1G4RA

Crystal structure of bovine beta-arrestin 1
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
387
structure length
353
Chain Sequence
b'RVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSDLASSDVAVELPFTLMHPKPDIVFEDFAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-ARRESTIN 1
molecule tags Signaling protein
source organism Bos taurus
publication title Crystal structure of beta-arrestin at 1.9 A: possible mechanism of receptor binding and membrane Translocation.
pubmed doi rcsb
total genus 69
structure length 353
sequence length 387
ec nomenclature
pdb deposition date 2000-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
A PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1g4rA02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1g4rA01
4J2QA 4ZRGA 1ZSHA 5F0MB 1SUJA 1G4MA 3LHAA 5F0PB 2R51A 3UGUA 3GC3A 3LH9A 2FAUA 4LL4A 4GEIA 3GD1C 1CF1A 5F0LB 4GEJA 1JSYA 4GFXA 3P2DA 1AYRA 4LL1A 4JQIA 2WTRA 2WTRB 3LH8A 3UGXA 4P2AA 4R7XA 4R7VA 1G4RA 5F0JB
chains in the Genus database with same CATH superfamily
3STBA 2CBMA 2X6MA 1GRWA 2ZX5A 1ZV2A 1AS6A 4GKOA 1IAKA 4OJFH 4BKLB 4X5QA 1H8SA 2X4SB 2EIMB 4XNUH 4XBGA 1UT2A 1NWPA 1HIMH 3GD1C 2HJFA 4NHUA 3VA2C 5HVFB 5I66B 1K6QH 3F7RA 4U6YA 2F7OA 5T3XL 3TVMA 5C08D 3UROR 5I6PA 4N0RA 3W81A 3MYJB 4YGAB 2L3BA 2GJPA 4QRRE 4Y2DB 2QT6A 1AC6A 3RGBA 5A2LH 5EZLB 1FBIL 4YFEA 4R90H 4TSAH 1WZKA 3PXHA 2ZOOA 4KJWD 4AWJC 1XF3A 5MEPA 4R4FL 3SDDD 1IAOB 4PWFA 3ZDZB 4MDJB 1ZTXL 4NQDE 4QHMB 3T2NH 1NOFA 5DI8A 1WICA 2ESVD 3UZVA 4J6RL 4UV4H 5CBAA 2I69A 1K8DB 1RSFA 3IF1A 1QBMH 4LLQB 5ANMB 4C4UA 5D1XA 4AKQA 1YVLA 3SN6N 2O6CA 2GT9A 4G9FE 4U0RC 1B4TA 4TV3A 4Y19B 3L5XL 2XN0A 4K94C 4WDIA 3IDNB 5F9JB 5E24E 1BIHA 2DBLL 5B7EA 1UURA 2EYRB 1I8AA 3BUIA 2CLZB 1BEYH 4YS4A 4YK4C 3NJKA 3KBHE 3T1WA 2EDBA 2D31A 3P54A 4MCNA 4OI8A 4JRXB 4QRFA 4QLWA 1FVCA 4XXWC 2YD3A 3AXIA 1AD9A 1NCCH 1NM4A 1W6LA 4JFPB 2AQNA 4NERA 4HFUH 4UIMA 3VFWA 2BM3A 3ILQD 4BFKA 4FQLH 2ICCA 3B7RL 3MBED 2WYZA 4NQXA 5D7JC 2H45A 5JXAH 2CQVA 1CYGA 2DJMA 1MI5E 2NCEA 2Y36L 4BA8A 5CD3A 2W5PA 1MH5B 3QIWC 3QUMH 1RUML 1DFXA 3KPOA 2AZAA 4L8SA 2BOCA 4NCDA 2XT1B 3VXQB 3LEVH 4ZMXA 4OZIF 3BFQG 2BK8A 5DS2A 2XZQL 4IEFB 1BJMA 4HP5A 4J3SA 3DX3A 5I5IA 4GMTL 3OSKA 4I13B 4QR7A 5DURD 4N2FA 4PGJA 2N56A 1R0AH 5DK2B 1NFAA 1XR9A 4ZYKB 1CDGA 1JF1A 2V7HB 2VDNB 2WCSA 4HXBH 5DHVB 4UUJB 4GKLA 3N44F 2D3NA 4KXCA 3SOBL 5I75B 2ITDA 5KVDH 3QHTC 1KENL 1WDAA 4NQQA 3J07A 4N8VG 4YN3A 3STLA 1DQJB 2WTRB 5C09E 2OQJB 1SQMA 2NYYD 3VXOA 3WO4B 2ID5A 4B3EA 5EN2B 4DEWA 3OB0H 4AVHA 2E9IA 3QUXB 1VFAB 1UQSB 2EDFA 1ZT1A 1DJHA 1LJMA 3VXUE 3WNIA 5JPMC 4UOW1 5IQNA 5I1DB 1KJ2L 2CMRH 4ZW6A 1JERA 2DKUA 5I1DA 4L4VA 4C47A 1KIRA 1OALA 1IGML 1GCFA 3O6LH 3QJFA 5F7WC 3GKZA 2EDTA 2XY2A 1I8MB 2X6UA 2D0GA 4X6DB 2VO5A 3QO0B 2CIKB 2AXJA 5E4OA 3GS4A 4Z7QF 4QXTA 2A83B 5KVGE 1XSOA 5CSBA 3CFBA 3VFGH 3G6JA 4PB9H 1RIHL 5L8KB 3GRWA 1H8OA 1UD6A 2J8UB 5DC4B 4EKJA 4W9ZA 4Y19D 2CXKA 4X50A 1S7VB 2XPYA 1PZAA 3RWDB 5JW5B 1ZJBA 3GRWL 4QT5A 4LCCC 1F4XL 2Q6WB 3RWFA 5JOEA 2OX5B 3FB8A 4WENB 3UBXA 3ESPA 1FJ1B 3SDXB 3WOVA 3RU8H 3C60D 5HXMA 2OXGA 4U3CA 4ZPVB 4AGNA 2WCGA 4CMMA 2AAVA 3BD4A 1XF1A 3F84A 4APQC 3WEXA 3CHRA 2ICEA 1RI8A 4WFHE 1BAFH 1WFOA 2L04A 2WBJD 2ZKHH 2BFGA 1DVFC 4GMSL 2WBJC 2K4WA 5IQLA 4NQXB 1F4WL 5FO7A 5B3NA 1U91A 5PAZA 4BWUA 5IFJB 3WN6A 2H32B 1VIWA 2ZUUA 3BPLC 4UQ2B 3QISA 4FMKA 3CFKA 2A6KB 4OIFA 4QF1B 2XZCL 1HEHC 4H20L 3UJTH 1MJUL 2XYCA 3TBTB 3H3PL 2XNAA 2Y69B 4LF3A 4XVSH 1BQHB 3MREB 2W0LA 2AJUL 2CBTA 2AQRA 2ADFH 3NJLA 1QLEH 1BIIB 1HESA 4J2QA 5DEFB 2XBDA 2OBGA 1VENA 4QXUL 1MKFA 7PAZA 3WUWG 1WHOA 1KN4H 2B3IA 3CQQA 1TT6A 1XD0A 3LKOA 4GW5B 4PJIB 3QRLA 4PVMA 4JY4B 4Q89A 3JSSA 5AB9A 1YN6B 1QQDB 4TPRL 2XVKA 5DZ9A 3RVXC 5D7KE 4LP5A 2WXNA 2Z6FA 4BKLA 3L4UA 4PJBB 3HG1D 3TEWA 3KL0A 1CLCA 2GVYA 1UTDA 1WCQA 2HH0L 2W0KA 4ZUVB 3VFPB 1UEMA 1I8IA 3ZHDA 3SB3A 2V5SA 4TULL 3OMNB 3QDJB 5F97E 4HCRH 4C4KT 1A7QL 3EJZD 3TIDA 2KMWA 3TO4B 3LQAC 1IM9D 3CHQA 4KQ3L 2AEIT 2V7NA 1Z2KA 5C7ZA 1BLNA 3WMQA 5C0DB 1PCXA 2WXIA 2E9JA 1JCKA 3ZDYB 4BA0A 1SUJA 2J6EH 4HUUB 3LKPB 1K4CA 4PP2B 4Z7OF 3C60B 3VW3L 3KBPA 2X2HA 2HT4D 4W4OC 3S36X 4AM0Q 1KTBA 4W9HC 4PW4A 2W07B 3QFGA 4XBGB 2A0LD 2HKHL 3LEXA 3NFPA 3CVIL 3D85D 3EOTL 4JKMA 2X6CA 1GKOA 2C3XA 1MNUH 4PJHF 5KSVA 2NNRA 3PHQA 3IGUA 2IWKA 2WN3A 1IAKB 3DV6B 2Z8WC 2WKLA 4JJHA 1U8QB 1TTAA 1TF4A 1KWGA 1Q0YL 1FL6A 1UUNA 4P5KB 3A47A 4W9IC 2FLBT 5HHQA 3E7JA 4CJ1A 3V4UH 4RMQA 4PVNA 2X4OB 4KMLB 2NTFB 2QVIA 2J5WA 5I9QB 1OARH 2QKSA 4GIAA 2VDQB 3KYMA 4XTRC 1Y0LB 2IXQB 3IDMA 2W9LA 1VCAA 5DJAB 4Q56A 5AW3B 2J1YA 5C0GB 3ZE0E 1OE2A 1J05B 3FSZA 5I1KL 5I8KH 2FGWL 1T0OA 3KPSB 4KDWA 4YHKL 3OR6B 3D85B 2W9EL 3R8QA 1PY4A 3B9DA 4HWEH 3DSFL 4YE4L 3B2UC 3VD1A 3QJHB 3DPDA 1Z5LA 1SBSL 1A7NL 4BCXA 5L7XH 1HKFA 1NOAA 1D5XA 4ODSH 2CM5A 2A73B 2R27A 3MI6A 2IIJA 4KBPA 4LSTL 1RZIB 4PJBF 1UXSA 4B5ZA 5D7LB 3FC8A 2PTTB 5JIKA 1PD0A 3HG1E 3T6WA 4WUKL 4MCZB 3PXJA 4EE2A 4PH8A 1KCVH 2WINA 3QDHA 3NAAL 3VM7A 3SY0A 4LCWD 3TJEH 2A9DA 4PJHA 3JWNE 1O6SB 3ZT6A 3BGMB 5E08H 3MOBL 1LDPL 5T8IA 4X5XA 5HI5C 1A6TA 3I3BA 5FLVA 3NEEA 4OKVB 1B2YA 3E8VA 2B4CL 4X4ZA 4P8QA 4N0UB 1U8HA 3G6AA 1EFXA 3QIUD 2X1WL 4PN6A 2BXZA 2WQRA 2AK4E 1I9RL 5TE7L 2Y23A 4IOIB 4F7PA 4PG2A 1XWVA 1GC1L 4XCFL 2NUPB 4BKSC 3TOPA 4PJHE 3JV6B 3I9PA 1DQML 1RMFH 3PPEA 2QSTA 4F7EA 3MRQB 1U30A 1ZK9A 1L4IA 5L0QC 3WD5L 2Y7NA 3UJJL 3HN3A 1CXKA 1UACH 3U36B 3UPCA 4D3CH 4RQQA 4NKMB 2CJUL 1HK6A 4CNIB 5IB1B 5E5UB 4V33A 3UPRA 3TBYA 1PJWA 1NBCA 3VVVA 4N8CL 5JQ6L 3I6LD 3B7SA 3QEQD 2D9QB 3HAEH 2D9CA 3ULVL 1W6WA 3MQIA 4QEGA 5DSCA 1CZ8H 1EDQA 1YEEH 4YHNB 2FR4B 1KC5L 3LHPH 3L4WA 4OCRL 1HSAB 5DLLA 5DT1L 2Z65C 1D5MA 1LO0L 1L9RA 4BFIB 1EBAA 2EADA 3KWVA 5EU6D 2ALWA 3TT1L 4NO2B 4QRPE 1NBVL 4KUCF 2RJMA 3FL7A 3FSWA 5GS1C 5I18L 2VW6A 4FKHA 1AG0A 3MO1B 4NRYA 3D51A 4NDMB 3RZCD 1OF2A 3RPIB 3T77B 4PJAA 3SKMA 5IMLB 3FS9A 2FR4A 2NY6D 3SO3C 1HI6B 3FTSA 4HUWB 3S3SA 4A2MA 5BO0D 1UGNA 2BIHA 4H8PA 4PJBA 3S4SA 5BZWB 2AP2A 1FL5B 1E65A 1LGVA 2QQQA 4JPKL 3SGKA 5LUMA 5EULV 3VGGA 5HD8D 4XXDB 1C16B 1YEGH 3Q1EA 2X53A 2ZUXA 5G4OA 3TONA 3HVDA 3FTUA 4NDMA 1LE5B 3BVNA 4LSVL 3BQUA 3D2UD 4GS7C 1OPGH 1Q0EA 2GTQA 3Q13A 4Q14A 4M5TA 1IFHL 5E2TH 5J6SA 2BRRL 4DP0X 3QZWA 4I0PD 5LCVH 5FYJH 3KVPA 4MTMA 3T3PB 1FYTE 3S88L 1I1AA 1TEGA 4JG9A 2P8MA 2YBGA 2QQLH 3HVNA 4HLJA 4YHNA 4UM8B 4JM2D 4JJOA 5GIRA 3FQRB 3FQTA 3SDXE 1FGNL 1RJYA 4NNPL 4F37K 3CU1A 4WHTB 1M3JA 4N0YH 3FQUB 4K23L 4JFYA 1SOKA 2FL5A 5D2NA 6FABL 5AL8A 5LN8A 4J3OC 4JVPA 4NQUA 5KTEH 3DRTB 4X5XB 1S7UA 3EFFB 4YZFF 2PN5A 3V5KB 2H6PA 1MW3A 1BW8A 1OANA 2BVOA 1SJEB 3D2UA 3U7YH 4L4JA 5AUMA 5BZDB 1BVLB 1JZ7A 3VWKA 4YDLB 5I76A 3F58L 4NJ9L 4KV5E 3HRZA 3CHSA 4BH7B 3B9EA 4BZ1A 4TLTA 2A1WH 3BDYL 1AYRA 1BQHG 1JNLH 2P28B 1BPLB 1I3GL 1S46A 4KX8A 3ZBMA 4Y5VB 2AJSH 4JRXD 5EU3A 3JTTA 2C4XA 1SDDB 3PV6B 3NJVA 2L7UA 3FB5A 4DK6A 1J9QA 4LNVA 3UTSD 5D7JD 1B2WL 1FG2B 5D7IA 3IJHA 1XV8A 4LCYA 4FFZL 1IAIM 3LNIA 4JDEB 2VXQL 4K7PH 1B0GA 3DKHA 4ES8A 4N0CD 3G9AB 4N2BA 5KVGL 5MEOA 1P4IL 4DN4L 3OKKB 4BFRA 3CLFL 2FECI 3M88A 3DK2A 4L8BB 4OZGA 4JDVB 1UOVA 4MD4A 2PF6A 3D09A 5D7SH 1WC7A 4NN6C 3V9CA 1UXSB 3LN5A 1E4WL 2ISDA 4G1EA 1N64L 4GG8B 2QADC 5IK3A 3RX5A 4IMLA 2VDLL 1L0YA 4P5KA 1WT5A 4P5RA 2QPUA 5HHXL 3Q7JA 4IRSC 1WAEA 1NCWL 2J25A 2LOEA 1Z5YD 1GZHC 2JIXB 4LLUB 3T0BA 4FFYL 2WAQA 4ZYKA 4X6FA 2A6DB 4CN6A 1C5DA 3VWJB 5CBEB 3BYTA 3WNNA 4MZRA 1O5DT 4S1RH 5J1AA 1LM8V 1JG9A 2ARJQ 3QS3A 3N5AA 4XC1H 3ARVA 4H25A 3RIKA 3MAWA 5IIEA 3PDOB 3UAFA 3PGFH 3LKSB 2DL2A 5I17B 1FL6B 2IH1A 4Q6IA 4OCYH 5F1OB 6PCYA 1FVEA 4LCUA 4J1UB 5IBUB 5G4MA 2ITCB 3OJMB 5TDOA 5I5RA 4PJXE 1HYRC 5CEXA 4JY4A 4PJ8C 2RGSA 3F01A 32C2A 4R0LB 3RI5K 3RTQC 3BFOA 5TGBB 5I8EB 3MOQA 2RACA 2Z7WA 3EBGA 1OW0C 3KE0A 1GH7A 4HIXL 4HUKB 1ERNA 3WLBA 1C08A 2PYFB 4WHDA 5JIHA 3EZ8A 2F54E 3WJJA 3QFDB 4BK5A 2EILB 2VLME 3TO4A 3WDJA 4FADA 2Y07H 4ESKA 1VESA 1EJ8A 1T22B 1FPTH 1AMYA 5EFIA 5ESVB 4BUGA 5L4MA 4LLQA 5ANMA 1X7SA 4JHAH 1F8TL 4IIQC 3FCBA 4TSCH 1JUFA 1M6OA 3PDDA 3NN8A 3PWUB 2NNAB 5E6RB 1Q9OA 3QZNA 1IGJA 4R4FH 4QKXB 1J8HB 1ZY9A 1U21A 2R0KL 3HE6D 1X6NA 3NABL 3DX7A 2DQDL 3IGAA 4YSRA 2VZSA 4ELME 4AIZB 4P46B 5DEFA 2KS0A 3WNKA 1G7HA 4AYFB 4M7KL 3RAJL 5E0QA 3UX9B 5CFAA 3AG4B 3AT0A 2N0KA 3NPSC 5DU7A 3SE9H 5JOFB 5B1AB 5HGHA 3WN5B 5B38G 2XRAH 4GG6F 2B1AH 2WN2A 1P4UA 3OTTA 2K8QA 1FFOB 1ACCA 2Y3AA 1SQ2N 2OMYB 3CVHH 4FP8H 1I9IL 1G4RA 1GYCA 4LLWB 1N68A 3KCPB 3X2QB 1MJJA 3E8UH 3QXWA 4HLEA 5CZVL 4LOVA 2C4FU 2ICEB 3ZKMC 4AE0A 3D39D 3S3BB 9CGTA 1R5IB 4GLRI 2MNJB 3B9KD 4QRRA 1JGIA 4KNUA 1UOLA 3QA3A 2P8LA 2PO6C 3FTWA 3UEQA 1KGIA 2VLJE 4M1DH 1D2OA 3I6KA 3G5VB 3NJJA 4F33B 1EXHA 3WLBB 5DC2A 2G2RB 4HCRA 3TC9A 4PRBA 1MIEH 3TX4A 2W8CA 4F7KA 1ZDSA 3OJ2C 3V6OE 3ZZLA 1RURL 2WXPA 5I9QC 1INEH 1FAIH 3GSOB 5F8RC 2IADB 4OQTH 4K94H 4GMTH 3ABKB 5SV3A 2H9GB 3T1FA 1LO4L 3L4XA 2YUVA 3P3SA 1SM3L 3GF8A 2BX5A 2J88L 3U48A 4P2QE 4TVPE 5D2LA 3U6XA 2HG5A 2FBOJ 4X9BA 4HGWB 1R24B 2YKLH 1VB9A 3OXRB 4KTDH 4F2ME 3MGTA 1WGOA 1BM3H 1F86A 1AR2A 1JWUB 1HINH 3SPCA 1GGIL 4JQVC 2WLHA 4KO6A 3GQFA 1OCWL 3T8XB 3O4LE 3L6FB 3VI3B 1N18A 3M7FB 5IM7B 4D9QE 3MJGX 2G9HB 4NKOA 4WUUE 3PREA 3UTTD 2GB2A 4XI5D 4UQAA 4UQIM 2FSEA 1NFDF 5DD0L 4DT2A 4PJAF 2DL9A 1UWYA 1IGMH 2Q8BH 5CINL 4ZTOL 2NLJB 2FTAA 1VGKA 3HMWH 1DN0A 3HG1B 4JE4B 3OKMB 4MJIE 4BUQA 4QGYA 4KK6C 4WFHD 1FVCB 4EZJA 4HXAH 4YO0A 4RIRA 4M8UA 1JI2A 3SE3C 4CU6A 1TXKA 5PCYA 2YD2A 5D1ZD 3VFGL 5J56B 1CF8H 2APWA 5E03A 4BHUI 2G3MA 5AOMA 1S3RA 2XQYK 3I6KB 2ENSA 4QRRD 3VGFA 1BHGA 4Y19A 4HPHA 5F7HA 1I85A 5EDSA 3QAQA 5HHMB 3SKJL 2X1XR 1KZYA 1R5IA 2FWUA 1CK0H 1K8DA 2CO7B 4CKVX 4Y16D 4UNVA 1EEYA 1VSCA 3FQUA 3ZX1A 5AD0B 2BIQA 1BYPA 4W9JC 4XCEB 3V6BR 3ZE1F 2WNKA 1CLZH 2CO6A 2VKWA 3ESMA 4L5FH 1UB6B 2VDNL 3IE4A 1TQBC 5ESVA 1RZKL 2P5WA 2V3FA 2WB1A 3SPVA 2WO2B 1JRHL 3B7TA 3BH8B 2BWDA 3AAZB 4OTXL 5AUMB 4HC1A 4TNEA 3BUPA 5AOJA 3FMGH 4HZLB 3BISA 1T5WB 3HE6A 4DGIL 3UC0H 4NHUB 2X1OA 3D12B 4JN1L 2GSGB 5EZJA 4B7IA 2OR9L 5HSFA 5I6XB 2H0JA 3ULVF 3EJUA 5KVEL 4WGWB 5LLIC 2APBA 4ZQTA 2CHWA 1KCRH 4M3JA 2ITCA 1TVBA 2H5UA 1CFVH 1NCDL 4OF0A 3MCG1 4Y4HA 4JL1A 1CFSA 4G9DB 3PJSA 5D4IA 4A04A 2J72A 1TZHA 3NTCL 5ALCH 4X4MA 3NGBB 3C6LA 4IGBC 5J0BA 4J2XA 2EKSB 1WIPA 2GJJA 3X14B 1RK1A 3HLKA 4AL8C 1BF8A 3D33A 4ONGL 1NC2B 3FF8A 5IFHH 2YXWA 3AFLA 3NZ8A 1S7XB 4ATWA 4U6YB 4EIZC 4JHBA 3HBGA 3HI1B 4JZJC 1ET7A 3S35H 4PRNA 4LLMB 2A77H 4H5SA 3TNNA 5B39A 1QW9A 5I23A 3ULUD 15C8H 3O6FB 4RFOL 4JUTA 2IDFA 3PL6C 2I9TA 2R69L 4M8RA 4HS6A 2IAND 3LV3B 5DWUL 3TXAA 1EK3A 2R4SH 5EWIH 1KPRB 5IIEB 5B1JA 1T2XA 1W72H 1OAYH 2VSCA 3ARDD 4J12A 4EZKA 4RQQB 3UTPE 1CGWA 4LCWB 2JKTM 4P5SA 1R46A 5C0JB 3RFZA 1QLEB 1AJ7L 1TYRA 4MMZC 4DETA 3BUBA 5EU4A 1XEUA 2HVJA 2AJXL 1NEPA 1UJ3C 3REVB 4BFIA 2QV2A 5AG8A 5ISZA 3WE6A 3W1ZA 3NGBC 4XCNB 3DX9B 4Z3EA 2H3KA 4FLQA 2AK4B 5KYYB 3LN4A 5J06A 2JKNA 2ZCLL 5HHOB 5ILTH 3IJHB 3QEQE 43C9B 3W9DA 4UM9B 3T8MA 3TZVC 4DO6A 3QWRD 3RB7A 1QHOA 4PJ5A 1SDDA 3A6BH 3TT3L 1LD9A 4PJ5E 3ETTA 2L8AA 5EH1A 1YNLL 3FBQA 1BP3B 4MLSA 2X9XA 5CCKH 4ZO8A 2GIMA 4D9RE 3M1BB 4HZAA 2EUVA 1U2YA 4ZUTA 4LSTH 3GBML 2X12A 3OLIA 4HT1L 1G7LA 4NBXB 3RLSA 3UCRA 5ISZE 2F74B 1PDKA 4XOAA 1MHEA 4ECNA 4IJ3B 2C7UB 2R0ZL 1JZDC 1Z0MA 3NH7H 5IGXL 3CZEA 2NUPA 3LH9A 3VGAC 2WP3T 2RALA 1G7PA 4XN7A 3IJ9A 3QCVL 1LD9B 3VXRB 4J39A 2O6DA 3ZDXF 3IU3A 4AYDC 1X5XA 5ABZA 1EFXB 1K3ZA 1S4IA 1Z5LB 2CG9X 5DMGC 3OF6D 2NNXA 3QEQB 5BMFL 1RJYB 3DO4A 3GSNH 4L9LB 4QHKJ 5JW4M 3QC6X 2B1HL 4I3SL 4AMKH 2Y06H 4RETB 5TE7H 1BAWA 2QQKL 2XETA 3DX8A 4HFWB 4NCC1 5B1BB 4F2EA 1GZPB 3OSVA 1O6SA 1WG3A 2V6HA 3GFUA 3SQOH 5T1KD 3WYRA 1DQMH 2VXTH 2GBTA 3OX8B 4YBQC 4KMTH 2I26N 4RMRA 2DQTH 3QFJE 3KLDA 3ARDC 2NTFA 3QPQC 4XC3L 1CPUA 4JMNA 4U1IB 2OZ4H 3B5GA 3D4YA 1MLBA 4X8CA 4LPTA 1NKOA 5KYXB 4X4ME 4D3CL 2MOVA 3LV3A 5EUOF 3Q3GB 2JB6B 4OCSH 2AV1A 2N59A 4BDVB 3VXSD 3TIEB 2F7RA 5IROC 1AGEA 2JVUA 5HHVL 2GUOB 4TVPD 3WE6B 2DQUH 3B9VA 5FF6B 4KZDL 2X0VA 3WKMH 1NGZA 2BIMA 3HB3C 1S9WA 5E2WH 2BCKB 2D03H 3MRLB 3LHPL 3FF7A 3FQNA 4JFED 3IJEA 3OAYH 4NNXB 4ZQKA 3K6SA 2RCSL 4OM1L 1ES0A 3WY3A 3ARXA 3QIWD 2FUQA 4IGBD 4W6WB 1H0DA 1C16A 3O4LD 4UAOC 1JXJA 3O9WB 3ZSTA 4DKEL 1FE8H 2YAFA 5HTSA 5HHQB 5I18H 1FL3B 2XA8H 1QSFB 3MBEC 2E56A 4L3CB 4D9LH 5ID1A 5F7NC 1N8ZA 5E4EC 1DQVA 1UM5H 2YA1A 1D5RA 3TBWB 5C0AB 5E2VH 1MY7A 1IUZA 4PJAB 4X5LA 4PJ7F 1PYWA 1DQLL 2FT6A 4AUJA 5B7MA 2BINA 3IRZA 3ZTNH 3ZK0A 3TF4A 4ORZC 1W16A 3N1MC 1MFEH 1S7XA 5ADPL 5GZOA 1GSKA 3MREA 4Y2OB 1EEQA 2R29A 4AGOA 3O4OC 3C6LB 3MXVL 3H3KA 1WA2X 1NC4D 3NSDA 1YNKH 1DLHB 2J1ZA 1FSKB 3FN0H 4ZUVA 5TDPB 2N01B 1J8SA 4HKXB 4MQ7B 4Y4HB 5GGUB 5KBKA 5L8JB 1EEUA 3HC4L 2N1TE 1L0QA 4KJYB 4ZAKB 5TE6L 4Z8FH 2DN7A 3CUPA 1MUJA 4ALAC 2X5PA 3IK2A 3H54A 5FUOL 2IFFL 3G5ZB 4O58H 5IJCC 1XF5B 4QHUA 5K1NA 2JTDA 4G59C 4HISA 1JGVH 3NJHA 1R3HB 3B3BA 5L2KD 4AGMA 5DJCA 1U8NA 2RBLA 4GKSA 5LBSA 4JO4L 5I74B 2WMPB 1ORSA 4FMVA 5SWZE 1ZLSH 2B59A 4LDLB 1BXXA 5FW6A 2E4FA 4QF1A 4DSYA 1KY6A 3CFKB 4JS7A 3DX0A 4G80A 1DBMH 4FLRA 4KI5F 3G08B 4FG6D 1JNJA 2ENJA 1TCRA 4JDZB 4QXTB 2AMUA 5MENB 3AWGA 4OCWL 4K3GA 4YDNA 3OKYA 3UP1A 1OB1A 5I0DA 4JQXC 3TN0A 1NDGA 4OKVA 1LE9A 2B5IB 1TQCC 1L6XA 3GO1H 1N0XL 3SKOA 1UA3A 5IM7A 1BVKB 5A6LA 1G7QB 1J88A 2OX5A 3FB8B 2DEYX 4FFZH 3F12B 2X2IA 4PTTB 4LLDB 2BHUA 4GLRH 3KPTA 3LSOB 5AKSA 5DRWB 2GJ6E 3HAEA 3HC2A 5D71H 5E94B 3U4KA 4TRPL 4G8FB 3PUCA 1RERA 1SXZA 1XD1A 3EJRA 5F3FA 3U4EA 2QSQA 5D7SL 1ZHKB 4GQQA 2Q1EA 2YGNA 2XWJB 3F62A 2HVKB 4JFOA 1W72B 1DQJA 2WTRA 5AVWB 2OTWB 1RUQH 4K7FA 3T1FB 4O4YL 4E42A 4YHLL 5HPOA 3SKNB 2ATPA 4X7DC 3L9BA 4WWKB 2AK4A 4HW6A 4S0SD 4YXLH 4DGYH 2W07A 3VD0A 1TKWB 2CKBL 4JFHE 4URTB 5JPNC 3AY4C 1F4YL 1E4JA 4WKZA 3T0ED 3F7YA 1IBGH 4YMPA 4OM0H 3WMSA 3MU3A 4WWOA 1JWUA 3PS6A 1BLNB 1BZ7A 2VLJB 3OG4B 1XGRA 4ZS7L 1V8HA 1Z9SB 1X5YA 4HUCA 2FBJH 3CX2A 1BZDA 2NNCA 4YXHL 2R59A 5ABAA 4E68A 3JBG7 5FA3B 4P3WA 1ZXQA 2HG5B 4XP1H 4YLBA 2X3AA 1QUNB 1U58A 1K4DA 5DR5L 2HT2C 1OD9A 4YC2C 4ZJ9A 3SDDB 3GINA 3HKFA 3LTVA 3UIYA 5KVEE 1FZKB 4TQEL 3TPUA 3DETC 3DV4B 4HX1A 4UUJA 3CGTA 4WJ5A 4NN6B 2CWRA 4YDKH 1R3IH 5HGHB 5LXGH 4YXKH 1UWXK 3ZRSA 1Y7VA 3G04B 1AYOA 5LGJB 3QRBA 3AWFA 3V9FA 4Z7UA 2VJXA 2XVGA 2VE6B 1U8OA 4DOHE 1LLAA 5I1JL 4EAEA 3DX7B 3MV9E 3QP3A 4G9DA 3F00A 4DZBA 4O51B 4J3OD 4R90L 2ADJB 1XGYL 3OPZL 5E6IB 1IAIL 4Y5VC 2WZAA 4ZMLA 4BFGA 4O51A 1MCHA 2ZKWA 1GJIA 4M6ML 3S96B 2K8MA 3LKOB 2IGFH 2UZIL 1UA7A 3EH2A 3VI4E 2E3VA 5I1IL 4OGZA 4KH9A 2QPSA 3UBXB 2R0KH 5AZEH 2FJHA 3ME0B 3TYFB 3GI9L 4E9SA 3T6QC 2VDKL 1KEMH 4M9PA 4TOYL 5I66A 2YPLA 2J56A 2W9DH 2P5WD 4LGSB 2NSQA 3H1ZA 3GNMH 4RCAA 5JW5A 1S3KL 3OGCB 1R34A 1V3MA 1UB6A 2W88A 1JHKH 1IB5A 2EIEA 4WJ5B 1DBJL 3U83A 4AGPA 3H42H 1BMGA 5EORL 1Q9OB 2RTTA 5T5NF 4KDVA 5I1LA 1M6OB 4P4KC 3QQ9C 2PCXA 3FU3A 2VLKB 2CO7A 1HH9B 3LB6C 4RGMB 4MAYD 2F9BT 2HUEA 2HKAA 4LZKA 3ATAA 1CDCA 4LLYB 4L23A 4G1MB 4DUWA 4OLUL 2D4FA 1O9WA 2ZG1A 2ZYRA 1XGQB 4ALAL 1T0PB 4U3SB 5HDQH 3MRMA 4IYKA 1TENA 3MHZA 3WTSA 3Q6GH 1C5DB 3VWJA 2X4PB 3ZKSD 1TJXA 4U1JA 4U0QB 3RWEA 2VR4A 4GBXC 5E6UB 3D5OF 3PHAA 5D5ME 4JZOA 3ARYA 3UTQA 3VXOB 2FH8A 1T5XA 4ZOEA 4WF7A 1BV8A 1LK2A 1WAAF 4I18B 4PCSA 5SWSB 3QCUL 3EAKA 1FAIL 3NA4A 4DKTA 4Y0GA 2JKLA 3APFA 1BFVH 3CK0H 2JXMB 1JDAA 1Z9SA 3BAEL 5DK2A 3MGAA 5FYLL 1Z3GL 3FRPA 4RRPM 4FYTA 4XNMB 2JQMA 3MLRL 3QZWG 2GI0A 2V5YA 3HB3B 4Z0XA 3IJSA 4U4IA 4C58B 3OWEA 1Q72L 2WZ6A 3C2SA 1XGPB 3FTZA 1DDTA 5DK0B 1R24A 3EH5B 3OXRA 3PY9A 4MA7L 2DQGL 5FW8A 1FH2A 3FOMB 2P5EE 3Q8BA 5K9JH 2WUCL 2VAAB 3ECQA 3MV7B 3G7TA 3Q5YA 4YFDB 5MERB 5KSAA 3EBAA 2BVQB 1MHCB 4W9KC 4YBLB 5A3ID 4FFWC 1AO7A 1QA9A 5I1CH 1DZ0A 3H9SD 1KULA 3TZVD 5EUOA 3PV6A 1A3ZA 4G7RB 5DRZB 5IESH 1X5MA 1KELH 1AZBA 4UT9H 5CSZA 5K9KB 3LNGA 3MLWH 2GABA 3HRZB 5EOTB 1KTKE 3HOGA 4PB9L 2UY6B 4ODUA 4J3UA 4Z3JA 1OWRM 1FNGB 3L08A 3SCMB 2B08A 2DLEA 5DJDA 4NHCH 3KLHC 4N2GA 4FQ2L 3BZEA 4L9LC 1B6DA 3GUFA 4P05A 4YH6A 2YPKB 3DMMA 3IXTA 1OGSA 1ZTMA 2DQ6A 4JGJA 4Z5RB 5TE4L 3UTSB 1TLKA 3O2VL 5EIIG 4AYGA 5IVXF 1TJHH 3QQ3B 1FLRH 2WPGA 3BPOC 4ZMWA 4U31A 2BSEA 4JREC 4L3FA 2HFEB 1ZD6A 3IKCB 4K55A 4G80B 2X4NB 5C09A 3V5DB 1ASOA 1IJNA 1VFBB 4KUCD 4F7CB 5J13C 5JOFA 3MUHL 3BDBA 2P24A 3Q05A 5ACZB 1R3HA 5GZNC 1IC0A 3QRGL 3MYJA 4MXWH 1F0LA 2VDNH 4XP6H 1MJUH 1TJGL 3QUYB 1S7RA 3KH3A 1KGUA 4W9CC 5DO8A 4QRPA 3MRKB 5I71C 2XXMB 1TFPA 3IF1B 2PR9A 2IPTH 3P3UA 2FWOB 4PW9A 5A2KH 4MS6A 1AR1C 3V0FA 4NOBA 1TITA 4H0IA 5IMOB 3ASWA 5F3BA 4N90E 3EXLA 4LOEA 2EIBA 1QYGL 4IRJD 5DGQA 4XP9H 4WO4B 4DN3L 4ERSL 3MRJB 4MNQB 3R7RA 5IEKA 1CGSH 3CX5J 4TPRH 2Y7QA 5KN5A 4XN8A 2Y4SA 3GMOB 4Y7MA 2DIEA 1CFVL 5FO8A 4UOQA 5EBGA 3DO7B 2P1YA 1N6QL 2ED7A 4RA3A 4UT7L 2FEDD 3ZGHA 3QE5A 4RDQG 3PNRB 2BC4B 1EERB 1S9WB 4PJGB 4JM2F 3QDMB 4ZXBB 1AG6A 3SJVD 1TJMA 2GEEA 1L9OA 2NY7H 1MIML 2E6PA 3KWTA 1TTGA 2AJZA 2CR3A 1S9VA 3EJSA 3VDBA 5JW4Q 4LVHB 2BHFA 5FGBA 3TBWA 4MJ5A 4KNSA 3SDCB 3RGVA 5KSUB 5KYWA 5D1XE 5JHDA 4XP4H 4OZHA 1QSFA 3LKSA 1OT4A 2X9ZA 3OV6A 4F8QA 4L8DA 4PIRF 3IFPB 3AG3B 3B2VH 4UOJA 5F7UA 3U2JA 3SKMB 5IB5A 5IMLA 3FH5A 4NN7B 5BZZA 5AVQB 3DJSA 3BO8B 5EWIL 4E41D 2VR3A 3HHMA 1KJ3H 2XTJC 5F0PB 3FTYA 3QJXA 1YDPB 3I85A 4OCNC 1HZLA 3N91A 3TA3A 5C0CD 3MRQA 1GW0A 4LHUB 1T7YA 1TTBA 3RWHA 3VMPA 1HSAA 1QSFE 1D9KB 5A40E 3GJFH 4OZHE 4IBLT 2RFXA 1K85A 2VMJA 4NJAH 5ELIA 5DSCB 4HSAC 5ITBH 3CDGB 1XGTB 2BY2A 5J3HC 5I8KL 3CFTA 2AJVL 4G3YH 1XZWA 5A2CA 4Y1AA 4UIKH 5KW9H 1S5HB 4A6YB 4NO3A 5A2BA 5FDWA 1PSKH 3U2IA 5KBDA 1H8NA 3BQUC 3FCTB 3AREC 4YNYB 4ODSL 5CJXC 1HDMB 1ML0A 2AEPL 4M4PA 2ZSWA 1X5HA 1R3LB 4L1HA 3NIFB 4NQEA 2CUAA 3ULUH 2DQJL 2V5RA 4F7EB 5E99H 3T4YA 3PHSA 2O5NA 1XF4B 1WIUA 2NZ9C 3KGRA 3UXFA 1NANH 4AQ1C 2A9CA 1OO2A 1T3FA 2DQFA 4UT6L 5L88L 3PF2A 4AI7A 3S8WA 1IGCL 1RZIA 3QRFM 3BPOB 2CDFB 4EEEA 4JLRA 4LDEB 1LDPH 1RZ7H 2DQCL 5D2NC 3ZPDA 4G9FD 1O7SA 2CDFA 2O5ZH 4J4PA 1GPOH 1C5BL 5AW7B 5IV2B 1MQKL 2W0FA 5F7YC 2G60H 5F89A 3I3DA 4KRMB 3LN4B 3KL3A 1TZIA 1XF4A 2FATL 5FCUH 2YQBA 2E6JA 3SE8H 3OLDA 3WNMA 2VC2L 2CGRL 2Y6TE 2B1HH 4I3SH 4A1RA 4AUYA 2O61A 1HXYA 2QQKH 3N9GL 4ZDHA 5C0NC 8FABB 1CDJA 2V2XB 4MBOA 1EV2E 3UJJH 3EO0B 2DZEA 3SBPA 3SQOL 2DH3A 5CEZL 1Y1DA 2PCPA 1A9EB 1KLGB 4LPWA 3ZRCC 5I1HH 3UMNA 4K15A 1MWAL 1QPXA 2J8UE 3MJ9H 2DLTA 2V0AA 2EVIA 1DBAL 3WL9B 2CNZA 2V3EA 2EZ0C 4G72B 2FIRT 5TFSH 3FQRA 2AK1H 2Y22A 3NJGA 2W65B 3G6DH 4L3AA 2WNWA 1G7IA 3WSQL 2DTMH 3ARBD 3J7HA 3D52A 1FGVL 1KWKA 4RISL 1CLOH 1EUUA 2BNRB 1YY8A 2HVJB 3T0EC 2F1BA 3A22A 3T3ME 1A7RL 3IDMB 3PRZA 5HDRA 4AV0A 3D30A 1L9TA 1NC4B 1LO0H 1QZ1A 2WUBL 3DO3A 2GBVA 4LIQL 2DLFH 3RB5A 4O2EB 4Z7QE 5C0EB 1CBJA 1ZVHA 1U3HC 2FT7A 3LDBC 4HHAA 3F5WB 1MVFA 3O4LB 5IOPB 1AO7E 2VQUA 1IV8A 4M6OH 2EDNA 2FAUA 3MBWB 1Q8MA 2PYEB 3EJYD 4WJKB 4MMYB 1JV2B 2Z7UA 3MA7A 3NIDF 4X5WB 5KSUA 3RGVB 5BS0E 1RZJC 5E9DE 2GITA 3UZQB 4BINA 4P2QA 1U0QA 3DUUA 4GBXB 2LLLA 3MRNA 4B60A 5K5YA 4WI3A 4CSTA 5GRWA 2ZUVA 5FOJA 5FYKU 3WENA 1X5GA 2I60L 1RP8A 3H6AA 1MZYA 3JUZA 4P2CG 4NM4H 1MVUB 2NY4B 4XH2B 1DQLH 4WAFA 1J0HA 2Y5QA 4YHOL 3Q8EA 3AAZA 3K2KA 5GRUH 1KACB 5D6CB 2D7NA 1L9NA 3QIWB 4UQ3A 2EJ1A 1IQDB 1I7RA 4R4BB 1JDDA 4X7TB 4APQA 3QHZL 2IDUA 3H55A 2ICEC 3D39E 1AGBA 3O41B 1CFSB 3BESR 4F8TA 4P4KB 4NZJA 3TEUA 3C87A 4WKXA 1Q9LA 1ZT7A 5D5MA 5B1KA 1QR4A 3RX8A 3GJEB 1HE7A 4FE9A 3AUWB 3UABA 4ZO9A 5DRNA 3UBHA 2JJUA 3RTQA 1I7TA 3FN0L 2WK2A 3H9HB 1WA1X 2PWHA 4XBEH 1W91A 2CHXA 4QTIL 5EF0A 2PR4L 3BSZL 1GS6X 3Q1SL 1KOAA 3BZ5A 4BK5C 1KJVB 2EYTA 4FNPA 1UCBH 4L4VE 1IM3A 1L0PA 2BMKA 4KTEH 4F7CA 3I9GH 3FONB 3TH2T 3RIFK 2ITEA 1E40A 4P2QD 4NPYB 1JWSB 1R19A 3VNZA 2FBRA 2LTQC 2ZD0A 4NO0D 5IFJA 4AW7A 1ZCRA 1BQUA 3CMOH 4UU9A 4JO4H 4IOSD 1Z9MA 2A1WL 4N0UA 1QKZH 2ZPKH 2B1OA 1DJIA 4ELMB 1DBML 1W9XA 4JJ5A 3L9RB 1DQIA 5HDBF 4D0DA 4R5TA 2WW8A 1XZ0B 1TQTA 4OCWH 1OGAE 5BS0D 3GYRA 2XZAH 2NT1A 4ZMPA 3T65A 3FUNA 4TNWK 5B8CB 4YQXH 2EVJA 4HJSA 4HWNA 1TZGL 4QT5B 4R7NB 4C8XA 2ZP8A 3T0EB 3PV7A 4P06A 4AEFA 5I15H 3A67L 4IBTA 4G8GA 4U1KA 2G9KA 1FZOA 1NGWA 3D9AH 1SJHB 1KXQA 3IMVA 2OZ4A 3MRRA 1G0XA 4U1NB 2EUWA 1AACA 3HBQA 6CGTA 2MPAH 5FO9B 4Z95L 4YR6B 5GS2D 4JHVA 3HPLB 2WZ0A 1U4FA 3TFKC 1D5IH 3O6ML 3RIAF 4HS3A 3ZE2F 2PW2A 1XR9B 3K6IA 1BVZA 2VT0A 3P2DA 4YDJB 4L18A 5C8JA 3GS0A 4JHWH 3CBRA 3H56A 4EMZA 3FRPB 4PCTA 3KDMA 5KYUA 4FAAB 1A4JA 1AIFA 5JPNB 1FN4A 3GSNA 1GOHA 1NFIA 2H26A 2GUYA 1OHQA 2H0FA 6TAAA 4EDWH 1VGEH 1SHMA 3NJXA 4M02A 2MFNA 4G6MH 1Y18A 4YHMH 2NXZD 4N1HB 2H2PD 1WISA 1FUNA 5DD6A 2NY1C 2BNUA 5FWQA 3ZL4H 1CDIA 4RZKA 4JZOB 4XVOA 3C09C 3POHA 2Z34A 3W11C 2DWYA 3WS6C 1PD6A 4MA1B 1GGCL 1O9ZA 5DJXA 1X44A 5IWLA 1ZVNA 5L6YH 2IF7A 5GGRA 3MFFA 4POYA 2EEDA 3KGSA 3PWPD 4HUUA 1Q9WB 4AQ1B 3BUTA 5IKCB 1OZUA 4TQEH 4OT1H 4ZW7A 3D87B 4WWID 1AQKL 3B7YA 1E67A 4EI0A 5LXGL 4JFZL 1CFBA 4AEIL 4N8VB 1K6QL 4MD5B 2X4UB 3VGBA 1YQVH 2FO8A 4D9RD 3ESNA 5MHSE 2EIDA 4MB3A 1ZLEA 5GHWH 2MCMA 2A4CA 2EH8H 3P02A 4E9QA 1E4XH 3MODH 4TSAL 3ROLB 4MDRA 1WFIA 2IDSA 3BLBA 1OWWA 2A5UA 5E00B 4PMFA 3HUJB 3L3DB 4IOSA 4WNJA 1G84A 3OGCA 2NMSA 3BAKA 4GSDH 3MRCA 4GAJL 4D8PA 1J1PL 3TO2A 4LBAA 2EYRA 4Z7WE 2IWFA 2R51A 1BBDH 1GVIA 2DM7A 4PRHD 4XO8A 4Z7OB 2C4FT 1JXGA 3VNYA 5FYKE 2D4DA 4IKIA 3P0YH 5DMJB 4U1HA 3LXUX 3RAJH 5GGVY 1A64A 2VISA 4GUPA 4UQ2A 3RA7L 1VZIA 2VDOL 1BEYL 1R5WA 3CLEL 4OZFA 2ARWA 1G5AA 3BMVA 3UG4A 3AY2A 3VO0A 4NZ8A 4F9PC 3S3CB 1A65A 2R2HB 2FHFA 2YK1H 3GK8L 3O3BB 4RMSA 4ZFQA 3O8XB 5C07D 2V8LA 1IAOA 3VRIB 2YMXL 4RH4A 4FQLL 2F5AH 3V0DA 4H25B 1IM9B 3FUFA 1FJ1A 3FZUC 3SDXA 3QFDA 5D1QE 4G42B 4FXKC 2VN4A 4UNUA 1BD2A 5GS1A 4PJGF 3Q06A 3PIQA 2IBBA 1A4KA 1JZIA 4K8RC 1WF5A 4KUZH 1X7QA 3EZJB 3LEVL 2YMTA 5AW5B 5FYJE 1LK3H 1LWJA 2ZX8A 3QXDB 32C2B 2GPZA 2Q3ZA 2FNBA 1OGTB 2R1XA 3N1QC 5DTFB 43CAB 4PWJA 4ADJA 1DVTA 4LU5H 3BAWA 1A4CA 1H3GA 3T4AA 1ONQB 3QWOA 4N87A 1QLRB 5D72L 3EYVB 1OE1A 4PRDB 5ESAA 3O9WC 2C34A 5AVUB 1INEL 1FFTB 1QUNA 3HW7A 4X6CE 2ERJC 4NKIL 3IAGC 2A74B 2WLIB 3W57A 4HJGB 2G5RA 4HC1H 5DVLA 4KKBC 4UQCA 4UILH 2EINB 3HE7A 5EO9B 4N0FB 4FA7B 3QUYC 4FQJH 5DUBA 5DVMA 4K9EC 3ZZ1A 4L1SA 1D6EB 3NP3A 3KYKL 3CZJA 5LG1A 4JPWH 1TQVA 2JLPA 1HVXA 1WBZB 3UTTB 5JZ7C 3VFUA 1IT9L 1MCIA 2J4WL 1VFAA 4LLUA 1B0GB 3VX0A 3ES6A 2F8IA 3KLLA 4MGXA 3BRDA 1T2QH 4A7GF 4MXQD 1NBZB 5FM5M 1O7VA 2VN3A 3ULUF 3LRLA 4JFQA 2JV6A 3BGFB 3ZHLA 3FU0A 3QEGL 2QTVA 3AGWA 4WU5B 3RWCA 5K9JL 1KPVA 4NUJB 2KZ1B 2YGPA 4JG1L 3W2DH 2V7HA 3MNVB 4L29A 3U82B 1NMCC 3I3EA 5CINH 2NNFA 4KRPD 3UAAA 3B2PA 4NO5B 4BD4A 1XVSA 4QRSA 3BJ91 4Z7AA 4OLYH 3WFEL 5BZDA 4ZXBD 5IW6B 2XN9A 4D94A 3ULVC 3G5XA 3GSVB 4KKBD 3L1EA 3VXQA 5GZND 5AENA 1MFAL 3D6GA 3EJZC 2EUZA 1HX0A 1OVZA 2PCYA 4Y5YB 3TN0B 2FL5B 4FQ2H 5D2NB 3K5SA 4YHZH 3CN2A 4HPOL 4Q0XH 2H8PB 1UJTA 1XR8A 3SDCD 3ZVVA 3L8QA 3NACL 3X17A 2BSSB 3FTXA 3BGFC 1JXDA 1JFQL 1JWMB 3QFJA 1MW2A 2FJSA 2OL3L 3O0RL 1A3RL 1MOEA 4FQCH 5GIRB 5BOZG 4TSBH 4R7VA 1SHWA 2B59B 2A0LC 5CMAA 3ECWA 3VFTB 3WKNA 3GMMA 1RJLB 2AMGA 3AUVA 3N44B 2OKMA 1CLZL 4GKNB 3VWKB 5I76B 5KUKA 3CXDL 1A4JB 1AIFB 4HJJH 3WFCL 4DKDC 1V7NL 3OPUA 2CE6A 2UZPA 1S7WB 3BQUB 4PV8A 4JKKA 3D50A 4YWGL 5HVHB 4LNRA 5C71A 1EA9C 4DO4A 2B4CC 1ZPLA 4EXPX 4XRCB 5BV7L 2GI7A 4NQTA 5DYOA 1H6UA 3IMWA 3U4BH 1J0KA 5FO9A 1U93A 4Y1AD 4DQOH 4QHMA 2L4OA 4ODXA 1YEIL 3FQTB 1JV5B 4M93C 3HIZA 4FQIL 4N9OB 2ITFA 1FZOB 4AYMC 4OJEH 4R5XA 3TNMB 3OJDB 3A4AA 3MXWH 4P07A 1QYGH 1ZHBB 3KWWA 1MHPL 3QHFL 3FT3B 3QPKA 3QZWB 1ZXKA 1KNOB 3PLYA 3L1FA 1EQWA 2CDEB 1PTZA 1N2RA 3TA3D 5C0CA 1NSNL 1CGXA 4QHNA 4LBEB 3VRJA 3DJZA 3MLVH 3ARQA 3QDGA 3REWB 3HI6H 4Z7WA 1DQTA 3BIAX 3V4PA 4PJXF 4XXDA 1BM7A 5J8OA 5BW7A 1L6ZA 3HG0A 3CVHA 4UZUA 4BELD 3MACH 1MCWM 5A6MA 3LD8C 2XG4B 1MIMH 3SODB 4GAFB 4OAWA 5IROA 4GT0A 1ACXA 5CIPH 2VITB 3SE4A 4RFOH 4UTAL 5I19L 2VMCA 2WXOA 2J8OA 1JPFA 4KXDA 4FNUA 1TU2B 1UT9A 3P73B 4JY5H 4Z7VF 4HJ1A 1EXGA 3TO4C 4RAVA 3GBNH 1S7SB 2XX1A 4X0NA 2Z4QB 5LG6A 2WVVB 3ECBB 1U2CA 3AQZA 3EJTA 2DLGA 4NFBA 5IW1B 4MNHB 3W11D 1MCPL 1MFDH 1T0NB 1RUAL 1SY6L 2XYBA 3CVBA 5A2FA 4ORGB 2XG5B 3I6GB 3V6FA 1J5CA 5E8OB 2ZSVA 5SWSD 1SOSA 3G6AB 3K71A 3LCYA 1T6WA 4IRJA 1Q9LB 1JK8B 2ZCLH 5I6XC 3PL6D 2J1KA 2V17L 1GMEA 4F1ZA 2OMVA 4K3DH 4XNAA 3NK3A 3H4HA 1JPGA 5HGAB 1UZ6F 5IB4A 5KEZA 3MV9D 1ETZB 5T5FH 5L7XL 1I7RB 1PCSA 4MS8D 3WFZA 1CE6B 2YD8A 4PRHB 5DA4A 5EBLB 4DPCX 1ILUA 2NPLX 4XZUB 3OHMB 1CTNA 4U1GB 5KAQF 4KO9A 1RZFL 3GS7A 2WXQA 4MLIA 1M3IA 1T0MB 4OGAD 3WNJA 4ETQB 5J13B 2V9QA 4HOWA 2IQAA 4PS3A 2HWZL 4MCYB 2BNRE 2WWMD 2BSRA 3BPLB 2WAHA 4JN2B 2C3VB 5D7LA 3WEAA 4KRPC 4ZFZB 3NRQA 1T6VN 3HBZA 2D7TL 5KVDE 2DS4A 3N2JA 3BHBA 4EN3B 3IMRA 4P2OD 1CFNB 3WJLA 1U8HB 4PLNC 4XBPA 2NY1B 5I30H 4XN2A 2F15A 2PO6A 4PJFE 4HULB 3IMBA 4MXQC 2R15A 3GBEA 4JRYA 2VOTA 1KG0A 3TLRA 3GBLA 5DF0A 1KB5A 4M8QB 1GPOL 3UACA 2LU7A 4PJHB 5KSBA 1QACA 2ADYA 1XX9C 1RMFL 3LQZB 1JNHB 1HHGA 5FAAA 5FCUL 4PJ8D 4NZTL 4D2NA 2G0LA 2B7DT 3C5ZC 1EIBA 1UXWB 1DUZA 4ANKA 5EEYA 5C08E 3SYPA 2YWZA 3X12A 3QIBA 4KMTL 4H40A 2ENYA 3HS0C 3BAJA 3L3JB 5K1VA 3W9DB 1DDHB 1VACA 4XC3H 2ZXGA 1SRDA 3G6JE 1HQRB 2LW3A 4X7FC 4XHJC 4QTHB 3LKNA 5K33A 5CLZA 2VABB 3ULSB 2X7LA 2V33A 2X70A 5CZRA 5ISZB 1ZKAA 5TFSL 1HHGB 3MGOB 5CZXD 5DJAA 5KJ4A 2N0MA 4PRIA 1F45A 4PGDB 3L1GA 3ZYOA 1UZ6E 4UI2A 5KJ7E 3U7AA 3UYRL 2YAQA 2DQUL 5JPMB 5DJYB 3MJ8B 4L1LA 3MPCA 4NKDB 3TT1H 5ESQB 3TN0D 4LQ1A 2ZOLB 1IBBA 1P7KA 4LKXB 3RZCB 4CVZA 1TG8A 3W9EB 2OMWA 4GG6B 4LIQH 1TJIH 4IRZA 4OUUB 1JPEA 2Q7AA 5KSVB 4BZ1H 2VDKB 5CM1A 4WUUA 4M6NL 1H6TA 3D4GA 2PPAA 1OTSD 3SE3A 1E0OB 3C8KB 3PWJB 1KGYE 4FNQA 4HK3J 2YS4A 2BJMH 2N7BA 4BCYA 3K5RA 4W9GC 4PJ9D 1FYTD 2Z35A 1OP3K 1OM9A 2VLJD 4F37F 4HOZA 4PI2A 3L95A 4KZEL 3IVKB 1DLFH 4G71B 5CSGA 1FRGH 4TNVF 3TEXA 2EO7A 5C0FB 3SQBB 3UAJD 2OSLB 4ZD3L 1IFHH 4NM4L 1IL1B 2A6KA 3LQMA 3L9EA 5HGAA 3ZDXB 1EWHA 3ALPA 4X83A 1NL0H 2HYMA 1CR9L 3ARFA 3BIKB 3KAAA 3IDIB 4U6XA 3SGDH 5DD1L 1CDHA 5KWYC 3MXVH 1KBGL 4XNQB 2XG5A 3V6FB 1MI5A 3HZKB 5EOCH 4ABVA 1DBBL 4NC1E 1I1CA 3IRPX 2JJWA 1QSZA 2APFA 1G7MA 4NS0A 4IU2B 9PCYA 5F21B 2QKIB 3LRSA 4UF7C 1TTUA 1GYUA 1YCSA 3MLUL 3VE0A 3F05A 3G6JF 3ZZQA 4X6DF 3BKYL 2XFXB 3BKJL 4RSYA 4AM0A 3TESA 3K2UL 1EJOH 3G5WA 4LF3B 4EQ3A 2GCYB 4XAWL 2AVGA 1HEZA 4X4XA 3WTWA 1CFTB 2DIJA 4MJ6B 3MLTB 4OVUA 1ETB1 2Z92B 4NP4L 1UH3A 4GQRA 2DF3A 4GNKB 1N5AA 2CO6B 2XICA 4WW2B 1KTRL 4QRTA 3MCYA 3R06A 4JO1L 3DRQB 4LRIA 1XTLA 1ZLSL 3K1KC 4UINH 1YEHH 5KYWB 1PX3A 1JHTA 4MD0A 2C1PA 1GGBH 4IGBA 1FC2D 1FF5A 4J3OF 5DMIH 3U0PB 4OIBA 4RFEB 2IG2L 2XQBL 5HYJE 4OD1H 3ECBA 3II1A 3V4PB 4ZTPH 4NQDA 1I82A 1LEGB 2HSIA 2WLZA 4F5CE 1B2WH 1BF5A 1T4WA 2NY4D 3ARTA 4NPKA 3ML9A 1XH2A 3EW3B 4LASH 4FQHA 2Q3AA 3ILPB 2C9AA 3UC2A 1HHHA 3HHSB 3S98A 3C75A 3FT3A 2XZAL 4JFWA 3SEPA 3FUKA 1JPFB 3F8UB 1SMOA 4Q58C 2VXUL 5I8OH 1EAOA 1E2ZA 2X41A 1VCBC 4HALA 4LQFH 3TCTA 2R0LL 2BNQA 5DZOA 2WO4A 3QR2A 2LQRA 2ZUTA 2R39A 1PAZA 4BRJA 2OQJA 1EHLL 1CXIA 2BY3A 2XWDA 4GRWH 1QASA 3BYYA 3DVNB 4OBSA 3U1QA 2PTVA 3L4CA 4FZEL 1CICC 2APSA 4PJCB 5TH2A 3HS0B 1PX4A 2XN2A 4NCC2 3VFNB 4ZFFA 5MP6L 4H88H 2WP3O 1BFOB 5HHXH 2NY2C 2KLRA 2IWGA 3O8XD 3L4ZA 3O45A 4P23D 1I8LC 4P2RB 3BUYB 3MN8A 4N1EA 5KSBE 4PV8B 4L05A 4HIJB 2J73A 5DJ6A 5L4IA 2BNRD 2IALB 5AAMA 3V0WH 3WXVH 1UJ3A 4FG0A 3BC9A 4G11A 4DGYL 4AQOA 4XPGL 5KS9F 1P84J 5LGHL 4QOKE 1T7XA 2GKIA 4PJFA 5CP7B 4I77L 1VADA 1IKFH 4WEBL 1OAQL 4NQEE 1TVHB 1RJLA 2ED8A 3OLGA 4XCCL 2WD0A 1H3WM 4WI0B 3BWUF 1ZSDB 4M7LT 1UM6H 3TWCL 4UZGA 3DPBB 1JV5A 1E4HA 1VF5C 4A68A 2FBJL 1YMMB 2I9LA 4JHUA 1QAWA 1AY1L 1FORL 1VGEL 4PS4H 4W9LC 5KANG 4EN3C 1AD9B 4JFPA 4UIMB 3KS0H 4YSDA 3PWPB 5HHPB 4OCYL 4P2YA 4NBZB 2X42A 4OVVA 3GRBA 1S7WA 3EFDH 1AFVL 3L3OA 3NDZE 4JE0A 4IJ3C 5CEYB 2HTLC 2XJKA 5LO7A 2PETA 4MQXD 4G6KL 1JFHA 3NJIA 3P0VL 4I5BA 4ONOA 4YDKL 4F2MB 4P3DB 1NUGA 4U1GC 1MRFH 3TEZA 2GT9B 2GSIA 4AE1A 4R96B 2X1QA 1NFDA 4PWKA 1CCZA 5I16B 3HNSL 3SGEI 1JVOA 5CLWA 4PAZA 2Y5TA 3VMOA 3QIUC 1FBIH 3WO3B 3BP7A 2DYPD 1A5FL 3GLDA 4M03A 5C3IA 3T2LA 2AS5M 2HRPH 1GA2A 1L0XA 3HJEA 4NZRH 4LAQL 5EC2A 3WXWL 3RDTB 3FFCE 4TYUA 3QDJD 2EH8L 2WNXA 1EHNA 1N7ML 2ZCHL 1BYNA 1IAIH 4OZGE 5G4NA 1DVZA 3GBDA 7PCYA 4OSUL 3V0IA 2Q7NA 5FHAH 4Z7VA 1WCBA 3AVEA 2PLTA 5DUBB 1UJ3B 4MJJA 4GAJH 3EO9L 3QARA 4RX4A 3ARDA 4QCIB 4AUUA 4BQ6A 3L5XH 1QPPA 3WIFA 2JJTC 1HSBB 4Q8BA 4MYPA 1WTGT 3QO1B 5L2KE 4B96A 3GMNB 4U4BA 2IANA 3HFML 3DHMA 3FUHA 3B2MA 3TV3H 1S3KH 2UX6A 3UTZA 1P1ZB 2ZWSA 5EZPA 2TSBA 3SPJA 3UTQB 3EYQC 4H1LB 5HI3D 4FP8L 2R8SH 3BKMH 1QW8A 4PLJD 1NGQL 1WBZA 3SGJA 2KYIA 5L4FA 4U1JB 1UGKA 4MQTB 2E9BA 4EDXA 3O81A 4KHTL 2PYFA 1C08B 3IS1X 1S9XB 2NXYC 1RUMH 1R3JA 3UADA 2BH0A 1I7UB 5GZOD 1E5YA 5F7MC 3V52H 4ALAH 5B3JF 4NQDB 2ETWA 3L2NA 4LPCA 5GGVL 2WLIA 5E4EB 3VYNA 1NIFA 1I1AC 2XLLA 1U6AH 2Z64C 4AVKA 5C7XH 2G5BB 4CDGC 2Z8VC 2K0RA 1FDLH 4M5SA 1BJ1J 4AW4A 3O6KL 3O3EA 4R26H 4Q9QH 1IX2A 4YSTA 4IRZH 5E5MA 4N6RA 5KVDL 4QKTA 2QVTA 1Z9PA 3CCHB 4K5NA 3LKRB 3QUXD 5F1KC 3Q5OA 5GZOC 1A4KB 3LXBA 1E9OB 2EEAA 2UXFA 5IT2H 2GC7C 4RSVA 5IHUH 3TYFA 4H8HA 1BZOA 5FYLH 2AEWA 2VDPB 3VWKC 4D8PB 1DE4A 5J9PA 4JFFA 5DMGD 2A6IB 4DGUA 2Y9RT 1WJ3A 4L4TB 4JPWL 5JOPE 4MJID 1IGFL 3FSOA 4FFWD 3EYOA 1BFSA 5ACLA 5T3XD 2IANB 1NOLA 2FVNA 2PP9A 4OD3H 1M9WA 3KJ4B 1TTFA 2NY6C 4QRAA 5I1EL 3KWUA 2R0WL 3VH8A 4YHPA 1UATA 4UDUA 4B0MB 5F1IB 1U8OB 4EUPB 1WHPA 3UAJA 2DDQL 5EOQL 4MFHA 1QTPA 4TVSa 1RIHH 3LAFA 4L1DA 1MQ8A 3FAWA 2VIRB 5IVXE 4CN1A 1ET8A 4Y4FB 5E70A 2PABA 4Y4FC 2KKQA 3MLYH 3OKKA 3APDA 2J3SA 3OKLA 4ODTH 5EIVA 4BXVA 4TUKH 1FNEB 1DQQA 1SMAA 4HWBH 3ZKND 1MAJA 4XPBL 5JORA 1QG3A 4OLYL 1SLUA 1KY7A 3U0TA 3HUJA 3L3DA 1BZ8A 1UC6A 4R4NC 5F9OL 3LPWA 3UTTE 1A2YB 3D3VA 3KJ4C 4Y5XB 3WTYA 1QFWM 4CADA 5AVTB 3V4VA 3BP7B 1YMMA 5AAWA 4PVBA 5I1AA 3JTTB 1QI4A 1G4MA 5KOMC 4ZNEE 5FA4A 3KEDA 1XBRA 1IQWL 4GBXD 4DWHA 2GSMB 1QNZL 2WLYA 5J6GA 3BUDA 1UD5A 1TSRA 5KVMC 3VFSA 5KZCB 3SCMD 3QPXH 4OZIA 12E8H 2V2WA 3DTDA 4GSQA 3UZEC 2JCCB 1E3XA 3ZUNC 1G87A 1QTYT 3UJTL 3FN9A 2XXCB 3UGXA 4YPGB 3MFFB 4J23A 3WI9A 5D9SA 2C9SA 5LNGA 1FNAA 2EDRA 2CK0L 1D7DA 3QUKB 1OGAD 3T5WA 4CSPA 1V7NH 1ODUA 2IV9A 2V9TA 5C0BA 3OHXC 4MJ2A 3TZVB 4FI7A 3NQKA 3PDGA 1QRNA 4IK6A 3CAFA 4P9HL 3QJSB 4PUBH 3AU1B 5A6IA 4QAWA 3MUJA 3QWRA 2P46B 4B9FA 3BVWA 3FJTA 3FT2A 1RPQA 2P8MB 1MDAA 2QGEA 4GIPD 1F11A 1IKOP 1Z7JA 2FX8H 4C59B 4PW3A 5ICYB 2WWKT 4PJ8A 3D34A 3D69B 5SWZB 3GJFA 3MRFB 3FUJA 4EOWL 3CU7A 4KKQA 3QUMA 1UOWA 3GWJA 4PP1C 4DTGH 3V5HB 1TZAA 5KSBB 1MCKA 2DQIL 2I7SA 1RJZA 1MCSA 1O0VA 3NEXA 4FHKA 2D73A 1I9EA 4RWHA 3FQWA 2FO4B 4M5ZL 4MD0B 2NUTA 4HJTA 1OB1B 2A9NL 4ZUUB 3O6FC 1LMIA 3HI6L 1ADQL 3CFUA 3G08A 5HY9B 1UG9A 1N5AB 3KPPA 2OMZA 1YG9A 1JDCA 4I0KA 3RNQA 2JKRM 3FQXA 3EF7A 3RPIA 3T77A 4I3RH 2WHVA 1L6PA 3FU7A 3KXFA 4APXB 2WOYA 1A1NB 1KDIA 2PP8A 1K8IB 2YD9A 5F7BA 3QZBA 1U8NB 4GKSB 2Z0BA 4OGXL 3T65B 4CJ0A 1RLBA 3O2DL 1J48A 4HK0A 4RZCA 1JGDB 3AXLB 1HNFA 4XGZA 1LEGA 3GB7A 4ETYA 1CMOA 1AJ7H 4MRBA 2ZAHA 3EDEA 4P57A 5T3XH 1CXLA 4AENB 1JPGB 5GGQL 3ZW3A 3CUPB 4F15C 3CXFA 1IBZA 3I9AA 1CD8A 1CVRA 3B9KC 2BNQE 3US1A 2GC4C 2QMKA 5J6HB 3GJEA 1FV1B 4L1BA 2OP4L 3WHXA 1G1KA 3C2AH 1D3CA 5ITBL 2QELA 4PRPB 1WAPA 3FUIA 5E9DB 4PI0A 3M17A 1XCQA 4ZUSB 5KVFH 2HT4C 2ZTBA 2GCYA 3FFCD 3CC5A 5HDBB 1PSKL 1D7FA 5AW2B 4CL7A 3GM8A 4KJQC 1N3NA 4BQCA 5CCKL 5T5FL 2DIBA 2MMXA 4PJ9B 2WQWA 5HYJA 3INOA 3UERA 4P5MA 3QI9A 4L3ED 4MWFA 2G30A 3K72B 1E90A 2H1PL 3FHAA 3C8KA 4TVPL 3FQXB 4JHZA 1OAXL 3C6EA 3GRGA 5E9NA 5BQDA 3WHXB 1JI1A 2E46A 5J12C 4DP4X 5C6WH 3SPIA 3QJQB 1KJ2B 3D39B 1IC7H 4HGMA 3L3HA 2X88A 1FA4A 4M5YH 4YDZA 3SDDC 2BVYA 4ZMYA 2NUTB 4HCIA 3WAKA 2PYEA 2AKRB 2GQHA 3BDXA 3QDGD 4TNVK 2QQNL 3N85L 4JL2A 3QH3B 5I30L 3GXPA 4GAAA 1C5BH 4P9MH 2GJ6A 1HE8A 5D5MF 3OR7A 2BCKA 3OMIB 4EVNA 1EJ6A 1TFHA 2VN5A 2YLKA 4Q2ZB 4ZNEA 4V1DD 1IFRA 1QSEE 1YEDA 5IHBA 1WAAE 1MZZA 2VC2H 5IHZA 2GUOA 2NR6C 2NY2B 2YAMA 1MREH 4DQAA 3FYIB 4XP5L 3CH1A 1LNUA 2YBRA 5SX5H 2P7TB 1LHZA 3SOTA 3Q3GA 4NZTH 1E5ZA 1CICB 3E1ZA 3K0WA 5C6TH 3OBAA 1KBVA 2YBRB 3MBWA 1TQSA 4OCMC 1A9EA 1QLFA 1SBBA 5I5MA 1FWXA 4HD9A 3MJ9L 2LFEA 5JQ6H 3JWOL 4PRAA 3OD3A 1GJUA 3ULVH 5C0EA 1CZ8L 2BP0B 5BRQA 2XSKA 4JQIA 3E0GA 4RLDA 5CUSH 1YEEL 3UL4A 1UM4L 1J9CT 2OA9A 3R19A 4PJDA 3KM1A 3D69A 3K4AA 2UVEA 2IXQA 5SWZA 4Z0BH 1ASPA 2BP0A 7FABL 4NQCB 2MQGA 5I26A 2YC1B 3VDAA 4A7TA 2FDBP 3GLEA 3X1NA 1FFPB 4FNSA 3RKDD 5KSAC 3EUDA 3C6SA 3OZ9L 1LWHA 5E8DH 4AV4A 5IV2A 5DGRA 3RUGB 4KI5C 4PLKC 1CC3A 1U8QA 2ZYHA 2NYKA 4ACTA 3LB6D 2YD7A 5HJ3A 4QRQA 2EEXA 2H0PA 5IBLC 3N1FC 4DKEH 2PCPB 4TN9A 3CPLB 4N9GB 2MQCA 2OI9B 3GIVA 1EEZA 1KCWA 4UNIA 2D0FA 1YEDB 2LTQB 5DK3A 3QUZB 4P5MB 1MHEB 4M6NH 3SZKC 2P47B 4D0CA 5C0DA 4WFED 1AP2B 3QH3A 1NPNA 1XEDA 2KDGA 5EBLA 2CR0A 3RG1C 5ID0A 5EU5A 2ILLA 4WWNA 5DUPL 3DMMC 3UYOD 5ADOH 2PPEA 1IBHA 3FCTA 3N40P 5ADPH 2QFPA 3D05A 3QYNA 3MNVA 1KMGA 3QAZB 4Y9GA 5MEND 4FOMA 4Z3IA 5IJDC 3CX5K 4NT6A 5GGTL 3GZPA 3V4VB 5I1AB 1CBVH 1VKXB 3D39A 1SJXA 1URIA 4K7PX 4HF5H 3UO1H 1SEQH 3EKCA 4JPIB 3AACA 2O72A 4TS6A 5BOJA 3GMRB 2ZKHL 2H7WA 4MB1A 1P9MA 5IREA 2YZ1A 1A66A 3BWZA 5FX3A 5BRZB 1QBLH 1SN2A 1WBXB 2IQAB 2Z4QA 3QXVA 3ZDYE 3C6LC 4AK1A 1U8PB 3DBXB 1E30A 1YY9C 3KYNB 2PW1B 1SOXA 3KJ6L 4P46C 2CDGA 3PQYB 2XZCH 5GS0H 1HCFX 1LO5B 2F2HA 5I1GH 4CSSA 3H3PH 4IW4C 4M61A 1DSYA 2DQHH 2MPVA 5HGBB 5E9DA 2R1WA 3VXMA 3RWJA 2DW5A 1OF0A 1W0VB 3H2QA 1K5NB 4M7ZC 4RGNB 5JUEH 1KPRA 1A3LL 1U91B 5F7LB 2HPTA 3I9GL 1ZWIA 4OZHB 4PRPE 4DEPB 4UOW0 1JNLL 1JD7A 3RKPA 2I9TB 1T0NA 4JFFB 4FERA 3N6YA 1MDTA 3H7LA 5DTFA 4OI9A 2PMZA 4YAQA 3SPHA 2WLKA 1ZHNA 4DW2H 2TRYA 1FNSH 4X6EA 1EZVY 2FLRT 4HK0B 2IAMD 4GUOA 3QUMB 2BC4A 4F7MA 3PE9A 5KZCD 4JGMA 4KVCH 4J3TA 3EGXB 1KXTB 4PJ8B 1OTSC 3UOAB 3ARUA 4LSRL 3WKQA 4XAKE 1UA6L 1J0ZA 4YZFE 1AQMA 3IFNH 1G9NL 1G0YR 4A39A 5BJTB 3FQ2A 3PGCA 5IEKB 2IOMA 1YJDH 3MRJA 2ARJB 2W94A 4KAQH 1MW0A 4ZUUA 3GLAA 4FQQA 1E2WA 3F85A 3QS2A 5FR3A 5I15L 4Q6YA 1NCBL 5JIMA 2DWTA 4PJ7B 3EOTH 3MCKB 1DYZA 4X6DA 1QWNA 4CGTA 3BRGC 3FPXA 5F7DA 1S9VB 4PBXA 1GYVA 3VB8A 2VISB 2VZVA 4FXKA 4GUPB 5A2JH 2D3VA 3F04A 3LQAH 4LEOA 3C5ZB 2CO3A 3QDMA 4WNQB 4ZO6A 4PJGA 3U6RB 1ICTA 1BZEA 1NCGA 4KK9C 1GIGL 3NCJH 5C9JA 4HKBB 5MP6H 4X4YA 4FFYH 4KGJA 1WCBB 1RZQA 3P4OB 1PFOA 3EF4A 1F4YH 1LP9E 1S8DB 5J6GB 1W2KT 4I2XE 5LHDA 2WO3B 4M7LL 3ERXA 3D0LA 3F7VA 1IBFA 1KTJA 2JK5A 5B38B 5EN2A 4IRSB 5TF1H 1VFOA 2GTWA 5JNYA 4MJIB 5FC9A 1UKTA 4WFGE 3LMJL 4GEIA 4JFTA 3QDGE 2DWDA 4XP1L 4PJ6A 2HT3C 4I85A 3AREA 3UMTA 1PKQA 1U3HD 4BYHA 4KNQA 1A7NH 4R96A 3VGAB 5HGDB 4YPGA 2TAAA 4N8VA 1RUPL 2VNCA 2VWEE 1NIAA 5T3ZH 2EDHA 3HG2A 1TTCA 2Q86B 2XN9B 2ZF8A 5L6YL 1FO0L 3VFSB 3OB8A 1R3IL 3LH2H 4HQQH 1AFVH 5CMAB 5D2LF 3VFTA 1WEJH 3NJMA 2QLYA 3NAAH 1MRDH 1JGUH 3JTSB 1AS8A 1NMBH 3AREB 4G6KH 5EV7A 5JIQA 3ZHFA 5E08L 4JFZH 3RWCB 4AEIH 3VM5A 3BN9C 1XR8B 2WOBA 5I1JH 1NGXA 2VDRL 3GXDA 4NM8H 3SIKA 2IH8A 4Z5RA 3UTSA 4AGQA 1JGLH 3H53A 2Y5EA 4YFLI 1YYMH 4JRXA 4WI0A 2IAAC 3ZZSA 4YDLC 1FFQA 5GXBB 1NFIB 2Z31A 2XHNA 2YPVL 4ABQA 2NY0B 3NIGB 3L6FA 4PTUA 2VH5L 4XCFH 5DVNA 1SNRA 1SVZA 3GM0A 4ODHL 2J8UF 2X9WA 4S1QH 3DIDA 1DP0A 3FPYA 1FFRA 2ZZUT 5IVXB 5JIPA 3GI9H 1P1VA 2PWGA 4HS3B 2Z93B 5EBMB 2X0UA 3B83A 1J5DA 5TQ2H 2Y2YA 4LVOC 4KOBA 4TOYH 3ABMB 2APVA 3WNLA 1LP9F 3TV8A 2Q10A 2VJ0A 5HPMA 3N0PB 1T5XB 2CJUH 1CXEA 1AGFB 2F68X 5HP5A 3EGDB 2AFNA 5E7BA 1MJ7H 4DVRH 4DP6X 1GTFA 2VLKE 4LVHC 5DJ0A 4L8CB 1PZ2A 3BLKA 3WS3A 5GISH 4OR1A 3X3FL 4Y2DA 1D6EA 1RUKH 3ZHKA 1TYEB 1E9OA 4P99A 4U3SA 5IQ7H 3GUTB 5ETUB 1KFGA 1LXMA 3BSHA 4POUB 3R18A 4ZFOL 5LBVA 1U3HA 1AQDA 3L81A 3BQUD 4UCFA 1CURA 1C5CL 3L2LA 2B2XH 2FQFA 3BGAA 5TH2B 2CCWA 4X6CB 4R7LA 1LK2B 2VLKA 3SJVE 5C07B 2EE6A 4WO4C 2DM2A 2X3CA 3ZDZE 3O6FD 2Z4TA 1O6VA 4LLWA 2A99A 4HBCH 4H8WH 4QPEA 43CAA 1R5WB 3LRHA 4ZTEA 4X80H 1IARB 5GRYA 3V6ZB 3HG4A 2EECA 2J88H 3H2PA 3IDGB 1CFQB 4Y4KD 4X7SH 1HNYA 3MRMB 1LO5A 4OFVA 5CCHE 2CDGB 4MAUH 1BD2B 1BG9A 2O5YH 2P43B 1VPOH 2DBJA 2Q87A 1G7HB 4OGYL 5GSRA 5D1QB 1FHNA 4ZZKA 1SGKA 1OPGL 4BK8A 1A7PH 5EHFA 3F6IA 5I6LA 3F6JA 1OCWH 2BRRH 2LABA 5B39G 1XT5A 2X6BA 3X1BA 4O9HL 3S88H 1UB5B 1T2JA 1X9QA 3R06B 3IDIA 3K3QA 3ARGA 4U6XB 3VXTA 3AGVA 4R2GD 1NANI 3PWNA 5T3ZD 1T2QL 3BE1H 3Q2NA 3RWJB 2CGYA 4JQXA 3TN0C 5JDJA 1PZSA 1PFCA 1NGYB 1T66C 3TH4T 1BD2E 4JPVH 3MLXL 2E86A 2VYRE 4F57H 2JJSC 4I5BB 4YL9A 3VH8G 5L0QB 2XWEA 1ZDQA 4V11A 5IKCA 2J44A 2CPUA 2VZ1A 3L7FA 2LLNA 5EOQH 2VM3A 4DO5A 1A6WH 1OAUL 1EO7A 1ETA1 2AHIA 3DLQR 2Y25A 2BW4A 1KB5H 1UCTA 1GS8A 3O3DA 4UMSA 1FG9C 4FTVA 4GXVL 2P5EA 2HJKB 1MFAH 1OZTG 3N3EA 4LCUB 4LVNB 4RGOL 4DZBB 1B4RA 1X7TA 3GXNA 1HEJC 1A4BA 4M62L 2Y7MA 2G2PA 3C6SB 4HPOH 4Q0XL 1YO4A 5DDHA 3OJVC 3B3IA 5MEQA 2C9QA 1PMYA 4X0KB 5ESQA 1WD8A 3S4SG 4LPYA 5D4QA 2HAZA 1WFNA 1Z9NA 3WLWC 3VXSB 4MZ3A 1LP9A 1Q1JL 1A1MA 1R1CA 3VCLA 3QUZA 2Q7YB 12E8L 2YN3A 3GEWB 1ASQA 3WEMA 3TPUB 4QJ3B 3WJLC 2YQGA 2YGVA 4ILDA 4RMTA 3WFDL 4B27A 5CD5D 5IVNA 4G82A 4GIOA 5DZJA 5T1LA 5KG9B 1DDHA 1G9HA 4U05A 3S36H 1U4EA 1XCWA 1OTUC 3RUGA 2P7TA 1K4DB 1AOZA 4FN0A 4HIPA 2K7PA 4Z18A 5CU9A 3BH4A 1ZVSA 1F00I 1TNNA 2UWEB 2EVGA 5MENE 1VZHA 2V2XA 3DHJA 5CZKA 2UXTA 1VFUA 1QI5A 1BWMA 5CWSA 3QUHA 4R7NA 4X6BB 5IF0A 3LQZA 3WIHA 3H6JA 3PJNA 2XFGB 1PQZA 4L48A 5FUZH 5IG7B 4XPTH 1JVKA 2DD8L 4HAKA 2P49B 5SV4A 1AE6L 3R0NA 2ZE0A 4LRNH 2PW2B 1URZA 4JFSA 2BRQA 2EDXA 2XWXA 4G7VH 4UT7H 4BEIA 3HR5B 3H9ZA 1QLFB 2B77A 4PU2A 3FTVA 3KL5A 4ELMA 4TL5A 4GB9A 1W72A 2W95A 1DBKL 1Q1PA 3DI2B 4RGMC 5IHLB 1C9SA 4JDZA 3C08H 5IQMA 1P0SE 3V4LA 1B0WA 1CJYA 1ACYH 4U1KB 4N2EA 4EBQH 1DCEA 2EIZB 3OQ3B 4AQ8C 4PD4K 4BBWA 5DRWA 4Z7OE 3WTXA 1HZKA 4Q9BA 4AT6B 3MBXL 4TMPA 4BH7A 2FJUB 2BMKB 5AW9B 1FYTB 4OF5A 4UAHA 1YQ2A 1W72L 3OMAB 3HNVH 3M8OH 4O02A 4TUOA 5IQ9B 3D18B 2A9MH 4KROD 4OGXH 4P3CH 3TBSA 3LRSB 4MXVF 4RFEA 3SJVB 4E9VA 1E7UA 5HYQB 3QXUA 1MCWW 3R1GL 2HTKC 1ZS2A 5F44A 1DVFD 3OQRA 2F19L 4OUOA 5JTWA 4NEHB 1TCRB 1WUZA 1NCAL 1FPTL 3WIHL 1Y6MR 5GS3A 1M7XA 4P4KA 2WYIA 3ILQC 2Z92A 1J1OL 4WSJA 2UYLB 4HS8H 1YNTA 4XWOD 3QI9B 5LKNA 4Y4FD 4G3YL 3D0VA 3Q48A 4EN2A 1ZE3C 5IQ9A 4JKNA 4K3DL 4Q6KA 1BMWA 1MRCL 4WI5A 4ZS6D 1PLGH 5GS0C 3QT2A 3PNWA 1QFPA 1WFTA 3L3IA 1DL7H 4YX2L 4EKXA 5TDNA 2YD5A 4FABL 3MX0A 3WMPA 4GBXA 1BG1A 5C2BH 1T1YB 4MA1C 4Q7DA 1RIUL 4F9PA 1R3KB 3LEYL 1V7MH 1IJ9A 3P69A 1N8ZB 2OW6A 3RE0A 1TTRA 1SXSA 5CCJA 2QEJA 2H1PH 1ZT7B 3BUQA 4H0HB 2XG4A 3CDCA 4ONFH 3RGVD 5F1SA 5JYLA 2B1AL 4HUWA 5DWPA 1NZRA 3VG0H 4MJ5B 3L9YA 1PKOA 4HFUL 5IW3A 2WLJA 4H26B 2FECL 1RFDH 5EU5B 1JL8A 4G8IA 4RAUB 5IOKA 4JFUA 3S5YA 1L7IH 1ES0B 1UKQA 1JGDA 1FFNA 3WIIH 3ETBF 2IAMC 1CFMA 4W70A 4D0CB 2EDYA 3B2DC 2XQYA 2JB5H 1C1EL 2DEWX 5TTRA 4A55A 2CLRA 3MNMA 5AG9A 1M1XA 3CFJB 5FF6A 3KXFB 4ODVH 4APXA 2F8OA 2ZQKA 2F18A 3OJDA 2NYYC 4DJMA 2NY1D 2KL6A 4LCVA 5C0AA 3T09A 4BDVA 4MAYC 5CIPB 4UT9A 2WQVA 4EN3D 3A4EA 4WK4B 5HVGB 5I73B 2MQ0A 2O30A 2XKUA 2R23B 2XV6B 1HT6A 8CGTA 4UNTA 5CP3H 5TQ0L 5CEZH 1MREL 1H3TA 3NEOA 5IB1A 4HHAB 2XN9E 4XNYH 1E8WA 3SYQA 3EO0A 3HE7C 3PQYE 4G7SB 5LQBL 2DJSA 2CLVB 1W80A 3QUYA 2LVEA 3H0TA 1YY8B 1UFUA 4M8QA 1NM9A 4QOKD 5CUSL 3BOVA 1G7IB 2EH7L 1ODAA 3AROA 1KJ2H 1KXVA 2CMRL 2VRAA 1A7RH 4L9LA 1ZLWK 5LGYA 3MLSL 2PPDA 5FA4B 5K9QI 4KMQA 4IBUA 4F7PB 3ESVF 3HN5A 4I48A 4BGDA 3VGHA 1Q94A 4LVOB 2EZ0D 5IFAH 2EVFA 1JNNH 3D3VB 4Y5XA 4F1SA 4NUGL 2ZJSH 2J6WA 5E8DL 1PEWA 1UYWL 4BE6A 3CSTA 1TZ8A 2XBZA 4XN1A 3BAXA 3EH1A 2OMTA 2OXHA 5JO5B 2NX5A 3E9UA 4I0PC 4OQTA 5C0ND 4HIHB 5DD5H 4FZ8H 3IKKA 2V2WB 3US0A 4OZIB 2OCCB 4KQ0A 2UY6A 4ODUB 3P4NA 3ZTNL 1XXDC 2BJML 1W0WB 4FXGB 3VD3A 1NGYA 1WV7T 3B3IB 5MEQB 3IDJA 2MQ3A 2C3WA 4EUPA 1MFEL 3HS9A 3P9LA 3VH8B 3E6HB 2P42B 5D7JB 4NO3B 4ZFOA 1UHVA 2H0EA 2NY5C 2I7OA 1PBYA 3VFMB 3E6FA 4YSAA 4ORGA 4M9OA 3WJMA 2RQ8A 3CV5A 1I7ZB 1FZMA 1U8LA 5JORB 4YK4B 1F3DJ 3AABA 4OZFH 4O2FB 5HYJB 3GSVA 5EOCL 1AD0B 1SMDA 5D1QA 3TA3B 1N3NB 2HRGA 4PJAE 3T2PA 1II4E 4U0RB 5EU4B 4XZUA 2DLHA 3L4TA 5FUCC 2VMDA 4XBEL 4U7SA 2VRQA 5I8CB 3IDGA 2BHZA 3AS1A 3Q43A 2X40A 2JXMA 3S3PA 5IB4B 2A38A 3QCTL 3KYAA 1JHLL 1YMMD 3DTUB 4K4KA 4NQVA 1AVAA 4Y1AB 1S6NA 3DGGA 3F64A 5AOKA 3DX1A 5EMYA 1NICA 3Q8AA 1ESOA 1ZOXA 4PGCB 1XGTA 3UDWA 5AYTA 2YPVA 3T9WA 4BWTA 1EHKB 2P5ED 3PHQB 4EI6A 3T8VA 1F6AA 4YDIL 2B3RA 4QY8A 4R2GB 1NJ9A 3CMOL 3UFIA 5B39B 2H47C 3DX4A 1PZDA 5IJKC 1N8OE 4KVPA 2KZKA 5GSRB 3V0JA 2IWEA 3SDAC 1L9SA 1AGDA 5E1AB 4U1LA 2NY2D 4Y9CA 3WUWB 3O0LA 2WXHA 4G42A 4KK9D 4DW2L 4R7DA 3THMH 2CIIB 3CDFA 5A16A 1U9KA 3X13A 1OSYA 5E2UH 1BD2D 2Y7QB 1OE3A 2J6EL 2JELH 1FO0A 4GOSA 3DOHA 1IC4L 3FAXA 5KSBF 2AERT 2BS71 2WZPD 4EF3A 3A67H 1DEEA 3BVUA 2PXYA 2X44D 5KS9E 2M8XA 3B5HA 1AHWC 4W68A 3TNNB 5KOVC 2WTPA 2CHZA 2X4QB 4N5ED 1JP5A 1KLFB 1P53A 2YPLD 4O4YH 3JT0A 5K9OB 4LOFA 1KTCA 1P84K 3HE6B 3SDAB 3MRPB 1DO5A 2YUXA 1EMTL 4JRXE 1PLBA 5HHME 4NFCA 2YAPA 3RQ3A 2YRPA 1CQYA 1QO3B 2Z8SA 5JR1H 1X4YA 1EZLA 2J43A 1CLYL 1MWOA 1R17A 2WY3B 3X11A 3WDHA 2WGNB 3V0WL 1VFBA 4Y4KA 4ENEC 3NESA 4OV6F 1X5AA 2A4EA 2O5XL 3CSYB 3S96A 4MNQE 1OAQH 4NWUH 4IRJC 3CN0A 5IMOA 4Q9RH 4XB3A 1I1YB 3QGVA 2VDMB 3WKYA 2JCCF 2OK0H 3QORC 5EEWA 1A6AB 3TWCH 3CVCA 3FQ1A 1OCOB 2JI3A 4WV1A 1EAPA 5C6PB 4U1HB 4GQ9H 1HCZA 3TJPA 2AQPA 1F4HA 1IGIH 3NIFE 1BMZA 3MUUA 1XXFC 3A6BL 1S9YB 4BIKA 1DSFL 1YUKB 3VFRA 4KROC 3M1CA 4MDIA 1V3KA 1SYVA 5EPMA 4HH9A 1ZTXE 4MX7A 1INDH 3MRCB 5EO1A 4NP9A 4GW4A 4AIOA 4R8WH 4K73A 1H5BB 3PWPA