1G4RA

Crystal structure of bovine beta-arrestin 1
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
387
structure length
353
Chain Sequence
RVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSDLASSDVAVELPFTLMHPKPDIVFEDFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of beta-arrestin at 1.9 A: possible mechanism of receptor binding and membrane Translocation.
pubmed doi rcsb
source organism Bos taurus
molecule tags Signaling protein
molecule keywords BETA-ARRESTIN 1
total genus 69
structure length 353
sequence length 387
ec nomenclature
pdb deposition date 2000-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
A PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1g4rA02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1g4rA01
2FAUA 3LH9A 4GEJA 3GD1C 4ZRGA 4R7XA 2WTRB 3UGUA 5F0JB 1CF1A 3GC3A 4P2AA 3UGXA 4LL1A 2R51A 4R7VA 1SUJA 1G4MA 4GFXA 4LL4A 1AYRA 5F0MB 3LH8A 4JQIA 3P2DA 4J2QA 5F0LB 4GEIA 3LHAA 1ZSHA 5F0PB 1G4RA 2WTRA 1JSYA
chains in the Genus database with same CATH superfamily
3MRCB 5JHDA 4ELKB 5EEZA 1KBVA 4L4VD 2NW2B 2J21A 2EDMA 4FQ2L 4LPCA 4GB9A 4LPWA 3B9KA 2XWCA 4KXAA 5ESAA 4FDWA 3ZL4L 5G4NA 3AS2A 1K2DB 1EEYA 3CVHA 4F5CE 2NYYC 1M4KA 2XDHA 4Y5YB 1CF8L 1MXDA 5DQ9B 1KCSL 3WLWD 5C0AB 1KBWA 3UDWA 3CHSA 1VFAB 2GJJA 1GKOA 2IC2A 1ZTXE 1UZGA 3D39B 3KL3A 4Z7VB 1F42A 2A73A 4KFMA 2DF3A 3ATBA 3ARDC 1E7UA 4U6HA 2EEDA 5BOJA 1F02I 4ORGB 2GJRA 4MB5A 3WTTA 3O4LA 2E4TA 3D2UD 5FGSA 4OD1H 4E5XG 3V8OA 5IV2B 2D9CA 3MRMB 2BFVH 4A68A 5HY9A 2DWEA 4QHKI 1H3WM 4L9LC 1I1AB 2NNFA 1OTSD 3TCLB 4ELDA 3V6OC 3WN5C 2G75B 4OZGB 2JB5H 3T71A 3ARFA 1UT2A 3BMWA 3TNMB 3BISA 1DQLH 1PKQA 3FUMA 4YSPA 3EG9A 5I74B 5GZOD 3JTSA 4M8QA 3V52L 4FFZL 5LGYA 1OQXA 4XE0A 5D72H 1UXSA 4G1MA 1AO7D 1LO0L 4YO0A 5L8LB 1T7XA 4OSUL 1QSEB 5GPRA 1A1OA 3O3BB 5AYUH 2F5BH 5IUSA 5SWSA 1F6AB 1R3JB 4DTGH 4X6EB 4AL8H 3VFRA 2WXPA 5ITFB 1J8KA 4X6CF 3R4DA 3DHUA 5AW5B 4OGXL 4WW1A 2E7HA 4QTIH 4GRWH 1UC6A 1Y6KR 1SUHA 3S37L 2VXUL 1KB9J 3SGDI 3WEAA 4PJDF 3LDBC 1TZIB 1TTBA 1K3ZA 3DUUB 4HZ1A 3WDHA 2H0JA 2VABB 2NCMA 2BNUA 4WJKB 4XP4H 3X3FH 5I8OL 1L6XA 3MNZA 4OJEH 4JO3H 1U93A 1ZT7B 12E8H 3GM8A 4J3OD 1EO5A 1WA1X 4JO1L 2BVEA 4KUCF 2E7DA 4ZBJA 1A4JA 1CR9H 2OL3H 3CE1A 4R5XA 5CEYB 1ACXA 2OMXA 5B1AB 3GNMH 5HI4C 1BM3H 2N3JA 3P02A 2XZAH 5CLTA 4LCUB 5TDOA 2EDHA 3WELA 3WCYA 3L5XH 4PCKA 4H2AA 2DBJA 2WYHA 3GGWB 1S7WA 2Y36L 2NXZC 3L54A 3RFZA 3RPBA 5LAPA 4QNPF 1YPZB 2XACC 1RUAL 4G8AC 2YUXA 3TIEB 4JO1H 5DEGB 3GUTA 1IGCH 1PL3A 1S3KH 3PPEA 3RNQB 4H8PA 4L8SC 2RTTA 3T8MA 1QKZH 5BXFB 2Y7NA 3MFFB 1J0KA 3FTGB 3C09C 4WV1B 1CC3A 3LKNA 2UZXA 1NFDB 3QQ4B 4IMKA 3FTUA 1KG0A 4XX1G 5CF3A 5IMMB 1IBFA 5IHUL 4XB3A 2Q7AA 2AGJH 5LWYL 3AXHA 3DK2A 2DQJL 4WTWA 4JPSA 2EDBA 2DQMA 2ID5A 4AL8L 2HG5B 2IH1A 1NEUA 4ABVA 5J0BA 4OGXH 4X0KA 1UXLA 3R0NA 1FV1B 2A77H 5IJVA 2FX9H 5JPMC 4ZSOB 4KKBC 5SX4H 4C47A 1RZJH 3QS3A 4KI5F 2L4OA 3D09A 4Q8BA 4PAZA 4TQ8A 5D1XB 3ZE1E 3AREA 2V2XB 1HSBA 2X4RA 4OAWA 2J4WL 1U8HB 1R24A 3HPJB 3A5VA 3PHQA 2YZ8A 3HG3A 1GSKA 1E40A 4P4KC 4KAQL 4F8TA 2ZIDA 3ULUD 3UBXG 3EGXB 5DI8B 1YC8A 2HKFH 4HEMA 3JWNH 2QFPA 4NUGH 1KFGA 2EIKB 2N1KA 4JKWA 1PEZA 3P4NA 3FH5A 5DQDL 3WJLA 2BNQB 2X6BA 2XETA 4KI1A 2BCMA 3CNKA 4JQIA 1VKXA 1PYWB 4JFQA 5ANMB 1YJDC 2NQDA 3SOBL 3EJCA 3FO1A 3WXVH 1DTUA 5BUAA 3RIFF 4O02H 4LCCC 5FLUA 1NCWH 2PR9A 1JWSB 1PZ5A 1UWXK 4FABL 4KJQD 2PPDA 4E9LA 4XP5L 2HT4D 1FN4B 3UTTE 1JXFA 5KTEL 1AG6A 2E7MA 4BXVA 3U2SB 5FWRA 3U0TB 5KYYA 3MRBA 3O3EB 2ZNWA 4I1RA 3P77A 5I73B 1A6UL 3RBGA 3S3SA 1S7TA 2WGNB 1YUHB 2WXIA 3TH2T 4ZXBD 2DW5A 4XMZA 3GI9H 1MCEA 4XO4A 4Y2OB 4K9JA 2XZQH 4IW4C 1T2QH 3OSKA 4LB8A 2GBAA 3N55A 4FI7A 2I07B 4P23A 4G71B 3IDGB 2DEWX 1QACA 5KTEH 3MDJA 1LD9A 3MV8A 4YR6A 1G6RA 1J0IA 1J1OL 2OMTB 2JXMA 3DUSA 3T6ZA 3PWLB 2PXYB 1FCCA 1HTYA 1IFHL 1HOEA 1SLXA 2IFFH 1G7QA 2MHAB 3G5VA 4YHMH 3ZE2B 1E42A 3U2JA 2EDTA 3QHZH 5LCVH 4LRIA 4RQQB 3FRPB 1NEZA 4HWNA 4MASA 1GYVA 3FO0L 5I0YA 1W72B 2CKBL 2DD8H 2MCG1 5GS0D 2Y06L 4PHZA 3W81A 5H2BA 1LMIA 1NCGA 4ILDA 4P2OA 3HCVB 1XMWA 5CSZB 2N0KA 1L9NA 2QADD 1BQRA 3RI5F 4JMNA 2CBOA 1SFHA 1FYTB 2XZCL 5HDRA 3ETSA 1CYWA 1QTSA 1J0YA 3CXHK 4KHXL 4YSDA 4Q2ZB 3VI4B 1E8XA 1MZYA 3FNKA 2TRYA 3MN8A 5FW8A 1IC1A 4AYSA 3NJVA 3ZDYB 2B4CH 4TNFA 4HUKB 3HN5A 1I31A 5EOTB 3REVB 4OLVL 3G5WA 3SZKC 1H8NA 1L0PA 3JWDL 1AJ7L 1FVEB 4JE4B 4X6FA 2XV2A 3PWJB 2HSIA 2ZNXA 4IKNA 4LQ1A 3UJJL 3KD4A 1I9RH 4UQIM 3WY3A 4IU3A 1DFBH 3M46A 3TA3C 3TBWA 5DJ0A 4JHBA 3NJFA 1ZE3H 1JYNA 5E03A 1CICA 1OVZA 2WBWB 3FYIB 1U8OB 1BYPA 3LZNA 4QAMB 2YN3A 1JHTA 4PGBA 4XMXA 3ZL2A 4YL4A 3IFNH 2C9XA 2YWYA 1JMZA 2KDGA 3K91A 3IF1A 4IK6A 3C6LB 3EFFB 2XWXA 2JQMA 4KRMB 3ROLA 3GSXB 5I1JL 1G6VK 5DMKA 4HUWB 1XIWC 1TVHB 5I8CA 2OTUA 1A3ZA 3PREA 2PPCA 3BKYH 3ULSA 5C2UB 2I9TB 3C6LC 3D3VE 4H8WH 4JL1A 1N5AA 3W5NA 1JZJA 5I1DA 4LP4A 2R0ZL 2ADYA 3MGTB 2OFQA 2WN3A 1SBBA 4AQAA 5H35B 1T0NA 2BNQD 5AALA 5INCB 3OKEB 3MROA 2OCCB 2OI9B 1XTLA 1RZ8B 4HC1H 1JGIA 2ARJB 4DP9X 1UD6A 1E8YA 5BRZB 3K6NA 3OWRA 4DN4H 3MX0B 4QYOA 2V8LA 2BZCA 1CXLA 3G5ZB 3NFNA 4NC2B 3M6DA 3ARVA 1SDDA 1IM9A 1UM5L 3U48A 1KDIA 1RUKH 1UGNA 2ZE0A 3M45A 5I15L 3QJRB 4U7KA 3HI5H 1D6VL 2IADB 5I15H 2F58H 5GGTH 4OCWL 3W38A 1G87A 4LAJH 2D7QA 1DUZB 4HUUA 4KXBA 1UG9A 3IKKA 4HJIA 4ZTEA 4N8CH 5FXCH 3NA4A 3U4AA 3SEPA 3DPBA 2D9QB 3FCSB 2VCOA 1XF4A 2UVEA 1FNHA 3K6DA 2A7BA 1RJYA 2FYYA 1MHEA 5EO9B 3KPRA 3LYRA 3K6SA 5IR1A 1B0IA 2CUAA 3ARDD 5B3SB 4KOBA 4OZHE 3S34L 5BV7L 3SJVE 4JCWA 1PCXA 4IRZA 5LHDA 2VR8A 1EHLL 4NO5A 4EN3A 5KJRH 2Z0UA 2I5YH 1IZKA 2OP4L 3P30H 4LBAA 4ELMF 1T1XB 4JVPA 4YHYB 1U8CA 4ZOBA 1CD9B 5C86A 3GB7B 1N7MH 5IBLC 1KPVB 2DLHA 2V9RA 2Y5QA 2W94A 5GSRB 2XYCA 3P0VL 4FD0A 4OZHB 2EE6A 4YPGA 3U82B 4QRTB 5HDQL 4NO0B 3TIDB 4IRJB 3L6FA 4X5WA 5FO2A 5EG6C 3SE9L 1WSST 2NYKA 4H20H 5DZPA 4ZK8A 5EBMA 2PETA 1NEPA 1AD0B 1RZGA 1OGTB 1KB5A 2X9XA 5FYKD 4LOEA 3WGVB 3MRIA 3T9WA 1TMCB 5FK9A 4A7TA 3MTRA 4UTAH 5K59E 3CX5K 1QMUA 5DLML 3CU7A 3NFPB 4ZAKD 3VXMD 3C87A 3H55A 3UZEA 4W9JC 3FJTA 1NQBA 2CJSA 5FOBB 4IKLA 4JKLA 2UXGA 2K6WA 3PV7A 9PCYA 1BGXL 4NKIL 1I9EA 4YLQT 1CBJA 2A6KB 3WFHB 3V0FA 1SHSA 4IIQC 1U8IB 2KL6A 3F7PC 3BPCB 4K15A 4WTZG 4KXZH 3H9SB 2BVUA 5IFAH 2RALA 1KPRB 3SO5A 1SZNA 4C55A 2DB8A 2ZYSA 4HFWA 3W0WD 1KPUB 3QPXH 2B2XH 4NEHB 1VFMA 2CNZA 3RIAF 2AJUH 2EDXA 1YMMA 3GSWA 4XPGH 1ZHBA 2MPAH 4U3XA 1BQUA 1SEBA 5JORB 4K2UL 4FHJA 2VLKA 4FCHA 5HGGS 1WLHA 2XFXB 2IQ9H 3VH8A 3ZDXF 2JKSA 5KJRL 1UCTA 4AX3A 2NY5H 4LKCB 4AIEA 4Y4KA 4U1IB 3MJ7B 3RDTA 5LNDA 2IMMA 5CP7A 4BKLA 4G9DA 3FT3A 3NPZB 5INDB 5JXAH 1JGLL 1MCDA 3OG4B 1GZHC 1LNUB 1MFBL 4YX2H 3KW7A 4GEJA 4DGYH 3HKZA 3SKOB 4I3RL 4HIEB 3MRLA 1G6RH 4NRZA 5E1AA 4JFDB 3VXPA 5H94B 2O5XH 1KGYE 4G8EA 5ICUA 2YRZA 3T0ED 3DSNB 5E9DB 5LNGA 1I4FA 3O9WB 4HMCA 4OJCA 3RP1A 3GSVB 2D8KA 5CEZL 2VSMB 3VH8B 4RIRB 1TVBA 2ZAHA 3V7AG 4ATTA 3ESPA 4KZEL 3C6EA 4HXBH 3WHE1 4OV5A 3LKOA 1JGLH 4PCTA 3K8KA 5IHZA 4GUQA 1I53A 1CT8A 3HZMA 5IG7B 3UAJC 5AZ2H 1UXMA 2JKJA 1KPUA 5HTSA 2VQ4A 1R3KA 5F9WB 5D1ZD 1I1FA 4RMVA 5IW1B 5IJDC 4KO6A 2J7LA 1VRSA 3H9SA 5DGQA 1GS8A 4E9QA 3NCWA 1SXCA 3IXTA 1N19A 2YGOA 3IFLL 4AYGA 3KLHD 1MEXH 2YQBA 4N3TA 4QF1B 2A6KA 2HTKC 3SJVD 2B39A 2Z31D 1QLRB 3ESUF 3M1CA 4D9LL 1KB3A 2EINB 1W6LA 3GXFA 4JO3L 3SCMA 4ALAL 5JW4Q 3RUGE 3LMJH 4LEOB 2G2PA 4MFHA 4PLOB 2N7AA 1RZGB 2Q86A 4NDMA 5GIRA 4AIZB 1EO8L 2DWDB 2ZG2A 1CXFA 4OLXL 4FQHB 1LO3H 4U1NA 1RLWA 3I6KB 4R84A 3SYOA 3AS1A 5DDHA 4Z7WF 4ZTPL 4NQEB 3FN0L 5FKPB 4XCNA 1AYRA 4PJ9C 4C56A 4Z0BH 2FECI 1CL7H 1L5GA 1FORH 1EO8H 1IL1A 2D3NA 2WAHA 3OF6A 4EF3A 1I8AA 5F9JA 3HC0A 3DMMC 1UGKA 2HT2C 2QV2A 1JD9A 1G1CA 2D0GA 3QUGA 4GG8B 5SX5H 3HAEB 4XZUA 5T1KB 3T3MB 4XWOD 4KJQC 2CA3A 1J0HA 5E00B 1BREA 2WLLB 2X4TB 3GMPA 5K33A 2ROYA 1RHFA 2YD5A 1OY3B 1TG8A 5CINL 2L0DA 4GRWE 1DUZA 4HUUB 3V6BR 3WUZA 3B8YA 1BZ7A 3EJZC 1LE9A 1CFVH 2XVKA 3CSPA 9CGTA 3PAVA 3BIBX 4F7PB 3L5WB 1KXVA 5EF3A 2A4EA 2VE6B 5TDPA 3BZFA 2YUVA 5DURD 3NFNB 2IOMA 4H8QA 2XV0A 3ZGIA 4BE6A 1ZPLA 1NJ9B 3MCKB 5GJSL 1YC7A 1JV2B 3K4AA 4JRLA 2YBRA 5DFVC 2CXKA 5BRZA 4POZD 4H5SA 3FXIC 3QDJE 4HGKC 3LX9A 5DD3L 2X2JA 4LGRB 3KPSB 2HMID 3OKEA 2HRPH 3DGGA 5C9KA 1V3KA 5CMAB 4CDGC 3UMNA 2JI3A 3EGDA 3PIQA 3I75B 2F8OA 3NCJL 2KHAA 2GK2A 2A6JA 1WBYB 4HLJA 1BQSA 3JUZA 5GRYA 3ULSB 3ZT5A 1HYRC 2R39A 4YSCA 1EZUA 2Q3XA 5E6IC 3QYCA 3X13A 4HUWA 4QXGH 5EU5A 1XGUB 4H25B 4K3JL 2RAMA 5GS0C 1SXZA 3B2UC 2R0ZH 2HUEA 2WOBA 4GXVH 5H4YA 1KGIA 4WGVB 4BQCA 4NKMA 5HDOA 4KAQH 3EXLA 2D03L 2VQ1A 4IKJA 4NN7B 1HESA 1ROCA 4WV1C 4NXKA 4YSUA 3I9AA 4TVSa 2ZJSH 2FD6H 2IG2H 3QG7H 1KLUA 4XP4L 3X3FL 4MJ6A 2XV3A 1X4YA 1JUFA 2VMEA 2DMKA 2NZIA 1YEKL 3LH8A 3BMVA 4WNQB 5AAPA 2NX5E 3B3BA 2LABA 2ZYRA 3TPUB 1UYWL 4C59B 4LSTH 4XNQA 1KZQA 1IKNA 1KTDB 5KJ7E 1DBKL 4X6FB 5DJ6B 2XPYA 1AFVH 4GMTH 4MWFA 3RU8H 1C12A 4TTDD 4X7SL 4E41B 1R1CA 4MAYD 4OCYH 1J7VR 1DSYA 3L7EA 3P9MA 1KV7A 4EIZC 4EVNB 5TE4L 5K5YA 3KZ8A 1DR9A 1K8IB 1HCZA 2HKFL 5HDBB 1EHKB 1A3LH 5ANME 3WNOA 1AGCB 3OJVC 2R1YA 4XP1L 1FVCB 4QHUB 1BZDA 5D5MF 3UZEC 3GTVA 3HCVA 4JFZH 5KUKA 4CVWA 4FTDA 5A43C 2WK2A 4M1CD 2C3VA 2DYSB 4KI5D 4NZJA 2FJSA 1KTBA 1YMHB 3STLA 3VG9B 4M6NL 1ZE3C 3A3YB 4MSWB 5DQJB 2SODB 4KKRA 4A04A 2GFBA 3FRPA 5GS2D 1PX8A 2CMRL 3RGVC 2E7LA 3UZVB 4JDVB 1X4ZA 3CVBA 3GIVA 1G7QB 2YWZA 3ULVC 2EE0A 3SDXE 5IQMA 5DMIH 3QEQA 3PWLA 1UTDA 6TAAA 3LXAA 2CDFB 3T2LA 4GKZB 4OFDA 1LD9B 1QR4A 1CD0A 2H3XC 3DDGA 4PGJA 1G1YA 4B60A 3FPXA 4ZFGH 3LKSB 3AJ7A 3NRPA 2ISDA 4XPFH 1CFSA 3WKNA 4FC3E 3O6KH 1G7MA 2F0CA 1RMFL 1VEPA 3LZLA 4MS6A 3EJRA 3ILPB 3LQAC 2JB6A 3O8XB 3L45A 4QHMB 5GS2H 1OTTD 2PYED 3EHBD 1CFQA 4KC3B 5DJCA 3ZUNC 1KIPA 3V5KB 4UZGA 3U9UA 1MSPA 1U8PB 1GIGL 3LV3B 1WGVA 1PD0A 2HH0L 4Z3IA 4TQIA 1INEH 3NRFA 2MJWA 4LE8A 3G04B 2JCCB 1RHHA 4NQVA 4OZIF 2E5EA 2HJKA 4G8FA 1QSFE 3H9HB 1O0VA 1KBGH 2QLYA 4HQQH 5IVXE 3TCTA 2IQ9L 3MRKB 4W9EC 1DBBH 4Q97A 5IHLB 1I7RA 1CFVL 3FO1B 4S0SD 5ANMA 3ZL1A 3BVUA 3LKRB 3OR7A 3F7RA 4G8GB 4YHPB 2VRAA 5I74C 1VACB 2LU3A 5J56B 5MENE 4P2RB 4M7LH 1GPOH 4AENA 1E4XH 5FA4A 1HZLA 1NKRA 2DRUA 1EH9A 3FB5B 5I16A 2ZUTA 2WLNA 4YVNA 1NANI 2CLVB 1W0YT 2HRGA 1AACA 2OSXA 2C1OB 5AKVA 2VJXA 4M5ZL 2P47B 1OB1A 5E2WL 3KLKA 1VDGA 2E59A 1KGXA 3H6JA 2YOAA 3F6LA 5CILH 3PAUA 4NBYB 5HHXH 2ZWYA 5I1IH 5J7CC 4LLQA 3TZVD 4F20A 1XF5A 3MNWA 5C0ND 4RISL 1Q94A 3MR9A 4HPOH 5KVGE 1KXTB 4W70A 1ILSA 1Q94B 3L2NA 3LMJL 3M7OA 3MR9B 4GQ9L 4OJDH 4PJEE 3A4EA 4J3OF 3LQAL 5J06A 2P49B 1A0QL 4AGPA 1VENA 1JPTH 1NM9A 4MCNA 2APSA 5E4EB 3JWOC 3MLYH 7TAAA 3QJHB 4X0KB 3FU7B 5J1AB 4KKLD 4XVUD 4AE0A 1A6TA 5T1JA 4H2CA 4X5LA 3SYPA 3ZR6A 4BK5C 2P24B 3MODL 1XIWB 2C1OA 4LMQI 2J43A 2UV3A 1MHPL 1NFDA 1DO5A 2CHZA 3QQ4A 4Z3JA 5I16B 3RURA 3S34H 5BV7H 4L5FE 1BP3B 5FA4B 3IJSA 1N10A 1JDAA 1OWWA 4O2FA 3L3OA 2EADA 2FE0A 4LQFL 5FYKE 5DEGA 2FWSA 1EJ6A 5I5RA 2NY1B 1JD7A 2W9EH 3U7YL 4N8CL 4RFOH 1YPZA 3EYSL 4ODXA 3ATFA 4P46D 1JPST 3AM8C 3JYBA 3Q8BA 4S1SH 1F2QA 2XICA 2QQLL 3S88L 1JK8A 5I6PA 4Z0XA 1PX4A 1W9XA 3GGWA 1SN2A 1TYRA 3LZFH 3BZ4A 1S3KL 3PCYA 4M56A 2BXYA 1RHHB 3L16A 5AVVB 2F18A 2UZYB 4Q74A 3ZO0A 6PCYA 4EN3D 4UT9A 5AVTB 1CDHA 4U2YA 3BGFC 4GS7B 2AJXL 1S7RB 2EO9A 3ARZA 1NL0L 3SDDC 3U9UB 2X4SB 1O9ZA 4U6YA 3UTQA 2J6EA 1MCBA 5L88L 1OV8A 4XMVA 2N4IA 1B90A 1SXNA 3NH7L 1CXEA 4TUKH 3DUUA 1FNEA 3BGAA 1J5OH 3WN6A 4PRPE 5F3BA 5HD8D 2GW5A 3VFVA 4KRPB 2AAAA 3N0PB 4WW1B 2IPKA 2CDFA 3PNRB 1XGYH 4P5SA 2DWYA 3WTYA 1W6WA 2F15A 3P69A 4FKKA 4J8RB 4Y2DB 1SQ2N 4K9EL 3GIVB 1YAZA 5JW3H 4OLEA 3AU1B 5TQ0H 3I3EA 2QKIC 4XAWL 5J3HC 4BQ8A 2GFBB 3H53A 4AIOA 1HL4A 4O02A 3TJEH 2QTEA 1WWCA 3STLB 4TS6A 1TOXA 1DN2A 5L9DL 4LCCA 4DHLA 2BNQE 2C3VB 5JZ7D 2BNRA 4PRPD 4QXUH 4N6RB 2MTPA 5L0QB 4XI5C 5D93B 1BQLL 1E2VA 3ECQA 4I5BA 4KROC 1NGWB 4OZGA 1RZJC 3VNZA 2JCWA 1FVCA 2DLFL 3H9SE 4I7ZC 3G6JF 2QPUA 3OKDB 4PJFF 4E68A 1SVBA 1XF2A 1K3IA 4I4WB 1C08A 2LAGB 2DM2A 3LEVL 3VM5A 2EIMB 2JKXA 2F61A 3P9MB 3WSQL 3QEHB 5AWNH 1UJTA 3MV7A 1W0VA 2OR8A 4YDVA 4DUWA 2RH0A 4AV4A 2GBUA 2D7TH 5BJTA 1FG2B 3FQUB 4YWGH 3FF7A 4O51A 4XWOC 5DJ6A 1CO1A 1KTCA 5J11B 2EYSA 5DRNA 1HINH 4PJ8D 5E5MA 5EIVA 1KBGL 3TPUA 4WNQA 1WFOA 4N2MA 4ZMZA 4ZG1A 1HIMH 1R3HB 3DX9B 1CLOH 1K2DA 3RVWC 2X1XR 5FO9B 1NIDA 2OMUB 2WIIA 1BW8A 3B9KB 4ZYKB 3ARQA 4ATWA 1WUNT 1W15A 1NCAH 2JJSC 4NKMB 2APVA 2NW2A 3ZVVA 1FBIL 1JNHA 2JMRA 2LTQB 5E95B 1UWXH 1IGFH 2J1XA 1E5CA 4DKFH 3ZIYA 1S7UA 2H47C 4V2BA 3B34A 5JW3L 1ETZA 4RNRB 4POZC 1BIIA 3VA2C 3PY9A 6CGTA 1SEQH 5JPMA 1T0MB 3HOGA 1T5WA 4AI7A 5E2VL 1WBYA 1X5HA 2VXUH 1BQHB 3FQXA 3N42B 2ED8A 3BP4A 3VRLE 3WS6C 5DK2A 4PJ5D 1HS6A 5HGAB 4JB9H 5AEAA 4K8RD 3WNNA 2XRAL 2CBQA 3GBDA 2GJZB 1EGJA 2CIIB 3QJQB 2O5YH 4FXLA 5A6MA 2FEEL 3L1OH 2A9BA 2BK8A 1CCZA 2YBRB 4M8VA 1S78D 4MX7B 3TBVB 3CHOA 5DJYA 1BVNP 4MJID 2HFEB 5CEXB 3BZFB 1Q9OA 1X6NA 2XA8L 5F9OL 4YXLH 2F53B 2C9AA 2Z34A 4WUKH 2XTJD 1DUYB 1UEYA 1YEEH 5GS0H 4S1SL 5D1XE 1EZSA 3MBXL 2FT8A 4TSCH 4ZS7L 5E08H 4I3RH 1JGDA 3MV11 2P44B 3VSTA 3F84A 5T33L 4Y7MA 1IC4H 4LLWA 1T21B 2C1PA 5E00A 4LHUG 2J72A 4HJEA 2BP8A 4NJ9H 2WYIA 3P0YH 2NXYC 1VHPA 2UY7A 3PGDA 5HHOA 5B39B 4Z7VF 2VLKD 4D7BA 1FAIL 2X28A 4DPBX 5C0FA 3I84A 3WLBB 4L4TD 1LHZA 1TR7A 3O3AA 1B4LA 5FYKU 2XHNA 2BH0A 4BK5A 3EO1A 1ET5A 5EO1A 1EMTL 3QYMA 1EFXB 5IF0B 2R2CA 3AUVA 4URTB 3V6FA 3RDTD 1BJ1J 3D06A 3VXUE 4DCQB 3FT4A 4NQEA 3SO3C 1GAFL 4YEEA 4YJZL 2XX1A 2WM0A 2VRKA 1HILB 2OJZL 3B43A 2CPUA 4M1CC 3DXAE 2YD0A 1T66C 4MQ7A 5T1KD 2FECL 1TJHH 2A0LD 2AQPA 4ODWB 2Y7OA 3HI1A 4MTMA 3HE6B 4ANKA 3I6SA 1VFBB 3QFJB 3ZHFA 3BGMA 2DWDA 3E6FB 4AIZA 1BEXA 2Q86B 5C6PB 2DQUL 1PEWA 5CUSL 5IOPA 3FOMA 2WY3B 1IM3B 2OI9C 3Q2NA 3CN4A 3EOTL 3O0LA 2NY6C 2BVQB 4GINA 4O58H 3U9WA 1BYOA 1AOHA 1MLCB 4LF3A 2IGFH 2WXMA 2V3EA 1IBHA 3G08A 4QF1A 4K3DH 5E0QA 3IXTB 4M6OH 1P7QA 1UM6H 4ZOCA 1X7SA 5TD4A 3RWEA 4POUB 4JM2A 2C5DC 1U21A 1T22B 4MMXC 3SGEI 3I74A 2WLIB 5C70A 2G60L 4JLRB 2VR6A 4Z7VE 2O4EA 2BCKB 2YKKA 3UG4A 4X99B 2Z93A 3C6LD 5IG7A 1WWWX 2BFGA 2K6YA 3FQRB 1THAA 3DX8A 2FZ3A 2EE9A 3ECBA 3K0YA 2ICES 3U6XS 5TF1L 5KVDH 4AQOA 4M9PA 3S5LA 3GSVA 5CWSB 3RWGB 3S2AA 4Y2DC 4F3FB 3N04A 4G8EB 2AXWA 1TU2B 4ODBD 3ZDXB 1DBAH 2VZOA 3F01A 4PJGF 4X4ZA 2RMNA 5IREA 2FIKB 1DP0A 2V7NB 1DN0A 2V37A 4GSQA 4X4XA 5DVLA 5HDLA 3MCLH 4KY1L 1H8SA 4WSKA 3DHPA 4DPAX 2ZSWA 3GEWB 2CO4A 5GGRB 1JZFA 2DM4A 4FMFA 3QNZB 3IGFA 4HLZG 5J13B 1FBIH 2FO4B 4UIMB 3S36L 3INOA 2NX5B 4MQTB 1BGXH 4PJAE 4YE4L 3GXUB 3RE0A 4F37F 5EEUA 2XKUA 4KVCL 4PU2A 3DARA 4PYGA 1AGFB 4FL4C 2QADB 4GSDL 3BO8A 3EFDH 3VFPA 2A6IB 1BZEA 1LDSA 3PGFL 3FU8A 1J5CA 1WZ1H 5L6YH 3BPLC 1YUKB 3EH2A 2OR9L 4HX1A 3D33A 2ZKYA 5LDSA 4LSUL 2KLSA 2IOIA 4ODTL 5CN2A 4GW5B 5F8RC 3FQTA 3TN0B 4QRPE 1P4LB 1X5AA 1E28B 3L3OC 3PWVB 1AHWC 2OPCA 3RWJB 1JXJA 1UENA 2GEEA 3S97C 4CSTA 5F88B 1HKLH 2BINA 5JOPD 3DHMA 5I1HH 3ZT6A 2XXCB 5G5DA 2MNWA 3IFLH 5KVEE 3QZMA 1OGAB 5KVEL 3P9WB 1CMOA 3JXAA 5D8JL 3IDIB 4DERA 3KPSE 3MOBH 1QEWA 4C54A 3WIHA 1A64A 4NHCL 3SYAA 5HYJB 3U1SH 3SBWC 2DQHH 5ECGA 4JAMB 2YQGA 2YJQA 2ZCKH 1WIPA 4Y1AB 5EC2B 1QSVA 4X7SH 2Y2WA 5LG6A 4EXPX 5EZOL 3WJJC 3CZSA 1P6WA 3QW9A 2XY2A 4ZMNA 4Z7WB 4L23A 5KG9A 3RX9A 1PTZA 5EORL 3O11B 2EEAA 3MLVL 3BYTA 3RY5A 1KXQA 3Q05A 3SDCD 1D7CA 4WVRA 2FNWA 1AHWB 3RBSA 4DGYL 4QHKJ 1PIFA 2QQKL 3FCSA 2R2BB 1VF5C 1FO0H 5K93A 5D7HA 2VN7A 4Z7WE 1ZVYA 4G7SB 2DAVA 4LSUH 3HMXH 5I6XC 2HFTA 2QDVA 2V4LA 3SDDD 4PJXE 2G3MA 1NGZB 3RLSA 2BVOB 1JGUH 1ZLEA 2BHUA 4G6FB 5DF0A 4EPSA 2VDNH 3IMWA 1AP2B 4RMQA 5CINH 4ZNEE 2CWRA 2ZG3A 3MRJB 1Z7JA 4K3HA 1F13A 2D7PA 5JA9A 2AABH 2R51A 4QCIA 3MROB 1XSKA 3EF4A 2X05A 3VRIA 4UQBA 2LAAA 4G9FE 1QLEL 4J3XA 5JIHA 3MGTA 4Q9CA 2Z1KA 3Q1EA 3QDJD 3QUXD 5C07B 5JNYB 4EUPB 4GG6F 1Z9SB 1JPGA 4LLYA 3T1WA 5J3HD 2HJLB 3FSOA 1FFQA 3O2DH 1TVHA 4AMKL 2O5ZL 2DEYX 2FLBT 3DV6A 1FRGL 3CPLA 1EEQA 4Z78B 1FYHB 3EFFA 4PJ5B 3VXSA 4OD3L 3L3IB 1I8IA 5E6IB 1JHTB 3H7LA 3HBZA 4PGBB 5EFIA 5F72S 1ZMYA 4AW7A 4FQIL 5A2IH 1U8OA 1YDPB 2HVBA 3FFOA 4QPEA 3DMMA 3C5ZC 1DVUA 4NKDB 1CE6A 4YDZA 5I18H 3CSBA 3H56A 3F6IA 2J55A 2W5PA 3KPQA 1JPEA 1ZWIB 3P4MA 4K8RL 4LZKA 4MJHA 5KYWA 4DP4X 3DBSA 1AR2A 1MQKL 1P5VB 1FVEA 2C3GA 3U30B 3RVXC 4G1EB 4HKJA 1RUQH 4XNXH 1QUPA 4DP2X 5IWLA 4HIQA 2O6EA 3OKLB 3GC3A 2VDKB 3VU2A 4DVBB 3DYOA 2OMZA 3GFUA 1NDGB 1XR9B 2E76C 2FEJA 2I25N 4JANB 4Z76A 4DP1X 1RIVH 5KS9F 2MEJB 2A83A 3HZVB 2D4DA 5F1KC 4E42A 5K39A 3TWCL 5D93C 3R18A 4ZW7A 4JDEA 3K3QA 5HGDA 4XCEA 3ILEA 4OGYH 4XBMA 3LKQB 4P2OB 1TQBB 3DV4A 5H2BB 1E4XL 3MCYA 4Q9QL 3VMNA 1R34A 2PF6A 2F2HA 5KS9A 1NEZB 4KVPA 3DVNB 4RQQA 1NCCL 3C60A 1E9QA 1TT6A 2WNGA 3EIFA 4D8PB 4QMEA 1ODUA 2I27N 3KPNB 5ENWB 5C08D 5BQ7A 3A4FA 3QIBC 1UOVA 2WNKA 3D0LB 5CP3H 2VLKE 5BZZA 2JXMB 4JM2D 2Z7ZA 4X6DB 1ZANL 2DIAA 4QGYA 1BJMA 2GC7C 5LGJA 3K72B 1YEFL 3H6AA 3LN5B 1XWVA 3ISYA 4TYUA 4MA3B 2FX7H 4R26L 2V9UA 2V5SA 3UPAA 2I07A 2X42A 3RVTD 2FUQA 1BAFH 2HTLD 4AGNA 4LT7A 1EAOA 3WTXA 1SLVA 4ZSOE 1HE8A 4FZEL 5ICZA 4RCAA 1J9SA 5ISZE 5F7EL 5C92A 4L9LB 1QEXA 1UM6L 3EH3B 1NMCC 4NS0A 1AZVA 2HN7A 5EUKB 4ACTA 3O3EA 5EOQH 3MRBB 1KJ2L 1L3WA 1LEKA 1TTUA 1FNAA 4BIKA 1FYTD 1RMFH 2EIZB 2IALA 5EH1A 1FN4A 4JRYB 4XO8A 5KS9B 3CJJA 5GRJL 3RY4A 3W9EB 1HIML 5AOLA 1JV5A 4CSZA 5PCYA 3HNTH 5JPNA 1ZS8A 5TJWK 3LS4H 2R1XB 2IF7A 5FS5A 4YWGL 5KSAC 4NKOB 5E99L 1XXDC 2JKIS 2K3TA 3GWJA 3FFCE 1BFOA 5IBTL 5K39B 4AZ8B 3QSKB 3WD5L 3MRQB 1R5WA 2QZ5A 1JI1A 3P4NB 4M43H 1DJSA 2XXFA 2B20A 3QC6X 5LXGL 1KXVC 3RKDD 1FHNA 5D1QD 3B6SB 1ZT1B 2XYBA 3QCTL 3WXWH 3ABKB 3PHAA 1H6EA 1ZHLB 5I6OA 4X7DC 3PHQB 4I77L 4CC4A 1WCBA 5TE4H 4JRXD 3TF4A 5KBPA 4OM1H 1OEZW 2YAOA 1A3LL 2ZF9A 3P4OB 3TH3T 1AKJA 4ZZFA 1QQDB 3EFDL 2WQVA 1YDPA 5JYMA 2F1BA 1CXIA 3KPRE 1OP5K 2XQ0A 4FEIA 3U4EB 4Z6AT 3GZKA 1N4XH 1LK2B 1B6DA 1YJDH 2C4FU 3EAKA 1PG7H 4K7PX 4PJ5A 3VXSB 1SJMA 1WBZB 4R0LC 3VQMA 4OFQA 3CPLB 4Z78A 2AP2A 3DV6B 3CFBA 3B2PA 3H7BB 5CGBA 5C2BH 5LKNA 5FCUH 2VQUA 3IT8D 1WA0X 1JPGB 3KBFA 1OT4A 5CFHA 4QRUA 4XB7A 3K0WA 4EUPA 3N1MC 3FTWA 1F45A 5IMMA 3LKNB 4Y4FC 5JXED 2XPGB 4LP5A 1J9QA 1KT2B 4NJAH 4UV7H 7FABL 2EDJA 3RNQA 1I8KB 4NI6A 5GS1B 2IWGA 2HA1A 5KSAB 1X4XA 1INEL 2FT7A 3GYRA 1CQYA 1ZA6B 4UAOB 12E8L 4JFEE 4EZKA 3IU4L 5F1IA 3RFZB 1ZT4A 1OAUH 5KW9H 5E24E 3PDDA 2XOTA 3QUZD 3EADA 4KHTH 4ZMLA 3NZHL 1UHVA 3BZ5A 4LGPB 3CFCH 5DMJB 1NCAL 2NQCA 3LPFA 5L4FA 1S7QB 3S8WA 5EORH 5IB2B 5A3ID 4EI5B 2RJMA 1IFGA 2HRHA 1EXUB 3L3HB 3SPVA 4EIUA 4P57A 1ADQA 2DV6A 4HFUL 1MCPH 3EOAB 5J9PA 1G9EA 2VL4A 2WXQA 4KO5A 2IH3A 3V4VH 1IAKA 1MCIA 3QI9B 4G82A 4YQXL 2BNUB 2CLZA 3CVIH 3CDGB 3IDJB 3L3DA 3V55A 4NGHL 4AQ8C 3MQIA 1ZEAL 2YO3A 1XH2A 3SDDB 3N1QC 2E7CA 3L95B 4LLUB 3UTPD 3T6XA 2AK4E 3LNFA 3MODH 3V9FA 4R90H 3S5ZA 3A6OA 3H4FA 3UX9B 2WVVA 3JV4A 5C2BL 4DP8X 4B0MM 5BS0D 4X6EA 2WQUA 2IPUG 1KIRA 3ZTNL 1IO4C 4YSAA 2D7MA 1L9SA 1N2RB 1CBVH 3WOVA 4CJ1A 3IAQA 3D6GA 2VLRD 1VJSA 2J2ZB 3BIKB 3MLYL 3FKUS 4MNGA 4W1TA 3ZR5A 3BX7C 5DS2A 3CVDA 4OJFH 3NP4A 3O4OB 2QR0A 3MGAA 1FL5B 1IJNA 5D4IA 1IJ9A 2YQ2A 1ZLWK 4YK4B 3BP6A 1QSEA 4TM9A 3PU7A 2A38A 5E6RB 4K7PY 4XP9L 4DP0X 1HNFA 5I17A 1S9YB 3WFCH 5F88A 1W91A 3DOSB 3S35X 4PJBE 1PKQB 1CDYA 3TNMA 3H42H 1BX2A 1AGBB 5T5NF 3CX2A 2MKWA 3GI8L 1WT5C 3QHFH 4OLXH 4WO4C 4X5XB 5DUPL 3UAJA 3D85A 3FQTB 1FFNB 4L9DA 2FJUB 4KTDH 3TN0A 1F4XH 3RZCC 5I8KH 4UT9L 1E8WA 1B0RB 2K9UA 3S96B 4GIOA 4XMLH 5ACLA 5HI3D 1AR1C 4BFIB 5J8OA 1N7ML 3QXUA 4MAUH 5IBTH 3WMPA 5SX5K 1LEGB 3KEHA 1IGTA 1F18A 3EJYC 5C0CA 5TE6H 3TBBA 2A73B 3GIZL 3ZKNC 2RFXB 2GPZA 1VFAA 3TBCA 3QDGA 3BRGC 1BZ9A 1XSIA 2EAEA 3FTYA 3KWWB 4JVWA 4MCYA 4UTBH 4B3VA 2DQDH 2HLEB 1SMAA 3LS4L 3MLSH 2CK2A 2OSYA 3D7PA 4DGVL 2VH5L 3RWHA 3GSRA 3OJ2C 2GI0A 3VX0A 2NNXA 1E0OB 1SY6H 2BM3A 3ZKSD 1DEEA 4KTEH 3KMDA 1M2VB 2RACA 5C09E 4M6MH 4WSGA 3FQ4A 4ZUUB 5BO0D 4LEXH 3C2AH 1LLAA 5KVMC 3MRCA 3OM3B 3SE6A 5I75B 4HIHA 1LO2H 3CFUA 4GRLC 1QKZL 3CFTA 1CICD 4G2AA 1D9KD 1XF3B 2B1AL 3CPUA 4LU5L 5GJTH 3FO9A 4BWUA 2GUOB 4XPBL 4W9GC 1DANU 1N0LB 3DX8B 2QMJA 1YEFH 4J2QA 4P2RD 3GRBA 4UCFA 2FWOB 4UOZA 1K8DA 3PV6A 4M6ML 4Q6KA 5E8DH 5CD5C 4NP9A 2BOBA 1Q72H 2UXVA 4GSXA 4J1UB 2R27A 3GTTA 3P3TA 1GZPA 4NZDA 4C8XA 1YYLH 4KX8A 2PLTA 3D2UB 4YSQA 2IVFC 3MV9B 4E36A 4JM2B 3RWEB 4Q0XL 3U36B 1P7QB 3T09A 4ZO8A 1JFQL 4HCRL 3MO1A 5IMKA 2DDQL 1G7JB 1IKFH 1EJ8A 1U91A 4K2UH 4J8QA 3BD5A 2VDMB 5B1BB 5IROA 5KSVA 4L8CA 4AJWA 3ARGD 4PRNA 4GKSA 4WSJA 4PG9B 1QNZH 2HCZX 5IOPB 2R0WL 4XNMA 4QXVA 3VDCA 4ZQTA 3QQXA 3QFJA 1DJWA 3MRHA 5CJOL 3S37X 4U4BA 3KCPA 2XSKA 4PJIB 1CXHA 1QUNA 5MEPA 3D9AH 2EJ1A 3ECUA 5E2JA 1H19A 3ULAB 2NNAA 4JN2A 2RA1A 1HCFX 1KIQB 2N7SA 2VXSL 3U0PB 2AEIT 3PGCA 1L9PA 4FHKA 2WXFA 4RGMB 2AQNA 2VLJA 3HS0B 3O6FD 4H20L 3UTTA 3ZRSA 3MVSA 3EO1B 1IB5A 4MMZB 1OPGL 5EO1B 1X5KA 3KJ4B 3CC1A 3K2UH 4Y4HD 4LAQL 3AGWA 3QEQE 5TGBB 4U1MB 3PWPA 4KROB 4D9LH 4JZNA 3RNKA 2B9BA 1F8TL 2A9DA 2JK5A 1NGPH 2NW3B 4YK4C 1XGRB 2EEFA 4HH8A 2H45A 1AXSA 4LCWB 2E27H 3M1BB 3WO4C 4CVUA 3TJHD 5C97A 3VGBA 2BZDA 5DVNA 3E1ZA 3WN5B 1DEDA 1Z3RA 1O6VA 2DN7A 4JM2C 1K6QH 2OSLB 3KXFE 5GQBA 5ACMA 3T3PB 3LNDA 3FT1A 4JPVH 4QWWC 4A2LA 5EZIH 3FB8B 3FU9A 2WTRA 5C7XL 3R8BB 1AXIB 5CEXA 4BZ1H 2X3AA 1DE4B 1AQMA 2PP8A 4J23A 3CFEA 3UMTA 5DZVA 1NLBL 3WAKA 1IC4L 1JRHH 2PYEA 1GXEA 4K3EH 3QQ9C 1N6VA 2P8MA 3BW9B 1SJHA 2EDRA 3DSFH 4XCCL 3VACA 3VXRA 1NGQH 2QVKA 5D70H 2YSSB 3X12B 4LCIH 4RSYA 5JW4R 3SDAD 4R7NA 1MIEL 4XI5D 3V0WL 4RFOL 4YXLL 4QO1A 4YX2L 4BUGA 1BG9A 1NSNL 2Z91B 4D0DB 5JR1L 1IT9H 2GSGA 1MJUL 4G6JH 4JJ5A 4NN7C 5CZRA 3T4YA 3V8CA 3WNKA 4C56D 5JQIB 5GZNA 3QDAA 5BRQA 3QNFA 1S7UB 3GNML 3KH4A 1TYJA 4PJAB 2ICEA 1E6JH 3EJTA 3RHWK 1H3TA 1M6OA 5KN5A 5TF1H 2BERA 3WIFA 4DGUA 4NZRH 4GG6E 5EU3A 5MI0B 1JGVH 3V0WH 5I1LB 3ARFD 2NNRA 4MAUL 1NGPL 2ATKA 3TNNB 2A99A 2UYLA 1EERB 3D39E 1ZHNB 1X44A 1XSJA 3ML8A 3EBHA 2R56H 5GZOA 4MMZC 3HJEA 1NBVH 5DRNB 5I6LA 4NOBA 4WFFD 4Z0BL 4NFCA 1K5WA 1HQ4B 4JPIB 4O51B 1L3NA 3RKDC 5FWQA 3IJHB 3T0EE 5BJTB 1EAQA 3BUDA 2ENYA 4IBLT 4IK7A 5AL0A 1CG9B 2EDEA 5HHXL 3QEHA 3D3VA 4ZRGA 5TDNA 1AR1B 4MXWH 2HT4C 3GXMA 1N8ZB 3OAUH 5IB4B 4L3EA 1XF2B 3B9VA 1TETL 1A6ZB 2DBLL 2QSCL 1RK7A 2YPLD 2C9RA 4KTGA 4XPTH 1AS6A 3VFMA 1DCLA 1XZ0A 3RL1B 2BRRL 4BSWA 2FH8A 1U8NA 4I5BB 4R7LA 4WEMB 4ZXBC 2GITA 4W68A 4I1NB 3P9LA 4GW1B 4LCCB 2WLYA 1MI5B 3LDBB 2EH7L 4HP5A 3WNLA 3LXCA 1K5NB 3FAXA 2OX5B 5EEVA 4CNIA 1DLHA 5HHMD 3BP5A 5DRXB 2ZX8A 2XIIA 1NIAA 1JI2A 4Z95H 3HLAA 5C0RH 1YYML 3BUIA 4Y2DA 4HS3B 1WK0A 4FS0A 1ID2A 4FFYA 3QARA 2K45A 4RMBA 4NN5C 4GFXA 1MLBB 2WP3T 2ICWJ 3ROOA 3UTSD 1C7SA 5A2KH 4A2FA 1Q9KB 1J8RA 3HMWH 1YEJH 5I8EA 3VFVB 1J8HE 1OAZH 3DVGA 1AXTH 4UAHA 4J28A 1OD9A 2H1PL 1T1WA 2VITA 2R7EB 1SOQA 3GRWL 4FLRA 5FUCC 2VR7A 3AB0C 3RWDB 3HI5L 3NIFF 1Z5LB 3L81A 2Z92B 1G7PB 4Y5XC 3TT3H 4U6YB 3ATDA 5EWIH 1KNOB 4JFUA 3SDXF 25C8L 1S7RA 4MS8D 1YEJL 1RZKC 4OF0A 1NZRA 2FL5B 3MUUA 2DYPD 1KWKA 4S1QL 4WWID 2WQXA 5AKSA 3BZ4B 1G7PA 2EO7A 3O0RH 4TUJB 2BNRE 1EZLA 1IAII 3SB3A 1NAKL 2PO6A 2CRIA 4WFGE 1HWWA 3BYYA 4UU9A 2GAZA 4HVBA 4ZZKA 5LDUA 1JZ4A 4HIXL 4ZW6A 4WW2A 3ZJAA 1ULVA 2NY1C 5D2NA 4PV1C 3L2LA 1GC1H 3LN9A 1A7PH 4I0CC 1DQKA 3EJUA 1DVQA 43C9B 4NP4L 2UXTA 1V10A 1L9TA 1OK0A 1M7DA 1YAIA 2CJUH 5CZVL 4LIQL 5FM5O 3ROOB 2N01B 1MLBA 4BWTA 1AKJD 5I1CL 4PJ7F 3GUFA 1T04B 1T6BX 4XP1H 4ZO6A 5GZNC 1GRWA 3IDYC 3G6DH 3T0EB 5F7NC 2DJMA 2P24A 3ARWA 1FUNA 1NUFA 3PE9A 4PMEA 3ZMEA 1XIWD 3BKJH 3C60D 3CK0H 1WBXA 3PDGA 3FCUB 3DBXA 4LLDA 2DEXX 5C08A 3DK0A 1LMKA 3U1SL 2A74B 3ASNB 4M1DH 1MWAH 2GITB 2A1WH 4HHAA 1U8NB 2K8MA 3G5XA 4N22A 2WHVA 1XF5B 1MCWW 4Y16D 1MN4A 3W3BA 4TULL 2FQEA 3T2OA 1N0XL 2C9PA 4ZTOL 5AAWA 4WUKL 3T2NL 1K4CA 2OXGA 4P4KB 1KZYA 4NQCD 1OB1B 2XX0A 1CG9A 5HI3C 1FNLA 2VERA 4GNKB 3MU3A 4OUOA 3NIGF 1HDMB 2PWEA 3ARRA 2MOQA 4L4TE 5E2TH 1WAAA 2UXFA 2ZOWA 3WE6B 2QKSA 1NBYA 4PQXA 2BSTA 1WHOA 1ZVSA 4KMQA 1U30A 3NZ8A 1WAAE 4AIXA 4HULB 2F7OA 1ZLVK 4HOXA 4LSRH 4OU3A 4HFUH 1J86A 3NCXA 3UZQB 4MAYA 5TH2B 3IFOA 1G6RL 3WFEH 3F00A 4N4YB 1OWRM 2HJKB 1G1KA 3DVFA 4IMLA 3HNSL 4OCNC 3FFCB 2Y9RT 5JW5B 2WQRA 3LV3A 1SMDA 4MD0A 5D7LB 4R90L 1S7VB 2PXYC 2EDDA 1U8PA 4PJBB 4YDMA 4JZJC 5A6LA 1MZZA 3EO9H 1IQWH 3ESMA 4GSRA 5BS0A 3X12A 3C12A 2B77A 3FPYA 2JKLA 5D96C 4PTUB 2W0FA 1SJHB 4MJIA 1QFHA 1XV8A 5FAAA 4XWGH 4QNPE 1CFSB 4P9HH 1GCYA 4OCSH 2LU7A 2MNUA 1WRFA 5KSUB 1MIEH 1CLVA 3V5HB 2W07B 1A7NH 1SXBA 1XEUA 1Y1UA 2RQEA 4N0YL 5HHOE 2LTQC 1CVRA 1DL7L 1SJEB 2ENSA 3B1TA 3DX4A 5BW7C 5D7EA 1YVLA 3WJLC 1WIOA 4HAGA 5BZDA 1FORL 2PW2A 3DKHA 2KS0A 4PJEB 3ZIMA 1OAUL 3UZVA 5KW9L 1OSEA 5DHVA 5FDYA 4XP6L 2R29H 1BXVA 5ISZD 1WFMA 1XGRA 3ZYOA 2OMNA 5EF0A 3MHZA 2NY0D 4L4TA 3RNKB 2A5UA 4O9HH 4MJ2A 3N40P 2PP7A 2PN5A 1PSKH 3ZTJH 4ES8A 4QRPD 4PRHA 4KJPC 4I88A 4ECNA 5C0CD 5AVXB 4NQED 3ETBF 1DBKH 3RU8L 1NBVL 5DR5H 5GGVL 1NGYB 2D3LA 1AZBA 1CL7I 1RU9H 3CV5A 3FYEB 3EBGA 1E4WL 3L7EB 2NNAB 2XWJA 1E4WH 1V3MA 3E8VA 4AYEC 2CDGA 4BJLA 3WD5H 1EIBA 1KTDA 2BY3A 4FQJH 1MCSA 3O2DA 2ZKHH 4G6MH 4XNQB 4ZW5A 5ITBL 1MCOH 5HPMB 2DTSA 1E50A 2GABA 3BQUA 3EJZD 5H8DA 3T1FA 4X9HA 3QQ3A 5BZXA 5FFLA 1W80A 4EI5C 3F12A 5D7LD 4BYHA 3MLXL 2VDKL 4QWWD 5C09A 2X4NB 3CD4A 2VM4A 3VG0L 4F58L 1SLWA 3P2DA 4GRLB 3MO1B 1NOAA 2QPSA 4XP9H 3QIUB 1HHHA 2AJVL 2FBRA 4F7KA 4XN9A 1XB6A 4TMPA 4YDIL 4W93A 4Y1SA 3FU0A 3ABLB 1CYXA 3ULUE 3QA3A 4FZEH 4HV8A 3S5YA 2E9WA 3QIUC 1QAWA 3O6LL 4N2GA 5IBUG 1QX1A 1T20B 1C16A 4IDLA 4OZFH 4BH8A 3I75A 4PJIF 4RDQF 1G7IB 3PIQB 2GQHA 5ACZB 3IRZA 5CO1A 3CN0A 1L7IL 4DZ8A 1B88A 1MDTA 5IROD 3KYNA 2GUOA 2XTJB 4Z7OE 5JPNC 4PP2B 4ABWA 5CU9A 1ORSA 2PCFB 3JWNE 4LESA 5GRWA 1OSPL 4FQQB 5LXVA 3ULVF 2WIMA 5KVDL 3VXTA 3HE7C 2D2OA 4DZBA 1P53A 3VWJA 1GJUA 4Z7UB 4RRPA 3RVXD 3KPMA 3P4LA 1UKSA 3ARFC 1KCVH 4HBQA 3QJUB 2EABA 4WO4B 4EOWH 3BDYL 4WU7A 4PR5B 1LE9B 4J4PC 2Z8SA 1G0YR 4HS8L 1H0DB 4HJ0C 3QS2A 3QDGB 2ZWSA 3WKMH 3CUPB 4PJIE 3GMPB 5DWPA 5EOCL 4EUPG 3QIWB 3EBIA 1HSAB 5EU6B 4GH7B 4PVBA 4BQ9A 1IGTB 3HAEA 3MSPA 4BQ6A 4FG6D 4GSUA 3WS3B 1N6UA 4WJ5B 5HBBA 4FJ6A 4OM1L 1U3ZA 2EE2A 1JZHA 5ICYB 3S96A 2JJVA 1L5GB 3GJEB 3WDJA 3H9ZA 5LGHH 4HJGA 4F9LC 4XCYA 3D85B 3SE4A 3TBSB 4ETQB 1P4IL 4CMHC 3VQ2C 3QJZA 1QR1B 1S8DA 1AGBA 2PWHA 5D72L 3G6JE 5I1HL 3ZE0E 5IHHA 4E2OA 3N44F 5MEQA 3I6KA 4IEFB 5E51A 1JWUA 4HJ1A 3CBKB 5AB2A 5T1LD 3KL5A 1D9KA 2QR0B 4MXVF 4C4UA 4AKOA 2EIEA 3P0YL 4JFSA 4ELMB 1KIRB 1HNYA 3WMQA 4EKJA 2WVVB 2H0PA 5KANI 3OKMA 1Z5YD 3NESA 1AO7B 4XO5A 3FFDB 2H41A 2UZIL 1KJVA 5T3ZH 4OM0L 1I1FB 5IW1A 2XVGA 4JPKH 2YEQA 3WTWA 3ISRA 3VFTB 1OSYA 1NFAA 3JV6A 4WI7A 4P2QB 3IDJA 3L4WA 3QORC 4LEBA 2FGWH 2FNBA 3IN0A 3MRRA 2IH3B 2UVFA 1NCTA 3ESVF 4MBRA 2P5WE 2YEVB 4D8OA 4OV5B 4KI5E 4P57B 2YMXH 3MLPA 4R2GB 1TVBB 4D0CA 3T8XA 2HLAB 2G5RA 5TTRA 5IB2A 2PNDA 3K80A 3O9WA 3QFJE 1S7QA 3DSNA 1U95A 1F3JA 3QXDA 3ZMNA 3SGDH 3B5HA 4OF5A 4NRZB 5E1AB 2GHWB 2WQAA 1IT9L 4IYKA 4K94L 1A4BA 4XMPL 5D1ZA 5DTFB 5HGBA 1UH3A 4LPTA 3K71A 3MRDB 4BRJA 1JNLL 1TXKA 2ESVB 3AY4C 2FO1A 1T3FA 2I24N 3D52A 4G9DB 2CSPA 3ETTA 4BKLB 2CK0H 5HJ3A 1BD2B 1UQSA 2YFOA 4N9GB 3MJ7A 3QCVH 1URIA 4UQAA 1I8KA 3V0AC 5IMLA 1RP9A 2CLRA 2HWZH 2XVLA 3CHPA 3F7VA 3OAWA 1S5IL 1ANUA 2CPCA 4HMEA 4Y4HA 1NLBH 2WZ6A 3QPKA 2XNAA 4AYFA 2G9KA 2ATAA 4Y16B 2P28B 4XPTL 1A6AA 2IDCA 4PV8A 1BAFL 4JE0A 2PPEA 2IGFL 4KI5C 5PAZA 3ARED 1YMMB 3PQYD 4YIQA 4K23L 4TNWF 1FVDB 4HC1L 3TO4B 4TVPD 3TONA 2OW7A 5SX4I 2F5BL 4EMZA 4CVXA 5GGQL 4ZUVB 3TOPA 4YSRA 4WEBL 4DTGL 5FV2A 3OX8B 4YXKH 3TP4A 3ZZQA 2R9HD 3GIZH 1FLTX 3VFSA 4CC4C 4AUYA 4YOKA 4HHGA 3V0EA 3KCWA 1QQDA 5JHLH 1X5IA 1BXXA 5IFHL 3NFPA 5DUBB 1A5FH 3RB5A 1RK1B 1BQKA 2NNCA 1J11A 3VW3H 1JGVL 5HDBE 2ITDA 3KHQA 5IMOA 1S7SB 3K8LA 5F71A 4FJYA 2VZ1A 4TQEH 5I30L 5FYLD 4IRJA 3RJOA 4QRTA 2H6PB 4YPGB 5AD0B 5IM7A 4PUBL 2F7IA 4JFOA 4Y2NA 1D5BB 4PUBH 1HOCB 4U3SA 1Y07A 3T0WA 4YBLB 43CAB 4GJTB 3RZCD 1PJWA 1EVTC 4LCWE 2P5ED 3HZKA 3DJRA 4Z7AA 4A7SA 1ZGLP 4AVHA 3SBPA 4NKOA 4HH9A 3RZWA 3LIZL 3X1BA 5JPNB 2WANA 1ZPUA 1RUAH 2XBZA 1UT9A 1JV5B 1XF4B 2E4FA 3MV01 3L4CA 5ICXB 1UFGA 4EN3C 3K2MC 1MNNA 4JRYA 2RQ8A 4HIXH 4L8BA 1SUJA 2LV4A 1LE5A 4OZIE 5DWUL 2Y6SC 3M17B 2DKUA 1FE8H 1JDDA 1U42A 2P5EE 5IESH 3QWRA 4XNUH 5T1MB 3QEUA 3ARDB 3F7YB 4JFED 4NAMA 4AYID 1BFTA 1WE5A 2E27L 3BRFA 1TTCA 2AVGA 4DEUA 1UWFA 4X5RA 5HVFB 2VGLM 3DJSA 2EKSB 3PS6A 1HZKA 4GRLD 3VQLA 1KMGA 3O2WH 3QPXL 1RZ8A 3V6ZA 1KCSH 1AD9B 1PQZA 2Y72A 2W9DH 3P1VA 1WFIA 1G1OA 4FE9A 5I26A 4NQXA 3PWUB 1LXMA 3BH9A 5DVPA 4Y19A 3I2CL 1KCRL 2QGEA 3DX0A 2DH3A 1JRHL 1U4FA 1S5HB 3IKCA 4X80L 2DQEL 3TL5A 1KENH 3MFGB 1YMME 2Z64C 3HG1B 1KJ2A 2DQTH 2R59A 3BH8A 3KL0A 4ZOAA 5CJQL 3DX6B 4FF9A 1S7XA 4MVBC 3BKCL 3C6LA 4JHAL 3D9AL 4WEEA 5JZ7C 1RJLB 4F7CB 1GC1C 3NFSL 1OP3K 5HGDB 4BELD 2DQGH 3KLSA 5A16B 4R3SB 4BE5A 1QW8A 1BV8A 3TBWB 3OKYA 4KWUA 3QR1A 3Q2CA 2EILB 4I13B 5DO8A 1OPGH 4NSKA 4N0UB 1AKPA 3VTAA 1N0XH 4L5FH 4QHLA 5AZEL 4U0RC 1PBYA 3QXTA 2LLLA 3SE8H 4UUJA 5FYJD 4A67A 3W57A 4DGIL 5BW7A 1DQDH 4HAKA 2C9UA 4PWHA 5EU6D 1VPOH 2BS9A 3O6FC 3VI4A 5GGSY 3VO0A 3C5SA 3GBNH 5IKCA 4LNVA 5HHNB 1Q9WA 4V2CB 2EXWC 3OQRA 4OB5L 4G43A 1KTLA 1MAJA 5AB1A 1SJXA 3MOBL 3N9GH 1VSCA 2MFNA 2N7BA 5CZVH 5I0DA 2CQVA 1TQCB 2PO6D 4AUJA 1W72A 5EN3A 4PJ6A 3ZTNH 3OAYK 3FUDA 5D7KE 3FT2A 4ZX5A 2EKJA 3NSJA 4NQTA 1MW1A 5EZJA 2NY4B 5K9QG 2HJLA 4DK6A 4P9HL 2BP0A 3WEXB 5GGVY 3E9UA 3EOYG 2NY2B 3GSQA 4B9IA 3G5VB 4Y89A 5D7SH 5HSFA 4WKXA 5HYSB 3L5XL 3R0MA 2PXYA 4HMDA 4J2XA 3APDA 5T3XD 2M1KA 4WIQA 1N67A 3MRNB 2X6AA 4JR9H 4LDLB 1UUNA 1NSNH 3PAZA 4NJ9L 4ZT1A 1OE2A 1MVUB 1TNNA 4YHIB 2HP4A 3AMLA 4R7DA 3UYRL 4MCZA 2AHIA 4JG0H 2E6QA 5FKAA 3RILA 1JP5A 1OM3L 4JG0L 5HHQB 2VW6A 4U0RB 1PAZA 3F8UB 5EUOF 1AXTL 1P2CA 2WD0A 3BAWA 1J5HA 3U2SA 1R75A 3LOWA 1PZBA 1T6VN 2BW4A 3IU4H 1DQQA 3MJ6A 3DX2A 1XCTB 3V4PB 3WL9A 2LU4A 1MF2L 4HLZH 5K9OA 1MFCH 1I8LC 2EYTB 2NXYD 3L1GA 3A24A 4B97A 4KXZI 1AHWA 5DVMA 1QABA 4G42B 5MERB 3VVWA 3DRQB 3VB9A 2KQNA 1TIUA 4NOFA 2NY3C 4ANXA 4NPYB 2PTVA 4P2OC 1NC4B 1U3HB 2ITEA 5E56A 1ORQA 1ONQA 4FQJL 4UDTB 4BCXA 4W9ZA 4Y1AD 3HB3C 3VD9A 4RX4D 2VN3A 1U8JB 4W6WB 1GOHA 4C83B 5CKGA 1GH7A 3P0GB 4TQPA 3QAZC 4J27A 2AEQH 3QCUH 5DI8A 4UM9A 3WUWB 2ESVD 5ERWB 4HSAC 2F68X 1D5ZB 5I2IA 4KZDL 1RY7B 4Z7OB 3H9SD 4TQHA 4NT6A 1N6QH 2CO6A 5G5DB 5T3XH 2VC2H 2WC7A 3RL2B 1EDQA 2GUYA 4BHUA 4CN4A 5CGYD 3AREB 5D1XA 4H8WC 2J8OA 4TLUA 3TN0D 2ZTBA 5CIPB 3NJKA 2AQQA 3EUUA 4TRPH 2WBKA 4UQ2B 5IK3B 3SDAC 2MKLC 2B5IC 1JXKA 2NX5D 3T3PE 1O7VA 2D7TL 4GW5A 4DN3L 4HETA 4U3CA 1DL7H 4KZDH 5EUOB 3CBRA 2YLHA 4EOWL 1VCAA 1UYWH 4A7UA 4ZMTA 2J6WA 4PW9A 5DO2D 1WCQA 3ZDZB 4ADJA 4KPHL 1QFOA 2B3IA 2Q3ZA 4PV9A 4PY8J 5I1GH 2WXOA 3KYKL 5FYKL 3L8QA 3BDBA 1THCA 4LHJB 5EIQA 4ANUA 3UTPE 1EHLH 1HHIB 1KG0B 3I9IA 3T5WA 2XNAB 3D4GA 1M7XA 1YEWA 2X12A 4UIMA 3HJ0A 1XGQB 2FO4A 4O9HL 2CLRB 2HJFB 2AK4B 1NPNA 1XCQB 3QDJB 5GGRA 1BD2A 1N26A 1UQSB 3BSZL 5T1LB 1ND0B 1JSYA 5ETUA 2ZWZA 4GMSL 4FULA 1CLYL 2EIJB 1NMBL 3H2QA 4DFHA 1TTGA 2V7NA 2NZ9D 1OP5H 3WV0A 5K9QI 1E8ZA 1A8JH 5D1ZB 2X41A 4KMTL 3FRUA 4H0GA 3QRBA 1E7VA 3RWFB 3BT2H 4MS8C 4FYQA 4QRRE 1U95B 3RWGA 3QZWA 1TZGL 3T8XB 1F4AA 3KPOA 5L4IA 5DD3H 4LL4A 4GRWF 2L8AA 2DS4A 3JBG7 3B9KC 1PG7W 2P26A 3MUHL 1J5OL 4MMXA 4XGZA 3ZGHA 1ZT7A 4GMSH 1ZSHA 3AREC 4FKEA 4HT1H 3LVTA 2GVYA 3PP4H 4AV5A 4FQ1H 2VABA 2YAPA 4UQ9A 4XMTA 1XL6A 3FQ2A 4TUUA 1AZZC 1GA2A 1QFWI 4JLRA 4RBPK 5D7SL 5F6IC 1KJVB 4J39A 2DQ6A 4ZX3A 5FR3A 1IBDA 1QSZA 4M1GH 1YO4A 4ZMOA 1EAJA 2G3NA 3QEGH 3RGVD 4Z77A 2NSQA 3G08B 5ITFA 1P84K 1CI3M 2GY7B 2R9HC 3X1EA 5I1GL 4LSPL 4LL9A 2O61B 4CMHB 3RWCB 3K46A 3UTZA 2CGYA 3MPCA 4W6YB 3K2KA 4MD5B 2WQWA 3TEZA 1SY6A 4O02L 3BDXA 1WO2A 3MLVH 4CSSA 3MJ8A 1YEIH 3NDYE 1YJDL 4X7TB 3KWXA 5C0IA 1IILE 3DROB 5AZUA 2UZIH 3LZRA 2DWTA 2VDLH 2HAZA 1FIGH 4HKXA 4UB0H 2XWEA 4IU2A 4KKNA 3A67L 5MEQB 3G9AB 5BV7B 4CN6A 1TLMA 2X88A 4TTGA 4M5ZH 3ARFB 4M7JL 4NPJA 5IB5A 4ETQA 1BD2E 2K9FB 5IVZA 4L3EE 2KZ1B 3TCLA 4HJGB 3GXDA 1MQKH 1RSFA 4FFYL 1I1AA 4NRYA 3GJEA 4UZUA 1YG9A 4RAVB 5F7WC 2DWEB 4E9XA 4WTXA 1RUQL 4OF6A 4XNXL 2WB7A 1YSOA 4YZFF 3VD2A 3WJMB 1M1XB 3KXFA 4DW2L 4F57H 3OZKA 5CIPH 1FSKC 1RZFH 3V52H 3IS1X 2ZCZA 3LQAH 1MKFA 5EU6A 3QIWA 4G6KL 1NIFA 3CXFA 1OGAE 4MXQC 4NM4L 5FIEA 3WY4A 5B3NA 2V3FA 3WKQA 3P3RA 1XCWA 2LLGA 4P23C 3NA9H 4Y5YA 3CVHB 2CJTA 3NRQA 1KBBA 4DWHA 2XQBL 3NVQA 4KDTC 2ZXEB 3IJ7A 4XBEL 5G2NA 5E4AA 2H9GB 3PLYA 4F2FA 2D31A 3PF2A 4XVJH 2EUWA 3MTXA 1G7LA 4D9RD 3SKJL 5FLVA 5F6HI 1EXGA 4YHKH 3WBDA 3O2DL 1FIEA 1IAOA 3TV8A 4IOFD 3IN2A 4EKXA 1G43A 1IFHH 2IFFL 4UOJA 5C0AD 1BMZA 1RIHH 2BZ7A 2HG0A 3GQFA 3BEVA 1A7NL 1FP5A 4N0YH 2HPOA 3NOIA 5IIEB 7PAZA 3KAAA 2JFCA 2GJPA 3FQXB 1QLFB 4KRLB 4U1KA 4PJHE 3E6HB 4L3CB 4M9OA 1C16B 5GGTA 5IIEA 1NPUA 1TQUA 3QWOA 5FYLH 5EU7C 1T5WB 3PP3H 4D9QD 1U92B 4XMKH 3GBEA 1F4YL 4RFEA 1BIIB 4JHVA 3KVQA 3DI3B 4O2EA 3VYPA 4AV0A 1SVZA 1LP9B 1WZAA 1I7ZA 4H0LC 5CZXC 2G2RB 1KYAA 3RI5K 4OVVA 1WD9A 2H9GA 4Y9FA 1O6TA 3O81A 3UACA 1ZHKB 2HFFA 4PJCF 5D2LB 5BZWA 2XKSA 4BA8A 2QGCA 3LRSA 2OJZH 1XEDA 2WQ8A 1HXYB 4FP8L 5IZ7A 2AXGA 3LCYA 1AQKL 4RWYH 5IEHA 4PIBA 3BQUB 3VGHA 5E5MB 5F7BA 1YNTB 1Y7VA 4RGNE 1NM4A 3RGBA 1B0GA 4GAJH 1MFNA 3NJXA 1KIUA 1UACH 4S10A 3GLAA 1U8QB 1H3XA 4B3EA 3CXDL 5E94B 3JUYA 4X4ME 3BWSA 4H7VA 3QUZA 4LMQE 1CIUA 4WI0A 5AUMB 5LNEA 1Y18B 1AMYA 4A7VA 1W0VB 2V6HA 1ICTA 4UOW0 1XSOA 3DA0A 2A77L 4P59L 4AYBA 1MCOL 2EDFA 2XG4A 2E9JA 4RAVA 1KEGL 5EB9A 3ZLQC 5E8NB 3NQIA 2DJUA 3SO3B 1F00I 2YK1H 3ZO9A 4YS4A 3QJFB 4GUPB 3QCTH 4UM9D 1H3UA 5IVZB 1EDHA 3MNVB 2CRYA 3U79A 1REIA 2C34A 1GGBH 1NFDF 2CJUL 3V5DB 3MBWA 4MDIA 3FBQA 5GZOC 2H2SC 1HEZA 1EFQA 2LVEA 1DQTA 4M00A 1VESA 2ORBH 4PI2A 1I85A 1BIHA 3IMVA 1WITA 4QRQB 5D1XD 2Q76B 4RAUB 4WY7H 3BEWB 2MWCA 4JM4H 5F7KC 1WFNA 1HK6A 2YD6A 1NFIB 2W38A 1CE1H 3QULB 5I1KL 3UJIH 2DTMH 1D6EA 1AVAA 3EYVA 3FUIA 3ZOAA 1SLUA 3IRPX 1L7IH 4JGUA 3D48R 4U1JB 4PJCB 2K7QA 4NQCB 3RJDA 3VYNA 4Q52A 4FYTA 3B7SA 3X1FA 2W0FB 2WMPA 1NFDE 1QRNA 1TQCC 2B08A 3L7FB 2Y7SA 3RUGF 2ZJSL 4IOIB 4JZOA 4MNQB 4MMXB 1PW3A 5F9AC 3IGLA 3KPPA 1GGIH 5B38G 3QH3B 5D7JB 4PB9H 4KKPA 5BVPH 2WXJA 3VX1A 1QNIA 3GMQA 4JDTH 4S2SB 3PUCA 2E3VA 2Y69B 3FSWA 1ROWA 4IMLB 2H3KA 3KJ6L 1D7DA 3RWFA 1II4E 1Y1DA 4ANWA 3F3HA 4ZUTA 3RUGA 2OJEA 4GO8A 3KGRA 5BS0E 3LB6D 5JIQA 1JK8B 5DC4B 1JS4A 2NY3D 1LP9E 3N50A 4Z9KB 4M61B 4BV1A 1GYCA 2Q3AA 1MWAA 1A9VA 3KGTA 4PM1A 4XP5H 5JQ6L 4LSSH 3C5ZB 4JCLA 2VIRB 3AWEA 3L3OB 3HHRB 4OCRL 4F7TB 4O2FB 2O6FA 2HJFA 1UWYA 3CCHA 3CQQA 2RCSL 4EZJA 1YZZA 3ESNA 4RLDA 4OVUA 1HDMA 4QTFA 4MDJB 3OB8A 1HJBC 4L48A 4Y5VC 4R8WL 1N4XL 4F15C 4ODTH 2GBTA 2HVKA 1DDHA 4P4KA 4JRYD 4XC1H 3IMRA 4JR9L 3QJHA 3KWTA 3DJZA 3IB4A 4AMWA 5AB0A 1RK0B 4HOMA 4KNQA 1E2WA 1BAWA 3PQYE 2XG5B 5DMIL 4XPHL 3QI9D 2CM6A 1HU8A 2R29L 4ZODA 2DPKA 4OJFL 3W9DA 2EDNA 3NCBB 1PU0A 5CIPA 3FH7A 5KVEH 1VIWA 5JOPE 2XN9E 4LLQB 3K74B 2BVYA 3AACA 5MI0C 4EDWL 2YKLH 4XPAH 5E7BA 1RXLA 2X89D 1IU1A 3QEGL 1OZUA 5CJXA 1MAMH 2FQGA 4NNPH 4OGZA 3V4PH 1FF5A 3SDYH 4UQDA 1EJOH 4EXKA 2FVNA 5I8KL 4OGAC 5KBLA 3QFDA 4UM9B 1F2XK 1T04A 3OQ3B 1JL8A 4IBTA 5GISL 4PJDA 3FB5A 1G4MA 2OXHB 5KSAD 2JIXA 4L3FA 3I85A 1C5CH 4MXWL 4WTZA 3CXDH 4MDRA 3ABMB 4YGAB 1EV2E 3KXFD 3OHXB 4U6TA 3SGKA 3APNA 3LEXA 1ORQB 2W91A 2X4UA 4IBSA 2VO5A 4WTQA 2YR3A 1ZLVH 2GAZB 1ADQL 2V8MA 2NZ9C 1QVOB 1AANA 4X0NA 2OQJB 1WC7A 1HL5A 1X5JA 2AV1B 2HZHA 3MRKA 3QUYD 4IKKA 4L0YA 4FA6A 4JY6A 1MXGA 1EAPB 4U33A 3VNYA 3EW3B 2EYTA 4AYMC 3CH1B 2JCCA 4NQVB 3D3VD 4Y2LA 2JELL 1DBMH 3N44B 2PYFA 2XI9A 3D34A 4LSRL 5GJSH 4I2XA 5L8KB 2D3VA 3O45B 4AQ1B 1XGTB 5HHQA 4XMPH 4TPRL 1Z5LA 4UT6A 3RWDA 5EO0A 5FKAB 1A21A 3PYCA 5AW0B 2VB5A 3NGBC 2JB6B 3O8XA 3NA9L 4R7DB 1EPFA 1T1ZA 5HYQB 4MA8H 3VI4E 2XRAH 1BHGA 1G9ML 1MVUA 1FYTE 3US9A 2IWKA 4YPJA 1Z32X 3EDEA 3OXSB 3WIHL 4GKZA 2Y7LA 5I23A 1EHXA 3MRPA 1GJWA 4FFWD 5ILTH 3V4VB 1X9LA 1A0QH 4HS3A 3A6BL 1BJ8A 3RTLA 2V5TA 1WZLA 3GSQB 3ARBB 1VAHA 4JDVA 2BP0B 4UT9H 5GRZA 3WEXA 3BZEA 2AERT 4M6OL 4OFYA 5E1HB 2J5LC 3V79C 5DQJA 2WO3B 1TEFA 2TRHA 2ITCA 3BIAX 2A6DA 5D9SB 3GMMA 4TUOB 4F1ZA 1CGTA 2XPZA 2MCPL 1LILA 3MXWH 3P9LB 4PJGA 1QWHA 4Z7NB 1AFVL 1NCNA 2Z8RA 2ZUSA 3CH8A 1KB5L 1O5PA 3MOAH 4WO4D 4Z95L 1BMGA 3RL1A 1WFTA 1SQMA 1AGCA 1CFMA 1EVUA 5HHNA 3TT1L 4WNJA 4KK5C 5DHYA 2JJUA 3QAQA 3C5SB 4JL2A 4TLSA 2JTDA 1JHLH 5LB1A 4DOHB 5IKCB 3V4UH 4JJOA 3V4UL 1ZSDA 2F7PA 1IGYB 2F6AA 2XXGA 1EA9C 4UUJB 5AW2B 1LDPL 5SWSE 5ABDE 2AJSL 3UH8A 3V0GA 1JWMB 4AXWA 4IOSA 3AB0B 5IT2L 1OSZB 1BM7A 1KB5H 3KYMA 1KEGH 5CS7A 4P23D 3GSUB 4JM2F 2OR9H 2MQGA 5F7HA 2I5YL 4P5KB 4KO7A 2IV8A 3LEYH 5C09D 3VFGH 4CDHA 5KZCB 2B59A 4URKA 2J20A 2ZPKL 2KZWA 3VI3F 4CC0A 1N3NA 4N9OB 3I2CH 4J6IA 3HS8A 2P46B 4ABUA 2E6JA 2CUMA 2BIIA 4JDZA 3II3A 4F7CA 3MLRH 4PJAA 3KGUA 1I7UA 2QVMA 1LO2L 4OKDA 1DVYA 3U6RA 1NAMH 5EU5B 3MJWA 1RCYA 5DGRA 3GSOA 4HU2A 3NAAL 4D0DA 4ENZA 4YMPA 2YPLA 3N1PC 1IKFL 1XGYL 4ISVA 2D0FA 1OAZL 4QO1B 1JFQH 3F04A 1I9IL 4NO3A 4Y19B 3PWUA 4W6XB 2DL2A 3OVUB 1MDAA 3CZKA 4IDJH 2AJ3B 1AD9A 3QISA 3SQRA 3KPSA 4H8HA 1TJGH 4WW2C 2FGZA 1PGRB 4EAEA 1QWUA 4OLUH 1JVLA 1RPUA 3CFEB 3MCKA 2EDYA 3UABA 1AR1D 4YBHA 4FJZA 2WTRB 3MYJA 4PI0A 5C8JB 1AQDA 4DW2H 1JBJA 1P0SE 5CSGA 3QE5A 2TSAA 4OCLC 2G4EA 4XNAA 3WFEL 3JTBA 4BSJA 5LBSA 4Z5RB 3B9AA 3DTXB 4PRPB 1TSHA 4XXDA 2FX8L 1USZA 5ECJE 5B1JC 1B2YA 1QP1A 2ZAGA 3LRLA 3I6LD 2CKNA 3E3QC 2HB0A 4CN1A 4XZUB 5T1KA 4XBEH 4PRBB 2ZUYA 2VJ8A 5F1NA 3SE8L 4HLEA 1UH4A 4X9IA 2DIJA 3FUHA 3QEQD 3NEOA 2J25A 3UTTB 4NM4H 5I5IA 2VLJB 1LGVA 1TJHL 4RVBA 1OE3A 5C07D 3NBNA 1OOAA 5C0EB 2QEJA 5A2JH 1I1CA 3UBFA 3ZRFC 4OUUB 5IM7B 3T0XA 1UD5A 4Y1AE 1NBZA 3QDMA 4XB8A 1IC7L 5SWZA 3WJJA 3LPGA 3FW6A 2BP3A 2A1WL 3KE0A 1INDL 5D1XC 5LBGA 2C3XA 2ITDB 4X5PA 2YC1A 5D96B 3OC5A 4PWGA 4PG9A 1RK1A 1JZ5A 4Y8DC 2Q10A 1G9NH 2M2DA 2HVJA 5DUBA 3SE3C 5KS9E 5L2KD 3U0WL 4K5OA 3V4LA 2HTKD 5KSVB 4PJ7A 1G7JA 2P5WA 4N2NA 3FCTA 5FUOH 1LP9F 4Y9EA 5L7XL 4A38A 5HVHC 1IEBB 3ENEA 3D2UA 1BF8A 1D6VH 1NCDH 4GBXA 4PRIE 4CGTA 4J1UA 5I76B 1E4HA 2B5IB 3HRZC 1JJUA 4R7XA 1W8OA 4A66A 4YIQB 4DH2A 1O9WA 1XTMA 1C7TA 4H8VA 1BF2A 4KROD 2CGRL 3EYSH 1DHKA 2ICWB 4M7LL 4WKZA 5HJDA 1A6AB 2C9VA 4Y16A 4PJEF 4QT5B 4U6XA 4Y4KD 4AKQA 2VWEE 4Y4HB 4RIRA 1SYVB 5IMLB 3ZHNA 1X7TA 5E9DA 3BP7A 4HIHB 5HJ3B 3TASA 3BFWA 1WPCA 3FN3A 5IUCA 3H8NA 1BPLB 3LB6C 3LN4A 4Q6IA 4XMKL 3K4ZA 5DJXA 4AEHH 2HT2D 2ICEC 2YMTA 4HXBL 4JFPA 3CXHJ 3B37A 4NC1E 5SWSD 4PREA 4JFVA 2Z8VC 1TUPA 1OM3H 2QMKA 2FR4B 3FT3B 5ESQB 1U9KA 5JOEA 4V1DB 5IJBC 4G8GE 3A23A 1P7HL 4TF4A 3RVWD 3VCLB 1BZ9B 3QXVA 4MCYB 4N0RA 1I8MB 4TRPL 4P04A 4X98B 5IJCC 1AI1L 3J2PA 4LSVL 1OGAD 3V0HA 1OLLA 1QSED 2ATPB 4LOUC 3RVVC 3MRRB 5DLMH 4GRMA 3TX4A 5JMRA 4JGMA 3IJEB 4N24A 2ZD0A 2IPUK 4QLRA 4KQ0A 2VC2L 3FQWA 3V0IA 4JGNA 2X0VA 2X7LB 4OZGF 1CTNA 4DF9A 5JHLA 4EZMA 4I3SH 3AUWB 5T3ZE 4XVSL 2X53A 5FYJU 1WZMA 3VMOA 2Z31A 3HN8A 4M3KB 5DD0L 3X3GL 3MUY1 3OG6B 1BPVA 1F0LA 3WFHA 2HKHL 4JFFD 2AW2A 3AMKA 3GZOA 2OBGA 2DYPB 4P3DB 2JF1A 1R5VB 4IBQA 4OFYD 2FJGA 1QASA 3RTQD 3FBKA 2QFRA 5E6ID 1MRFH 5CCGE 2XKNB 5GGUA 2C4FT 1FH5H 1UWGL 3CZGA 3L17A 1FSKB 2ZCLL 3CFDA 4ODVL 1WAEA 2RIKA 4RGNC 2XKNA 3QHFL 4GI8A 1E9PA 2HTLC 3LPPA 3TIDA 2E74C 5HHVH 2Q8AL 2GEQA 4IEFA 4X8JA 4P49A 1OF2A 2WVUA 1S9VA 1KPVA 4ZNCD 3K5SA 1TQWA 4GS7C 2FWLB 3CC5A 4WFEE 4K5NA 1IGIH 3TBSA 2CBPA 4KVCH 3AWFA 1PZ3A 2VDLL 4APQB 4PRIB 3S36H 3ALWA 1H5BC 3I9GL 1IAIL 2IBZY 2MSPA 1ACYH 2EDOA 2WLHA 2ZT9C 2H26B 4FP8H 1GS7A 4JZJA 4KJWD 1J1OH 2RCSH 3T0BA 4GRMB 3WS3A 5ID1B 3QUYC 2V5MA 2EQDA 4PRHD 3KPRB 5AENA 4JPWL 5HVGB 4E9YA 4Z3HA 1A7PL 3EOAA 4G7RB 5J9PB 4D94A 4X98A 3TPKA 3SPVB 2XWTB 4LPUA 4BSVA 1H0DA 3RDTC 3FCGA 2BSSA 3NCYP 1J1XL 1MW0A 1XZWA 2UUDH 1J1PH 4PJXB 4HXAL 3UERA 1FNSH 3KJ4C 1J1PL 1CGUA 4RETB 1BWWA 3IBEA 3PDOB 4ADGA 4JDTL 2Y06H 1H3PL 1YPZF 2TSBA 2F53E 4PREB 1IM9B 5HHPA 2EDKA 4JFPB 4MLSA 5F9DC 5F1IB 5DWUH 4CKQA 1CDIA 1RH8A 4K3GA 1SDYA 4Q6IB 1NAML 3MLWL 4G3YH 1JYXA 4I48B 1ORSB 5K9JL 4N68A 1RIUH 3QRLA 1EDYA 4G80B 1UD8A 5CBAB 8PAZA 1TZGH 2ZUQC 4XCFH 1A9EA 1SYVA 3AC0A 4KOCA 4PPTA 3ARGA 3S5LG 4DKAA 4AQAB 5FPIA 4YHKL 1TJIL 1CYGA 5I24A 4OD2A 4GLRI 3LVEA 1CJYA 5GISH 3SYQA 4AQ1C 2OTUB 4UIKH 5HI5C 4N3UA 4JRXB 3PFUA 3GLDA 4NHCH 4IIQB 1NUNB 2V2WB 2G5UA 5DYFA 4D0BA 1LEIA 2WZ5A 3HE7B 5E5UB 4E9TA 1GYWA 2Y07H 5DS8B 4G5ZH 1B3IA 2H0EA 2QQKH 4S1RL 5MHSD 3QWNA 4K8RH 5C09B 3Q6GH 5FF6A 4OI9A 5FW6A 1AKJB 3WFZA 3EYQD 2AITA 3PWNB 3P4OA 1KLGB 4FN0A 4PGEB 4IU3B 2YC1B 3V7MA 2WO2B 2WXNA 4LOVA 2QBWA 2AS5M 3N0AA 4DP7X 4BDVA 3U83A 1QSFD 3UBXA 3WI9A 2CDGB 3BVNA 2F5AL 5SWZB 2YD8A 4YXHL 4RSVA 1ZV9A 2GYSA 1LQSR 2ZX6A 4IRJC 1HL8A 4LHUD 5MEOB 3OJDB 2F7RA 3EFOA 1OT1A 2GTZB 3GDBA 3PXHA 2BSRB 2PR4L 4N8VG 4AZ8A 4LRNL 1EUTA 1MCRA 3KPLB 1N6QL 5F1NB 2DI8A 1RZIA 3S4SA 1MNUH 2HRPL 2CD0A 3D30A 1R3LB 5CJ8A 3MGOB 5A1AA 2JVUA 3O8XD 2OCJA 2HKHH 3X11B 1MEXL 3DXAD 3QPQD 5IEKB 3L4TA 3UOAB 2PXYD 4MD4A 4Y5XA 3V6OA 5JUEH 2LLNA 3E3QE 1I1YA 2O5YL 5JDJA 1DBAL 2JCCE 5EPMB 4L9LA 5JR1H 1ZJBA 2EVIA 1BBJB 1AQDB 1UATA 1V05A 5C8JA 3WFDH 3MYJB 2F08A 1G6RB 2BXZA 2I26N 3MC0A 3S8FB 5KSUA 4DEPB 4KU1A 4DO4A 1A4AA 1TYEB 1I3RA 1S46A 2XJLA 4GKNA 3C8KB 5F3HA 5LGJB 5BMFL 3GKZA 4Y2OA 3APCA 1FO0B 4FYSA 1RQ5A 3CN2A 4FTVE 2VDRB 1IC0A 3L9RA 4L0PB 5BS0B 5T3XE 1IAIH 1Z1WA 1CL7L 4F7EA 1PD1A 5KYYB 1KYFA 3MBED 4FNTA 4TL4A 2ARJQ 4KKLC 3TBTB 4QRPB 4TVPH 2NY0C 4DP6X 2ZICA 4XN4A 1SY6L 1D2OA 4IBYA 4IJ3B 1BOGA 5D1QA 8FABA 4G6ML 4MAYB 4JDZB 1LO5A 2P52A 3TO4C 5ALBL 1JZGA 2QGDA 2ZX7A