A;  1KAP P;  3E8R A;  1IAG A;  1OS2 A;  1ZP5 A;  1SMP A;  2FV9 A;  2WOA A;  3B92 A;  2RJQ A;  3HY9 A;  2OI0 A;  2PJT A;  5D2B A;  1D8M A;  1BQQ M;  3LIL A;  1XFX A;  4XCT A;  2OXU A;  2QPJ A;  1KUI A;  3DTE A;  3LUM A;  1BUD A;  1JJ9 A;  1EB6 A;  3USN A;  2D1N A;  3EHY A;  1BQO A;  4AYK A;  2O36 A;  3I7I A;  3KRY A;  4WKI A;  1Y93 A;  1AYK A;  2W15 A;  1CK7 A;  4H3X A;  1JIZ A;  4FU4 A;  4H76 A;  4FXQ A;  4GUY A;  1HTD A;  3TT4 A;  5L79 A;  2MLR A;  4HX3 A;  2X3A A;  1IAB A;  1C8T A;  3EDZ A;  3V96 B;  3KEJ A;  1R55 A;  3TVC A;  5BOY A;  5CZM A;  1UTZ A;  2ERO A;  1DTH A;  2JT6 A;  1ATL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...