1G4RA

Crystal structure of bovine beta-arrestin 1
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
387
structure length
353
Chain Sequence
RVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSDLASSDVAVELPFTLMHPKPDIVFEDFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-ARRESTIN 1
publication title Crystal structure of beta-arrestin at 1.9 A: possible mechanism of receptor binding and membrane Translocation.
pubmed doi rcsb
source organism Bos taurus
molecule tags Signaling protein
total genus 69
structure length 353
sequence length 387
ec nomenclature
pdb deposition date 2000-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
A PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1g4rA02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1g4rA01
2WTRA 3P2DA 4GEJA 1AYRA 2WTRB 2R51A 4J2QA 4P2AA 3GC3A 4R7VA 5F0MB 5F0LB 5F0JB 2FAUA 3LH9A 1G4RA 4LL1A 5F0PB 1JSYA 1CF1A 1G4MA 4GFXA 4JQIA 4ZRGA 3UGUA 3LH8A 3LHAA 4R7XA 3UGXA 3GD1C 4LL4A 1ZSHA 4GEIA 1SUJA
chains in the Genus database with same CATH superfamily
2VDLB 5IV2A 1RVFH 4WTZG 4F7CB 1J88A 5T5FA 3FQWB 5J4MA 2NUPA 4DZ8A 5LDSA 2J5WA 2JI1A 2UY7B 3P4LA 3FO1B 4FTVB 1A14H 2AXFA 4XODA 4HJUA 5L8KB 1CXFA 3OWRA 2R4SL 2W88A 2JWYA 4JFFA 1AI1H 2LAAA 4F93B 1WVZA 1G9NL 3NJGA 1C08A 4OLZL 5I8OH 1N0LB 1UM6H 3GIZH 4WJKB 1LDSA 5CJOH 2P24A 3VXUA 3MMEB 4HJEA 1ZWIA 5C0CE 2QFPA 1IE4A 2UWEF 2Z7YA 3H4HA 4H2AA 5D7KD 4PTTB 4V1DD 5IFJB 3LQZA 5F7NC 1EZSA 3KHOA 4HFWA 2X6MA 2P5ED 2AGJH 4ISVB 2E6QA 1AFVH 1D6VL 3ARDD 5DA0B 4JRWA 3TFKC 5A6LA 2Y5TB 2E8ZA 4FLRA 2PP9A 1IAII 3KLQA 3EDKA 2C7UB 1RJLA 5B38B 3VNZA 1KBGL 3CSPA 2LGNA 5TFSH 4IJTA 5F1KC 4MDIB 2Q8BL 1PBYA 2DJSA 1R3HB 1PJ9A 3K2UL 4YX2L 3HZKA 4HS3A 3ECVA 2EUZA 2AITA 2GUOB 1GSKA 3EBIA 4AYSA 3R0MA 1YNKH 5SWZA 4ANWA 5ICXB 1HZHH 3AUVA 1E67A 1FGVH 4XXDB 2YBRB 4ZPTA 3QO1B 4A6YA 2DJUA 1M1XB 2A9DA 4DP5X 3HS0C 5HI3D 3QG6B 1ADQH 1KB5A 1EZLA 2BNQE 5LNGA 3GBNL 3UMTA 4HC1L 4DW2L 1FC2D 1MJ7H 3ATAA 3QIWB 2XA3A 5LCVH 2ZOLB 2NTFB 2XN9D 3ZZQA 4JO5A 4L8SC 5EO0A 5E03A 1YAIA 2AQ1A 1CR9L 4NKOA 3WGVB 3SDXB 1NDMA 4N8VA 3GSNB 5AKSA 4TOYH 4PS4H 1WPCA 4Y9CA 4WEMB 2YA0A 3EH4B 2H26A 3ZSTA 1CVRA 2V2TB 3E80A 3G6JB 4B96A 4LLMA 1WD8A 1YEDA 5B7MA 2E6PA 4NERA 2XG4A 3EYUL 4YWGH 5AB2A 3RZCA 2NCEA 5D7IE 3IM1A 1YAZA 4QHUA 5BVJB 2R69L 2WO3B 4HA1A 3BD5A 4MA3B 1GSMA 4PW3A 2E9WA 4KXDA 3MV9D 2QT6A 1OP5H 4M1CC 2ROYA 4LHJB 4MA8H 1YEIH 3CFNA 4PJBA 4AYMC 4JREB 1AZBA 4FQ1H 4G8IA 4NFDA 2DRUA 4JDVA 2VM4A 5E9AA 2QZ5A 2DM3A 4H8QA 5HJGA 5BS0E 5ICYA 2AEWA 4WHCA 5HHOE 3ARBD 5ALBL 2RJMA 2Q10A 2X9WA 3MCYA 5EO9B 1O6TA 5LNDA 5MENB 1NAML 3LKOB 4YR6A 1X6NA 3BLBA 2EC9U 4F2ME 1IC7H 1XGQB 1EFXB 4XNUH 3R8BB 3WKMH 4CA4A 3Q44A 4X5XB 3G9VA 3K8KA 4GFXA 1JPFA 5EZJB 5T1KB 2ZUVA 5CEXB 3D3VE 1FVDA 1WUNT 1KB9K 3GSWB 4J6IA 3ZKNC 1NA8A 2JB5L 2RFXB 4PRNA 5F1IA 2C3VA 4X9FA 1OP5K 4KRNA 5E2TL 1XO8A 4I2XB 5F3FA 3TFKD 3EZJB 5ESAA 3P4NA 3FQYA 5K9KB 4G9DA 4MFHA 4WW2C 5E2UL 5GGQH 5DZOA 1RHHB 1AD0A 1I3RB 3KYKL 3VFNA 4PJCE 1XL6A 5D7IA 5JMOC 5JXAH 3ATBA 3CMOH 3MCKA 1GS7A 1E5ZA 2ZXQA 3D34A 2E5EA 4ZSOB 5IIEA 3A6OA 2BIOA 3NZ8A 4GAJL 4AK1A 1MLCB 3L4WA 3EGDA 2NY1C 4M48L 1SF5A 4QRRE 1SYVB 2BRQA 3L2MA 5D7EA 2NX5E 3FUMA 1K6QL 4Y5XA 4ZOEA 5K9JH 2FHCA 2C9XA 4XMLL 2PR4H 3LX9A 5KSAD 3T4AA 1NC4D 3TURA 5DK0A 2Y7OA 3FPXA 1E42A 5ABAA 3RKDD 3BH4A 1HIMH 2FWUA 3FO0L 2HP4A 4TNWK 3QUMB 3PGFL 4LEOB 5ALCH 3VM5A 2V3DA 5I1CH 2JIXB 1S8DA 4QGTA 1D5MB 5IR1B 1FZKB 3BHBB 2DEWX 4CC1A 2EP6A 3W9DB 1OE1A 4O02H 5KOMC 3ARBA 4PEEA 1FRGL 2MWCA 4NO5A 3EBGA 2AEPL 2OYKA 3TNNA 3SYPA 2CO3A 3DV4B 2YD8A 3ZKXB 1BQRA 5F6IC 1U6AH 5T3ZE 3CUPA 2JCWA 2XI9A 1E5UI 4HXBL 3ZE1E 3FCSB 1XX9C 1DUYB 1QFUL 3GMPB 4ZTPL 3H42L 2B39A 4Z7QB 5ABDE 4IEFB 4XVOA 4Z78A 3KPSB 1A1MA 3CK0H 4Q9CA 5AAWA 3PAZA 2CJTA 4FADA 3VMOA 4EUPG 3LNFA 3V4PA 2F8XC 4NAJA 3SDYH 1DBAL 4KK8C 5L9DL 4JQIA 4EF3A 3S3SA 4M1CD 1H3VA 4RIRA 4PLJC 2R1YA 2OTWA 1GC1C 1F6FB 3L7FB 4G8FA 4XMKH 1SLUA 5KW9H 1XAKA 4P2OC 3GM0A 3UYOD 2W0FA 4NQDB 1UWXH 4NNXB 3SCMA 4H2CA 1QKZL 3IDNB 2VERA 2CHWA 4R96A 2J88H 3C2AL 2X4TB 3MRHA 5FHBH 3D69B 3FFDA 2YQBA 4MAZA 5AG8A 4WK2B 3MSPA 5DZJA 1MFEL 2W5PA 1XF1A 5AD0B 1CICC 4MJJA 3NA9H 4ZOCA 4JS7A 5CCGE 2Q3ZA 1NC4A 2Y06L 3DX7A 1ILUA 4G1EA 5F9JA 2BX5A 4UB0L 4YHLL 3EOBB 3EFFA 2WZPA 4WKXA 2NY6D 3TT1H 3LPOA 3VW3H 3U0PA 2CWRA 4N1EA 4J4PA 3MHZA 1AGEB 3VG9C 1A9BA 4J3OF 1KTCA 4MA7L 2OCCB 4PH8A 5I76B 5IW6B 1TJHL 2FBOJ 4LIQL 1V54B 2C9VA 3FQ4A 3NK4A 3T0WA 3TWCH 3V0AC 2O6PA 1CDBA 3VUAA 4GSDL 2EDOA 4MSWB 5DK3A 3VXRE 4B27A 1PG7W 3OGOE 3LRMA 2AMUA 2K45A 1UWXK 3AVEA 5JPMB 4OQTH 4UOJA 4N0CC 5EC1B 1L9TA 1ZHBA 3N91A 4XMXA 2IFGA 1J9CT 4EN3B 1KJ2A 1HL9A 2YPLD 4QHPA 4AUJA 2VKXA 1DQLH 2GCYA 3S5LA 3GB7B 5KEZA 2OMWB 1C7SA 1LO5A 4EDXA 1KCUH 1DQQB 4L8BB 2A6DB 4WFHE 3OLDA 1RUKH 3CFKB 1SEQH 2VXUL 3TX4A 4NXKA 5C0RH 4GXUM 2ZXEB 1G7PB 3RL2B 2CAKA 1XGYH 5K59F 3RFZB 1N4XL 2DN7A 4PV8A 4IDJL 1DQTA 5HDQH 3VFMA 4BFRA 4EKXA 4Z3HA 1BJMA 4MD5B 4I4WA 3OVUB 4LSUL 1KPVA 4PRIE 3CLEH 5MEQA 1V3JA 7PAZA 3FU9A 1F4XH 4PRBA 4L5FH 1E4XH 2H2SC 1BZ7B 3ZMEA 2GIXA 3GLZA 2CRYA 2VR8A 1JVKA 2JMRA 3L4CA 1Z1WA 3O9WA 4TUJA 1XGPB 5D2NB 4JGMA 4NAQA 3O6FA 3S96A 5DS2A 1OT4A 5BW7C 2QSTA 3K72A 1MCFA 3ZTJG 3FT2A 2D2OA 3F2LA 1JS4A 4GG6E 5KBPA 4W6XB 1JGEB 3B5HA 3GXPA 2DBLL 1TCRA 3L5XL 3QEQD 2RR3A 4P5TC 1IAIL 2VDRL 4O58H 2NYKA 4PLJD 2JLPA 2ZX8A 3GNMH 1GKOA 1I3GH 4P2QB 2EC9T 4JQVA 2VRQA 3ZT5A 5DEGA 4P2OD 4YSAA 1GS6X 2BWIA 3A3YB 3H1ZA 4OCXH 5TQ2L 3WDJA 2OV0A 2GSGB 5FO9B 1RZ8A 1XFPA 2VDPH 3QB7C 1DVXA 4F7KA 3FB5B 1KCLA 1KXHA 3BP4A 3AMLA 1XZ0A 2WWKO 3L3OB 5B1JA 5IF0B 3EDDA 4XAKE 3MLSH 1ZT7A 4JL1A 5LXVA 1E28A 4LIQE 1TITA 2DWEB 2WXNA 4GAYB 4Y4HB 3ULUF 1CICD 4Q6YA 1RERA 3VFOA 3QNZA 5G4NA 1ORQA 1PPIA 3GUFA 1IL1B 1HDMB 3LTVA 1VKXA 3FBQA 3WS6C 4E9QA 1IAIM 2NY2B 5SWSA 4DEPC 4DKEL 1AY1H 3CSTA 1TZOA 2J6EL 3APCA 3BDYL 4YSTA 1QYGH 4S1RH 2WVTA 4ZMYA 3LZRA 3H3PL 4M03A 5LGJB 3D7PA 3CVHA 5AW5B 4Z5RB 3PWNA 2K78A 3L3GA 4NPYA 2UZIL 3MGOB 4HEPG 4FS0A 1B4JL 3ISYA 5E2JA 3SDAA 5LGHH 1QW9A 4NRZA 3LY6A 3S3JA 4UNUA 2F54A 2W9LA 4JFEE 4PLNC 4W4NA 2B3RA 1DDTA 4BK4A 1J8SA 1ZE3C 4NCDA 3QEUA 3ZYOA 4NUGH 4GS7C 3EHBC 4XO3A 3W0WE 3QCVH 4JM2D 1QNIA 2Y2YA 3WYRA 2VE6B 4LRIC 3FRUA 2YC1B 4J3UA 4Z77B 4MMZB 1WTGT 4QYOB 4WU7A 1IGYA 3VM7A 2V4LA 4IRJD 3NACH 3MRGB 4QLWA 2EDNA 1UURA 5EBGA 3ZW3A 1MFAH 3NJVA 2NY3B 2VXTL 3EDJA 4XO8A 5EN2B 3UFIA 1XB3A 3AQXA 5I8KH 1J5OH 3FT4B 4HIXH 3LIZA 4I48B 5EORL 5F7YC 1SDDB 4YH6A 2BSBA 2ZXDA 3OL2A 3IFNH 1KLFA 1BOGB 2CUAA 4EXPX 1Y0LB 4X6DA 5J6GB 4A7QA 1KIPB 2X2JA 2K3TA 4QYAA 5GGVL 4BRJA 1VSCA 2IBGA 2G4GA 1FNGA 1D9KB 1JXKA 3IYLW 2YGVA 4GRWF 2ZPKH 3KPTA 2NXZC 1ITBB 1RZGB 4OZGF 4E9SA 5F7BA 4FQJH 4TQPA 4YE0A 4CL7A 4XVTL 5LAPA 1EZVX 2D03L 5F8QC 1GOFA 2JB6A 1TQBB 4OZ4B 3TO2B 4S0HA 1QOKA 2ZICA 3LV3A 2ZP8A 2Y36H 4UUJB 5LB1A 4ZW5A 5CWSA 1FZJA 1ETA1 1MHPH 2YBGA 3PNWA 4P4KA 3ILQD 4PJHE 5A3IC 2BP8A 3FUEA 5CKAA 2F7PA 4UIMB 5E9DE 4FNSA 1GCYA 3AB0B 3DIVA 5TH2B 1F8TL 1AXSA 1YJDL 2CJUH 4NZRH 2EH8L 4XGZB 4YE4H 4DN3H 1W80A 4P5TD 2EVFA 1EDYA 3Q9QA 4HQQL 5CUSH 4P4RA 3FT9A 1H8OA 3UTTD 1LGVA 5CEZD 1YY9D 3W0WA 1BD2D 1GYVA 4R6UA 1F5WA 5C07D 3GRBA 4H0HB 2ZOKA 3LS5L 4JDZA 2VLKE 1HL4A 4AQEB 2BP0B 5AW2B 3NIDE 3NAAH 1AE6L 5BUPA 1UH3A 3ZL4L 2DQGH 3TJEL 1G7QA 5B4MC 3BVUA 1ED3A 4DT2A 1MRFL 2YWZA 2G9KA 2B59B 3UDWC 2VLMD 3PWPE 3ATFA 3EOAA 1AGFB 1HZKA 1SBSL 4IOFC 1F1AA 3CZUB 5BZXA 1VGEH 1C12B 1NUDA 1U2HA 4D9LL 4KVPA 4ENZA 3NP3A 2QADD 1NCOA 2HUEA 1OQOA 3DBSA 2WNXA 3BH8A 1UQSB 2P5WE 2XQYK 4YSQA 4NFBA 1SDYA 3KYMA 3LMJL 4EZKA 3FXIC 4QRTA 3MNZA 4AT6B 3K91A 1PQZA 1B2WH 5EH1A 3RWIB 4AV5A 5C86A 2PLTA 1ZK9A 4P46A 4UT6A 5JW4N 3GZQA 4X0KB 4MMXC 1EJ8A 3FQ1A 2YXVA 2YMXL 4PWKA 4PJHA 1YN7B 3EHBD 4DZBB 3A4DA 5JW5B 3IPBA 5E00A 1UKQA 3LXCA 1ETB1 1LO4H 3T3PE 4BH7B 4Q9RL 3IGKA 2AEIT 4RISH 2VAAA 1WFTA 3Q06A 2XPYA 3V52L 2XWTB 4AG4L 4C54A 3BZEB 3H0TB 5EDXA 3AB0C 5A2FA 2EUVA 5KSBF 4A67A 1XCQB 1QNZH 5I17B 3F3HA 3K6DA 1N67A 2RD0A 1IBGH 2WY3B 2BOCB 4XP5H 1AIZA 1FGNH 1JNNL 5KYXB 4WUUD 5KBKA 4HWBH 1QSFB 1L3WA 5E4AA 3MXVL 2MTPA 2CDGB 4IGBB 3GF8A 5E6SB 5D5ME 2COVD 4IRSB 3TBWA 3KPMA 4JR9H 1U3ZA 4XN2A 1CUOA 4JFOA 2YUXA 2MQ3A 3IFLL 3V4VH 2BMKB 1TQCB 2Q87A 1I1YA 4F7MB 1OLLA 2VN7A 2D3LA 2FT6A 4XRCB 1YN6A 1RQ5A 1T66C 2X4QA 3BQUC 1WZLA 5A3ID 4YVUA 3HLKA 1XH3A 4RGOH 4PJDE 4FZEH 2BO0A 2FSEB 2XVLA 4JANB 1WV7T 4FQHA 2P80A 2RQ8A 1HNFA 2X3BA 4CC4C 3ZE0E 1MCOH 3T0XA 2F08A 3T2NH 2W92A 2BVUA 2ZX6A 4N9GA 4AQ8A 2GPZA 3ARGB 4NC0B 5CCKH 5CAYB 2CGRL 2VOTA 3BEWA 5T33L 2O6EA 3D39D 3IDXH 2V2WB 5DF0A 4UV4L 5KYUB 2K3HA 3KPLB 2GY5A 3OMNB 3VMPA 4KROB 5E5MA 3DMMB 3RI5F 4CMHC 4O5LL 2A1WH 2VDML 2VWEE 5F1NB 2VL4A 1T89C 2X4NA 1O9ZA 5IG7A 1WISA 5EWIL 1DBBL 4I88A 4G5ZL 4C55A 5I66A 1UCTA 3TN0B 4HUVA 3IGAB 4IOFD 1LD9A 4PWJA 2HZHA 3WD5H 1VFMA 2DLHA 3GIVA 4YSPA 3HUJA 1BIIA 4DGVL 3M07A 4ADIA 3OKKA 4J3OC 3N2JA 5TDNB 1OL0A 2XBZA 1U8IB 2FRGP 2W9DH 3VA2C 2DW5A 1CFMA 3OXSA 3EH3B 4UZGA 3SGKC 5GS1C 3UZQA 3MKGA 4UINH 3RTQA 3IGLA 1UZ6F 4EE2A 2WIIA 5EPMA 1A4CA 2O5XH 3DTXB 1DEEA 1HE8A 4NN5B 4M7KL 4RWYL 2QKIB 1P4UA 4PR5B 2MPAL 1G7JA 3D2UB 3OZKA 1AP2A 2G2RB 1CFSA 4IRSC 3TJPA 3WIHL 4OI8A 3MXWL 4JB9H 2EDMA 4Q2ZA 3N9GL 5T3XE 2UY6A 1JWSA 3K4DA 3AU0A 3CQFA 3KVDD 1MCDA 2YSSB 3OM3B 5CEZH 4JDEB 1IIIA 1SM3H 5JYMA 2FYYB 3KGRA 1F56A 2O6DA 1JXGA 3MV8E 1D5ZA 3HI6H 3CN3A 2ZF9A 4APQB 1DE4B 5DHYB 1PLGL 2KKQA 1S7QA 1CVSC 3CDYA 3ZRFC 4XO9A 1P6FA 3T0EA 4LSVH 4I18A 5JLZB 4OTXL 4HWEH 1UA6L 3TT3L 2OX5A 4RGNE 1ZLEA 4UU9B 1ONQA 3DC0A 4KZEL 2J44A 5GZOC 1GR7A 3QSKB 1CGUA 1Z5LB 1VF5C 5I30H 1ZRUA 3IPFA 5F6HJ 3WMSA 1OK8A 3MJ9H 5KN5A 2ATPA 3BIAX 5BVPL 4KXBA 3ZDZE 4RZCA 3B34A 1R5VB 2FHBA 4NWTH 3S97C 4MD4A 4YFDB 1EO8L 5FIEA 1NGYA 3N43F 4K3DH 1UTDA 1BHGA 4LBEA 5LWYH 1GGYA 1T66D 3QZWA 3BQUD 3US0A 1EZUA 3FH8A 4PJAA 1RJYA 1LDPL 3FQTA 3S34L 6PCYA 3BAIA 5CZRA 3KPOA 3VSQA 4AM0A 4UIKL 4PJBF 1Z9MA 3KEHA 4DGIH 2E8YA 4EJ1C 5K9OB 3TEWA 5T1MA 2BVOA 2PF6A 3B3BA 2ZKWA 4QCIB 5IB3B 3GUTB 1NEUA 5C0AB 4QRSB 1QLFB 1YQVL 4JLRA 4P3CL 2BSDA 1KYOJ 3O3BB 1UT2A 4NN5C 2ENQA 4PREA 2XBTA 3U2JA 1H9DA 1ZA3B 3W5MA 1O9WA 1ZKAA 5I26A 2VISB 2HTLC 4Y5VB 5FM4A 3ULUC 3C87A 3C5ZB 2UX7A 2WXRA 2EXTA 2YRLA 4KV5F 3IFPA 2EVJA 3GSOA 2IAMB 2IBBA 4TRPL 5TE7L 1E0OB 3RWJA 5JUEH 1UCBL 2YD5A 2WXOA 3N44B 3WFZA 1J1PL 1CFVH 4Y16A 3OJDA 2CR6A 3II1A 4XXCC 4WY7L 3WXWL 2H7WA 3D0LB 1S5IL 3DURA 2JSFA 4YL4A 5EU6A 5J3HD 4F7PA 1G7LB 3UPRB 2EECA 1FSKC 1UB6B 3QPQC 3IMTA 1TZGH 3UTSD 1LEIB 4N6QA 3EFDL 3RPIB 1UJ3A 4JVWA 3LH9A 2Y6TE 4ES8A 5E4EC 1HXMA 3MRBB 3U4AA 3HC4H 2NW3B 3AM8C 3CLFL 5D7IF 5BUGA 5IZ7A 3V79C 4OD1H 3T8MA 1NC2B 3CXDL 3P73A 5ISZA 3MBXL 3QWOA 1SJHB 3KYNA 2DQCL 1N10A 2BSCA 1HQ4B 4Q89A 3TA3C 3U9UB 3WNPA 1J11A 3EYSH 4W9ZA 3HJEA 4WWKB 4UDUB 4OJAA 1BQHA 1A7PH 2CMRL 1CU4H 3HC0A 4R90H 3GJFA 2RALA 2FUTA 2F5AL 5I6XC 4R7DB 1H5BA 1PFOA 5H4ZA 4JRXA 2D3NA 4OLVL 5GRJL 1R17A 3LIUA 3AADB 1ITCA 1YNTA 1OB1B 3B7YA 2A9NL 3QQDB 3U4EA 4FKHA 3KZ8A 1OAYH 2LFGA 4KAQL 4MJ6B 3A5VA 2F0CA 3KDMB 5I0WA 1JUFA 3P3YA 5GZOD 3UBGA 3QA3A 1OM9A 1URIA 4NQXB 2QLYA 4H13C 4WO0A 2C3WA 5DZPA 4DOHB 4M7LH 1KPUA 2PPFA 4QRPD 2X2UA 4IU3A 4K3JH 2YUVA 4HV8B 1S9WB 4JG5A 2OJ1A 1SZNA 1BQUA 1A6AB 3D12B 1N3NA 4PLOB 2PWHA 3HPLB 2XYCA 1JHTA 2WNWA 4O2FB 3QT2A 4YXHH 2DD8H 2TRHA 4PIRF 2Q8AL 5KSBB 1TVBA 2Q76B 5IESH 5AL0A 1KIQB 2LLNA 2J55A 4AE1A 4PY8I 1NMAH 1DSYA 4O4YL 5C2BH 1QA9B 2Q20A 4QXGL 3QRLA 4AMXA 1XGZA 1C7TA 4PJXA 4GRMA 5E99H 2OTPA 5CHNA 1MAMH 4JDTL 3L9RA 4NPJA 3R1GH 1SRDA 2WSKA 4N2BA 4HBQA 4HLEA 4HK3N 1IBDA 3DYMA 1EAOA 5KJ4A 1KCRH 5D96B 4BKLA 5GGSY 5GJSL 4DQAA 1UYWH 2YUWA 4XOCA 3O3DA 3UC2A 4DEUA 4EEEA 4A2FA 2R7EB 4DKDC 5C7XL 2A5UA 4UQIM 4GG8B 1OTTC 1X44A 3HNSH 3WFCL 1GJUA 1NPJA 5B7EA 5EO1A 2OMTB 4E5XG 4ZFOB 4DAGL 4F24A 2ZCLL 2EUXA 1DVFA 1WK0A 3FCTA 1HHKB 5JW4M 2VNCA 1XMEB 1P4IL 1JF5A 4P5RA 3O2DH 5IV2B 4OGXL 3RURA 3DX9A 2GI0A 1EH9A 3FFOA 2NUPB 4DZ8B 1NLDH 3C6LA 3DXAA 3QXAA 1JRHL 3VGHA 1BWMA 4TVUA 5GJTL 3STLA 3FW6A 3QPQD 3MOQA 4TL5A 4ZPVB 2C1PB 2NXYC 4B7LA 2AXFB 3IJ7A 1AS7A 4C47A 3I84A 4JNXA 2AK4D 3ZE2E 4AEIL 2WCGA 2H1LM 3MLYL 3PHAA 4NQCA 3H3BC 3WHE0 1BFOB 1C08B 2FL5A 3PHSA 3ESVF 1WC7A 3N1PC 3B43A 3MRPB 3CQPA 2P24B 2RQEA 3M8OH 1ZWIB 4ZD3H 4FEIA 4AW4A 1G5GA 1DQDL 2NR6A 1M42A 1UH2A 3HHSA 1RH8A 1XIWA 4N4YB 3TO4C 2Z6FA 5FLUA 3QCTL 1ZVSA 4KKQA 5G55A 4YGVB 3LEVL 3N40P 4O2EA 2M8XA 5IROC 4U1NA 4OFQA 3RVTC 2WZAA 3MACL 4C4UA 5JOPD 4AQ1C 1P5VA 2G2NA 3GHBH 2QR0B 3CVCA 4BQ8A 3VACA 2Y22A 1MI5A 1OGAD 1DBKH 2GFBB 3B9KC 5DC2A 5BCAA 3L3JB 1MREH 3P2DA 2ICWI 1RZKL 2LFEA 4DESA 2NNAA 2W9EL 3HZKB 5F0LB 3HE6C 2QZQA 1RUAL 3BVXA 3HC2A 4M1DL 4PJ5E 5SWZB 2D7NA 3WHXB 1KGWA 4ZPTB 4J3OH 4A6YB 2WLJA 4Q0XH 4DVRL 3A21A 1SNRA 4PW9A 3QDJE 1KB5B 3QZLA 4BHUI 3VD0A 3MO1B 5IMMA 2WWOA 3SBWC 4TSCH 4YSDA 3CSBA 2D7TL 1FVCA 2OCJA 3QHTC 2AKRA 4LLYA 3ZRSA 4L8CA 1AKJD 3MNWB 1FL3A 3MYZA 4TLTA 5IBUG 3NYKA 5CMAA 4ORZC 1KXQA 1YEEL 2FJFA 5C0BD 1CGVA 4G8GE 4NKOB 2DTML 3LXUX 1NDMB 1EGJL 2EYTB 4N8VB 4E9LA 3GMOA 4YLCA 4PQXA 3VU1A 5D9SA 2VITA 1TTFA 1XHHA 1A64A 1EMTL 3RVWC 3V0FA 2DQTH 3QDHA 1PZDA 1XWVA 1XSJA 3C5XA 3O4LA 5IFAH 1YEDB 4FULA 1XF2B 1RZPA 3U30B 5I1HL 1JK8B 2XG4B 2W65B 3RZCB 5DJ8A 3A4FA 1S7RA 1PD0A 3GMQB 4Q97A 1IE5A 4KQ3H 4MBOA 4X83A 3VYPA 1C5DA 5D1QD 4L37A 4PGZA 2P5EB 4XNMB 5LDUA 2F8IA 5F88A 3WUWB 5FWRA 4EOWL 1EA9C 3RVXC 4MS8D 4PJBB 4M6NH 4FFWC 4G8IB 1AANA 1O7VA 1A4BA 4ZO9A 1ZAGA 2H47C 4JDVB 2DYPD 4H40A 1MVUA 5JQHC 1ZTMA 1RK0A 2Y07H 4PJ5A 1FJ1A 2GVYA 4UCFA 5IVXE 4AYFA 5ICYB 2NXYD 5KVDE 5I24A 3B6SA 1I9JL 4KKZA 1FE8H 3QDJA 1CE1H 5ETUA 1DVZA 4ZW8A 4GG6F 4YR6B 5CIPB 1NGWA 3LKRA 3FCUB 1H6EA 1I8UA 4FJZA 2WSPA 3MRCB 4O9HL 1QR1A 4L4TE 3VSVA 1HAWA 5ANMA 1JPFB 3CG8A 4L2YA 3DTDA 2EZ0C 5EDSA 1FIGL 4J1UA 4UM8A 3BKJH 4TPRH 2IPTH 3BZ4A 1SDAB 5J1AB 2Z7UA 5KANG 4PRNB 1WFJA 2C3VB 2Y2TA 5D7SL 1VACB 2FATH 2XDHA 1NIFA 3G5XA 5J1SC 4G9DB 1XL4A 3QH3A 4WV1A 2X7LA 3QQ3B 3JXAA 3VFWA 3U0WH 5D7IB 1KGXA 4QUOA 2KZKA 3MCKB 4LARH 1R75A 4X7CC 5IIEB 3A22A 3HE6D 3NZ8B 5DSCA 5F96H 4ZUTA 2EDFA 4PB0L 5IQ9A 3HZVB 3EGDB 2QV4A 4FG6C 5IMOA 2ZZUT 1CS6A 3BZ5A 1X4ZA 4Y5XB 2L7EA 3HLAA 1X5KA 3T4AB 2CPCA 1CDJA 4H7VA 5DK0B 3ERXA 2GITA 3JWOL 3SE6A 5T5NG 1SEBA 1RY7B 4OCSL 1ZPUA 2CG9X 3CQQA 2DQIH 4PP2A 4WTWA 1S8DB 3ZMNA 2CIKA 5FF6A 2OK0L 5T1DL 3ARBB 2Z65C 4NKQB 2X6CA 4NO5B 5D71H 3MV11 2JQZA 4WWOA 4Z23A 3B5GA 2WVUA 5CZXC 4KTDL 1QATA 3FZUD 3SKMA 3CUPB 4L4TA 3GBMH 3H6AA 1S7SA 1HI6A 4ZUUB 4OSUL 4LLUA 5IJDC 1ZGLA 2C34A 3I02A 4BEIA 1I8LA 4UQCA 3NFPA 1A1MB 2O5YH 2QPSA 3F7VB 1F86A 5AOZA 1MF2L 2MKLC 3V4PB 1XF5A 2BSRA 3F7YA 3PP3H 3T2PA 5D2LA 5CILH 1HWWA 2E76C 3Q3GA 4K3EH 1DSFH 1NUNB 4D8OA 1SXNA 2A3TA 4RIRB 4CAGA 4GRWH 2OTWB 2BWDA 5T1LA 4M93B 2J21A 4G8FB 2HFEA 1ILSA 1UOLA 1GTNA 5DC0A 3QRFM 4JN1L 4FFWD 4TUKL 2W0FB 1CBVH 4YQXH 3D9AH 3QEHA 1T5XB 3WNOA 5C0FB 1JZGA 3HR6A 3I3DA 3WFHA 3IJ8A 2DQEH 2HN7A 3K81A 5CXPA 2AXJA 2EQDA 4OBRA 5K5YA 3FFDB 2IAND 1XD0A 4BWTA 2H32A 1YEHL 3ZYZA 4DGWC 4ABVA 3O6KH 5FKAA 3H2WA 2VO5A 4X9YA 4Q9BA 4G8EA 4PJHF 1ZANH 2V0AA 4K94C 1BF8A 1NC4B 2VQUA 3QEGH 1OE3A 1RIHL 4PFEA 2ICEB 3I9GH 2APSA 1MLBA 1Q0YL 4FFYA 3L54A 4G1EB 5DJCA 2H4EA 3LRLA 5B1AB 5PCYA 5F9JB 5L4MA 1K5WA 2AQRA 1LQSR 3EFFB 1ZLWH 3BN9C 2Q7AA 3ESUF 5FA3B 4ZBJA 2EZ0D 3QORA 3P0GB 2DMHA 3U0PB 1BSIA 1ZV2A 3L4VA 2YGPA 3PP3K 4QOKD 5BMFH 4KKBD 3CXHK 1A9BB 1CYGA 1NL0L 4BZ1A 3BVDB 1CTNA 4JKPH 2V5RA 4XOEA 3AY4C 3NIDF 3FQUA 5F3BA 3TONA 3BP7A 1PNDA 1VGKA 2VC2L 4NWUL 4CJ1A 4X8JB 3BYYA 1F58H 3NN8A 4G1MA 3L6FA 3RX8A 4I87A 2R2HA 2CCLA 5F7EL 2XQYG 1FNSH 2YXWA 4JFQB 3MODL 5C0CD 4NXSA 1KJ2B 4F58H 2FBJL 3QXDA 1BPLB 4PTUA 5C3TA 4Z9KB 2GCYB 2QQLL 5MERA 4BM7A 1LO5B 3SE9H 4PSPA 5E8NA 1N2RB 1NZRA 2D7MA 4FG6D 5I16A 4ZX5A 4WSKA 1MJJA 2Q6WB 5TE4L 4H0LC 2YAOA 1KN4H 5FA4A 4ILDA 1MIMH 3PRZA 1HXKA 2GQHA 1WAEA 2GT9B 3ALPA 1ZLWK 3BIKA 2WB1A 4MCMA 4PV8B 5LVEA 3VFMB 5GIRB 1NBYB 4I4WB 4NFCA 2FWOB 2CLVB 1JV2A 5MEQB 3VE0A 3GZOA 1ZJBA 3SCMC 4PRBB 1A4AA 2A73A 3THMH 1N59A 1BBDL 1FAIH 4Y9EA 4PV1C 3UH8A 1V8HA 4YDIL 1G6RH 1S7WA 3Q2VA 4DFHA 1JZ3A 1P6WA 4GW5A 1YMMD 2D3JA 5E1AB 2WMPB 5CLTA 1IM3D 3O9WB 4TUJB 4AW7A 4CN6A 5HSFA 5I1GH 1CD1A 2DBJA 3O6FB 2BNQD 2PR9A 2NY6B 3EUUA 1Q94A 3FT2B 2VDKL 3DGCR 3U1PA 2F15A 1NJ9B 3U1QA 3MTRA 5DLMH 1PW3A 4KY1H 4ZFZA 3ARTA 1WDAA 2RA1A 3KMDA 1CDYA 1KELH 1TCRB 4YBLC 1DJZA 4ECNA 4J2QA 3HUJF 4J4PC 2E4FA 2UYLA 4K3HA 4M3HA 2OMZA 1INEL 5KUKA 1GKEA 4MX7A 5JPNB 4X6EA 1BVOA 4J3WA 2BSSA 1ZXKA 3SD2A 1F41A 5DEGB 2HRLA 4OGQC 4KVNL 5LXGL 4LHUD 1DJHA 2YZ1A 4IOIA 2DQUL 1FHNA 5BOZG 4HT1H 3I50H 1OOWA 1RZ8B 3H7LA 1A8ZA 2ZWZA 3GPEA 1KBPA 1A7QL 1XZ0B 1AQHA 1OHZA 1DJIA 1N8ZA 2IALA 1WS8A 1E28B 3RHWF 4W70A 2QQKL 4QXUH 2NNCA 2YGQA 1MJ8H 2HG5B 3VFOB 3QNZB 1AJ7H 3FYEB 3N1FC 4XB8A 2YA1A 2XC8A 3KPPA 4GP4B 5SWSB 4JO3L 4Z3TA 4FYRA 2B9BA 3GYRA 3ZE0F 2FX7L 3NDYE 3OF6A 4RX4D 4N0UB 3BN9D 4JZNA 4NKMA 2FCBA 2K8QA 2E9BA 4LLWA 5F7DA 4AKQA 3VWJC 2OZ4A 4KK9D 4K8RL 4NDMB 1LE5A 4I9WE 3V5KA 4R3SA 5I1EH 3CVHB 3PWNB 3V10A 3L3GB 1AAJA 2V37A 4NPYB 5HHOD 3TV8A 3SDAB 3OZ9H 3NMEA 1OP9A 3CN0A 3BUIA 2JQMA 4LOEA 2XWBA 2F54B 3LEYL 2XY2A 1DDHA 2OULB 4NJAH 3H9SE 4DIXA 2Z8WC 3VFPA 1Q1JH 1Q9KA 2WQ8A 1ES0A 4WI8A 3X12A 3LZOA 2OMXA 2N56A 3O9WC 4HJ1A 4KOCA 1RU9L 3D3VD 4QRUB 5BV7C 3FRUB 5A6IA 4WU7B 1IGYB 3FOMA 2JJTA 4OZHB 4I3RL 1HHHB 4ZTOH 4BFNA 4DP1X 5GZNA 5I5RA 4FFVC 1Z9SA 5AAMA 1BREA 1T3FA 4KQ4H 3ARPA 3DUSB 1A3LH 5C0NC 5FUZL 4PJAF 1KCSL 1MCEA 1TJGL 3F85A 3N04A 4W68A 3OLGA 2EYSA 1KWKA 3DO3A 4KK5C 1KLFB 4X6DB 5CEYA 4JQVC 3T3MB 4EZLA 5FGCB 1KTLA 5AOMA 1FNGB 1HJBC 3VRLF 2BIHA 1QLEL 2XZCL 3IU4H 3NZHH 4GY4A 4QRRD 3UBXG 4AL8C 2NX5D 4NZFA 5B1JC 1SLWA 2D7QA 1A4KB 4YLQT 4L4VE 5IJVA 1NDTA 2JJVA 4QKXB 2JB6B 2WN3A 1UB5A 1TTGA 3GSVB 4NNPL 1JGUL 3TEUA 1EXUA 4AQAB 1YPZB 3JV0A 3MROA 1NMBL 2NZ1A 3VH8G 2WHVA 1HILA 4OFVA 5CWSB 4L3EE 2JELH 1BIHA 3PNWB 5AB0A 4JFHD 2BP8B 2CE6A 3RLSA 1GGIL 4N8CH 1L6PA 2QQNH 1WWAX 3ZHLA 4F15C 3I6LD 1AXSB 2Z1KA 4OW6A 2ZYHA 4HULB 3P1VA 3WEXA 3O3EB 3RRQA 1L3NA 1PMYA 1U3YA 3BLPX 2OSYA 3IT8D 4R26L 4TQIA 5T3ZD 2JLLA 2UXFA 1C16B 3EH2A 3ZO0A 2MNJB 4OM0H 4GIPD 1N19A 3MVSA 4PGEA 2DB8A 3CZFA 3ZQ9A 4JDZB 3VX1A 3ZDZF 3UAAA 1IKFH 4JM2B 1RULL 3QWQB 4GMTL 1FCCA 3C60D 2MKWA 4JG0L 1G7QB 4ZAKC 2MNWA 3MV7E 3NCCB 4IRJB 4ZS7H 2IPUK 4PJ7E 3X3GL 1J0KA 5K1NA 2NZIA 4KUZL 4R0LB 2DQHH 5C0DA 2MQGA 3VVWA 2P43B 2XTJD 1D7CA 3GRWA 12E8H 4DKTA 4OUOA 4XNAA 2WBKA 4ZYKA 1ZSDA 3TPUA 3U4KA 1ODUA 5E6ZA 4HC1A 3VWJD 2V9QA 1IGML 4P2RE 1FP5A 3ULVL 3HRZB 3ZK0A 3JZ7A 3MRFA 4LMQI 4HZLB 2H3NA 2EJ1A 4IBWA 1YNTF 3DI2B 3FUNA 3MNZB 15C8H 4LCWD 4QRTB 4GAFB 2X1XR 3GHEH 2WQUA 2YPKA 4P46B 3WG7B 4FFTA 4QO1A 3O2WH 4PM1A 2G75A 3T2OA 2R8SL 3QS3A 5DUBA 4OF0A 3UYRL 5FOBB 4M7JH 1TYEB 3NFNA 4L3EA 3QZMA 1E6JL 1Z32X 4LSQH 5E6RB 3TEYA 5C0IA 2R0KL 5E00B 2J1WA 2QHRL 4KDVA 3V0HA 1IEAA 1GCFA 1MIEH 4H0GA 2ZJSH 1DQJA 2ZX7A 3K2MC 3NJNA 1V10A 2IFFL 2R69A 1J7VR 3MGAA 1DLHA 3Q9PA 4P4KC 5DUML 4EDWL 4FFVD 3SPHA 4XBPB 4XCEA 4Y7OC 3UJIL 1SY6A 4UTBL 1NGQL 4BFEA 1UZ8A 3C8DA 4FXGA 3BRFA 3VXRD 4YDLB 5CBEB 1TUPA 2GJ6A 3DGDA 2NYZA 1MG3C 3BUDA 4OZFH 1Y1DA 4M29A 3EJYC 3MV7A 3SOBL 1J0IA 4K94H 2VN6A 1NEZA 4JPWL 2GK0A 4PJ7A 4R7NA 2C5DC 3GMNA 5GGSA 5IREA 2BC4A 2R51A 1U42A 3Q1SH 4K71C 4FFZL 4MWFB 4WFHD 3TBWB 1D5IH 1NAMA 2LTQB 2KLSA 4JFOB 5DQDL 3P4OA 2X6VA 2GYSA 4P2RA 1I1YB 1VHPA 3MRLA 4P05A 3VYNA 5HP5A 1IKOP 2K6YA 2YQ2A 3X11A 3TBCA 5I23A 1HE7A 2X4QB 3WFEL 4JY5L 2EIEA 4XMPH 4PI2A 4QTIL 1XH3B 5EBWB 1DVQA 5FK9A 4OJCA 2EXYC 2XJKA 4GW1A 4PRID 1U93A 1UEYA 3Q5YA 5CU9A 4FQHB 1OGSA 4B7IA 1KCBA 3A47A 4K7PY 2DY2A 5DHMC 4EIUA 3MR9A 4X9BA 3GXFA 4G72B 4CVXA 4XBMA 2Q8BH 4XNDA 4YFLI 4NZTH 1NWOA 1PGRB 4N9GB 2CRIA 2NYYC 1IGIL 2OSLA 3AT0A 4GB9A 3MRIA 3D87B 4L1LA 1A22B 1BLNA 3Q13A 3TPKA 1KBWA 1DEDA 2BOBA 3G04A 5E5MB 3MPCA 4UQ3A 4MQXC 1FNFA 1KJ3L 1PZCA 1HEHC 1UGKA 1XTLA 4GT0A 4XXWA 4ZAKD 3IB4A 1AMYA 2VDOB 1FV1A 3E1F1 1INDH 4H0IA 5IG7B 5C08E 3V7MA 5HYSA 3OAZH 1FLTX 2J5LC 3DDGA 5I66B 4HUVB 1C8PA 3VFRA 1ZD6A 2VLRE 2FT8A 1CF8H 1LD9B 1TTCA 1W0YT 4MD0A 4Y2DC 3GIVB 5EZLB 1P1ZA 3HUJB 1UM5H 1BIIB 3Q48A 1A14L 4HXAH 3TYFA 4PG9A 1DCEA 3OKKB 2W38A 1E4XI 4MASA 1AI1L 2ZP9A 4HS8H 4TVPL 2X4SB 4N2HA 3OXSB 3GIZL 1UM6L 4N25A 1OGTA 2CQVA 3O8XA 4F57H 5I8OL 4ALAC 4FERA 3TIEA 4XAKD 5CJOL 3F58H 3RTQB 1UXSA 4S11A 3S3BB 4YSSA 1ZEAH 1CGXA 1P4LA 2WIIB 5EPMB 5FYLE 1DEEB 3EO9H 3AG4B 2YAHA 1ZOXA 1G7JB 4Y4FA 5HJBA 5ID0A 1QHOA 1CMOA 1CFSB 3V0JA 2QELA 4XOBA 4RRPM 4Q2ZB 1RJCA 1JWSB 1S7XA 5TDOA 3E8UL 3RE0A 5EFIA 4S10A 1KTKE 2VDNB 3OAZK 5T3ZH 5HYFA 4UBDC 3WTTA 1E4KA 3T2LA 1W6WA 1OY3B 1D5ZB 4R97B 4OIAA 1H3UA 2J12B 2OL3A 1DFBL 5HHQB 2X05A 3QC6X 3SN6N 3LN9A 4NKIH 3OGCA 3L1OH 3W11C 4Z3IA 3FFCA 4UZUA 4IDLA 4UOW1 1OTSD 3AU1A 4JFED 2DJ4A 3D4YA 4TNFA 3T0EB 1JV5A 2QL1A 4Y1AA 2X4OA 3ZE2F 1HZHL 2UXGA 3X3FH 1WZ1H 4AQ8C 2PPEA 5ALBH 1ONQB 2AJZA 3ZHFA 2HKHL 3IE4A 5F89A 3IGUA 1ADQL 3NCYP 1A9EA 2B8OT 1SGKA 4UV7H 3GM8A 5DS1A 3S36L 2ATPB 3DETC 4RZCB 4G42A 4GI8A 1MJ7L 4GUQA 2VDQB 1HHIA 5LCVL 4Z95H 4FQQA 4LBEB 5TGBA 3DUHA 5ES4B 4G83A 5DFAA 5E2TH 5C2UB 2N1KA 4PJAB 1TVHA 4BH8A 2EXYD 4TOYL 4PS4L 1BYNA 2B5IC 4GNKB 3WJLC 1RURH 3WIFA 5L8LB 2VSCA 3P9MA 4AM0B 4X99A 3QDME 5JTWA 4YJZL 1F90H 2R2CA 1BVLB 3O6MH 1Z2KA 5K33A 2Q7NA 4YWGL 5T1MB 2BVOB 2GI7A 5BV7H 4IIZA 4LLVA 1MKFA 5GHWH 1L9NA 4GAJH 4Q6IA 5B22A 2XKNA 4WO4C 1Z0MA 3MA9H 4GEIA 3CC5A 1P84K 4JE4B 3LJ3A 5IW1A 4M3JA 2MH4A 4MQXD 3ZGHA 1K6QH 4TVPE 5AVVB 4MA8L 5D6DA 2PCPA 1F4AA 5E9DD 1YEIL 4EI5A 3GSOB 4FQ1L 2TSAA 3QXTA 5ITFB 2OR8A 3C9NA 1D5BA 3FO0H 3HG3A 5CJBA 2A74B 3CPLA 4Y2DD 3QHFH 2VH5H 3MQIA 3T09A 5F8RC 3BUQA 4V33A 5FM5O 4Y16B 3RWCA 3OJDB 5TF1H 3UTQA 5BRZE 1WBXA 3NCMA 3FOLA 3DURB 4AL8H 3AXHA 2VLKD 3UCRA 3VI4E 5MEPA 2EKSA 5EU6B 2AEPH 5A6MA 1TYRA 4ANUA 3CFEA 4MAYA 4FD0A 1WBZA 4I18C 1IC7L 4F7PB 3VU2A 5H35A 4J3OG 4XNUL 3WKML 2PETA 2VWEC 4FX5A 4PD4J 4UNTA 4UM9A 1E27A 4HSAC 3LKNA 2Y1AA 4QKTA 1UJ3B 5KYNA 3PWPD 2X89D 3RGVA 1HXMB 2VR7A 2A83A 2VZTA 3OKOA 5ISZB 4X8GA 3QWOB 3HZYA 3QZOA 4JY4B 4ZDHA 3KYNB 4LK4A 5FYJE 4Z3JA 5TD4A 1EEYB 2UVFA 3QIUD 4N90E 3V0VA 1UM4L 3LH8A 1BAFH 1FH2A 1DBAH 5L9DH 3MRJA 3IJHA 2Z34A 1BQHB 3QUGA 1KXTA 2P5WD 3HC0B 3Q2WA 4I3SH 1X5ZA 2R29H 2Z3FA 1MHCA 3GJFB 5GGUA 5GGQL 5HYQB 3NGBB 3BAEH 4XNQA 3QYNA 4QHNB 1H5BB 1SHMA 3VFSA 4JRXB 2HTKC 5JXAL 3CMOL 3CDZA 1A65A 3RPBA 4YHYB 1YNTB 3MUY1 4IS6A 1XXDC 3HN3A 1EFQA 4L8DB 4IJ3B 1U8JA 5HHMB 3U4EB 5E23A 5HPMA 5JXEA 2V9TA 4KNSA 2WLMA 1DJGA 2DI9A 2APFA 5K9JL 3QA3B 1B4TA 1M6UA 4JRYE 4RQQB 1MCIA 1KPUB 3MNVB 1ORSA 4FKEA 2K4WA 1RZIA 5ALCL 2A4ZA 4C56D 1N3NB 5I1CL 2WBWB 3RY5A 4FXTA 2X9ZA 4JPSA 5A16A 2YXMA 3FUFA 4X98A 4O02L 1F97A 1L6ZA 1QSEE 3V9FA 3GTVA 3QDGD 3WEOA 1TVBB 1YEJL 5D2LF 3G5VA 1IMHC 3JV4A 2B15A 4LIQH 4RGNC 5ADPH 3MRKA 3JVGA 2FZ3B 5EEWA 2AHIA 2ZG1A 4RFNB 4CADA 1E2WA 5IGXH 1PDKA 2EUWA 3D85D 3D4GA 1CIUA 4PJXB 4G6MH 1WT5C 1H8NA 1VZIA 4MNGA 5CHNB 2YAEA 3CK0L 2LAGB 1PAMA 3L9RB 2ILLA 3K8LA 4J39A 3PPSA 4AGOA 1F4HA 2FH8A 3OAUH 3SDYL 4WO4D 1NSNH 1F00I 4X7DC 4B0MM 2D9CA 2D8KA 3CFJA 3BKMH 3NP4A 5DUPH 4BKLB 3HN8A 2BHUA 4P9HC 3O3DB 5MHSE 2HT2C 3X1NA 3WNMA 1B4LA 2AF2A 4XC3H 1QWHA 5KW9L 2F18A 1UOKA 3SDDA 4NIKB 2PXYC 5EO1B 4WZ9A 2YUZA 2ED9A 1UXLA 3FCTB 4NYLA 1F4WL 5FHBL 1A6PA 3HI1A 3C2SA 4P23D 1DQKA 1GMIA 5JIPA 4AH2B 4U49A 3DX9B 4PGCA 2EVIA 3NA9L 1NGXB 3C6LB 3DXAB 3QXAB 1TJIH 2IEPA 4HJJH 1HX0A 3GWJA 1FZOB 3ZL1A 5J8OA 3KDPB 2YPVH 3QJRB 4PMEA 1YSOA 3VW3L 4NQCB 1QZNA 1U91B 3IETA 5A2BA 3SJVA 1E4HA 3TGXA 4N2NA 2DEYX 2QV2A 2WD0A 2FL5B 3FSZA 3GTTA 4MNHA 3AS1A 1WC7B 5G5DA 3QI9A 4Z76A 5D7JC 2NDFA 3TWCL 2ALAA 3L5XH 3GLEA 5EEUA 9CGTA 3TA4D 5KS9A 3HHSB 4XP1H 1XIWB 1ROWA 3QQ9D 3I6GA 5AALA 4HG4J 1EX0A 3ZUCA 4OQTL 1ZVSB 5AUMA 2HTKD 4KNUA 1I4FB 4LCCC 4UQ2B 3O45B 3UEQA 4U1NB 4HAFA 1HHJA 4QTHA 4YK4B 1OAZH 3RDTD 2DI8A 1IBHA 1WZAA 1P5VB 4M02A 1A1NA 3KVQA 4XNZC 1MI5B 1KCUL 2ZXAA 4PCSA 2QGEA 5GISH 3BWUC 5FM8A 1MH5B 2DQFA 1U3NA 1RUKL 1B6DA 1SEQL 3D30A 5T3XD 2NNAB 1IVTA 2J3SA 2MFNA 1U9KA 3GTNA 5HD8D 3NCJH 3ABMB 5HDQL 3TFBA 3MV8D 1EUTA 4Z7AA 2J6EH 4PVMA 3HPJB 4OD2A 2BS71 4BSWB 2DICA 3ABZA 1SJEA 3MJGX 4L5FL 1E4XL 1Z9PA 3P2TA 4ALAH 3S0PA 1FVCB 2B9AA 3BXNA 1DVFC 4LLYB 1PZ3A 3CSYA 4L8CB 4RGND 3Q6GH 3SDCC 2FDBP 1FL3B 5D1XE 2NPLX 1P53A 3M17B 3KLLA 5EIVA 1Q9WA 1N70A 2V3EA 1OSZA 5I0XA 1SYSA 4QPEA 2WNKA 4F7EA 3EXJA 1FL5A 2Z31A 4HIPA 6TAAA 4L0YA 4FI8A 3NABH 3BUTA 5D9SB 2VITB 1AD9B 4X4XB 1T1WA 3O4LB 3CCHA 3DOSA 4P0DA 4O58L 4GSQA 1KF9B 3GNML 2HT2D 4ETYA 4R4NC 5I1JL 1I3GL 1MWAH 5DJ8B 3K0YA 1N0XH 1S7RB 3QR1A 1A6VH 4M9OA 1FYTA 4OCXL 1C5DB 2Z92B 5DDHB 4L37B 3GK8L 5F0MB 5C6TH 1CDGA 2PXYD 2PPAA 2ADFH 5EORH 1QRNE 3L08A 2VDPL 3MRRB 1BXAA 5F88B 4KQ0A 3HG1A 2HB0A 1YMHA 1YYCA 5DWPA 3C8HA 1KYDA 3MLSL 1E6OH 1HCZA 4NUJA 1IILE 2YXFA 1U8KA 1CD0A 4F8QA 2G3ZA 1I9IL 5H37A 3IDGA 5L8JB 2JE8A 1MVUB 3BVNB 4X42A 1RK0B 1IBBA 1FJ1B 5I5JA 4AV0A 1KN2H 4AYFB 1JZJA 4G3YH 3VXME 1AY1L 1K8IA 4XVTH 2D03H 5EB9A 1QYGL 1LILA 3PIQA 2FEDC 2WOYA 2DYRB 2EINB 3CH1B 4S1RL 5ETUB 3JUZA 2WV3A 3L2LA 1NGWB 4PVBA 1BF2A 3B8YA 4H88H 1K8DA 4CVZA 3WE6B 5I6KA 3VXSA 2EDDA 3EYFB 4A7UA 1GYCA 4DPCX 1JDDA 5ANMB 4NOFA 3HBGA 5LGHL 2DWYA 4J1UB 3KXFE 4OF7A 5D1ZC 3BZ4B 5AW8B 3ARFD 3SHSA 1H9VA 4NUGL 2EE9A 3QCVL 3G5XB 1NCCH 2CSPA 2HRPH 4AM0Q 3CHXA 2XVBA 4WV1B 2X7LB 1ZHLB 4JPKH 3O3AB 1F3DJ 5CJXA 4FLOA 3WO4B 2AJVH 2D31A 1W0WA 3VFWB 3NACL 3DJRA 3QRGH 5AKRA 3GMMB 5HYJE 1MFAL 3AXLA 4N22A 3QGVA 4FZ8H 1IGJA 2E7HA 3HE7D 5B1KA 5DSCB 5I8KL 4ZUTB 1V3LA 1SBSH 2BOLA 5D1QB 4HIXL 1I1AA 5IMOB 3B1UA 4MS6A 1HTYA 3BD4A 3IFNL 3CZGA 1NCGA 1K85A 1NCWH 4LSTH 5C7ZA 1E9OA 4GKOA 4LSPH 3HCVA 2ZPKL 1GZQA 1SEBB 4DTGH 2XX1A 2DYPB 1HCFX 2FQDA 4OI7A 2ED6A 4M1GH 4FQJL 1QFWH 1TNMA 1AGDA 2B4CC 2CIKB 1M05A 5FF6B 4PBVC 3KLHC 2XYBA 3K5RA 4OR1A 1URLA 4JY6A 2YMXH 2Y36L 3SKMB 4KRPC 1MHPL 1LK2A 5E4IA 1S7SB 4JHAL 1HI6B 2VJXA 5AZEH 1KLUA 5FYKE 4EI6A 3Q05A 4LLUB 2CJUL 4DN3L 4YE4L 1ZGLB 1U8OA 3I02B 4KMQA 5CUSL 3NFPB 1MXGA 4R4ND 5EUKA 4Z0BH 2I07A 1WEJH 5IM7A 2ARJA 2BSRB 3F7YB 4AGNA 5D2LB 4XH2A 5IK3A 4Y19D 4XMUA 3LVEA 3ZU8A 4XN8A 4AJ0A 1H3PH 3NAAL 4WF7A 5T1LB 3SE4A 3VO0A 4FTVE 2G3NA 2ZUQB 1U3HC 5T3XH 2DQGL 4P5MA 3QG7L 5HYJA 3BPOB 4ODBD 1F42A 4NS0A 2HLEB 1ZMYA 3V4UH 35C8L 3WFHB 2A6KA 2PYFA 3N1QC 2HN7B 4Y7MA 3RL1A 3ES6B 1VEMA 5J12B 2GSIA 4A63A 4XHJC 4HIHB 4Y89A 7CGTA 3FTGB 2H32B 1VGEL 1CK0H 4KTYA 4WGVB 5FKAB 2EXWD 4Q56A 2NY0B 4JO4H 2FEDD 2HRHA 4G8EB 2CZNA 4M43H 1HQRA 2Q5BA 1EHLL 3BKYH 5DJCB 1RJZA 1B2WL 5E1GA 2WIMA 3M6DA 2GBAA 4J3SA 3QORB 1VADB 4JFDA 3MRNA 3QVAA 3M7FB 4PJ8A 5J06A 3T1FA 3IE9A 3LAFA 1UADC 2IPUG 5KVGL 1NINA 4GUCA 4KHTH 3KM1A 4GKNA 1LO4L 5F3BB 5HHNA 1VZGA 4P9HH 4AZUA 3NUKA 3K6OA 1EEZB 1GC1L 1VGKB 2WINB 3HAEH 4GAAA 4RISL 4S1DC 3B9AA 5DI8A 3NN8B 4G1MB 1SJMA 3L6FB 1IQDA 2HYMA 4KHXH 4K5LA 5KG9A 2R2HB 4N2KA 4PJ7F 2FNWA 1HWHB 3N55A 3BRGC 2OMBA 5FCUH 3S5YA 4F20A 5EWIH 3RAJH 4F7CA 2CJ3A 1BG1A 2IGLA 3QXDB 3SPIA 1E9PA 3FQWA 4HK0B 4PTUB 3FT3B 1QNZL 1SPDA 5MERB 3QIBA 3BISA 4Z0XA 1WS7A 1IBGL 2XWZA 2UY7A 3BAJA 5E8NB 2BH0A 2V17L 4XP5L 5I16B 2WM0A 2CCWA 3QISA 4XC1L 5FA4B 4HWBL 3TJHD 3ZMRA 3RWDB 2I24N 5JHDD 4QIRA 3BIKB 1DQMH 3SDXE 1XCTA 4POZC 3ECBA 5JW3H 4JR9L 1A6ZA 2A6IB 3IJYB 1JV2B 3V4VL 4MB4A 1U41A 3VE0B 2Y4SA 3G6JE 5DRNB 3EUDA 3KLHD 4RWYH 4PTTA 5IFJA 4GKSB 2QSQA 4ZMQA 3LXAA 1EJOL 1QO3B 1S7WB 4KDTA 4GW5B 1WAAA 2MQCA 2RH0A 1PZAA 4FZEL 3ZPDA 2Y5TA 4H1LH 5A2LH 2BK8A 5E1IA 5JR1H 1LLAA 1MCOL 1YUHA 5B38A 3DECA 1OAJA 4XP9H 1DBMH 4AXWA 1Q94B 4CDHA 5FCSH 4MDIA 1QI4A 4X5PA 5EOTA 4YMPA 4QOKB 3CXFA 5CCKL 2W60B 4IOSD 3QWRD 3IDXL 3QORC 1R0AH 1U4FA 2GUOA 1M9SA 2UYLB 3FHAA 4B53A 2ZWNA 3GKZA 4G8GD 4MX7B 2WW8A 3QR2A 1S9XB 2KQNA 1UA6H 2BSSB 4WJG3 1U3HD 4XXDA 1NMCB 1TT6A 2A1WL 1TTBA 4WTZA 4HPYH 4E0RB 5FYJU 1M1XA 1E3ZA 5DJAA 1OWWA 4IOIB 5MENE 3J7HA 4ONFH 3QXWA 3IU3A 3P0VH 3VXPA 2G5UA 2PP8A 2W91A 4XHJD 3AS0A 4LHUG 3WD5L 4BGLA 2BHZA 3GD1C 1N8ZB 3ESMA 3QIWA 1N6QH 2X6BA 5B8CA 4MQ7B 2ZOLA 4B60A 1PYWA 4HF5L 2E7LC 4ADGA 4M7ZB 2W9DL 3GMLA 1JYNA 3WLBB 3SDXA 4OZFG 3GT6A 5F0PB 4L4JA 5JQ6H 4KJWD 5DU7A 4I2XE 3QARA 4X5QA 4UQBA 4JZNB 4LLWB 5F7DB 4ELMA 3G6JA 2O5XL 2PWFA 4U1GC 1LE5B 3QJVB 2YJQA 4LGSB 3BLKA 2JVUA 3V5KB 2D7PA 4H8UA 4R3SB 3WFDH 1OOAA 1TF4A 1MHEA 1JCKA 2OA9A 4ACTA 4CUCA 4X0NA 2JJSA 1AG0A 4WI6A 4MA3A 4JB9L 4P3CH 1LP9A 5CP7A 2KS0A 4ZSOE 1FN4B 4IK6A 2DWSA 5GS3A 4Z8FH 5CEZL 3LPPA 3O6LH 3V0GA 5ILTH 4XCCH 1SM3L 2EDKA 3VFPB 1B88A 1Q9KB 2JKRM 4YHNA 1ES0B 3UROR 4B95C 1CTMA 3HI6L 3QULA 4U7MA 3WJJA 3WO3B 2M26A 4ES9A 1M9WA 1R47A 3X12B 3P69A 2OMXB 5JNYA 2ZE0A 3B83A 3X2QB 5DVLA 4XWOD 2MNUA 5KVFE 1BZQK 4IBSA 3FOMB 4LSVL 3C5SA 5JYLA 2WLKA 3WTUA 4HWEL 1FNLA 1P9MA 1FO0H 3AREA 2WBJA 1T3FB 1B9ZA 4AKOA 1AR2A 5MENA 1WWCA 1JJUA 1YVLA 4FL4C 3BGAA 1BEYH 5I30L 1BGXL 1UWEH 1V7NL 2VQ4A 2A4CA 2EYSB 1ACXA 1NCUA 2Q3XA 3MJ9L 3EKCA 4POZD 3DJTA 4FDWA 5E6IC 4PV9A 5CEYB 3RGHA 3SGJC 3QBTB 1KTLB 4LDEB 4HGMA 5T1KA 5IMLA 3PXHA 4OCLC 1WYJA 2AXGB 4K3DL 4YXLH 4Z7QE 3VXNA 2I9LA 3CE1A 4LPXA 5LWYL 2RFXA 3MBXH 4L18A 1S78C 3KPSE 2DQCH 1OZTG 5IJVB 3AJ7A 4Q74A 2EIDA 1H3WM 3SKOB 1KZQA 1QW8A 3VWKD 3RVVC 1G0XA 1UB5B 5JA8B 3CN2A 1XBRA 1MQKH 4IBTA 4W6YB 5AVUB 2H3KA 3AS3A 4Y1TA 1R5IA 3UIYA 4OLVH 5F93C 8PAZA 4DGIL 4TTGA 1QRKA 1ZS8A 5CN2A 3KLSA 3X17A 4FQCH 1FFRA 4NQDE 1H3GA 2H9GA 2A9NH 4HWZA 1JGIA 4U2ZA 3D06A 3MUJA 1J9SA 3WEXB 1IEBB 1QMUA 1T04B 2ICES 3ASOB 4TQ8A 4QRQB 2Z4TA 3BDBA 4PYGA 4YIQA 5IY5B 5DZLA 4BFIA 5HI5C 4YDMA 5DJ6B 4AYDC 5CZVH 2VYRE 3LDBB 1V5JA 3SZKC 5F6HI 4JJ5A 5C09A 5C9JA 4ZX4A 1E40A 4K07A 3S48A 1ZLVH 5JUEL 2IOIA 4L9LA 4GRLD 4N2AA 3QUMA 4AYBA 1BPVA 2GAZA 3RIKA 2C1OA 4HETA 1PCXA 1N7MH 2MHAA 3BFQG 5IR1A 2JI2A 1OCWH 3MX0B 4K7FA 4YDZA 1SQMA 3PL6A 1T0MA 4RSVA 4LXFA 2Q8AH 5C0DB 1YC8A 3T8VA 3KAAA 3DV4A 3SGDI 2JJTC 1HH9B 5LGYA 1TZGL 4YGAB 3S5LG 2WWKT 1ZSDB 5AAMC 5JHLA 3TPUB 1JP5A 5IBLC 2X09A 1DUYA 3HNTH 1AH1A 3OKYA 4AE0A 5BJTA 2H3XC 3F6LA 3HC4L 3MRFB 1IEHA 4OD1L 4PRDB 4IBUA 4JDTH 4KDWA 1TPXC 3UJTH 4UMGA 3MA7A 5KVEE 5JORA 3OC8A 3D4CA 4WVRA 3QO0B 4Z7WB 2YPKB 2R59A 3EYSL 1NGPH 4QO1B 1EGJA 1ET5A 1A7PL 4Y88A 3RIFK 4OZIB 1CU4L 5CO1A 4R90L 4UQ9A 3CBJB 4LPTA 5JDSA 3NFNB 4L3EB 1QPKA 1KY6A 1ZLVK 3UZEC 4NQDA 1IEAB 4XPAH 4J5VA 2P52A 3L3IA 3MCLL 3MRMB 4I0PA 4K3GA 4WI7A 4DAGH 1ICTA 3U1SH 2XVGA 1DQJB 1I7TA 3DV6A 3IDNA 2YIHA 3D69A 4WHTA 2R23A 3CDGB 1DLHB 3UL4A 4HOXA 2OMVA 3OB0H 3T6ZA 3F7LA 4OGXH 4R5TA 4XCEB 4WAFA 2CIIB 5G4MA 4AVKA 4ZO6A 3F7KA 1FNHA 1UZ8B 1VESA 4FXGB 3VQ1C 2NY4C 5FW7A 3HMXL 1X9QA 2TSBA 2ZKHL 2GJ6B 4M7LL 2EDRA 3C8KA 2WANA 1BVZA 4X5LA 2MCAA 4N8UA 5E6ID 4L3CB 4F9PA 1KCWA 3LKPA 2J4WL 3ZX1A 4R2GB 1GS8A 2QSCH 1NEZB 2XETA 3LDBC 5D2NE 2CR3A 2GK0B 2ITFA 2K9UA 3C60B 4KH9A 3ZKSD 4AY0A 3BQVA 4GPVA 1S78D 1E3XA 2BC4B 2DD8L 4YXHL 1FQ9C 2NQCA 1NAMB 5IESL 3UCQA 3DSFH 1HNGA 2L7UA 1G7MA 2XTJB 1NMAL 3SQRA 1NCIA 5GRYA 2DH2A 3RVVD 4MSWA 3MRLB 1T83A 4KI5F 3X11B 3GPSA 1UENA 5KVDH 1NANI 3EYQC 3QCTH 3K1DA 4IQHA 5L2KA 2Y2WA 2OYMA 2LLGA 4EUPA 4P2QE 3Q8CA 3RWHA 1XGTB 1NLBH 5I1KH 2XPGA 1ZT4A 1JDCA 3R1GL 4GW1B 1U93B 1QSZA 4HIQA 4KZCA 7PCYA 4I77L 3MACH 5FDWB 2CDFA 2P48B 4LCWB 4OFYA 4TQHA 3OB0K 3GB7A 5JDJA 3FUHA 5AVYB 1KCRL 3MR9B 2WVVA 3B56A 4RESB 1UYWL 4AX3A 2LABA 4FCHA 1CCZA 5HI5D 3CFKA 2O6FA 4ZMLA 2ZKYA 3VGFA 4MXQC 3HNSL 2W9EH 4ESKA 1X9LA 1BLNB 5E2VL 4JW3A 1MAJA 1LK3H 3NSYA 4M1DH 2IQAA 3BE1H 3DX8A 4CVWA 3VVVA 2KUTA 2FECI 4G9FA 4IU2A 2R1WA 4UQ3B 4ENEC 3DJ9A 4ELKA 2EIZB 3KPQA 1FV1B 3O2DL 1R24A 4NBYB 5HYSB 1J8HD 4A2HA 4Y4KD 3B5TA 1A6WH 1IVLA 3V8OA 2D7TH 1NLDL 4GMSH 3MAWA 1NPUA 4PJGA 2P26A 3P3UA 1P1ZB 5KS9F 5LBSL 5KBDA 5CLZA 3FQRA 4PG9B 5EU4A 1HCVA 1Q9LA 4LVOB 3O4OB 4YZFF 5IBLD 3MZTA 3HB3C 2M1KA 3BZDA 2HX9A 4M62H 3IXAA 1BMWA 3NCXA 1OGTB 2ADGA 2XXMB 1J0HA 4L48A 1JGEA 4LPVA 5EOCH 3M8OL 1X5FA 2HVBA 4ZD3L 1P4LB 1SN2A 3S4SG 4MJHA 5I1HH 2OMYB 4GJTB 4HCGA 1Y07A 4OAWA 5ID0B 4BJLA 1SOQA 4PGBA 2G5BB 4GH7B 4CBPA 1IUZA 4I85A 5AYUH 5TDOB 1LO3H 3CTTA 4I9WD 5EFIB 5IFHH 3MUZ1 4BZ1H 4OKDA 3GHBL 2WLHA 3WTSA 2NSMA 2JQAA 1DBKL 1I31A 3EDFA 3WNJA 2DI7A 5I2IA 2E75C 4HPOH 4GP8B 3RP1A 1MREL 4DGYH 1JHLL 5MP6L 2DWEA 2N7BA 3RVUC 3OGCB 2KH2B 5BXFB 3FFCB 1IFRA 5FYKU 4F37K 3H9SD 1JV5B 5IWLA 4Y1AB 2X4OB 5BO0D 1A1OA 4GBXA 3RIAK 4Q0XL 3N0PB 5F89B 4KKCC 3L5JA 4KXZI 3F65A 1A9EB 5LGJA 1X5HA 1J8HA 4TSCL 5E8OB 4Z5RA 4GO6B 4UNVA 1OCZB 3BX7C 2BY3A 4G42B 4PJIB 3EJCA 4XXWC 3WMPA 1BEXA 2VGLM 3FUKA 5F7HA 2PWDA 1FIGH 1OGPA 1LM8V 4BQCA 4FQQB 5TGBB 1I8AA 1DANU 1HESA 5FGRA 2AANA 3DKHA 3GZPA 4N68A 1P4BH 4XBEH 2DQTL 2NT1A 3ROOA 4X99B 5CINH 4Z77A 4D3CL 4MMZA 3TEXA 5HHVH 4QDGA 1A4JA 1CQYA 1MCSA 3O8XC 2VZOA 3MRGA 3U7WH 4L4VD 4MXQD 4FMFA 4LLVB 4KQ3L 5J13C 4Q6IB 4EI0A 1HKFA 2XKNB 3I75B 1PKOA 1PU0A 3TH3T 3WHE1 1QD0A 3CC5B 2F19L 3VFVA 3B2UC 3G6AA 5IW1B 3KE0A 4ENED 5DVPA 4QJ3B 4Y4FC 3VD9A 3VD2A 4OIFA 3VXOB 2PCPB 1U4EA 5J6GA 5ESQA 4I9XA 4EI5B 4MJID 4M6NL 2FH6A 5GGRA 4N2LA 4BFJA 4IBYA 4NQSA 3C9NB 1D5BB 5I6PA 3TU6A 1KC5H 3CPLB 3TH4T 1RZGA 2Y07L 4OCSH 4W1TA 5IJKC 3WU1A 5CFHA 1L0QA 2B16A 2VZ3A 3RWCB 3KHQA 1SVCP 1JMXA 3ZJAA 1WBXB 3FOLB 5LAXA 4UANA 2OK0H 1AR1C 1FE8L 3DPDA 3HB3D 4OZ4A 3TO2A 1A7BA 1CE1L 4O51A 5MEPB 2ZG2A 4K8RD 3CFEB 4MAYB 5FO7A 1GPOH 5H35B 4KTDH 4QF1A 2WZ5A 4UM9B 5DGQA 4A04A 2OLDA 4XGZA 1DFXA 4ZOAA 3RGVB 2A83B 3BKJL 5CGYD 3OKOB 3F04A 3M46A 3HZYB 4DUXA 4PVNA 3WUZA 2BIMA 3QUYC 2F1BA 2FQGA 3KPRA 5D4QA 3V0VB 2FATL 1JZ5A 1M2VA 1QBLH 4UDTA 1FBIH 1NCAL 2XCMC 3IJHB 1L7TH 4JZJC 4PU2A 1W0VA 5F9WB 4AQEA 4HWNA 3ULUL 5DYFA 4LU5H 3L5HA 4Z7UA 5DD3H 5L4JA 4XNQB 2KT6A 1YZZA 3VFSB 2APXA 2EEFA 2YR3A 3U0WL 1S7TA 1DO5A 1QTPA 2CXGA 1IAMA 2NDGA 1QSFE 2ZOWA 3BPNC 3CDZB 3E8VA 3LPGA 3MTXA 2VDRB 3MI6A 4P06A 5J5EA 3N42F 4IS6B 4HIIA 3TNMA 1YNLH 5F96L 4AIEA 1VEPA 4Z3FA 1EAPA 1W72H 1U8JB 3PNRB 4GUOA 1XZWA 5HPMB 5FOJA 4WFGE 1C12A 4WI9A 1X5LA 2O72A 2NUTA 3NESA 2PN5A 5FX3A 4P59H 32C2A 4H44C 2GTWB 4HBCL 5TK2A 1ORSB 4B9ZA 4DN4H 1RZIB 2QFRA 3ZHKA 3ESOA 2DQIL 1N68A 3RWIA 4ZOBA 5A16B 4YPJA 1N64H 4EI5C 3CFTA 1K4CB 2Z7ZA 2D73A 3ORJA 3HOGA 4HMEA 1J18A 4MNQD 5D71L 1UD8A 3TVMC 1EHKB 3G5VB 3HNVL 3LHPH 3UERA 3BKCH 5GSVA 1GHFL 1TCMA 4TNVK 4E41A 3MRKB 3GBML 5DVNA 2A0LD 2WLZA 5KJRH 5GGTH 2ESVD 3WY3A 1R3JA 4FP8H 4LSDA 1PDKB 3TF7C 1NBVH 3BZEA 2XV3A 3QJQB 4MNGB 5I1DA 1UUNA 4NUPA 2ZTBA 2XN0A 2O5YL 3ABGA 1CB4A 3MODH 4NQTA 2BY2A 4G59C 5CILL 3QIUB 4JPVH 2PYED 4K3EL 2BOCA 4ZMPA 1WSST 4J6RH 5HDLA 2BFGA 2CDEB 1I85C 5K93A 3F8UB 4J8QA 1CBVL 4YQXL 3D9AL 3SDDB 4U1SB 4L1DA 2QHLA 3B7RL 4XR8C 5FFOA 3GLAA 2DQEL 2J25A 2OKMA 1OT2A 2SODB 3MC0A 3N50A 1UJTA 4N87A 5C70A 4BUHA 3HI1B 1R5WB 2BMKA 1ZT1B 5J11B 1BJ1H 5DFVD 1AR1D 3O6KL 4LSSH 3LN4B 3RA7H 4OV5B 5EEXA 1NPNA 4MKMA 5HJ3A 1KDIA 1L0YA 3QEGL 4JHWL 3ULVD 3I9GL 3JWNE 4PRPA 2ADJA 2P46B 4RA3A 2FSEA 4N85A 5C08D 3CV5A 4BFBD 5KBMA 4C56B 1IAOA 3SJVB 5FAAA 4UYPA 1WFOA 2VLRD 4W9DC 5F44A 5BMFL 1WH0A 2VDKH 2YD6A 1BLIA 2BM3A 3P0YL 1FI8C 5G5DB 3QI9B 3QUYD 3ARGA 2EC8A 4JKPL 2ENYA 3FF7A 3QDGB 3MOAL 1TDQA 2AAVA 2V2WA 1AO7A 5KS9B 1JZHA 2QLVB 3O0LA 4TTDC 4PRHA 4TUUA 4N2OA 4V2BA 4Z7VB 3I6GB 3R4DA 5DMIH 3OC5A 3GINA 3NJIA 1F58L 5F1NA 5AUMB 3C09B 1FNSL 4JKNA 4RFEA 4JKMA 3W9EB 2XXGA 3L4ZA 2Q0ZX 1HHJB 4F58L 3QZWG 4YXKH 1M71A 3TN0A 2ZXBA 2FK9A 4RBPH 5AQ0A 2MCMA 4XP6H 1IAKA 4NENA 3MJ8A 4IHOA 2DQFB 5J6HA 1KN4L 1DANT 1NCHA 3DVNA 4Z7NF 4N0FB 1YEFL 4X4ME 3WTVA 2JKLA 3AT8A 1U8IA 5CR1A 3DTUB 1NFDA 5DJYA 3U25A 4X50A 4JE0A 1F18A 2VERN 4K23H 1XR8A 4OFKA 4MRCA 4H8VA 4HMCA 1U36A 3DTXA 4K8RH 3VSTA 1Z9NA 1U8CB 3F00A 3THML 3UG3A 1FAIL 4P23B 4WNSA 1QBMH 1U8NB 3TVMD 1G6RL 3D2UA 2OS7A 4I7ZC 1MCQA 3KJ6H 4MYWB 5C0AE 1QLRA 3ZDXF 4ZT1A 1G43A 5CD5D 5I1GL 3V6BR 1Q9WB 2DH3A 3QUZC 4XCFH 1OSZB 1T2XA 1SYSB 3BGFB 3FS9A 4NX0A 3FUJA 4F7EB 2YEZA 5DQJA 4RBPK 3E38A 5DLML 1DE4A 4KY1L 5DHYA 3KH4A 1D2OA 3B9VA 1RU9H 2C9PA 1R4XA 1T1WB 3CCHB 4FHKA 3DOSB 1LO0L 1SUJA 4I3RH 4QY8B 4B9GA 4GXVH 4UU9A 3L1GA 1FYTB 1HSBB 4P57A 4B3EA 5FUZH 3SDXF 3P40A 1HHGA 1Z5LA 5AL8A 3RX7A 1OANA 4HT1L 3I50L 3QDMD 1XF4A 2EADA 2OW7A 4JL2A 4WNQA 4YDNA 3BPLC 3L3HA 3VGAB 1XH1A 3HG1B 1YMHB 4M8RA 3TBBA 2C4XA 3G6JF 3PJLA 1T22A 4U7KA 1R5VA 4ELMF 3CU7A 2DLGA 3GDCA 5KAQF 4NUJB 3FO9B 4X4MA 2ZONA 1E5CA 4QXUL 5CP3A 1U8KB 1BVNT 1MJ8L 3IDGB 3K80A 3VJ6A 4UMSA 1AJ7L 5F7AA 2PO6A 1LQBC 1Q9OA 4TVPD 4G7YH 4QRAA 2DM7A 1FA4A 5CFAA 1K8IB 4YHKH 4PGDA 3QUXD 4MTMA 4X5RA 2G0KA 1PZSA 3PIQB 3CH8A 4FFZA 1NCJA 1WIPA 4B41A 1K8DB 3MGTA 2BINA 4M5ZH 4CVZB 5I1EL 3VXSB 5E8DL 1JPSH 2VLJA 3LSOA 5BRZD 1MFBH 5IB3A 3GUTA 5IHLB 2G9HA 3OZ9L 4NEHB 3O3BA 5CGTA 4B6ZA 3ML9A 3HFFA 4NJAL 4Y5VA 4X6CA 3C5ZA 2AP2A 1Q1JL 2LE9A 1QHPA 4KUCF 4H1LG 1CGYA 2YOCA 2Y7MA 3WEMA 4GUPA 1FIEA 4DOHE 4FQXA 2Q9OA 4DP4X 1RULH 4LGPB 1E5YA 1LXMA 2D31B 1W0WB 2Z31C 4ZTOL 3U0TB 1QWNA 2ZWLT 4U0RB 4FXKC 3D0LA 3AXLB 1SMOA 4KQ4L 5A2CA 3Q2NA 1A3LL 3NVQA 1CXHA 2VDMB 2BSEA 5KSBE 1DCLA 1I1AB 1G7LA 2OL3H 5DRWA 2VSDA 2ITDB 3LD8C 3PDGA 3RPIA 2WP3O 3ILEA 3GS4A 5IEKA 2NW3A 4S1SL 1VFOA 1NC2A 2J1ZA 1GZQB 1XMWA 3IU4L 4JM4H 3NZHL 3N42B 5B21A 2IIJA 4K9EC 3U9UA 3ZYIA 3H54A 1XQ4A 1AGDB 3CFUA 4ZQKA 3K6FA 2ENPA 4WWKA 4UDUA 4YSUA 1M05B 2V7NA 4JRYD 3QUZD 2F5BL 5I19H 4ZXBA 3PHOA 4K15A 4JY6B 3DYPA 3RNQA 1D7BA 4R7DA 2JELL 3WV0A 2QHRH 1AXTL 5I9QC 4N8CL 2QQNL 1KLUB 4HHGA 3NCBB 4EI6B 5EF1A 4H20L 1J9RA 1OB1A 3KVPA 3CHPA 4XPGH 1QSED 4OIIH 3GS0A 3DX3A 4L1BA 4AQZA 5DUMH 5EUKB 4NO0D 3KDMA 3BH9A 2I07B 1IC1A 3O2VH 5FYLH 4IIQA 5IM7B 4OM0L 3UJIH 4TVSa 3H56A 4DVBB 5D1XC 4XH2B 4E42A 4NQXA 5IK3B 5FO8A 1WG3A 2E46A 1IKFL 5TDPB 1GRWA 3VI3A 4LLAA 3FT1A 3KCPA 4HV8A 3CNKA 3G9AB 3S2AA 2X3CA 4P5MB 3QXUA 4JPWH 2H2PD 1PFCA 5DD0H 2A6KB 4M4PA 3FQ2A 4MA1C 4RNRB 5I73B 3NIFF 3EJZC 2DQHL 2GSIB 3HHMA 3HE7B 4ZMTA 4X7SH 12E8L 1KIQA 4JKKA 4EN2A 1ADQA 4JZOA 2X2HA 4U05A 1O7DE 1BXVA 4IMKA 1G5AA 1PL3A 1Z66A 1OXYA 4P9MH 3ZO9A 2XQBH 1QA9A 2DTSA 2OTUA 3OPZH 4LVNC 3WFEH 1EUUA 1HH6A 4YEEA 1TZHA 4QTIH 1W8NA 3SPVA 3T1WA 3SY0A 1RJZB 15C8L 1BZEA 2ZKMX 1PY9A 3GHEL 4XP4H 2K0RA 5TE6H 4JFDB 3N06B 2XN2A 3O2WL 1EDQA 3MRNB 1UZ6E 3EW3B 4FLSA 5LBGA 4U3XA 3T1FB 5ERWA 4IM8A 3KWTA 4CGTA 4PLKC 4M7JL 3US9A 5K39A 4D0CB 1IGIH 4N86A 1AHWC 4LSQL 3RYMA 5MI0C 5EZIH 1OAQH 4OCRL 4GKNB 5HHNB 2YD9A 2WUBH 3QFDA 2PPDA 1GZHA 2COQA 2ZJSL 3EJJX 3WLWC 5SWZE 1OALA 5JIDA 1HHKA 2WXHA 3HG4A 3QFJA 4PJ9C 1JGDA 4ODTL 1U8LA 2XKUA 4K7PX 3IVKA 3L4UA 1G1CA 1TNNA 1E9PB 3GC3A 4G43B 3TZVC 2F53D 3APMA 3QIBB 4Z0XB 1HK6A 3UO1H 2V5MA 3L1EA 3AQYA 1M56B 5CN1A 4ZPVA 2WXKA 2C1PA 4Y19B 3AC0A 2V5YA 3W57A 4CILA 4BE5A 4K94L 2DKMA 3PXLA 4HUXA 3U36B 5IUSA 2IXQB 4XI5D 4TVPH 1BFOA 3UOAB 1LNUB 3D08A 1XCTB 3Q1SL 1EXHA 1MOEA 3MRPA 3ECBB 3H9ZA 1A6ZB 1D5IL 4E9WA 2NNRA 1I1RA 4A2GA 2JKWA 4EAEA 3N5AA 4ZMVA 5HY9B 2WWMD 4Z7NB 6CGTA 1VEOA 2VRKA 3QZNA 3VTTA 3ZKMC 2VR4A 1B2YA 3II2A 3OKNB 4YGVA 4XMPL 2F68X 1YYLH 3NEOA 1JZ4A 1PNCA 5C8JA 2DMGA 2YD2A 2GUYA 3E8UH 2P5EE 3BGMA 1YUHB 2QR0A 3P3SA 3BI9X 4AXWB 2GFBA 2IDCA 3L3JA 5M7QA 1B0WA 4NZTL 4PJEA 3MBEA 5EOTB 4PGJA 2AEQH 1DFBH 4PJBE 4HGKC 2MIZA 5DC9B 5D1XD 4E5XA 4PJGF 3GSRA 2CCVA 5FYJH 4KKPA 4PJ8C 2UZPA 2NZ9D 3ZDXB 3V9CA 1QASA 4WI5A 3WHXA 2BIQA 4F33B 1XTMA 2DS4A 1E4JA 2X6UA 1WCQA 2HKHH 4OY9A 4PCKA 1INDL 1FH5H 3R0NA 4NI6A 5DJAB 3LRGA 4NN6C 3MO1A 3ARYA 3R4RA 1V3KA 2WXJA 3JYBA 3MLTA 4HCRH 4KV5E 5DJDB 3S36H 2D4FA 3EJZD 3IU3B 3QJUB 3VXPB 5IHZA 1CF8L 5GS2D 1O5PA 3FRPG 3IF1B 1UM5L 3MNWA 4HXAL 3VG0H 4DPAX 5B8CB 5ACZA 1RIUH 1PYWB 1DBJL 1QRND 4F92B 2ZAIA 3CX2A 3GMLB 1XXFC 2Y5QA 4HS8L 1LE9A 2EYTA 4MCYB 1OARH 4XTRC 1BECA 4F57L 5JHDB 3R8QA 1NIDA 4W9IC 4WCYL 3F58L 4O02A 4FKKA 5HDWA 2WXQA 4NGHH 1ZEAL 2DM4A 2WSDA 3ECWA 4ELMB 1CLOH 1USQA 5SX5H 3D0VA 4CW1A 2XQ0A 4U33A 1FZMB 1XF2A 3EO9L 4WNJA 4AITA 1JK8A 4PLKD 2L4OA 2C3GA 2W65A 3L45A 1MHEB 2DZEA 3D25A 3VXMD 4V1DA 3GMQA 1LWHA 5CP7B 1OKEA 4PG2C 1HYRC 1LP9B 1FPTL 2XICA 2P5EA 3OJMB 2EVHA 4XNMA 4UILL 3ARDA 1SN0A 5BRQA 3LRKA 5T3ZL 1G7HB 3WUWA 3AAZA 4PJ9D 4NN7B 4YHNB 4KDTC 1D3CA 4MZ3A 2BHYA 3QULB 3H85A 3HR5A 4H26A 4XHQA 4F3FA 4Q58C 5JNYB 1RZJC 3AWFA 3TZVD 4NKIL 4AIXA 3L1OL 2WCPA 3KXFD 4LOVA 2I7SA 3C5SB 2XJLA 2P7TA 1CDCA 5D72L 1KJVA 1WZ1L 3X3FL 2GBVA 3AREB 2WBJB 1A21A 1E3FA 3HTLX 1PVHA 4TV3A 3H2PA 4JO2L 2XFXA 3QE5A 5CIPA 1E5BA 3Q7JA 1ECZA 4UV7L 5SX5K 2EDBA 4JFZH 3MRCA 5KWYC 4PV9B 4UOZA 4AC4A 3H8NA 3LB6C 1VA9A 5GRZA 2LVEA 5IMLB 2D0GA 4Z95L 3VXNB 4IBQA 2I9LB 5J1AA 4QI3A 1L7IH 2XN9A 3ZKMD 1EWHA 1UM4H 1VACA 5DHVH 3QIWC 2FX8H 4LCYA 4EIZC 3VRIA 1RURL 1P7QD 2WUCL 3BSGA 1OTUC 5ANHA 3QQ3A 2ENJA 1DHKA 1F90L 4RMUA 3UO8B 1R5IB 3O6ML 4J3XA 1ZS8B 3RUGB 1KBKA 5F2FA 3PPEA 5BV7L 2BSTA 5DMJB 3CVDA 4R5XA 5GHWL 2YEQA 2H9GB 4HWZB 1TJMA 3DO4A 1LHZA 3IJSA 3MA9L 4E9XA 2NSXA 3HZVA 2XV0A 3H6JA 2X0VA 3OKEB 2BNUA 1FG9C 3MV9A 2CM5A 5IHHA 2VUKA 4YIQB 3LZFL 4ZW3A 1MCLA 3P77B 4G7VH 4BFIB 2JJSC 5FYKD 3RWEA 4JJ5B 5C09B 5C9JB 5D7LD 1TQTA 3WN5A 1DL7L 1V55B 4B50A 2M83A 3F7RA 3PAUA 4L9LB 4A7TA 3G08A 2GAZB 3QHFL 2VH5L 2IVFC 1RSYA 3BO8A 3E3QE 2C1OB 4WI0A 4BDVB 3V0WH 3IWUA 2MHAB 3WJJC 1MNNA 5TF1L 4JREC 3K7UA 3GKWH 2HAZA 2JCCB 3HHRB 4K7FB 4M8VA 5E5LA 3IKCA 3PL6B 4AL8L 1T0MB 4K9EH 2BS9A 1MRCH 2DDQL 5IB2A 1YEJH 4MVBC 5JO5A 4KKAC 4FTVD 1KG0A 1QFWI 1BAGA 4R4BA 1QSVA 3PDDA 3S37H 1CBJA 5H37H 3OKLA 8CGTA 3B4NA 4ZUUA 3QUHA 2C9SA 4Z7UF 1FFOA 5FHAL 3H9H<