1G5FA

Structure of linb complexed with 1,2-dichloroethane
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
294
structure length
293
Chain Sequence
LGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,3,4,6-TETRACHLORO-1,4-CYCLOHEXADIENE HYDROLASE
publication title Exploring the structure and activity of haloalkane dehalogenase from Sphingomonas paucimobilis UT26: evidence for product- and water-mediated inhibition.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
total genus 109
structure length 293
sequence length 294
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2000-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1g5fA00
1P0QA 1CEXA 1XZMA 4C89A 3ED1A 3RK4A 3QM1A 4Q3OA 4ZGBA 5E2IA 5ALEA 4BAGA 2BGRA 4X7BA 2QT9A 3WKBA 3VVLA 5IVKA 2OAGA 4FLFA 4V2IA 2QKYA 3L1HA 3R0VA 2O2GA 3V48A 4UUQA 3VXKA 2I78A 3V1LA 4CCYA 4BVLA 4B85A 4JEIA 3MUNA 3F97A 3IBTA 4CIBA 2RHWA 3K2IA 2VJBA 5ALZA 2C7BA 1L7QA 5T4HA 1QIKA 3C5VA 1HDEA 1QIFA 2PSDA 4WJLA 4ARBA 2NW6A 3QMVA 1Y7HA 1DTEA 4DMFA 3F98A 3O9VA 1QIMA 1XZDA 3BDVA 1U2EA 3VDXA 4BTVA 1RP1A 4M0EA 3DL4A 4EUSA 1EVEA 2XUPA 3Q0TA 4HXGA 2VT6A 1EVQA 1QIEA 3I2HA 3HYSA 1A8QA 4X91A 1XRRA 3ZV7A 1ODTC 4DIUA 4GW3A 4ARAA 3G0CA 2D0DA 1BCRA 2JGKA 3GUUA 5SYMA 5DYTA 3A70A 3WK5A 4Z49A 2XUOA 4F5ZA 1NU6A 2QVBA 2ZYHA 1GPLA 4QDOA 3WL7A 1XRNA 4HRYA 4YK7A 2QUBA 3C70A 2PPLA 3H2GA 5CT6A 3MGAA 2ZYSA 1CUSA 2AJCA 2WFLA 1YASA 5A7GA 3AIKA 2W6CX 3ESCA 1MT3A 3A2MA 5ALOA 1WM1A 2CMFA 1XLVA 1LPBB 1MAAA 3QPCA 1EI9A 1TAHA 3KOOA 5AKEA 3G0DA 5ALWA 1MX1A 1G5FA 1IUNA 1CUUA 1UKBA 5DNVA 5LZ8A 5AO9A 3WYNA 3C5WP 4FNMA 4J0KA 1H2ZA 2PL5A 2XUKA 1JKMA 4N8DA 4I19A 4OUKX 3F9CA 1XKLA 5D3KA 5D3ZA 7YASA 4GLBA 3I2KA 2PU5A 1BN7A 4DNPA 3EBLA 4WDQA 5K3DA 1AZWA 4PSDA 3H1AA 2BAGA 4BBZA 1CUVA 3FOBA 3I2GA 2Y1KA 2J3DA 4WY5A 4BE4A 2JGIA 5DTIA 4MQMA 4Y2RA 1UZAA 2XUFA 1CUYA 4UBMA 2I03A 1LPAB 3FLBA 2WHRA 3FVTA 1CUCA 1AC5A 5DLPA 5HQ3B 4UHFA 3H2HA 1B6GA 5HK9A 1LLFA 3ZWQA 1IUOA 5KBYA 4C4YA 2HRQA 2XQFA 1CFJA 5EFZA 3R3YA 4IH9A 1F0NA 2WJ4A 3MUOA 3M81A 5EIEA 5IVDA 4MEAA 1BROA 3JYHA 2OXEA 2ACKA 2QOEA 4CIAA 3HSSA 4Y2UA 3DKRA 2GBIA 4DGQA 4PQEA 5DTJA 4BDSA 3NUZA 3QZUA 3IUQA 3KWFA 1KU0A 4HZGA 5JAOA 4EY8A 5BWCA 2H7YA 4BCCA 1XZFA 5ALTA 5EHXA 2WUDA 1IZ7A 1LPOA 5JASA 2D5LA 4Y2TA 5IKXA 3AZQA 2PSFA 2QUAA 3NOXA 4OU5A 1A8SA 4Q3KA 4AMZA 4LKOA 3YASA 3IUJA 4AO8A 3AZOA 5FLKA 4FLEA 4KE9A 5AKIA 5JZSA 5C81A 4JH0A 4YASA 3SWWA 3G0IA 2VJAA 2QR5A 2OGZA 1XZBA 5AKHA 2Q0XA 4P9NA 3HACA 1H2WA 5AM0A 5ALYA 5K3CA 3D3NA 1JI3A 2G5TA 1X2BA 1GT6A 2XMRA 4X97A 4KEAA 1L7RA 5AKLA 3WK4A 1BN6A 4BRZA 4U2CA 4UFPA 5LKRA 4UBLA 1CQWA 1QLWA 4H35A 5EIHA 5CTAA 2K2QB 3D2AA 3BF8A 1SCQA 5AIAA 2I3ZA 3QBJA 5HKAA 5AH0A 1DU4A 5BWBA 2X5XA 3C6ZA 4K2AA 5AP9A 1ORWA 5LZ7A 2PKYX 2PVSA 1E8MA 3F8SA 3WZLA 3DQZA 1O6GA 3W04A 5K3FB 3R3VA 4FWBA 1ZICA 1GKKA 1A88A 3AFIA 1U65A 3QH4A 4FBLA 2ZSHA 3LLCA 5CXXA 5HF6A 1H2XA 2ZJFA 3W06A 4EY4A 1X2EA 1ZD3A 1EK2A 1EK1A 1JMKC 4G8BA 4AXBA 2HA4A 1YR2A 3BIXA 1YAHA 3IULA 4U2EA 2HM7A 2BGNA 1XROA 4NS4A 4C87A 3E0XA 4BB0A 5CT8A 1BS9A 4GXNA 4QLAA 1DX4A 3V1NA 3WKAA 1H2YA 1BEEA 4ZV9A 5JZBA 1GGVA 3C8DA 3ANSA 1ZD2P 1OCEA 1FFBA 3VJMA 2B4KA 2GYUA 4ZREA 1E8NA 5ALLA 2AJLI 2BUCA 4RE5A 1C7JA 1VA4A 5AOAA 1W75A 3ICVA 1WHSA 1JFRA 1IZ8A 3WWDA 1E66A 2OPHA 5JIBA 4H7IA 1MX5A 5AKZA 3WYDA 5AKGA 5AICA 1WB4A 4H77A 2JEYA 3C6XA 3ESAA 2WU4A 3FYUA 1JU4A 2FX5A 1HBJA 2PUJA 4AQDA 2ZSIA 3WJ1A 4TVKA 4Q82A 2ONCA 5SYNA 4PW0A 5KWIA 1KU6A 1TIBA 5C8VA 4NZZA 2AJBA 4KYVA 5BOVA 2RAUA 4YPVA 3I6MA 3QMWA 4KAJA 5E4YA 2ZVDA 3WL8A 1YAJA 3R3ZA 2VA9A 2C0QA 4RGYA 5A71A 1K4YA 3V1KA 4G1FA 1HQDA 3LIIA 1QIDA 4XWGA 4KRYA 1W4LA 5A7FA 1NX9A 4J7AA 1FFEA 4BC1A 1QJ4A 5ALRA 5LLSA 1J06A 2WM2A 5ALIA 4DLNA 4CI9A 1WPRA 3ZLTA 1UK9A 4X6UA 3KWJA 5EIAA 3HC7A 4BZZA 1Q0ZA 1CPYA 4U2BA 1LNSA 4BDTA 4XVCA 4MYDA 1K6EA 1K63A 5KWJA 1W52X 2FUKA 3FCYA 5AK4A 3GA7A 3DYVA 3RLIA 2HHAA 1CQZA 2WUEA 1XZCA 3C45A 1E5TA 2AJ8A 1JJFA 2QZPA 5A62A 3OOSA 2GBFA 3BL8A 4H7EA 2XB6A 4QA9A 4J0DA 1YA8A 4GHWA 2OGSA 2XMSA 1MJ5A 4B80A 1J2EA 2OCGA 2WTNA 1Q84A 4UHEA 3VJLA 2BUBA 3WQHA 4QDTA 3M82A 3QPDA 2Z3WA 5CH8A 3WMRA 3GZJA 2GBGA 4UBNA 4CG1A 1QO7A 1ZOIA 5HCUA 1L7AA 3DOIA 2JEZA 4K6KA 4RNCA 3WL5A 4B83A 5I7UA 5EHZA 4BC0A 3E1GA 4CG3A 3BE8A 1DWPA 2XUQA 4I3FA 2WILA 4W9RA 1ZIYA 4CG2A 3O9MA 3ESDA 2WG2A 1EINA 3BDIA 2WIJA 5JD4A 1H22A 3UMJA 3L1IA 3C8HA 2P8SA 3D59A 4PF1A 5H3HA 4CCWA 1F8UA 3E4DA 1XZAA 3AILA 4G9EA 1S8OA 4WFJA 5IVIA 1CRLA 1EDEA 1FJ2A 5HQ3A 5HFNA 1R3DA 4OU4A 3FSGD 4B84A 4WY8A 3R3WA 1SOMA 1AGYA 1C7IA 1XZEA 5CH5A 3H2KA 4FBMA 1GQSA 4H7KA 2Z8ZA 4C88A 4EY6A 4GI1A 3X3HA 1DWOA 3DLTA 5AHXA 3FAKA 2WIKA 1P0IA 1ACJA 1BEZA 5AI4A 1OILA 1WPXA 4UBIA 5JANA 1CUHA 1XZKA 4G8DA 1HLGA 2V97A 4XIIA 2VATA 2CJPA 1DX6A 3KD2A 3W9UA 2WFMA 1XQYA 4A5SA 3GELA 4ITVA 3LCRA 2G63A 2CBGA 2DCMA 1JMYA 1Q0RA 1GXSA 1XZGA 1I6WA 4E15A 3K9BA 1VA5A 4MWSA 4QZVA 2EEPA 2OCIA 1THTA 5FOQA 3TGLA 4PSUA 3FNBA 4Q1VA 4DM7A 4YX9A 4BCDA 4U2FA 1XRQA 1W1IA 4DMKA 4KR0A 3C87A 2C4HA 4PO3X 1PFQA 2DQZA 4BYMA 2QM0A 4B0PA 4FOLA 1A8UA 2HA7A 2BKLA 3KSRA 3IUMA 2H7XA 1AURA 4JUIA 5FV4A 5HF5A 4ZXFA 4A16A 3EIOA 2E3JA 4MXDA 4IH4A 3WA6A 1THGA 1TCBA 1EDDA 5ALQA 1WCYA 2XUJA 4Y7DA 4P08A 4PNZA 2JGEA 5AM3A 4IH1A 3OG9A 4Q05A 5JATA 1KEZA 2RI6A 2IITA 4QDZA 1H23A 1P0PA 3STWA 2QXTA 1J1IA 5KREA 4J3JA 4F21A 5J3JA 2HU8A 2VT7A 5ALSA 2XDWA 3W2TA 2WHPB 2FJPA 2PM8A 3S2ZA 2B9VA 1LPSA 1B41A 2CKMA 5FKJA 4DMCA 5AKYA 2WIDA 4C01A 2Y6VA 3KDAA 1QZ3A 4H0CA 5JZ9A 5ISMA 1SC9A 4LXHA 4J0GA 1FFCA 3CN9A 5A7HA 5ESRA 5AM5A 1LBTA 3C43A 5LIPA 2VAVA 1LZLA 5ALUA 5K3FA 1MAHA 1EDBA 1TCAA 5AOCA 4RE6A 4B6GA 3R3XA 1CUAA 3GFFA 5LZ2A 1UT6A 4UHCA 4W1PA 2ACEA 5HK8A 1CUWA 1EX9A 2WIGA 4BVKA 1F6WA 4Y2QA 3H0CA 5AKKA 4DTCA 1JJBA 1SCIA 2WG1A 5JAHA 4S0XA 1UK6A 4AZ3A 4B82A 2ROQA 4ZV7A 4B9AA 5AOBA 3PFBA 3HI4A 3PE6A 2DHCA 5AK5A 4Y2PA 5DWDA 3PUHA 1QGED 2BFNA 2AXEA 1TKRA 1XZIA 3JW8A 3ZI7A 1ZIXA 2C5FA 2C5GA 3O4GA 3EQ8A 2B20A 4X95A 1QE3A 5AK6A 4D9JA 1Y37A 4KACA 2WJ6A 4LXIA 2CEKA 5CT9A 3FWHA 1UK8A 1E8DA 2V96A 1ETHA 4U2GA 2OQIA 5CRIA 1VZ3A 1AUOA 3EQ7A 2OG1A 4BAZA 2QJWA 2XUAA 3ZPXA 2ZYIA 3EF3A 4MEBA 1C4XA 1VXRA 5CMLA 1ORVA 1W6RA 1ZD5A 3OURA 4GEGA 1CUZA 1QOZA 4BTLA 1Q83A 3C6BA 1VE7A 4FTWA 4AO7A 1YB6A 1EHYA 1XQVA 3SK0A 3K6KA 1F0PA 4QWWA 3WJ2A 3WKCA 3WWCA 4BCBA 4IQ4A 1ZGCA 1UK7A 3A2LA 1WB5A 1R50A 1UOOA 3CCBA 1VLQA 4LYDA 4H7JA 1VOTA 1ZGBA 1HL7A 1CUGA 3VVMA 4GECA 2J3QA 2H7CA 5D7BA 1QTRA 4Y2SA 2DSNA 3WWOA 3T4UA 2WQZA 2XUGA 1R88A 4KAAA 1TQHA 4NVRA 2GYWA 2YYSA 4Y2VA 2J4CA 4AZ0A 5CT4A 4HXEB 2J4FA 4W1SA 3IA2A 2UZ0A 3F67A 1R4ZA 3B3QA 3I6ZA 4G8CA 2GZRA 2QTBA 3FBWA 4OYYA 4U2DA 2O7RA 3HZOA 1X70A 3A2NA 1U8EA 1FFAA 1CR6A 1LPNA 5DYWA 4WFIA 4GDMA 1PV1A 2C0PA 5ALJA 4H7FA 5HKBA 1G42A 2Z3ZA 1CUFA 2HDWA 4MJ3A 3WL6A 4JYMA 4INZA 2JGFA 3DKKA 4OCZA 3BWXA 1EH5A 2GZSA 3B12A 2ZYRA 2DR0A 1CUXA 2Z8XA 1ZD4A 2PU7A 4H7DA 1GQRA 3DD5A 1HPLA 1UKCA 3G02A 3R41A 3BIWA 3MVEA 3RM3A 1UOQA 5DNUA 2JBWA 2CB9A 2PSHA 3PF9A 5AI5A 4DSZA 4UFOA 5ALDA 1XKTA 3I2JA 1CUDA 4XJVA 3FCXA 4FFWA 3DCNA 3SX4A 1USWA 4UBJA 3C6YA 4LIPD 5LZ9A 2IX9A 3QYJA 1QFMA 1K8QA 1AMNA 2QXUA 4C4XA 1LPMA 5CURA 2WUFA 4M0MA 4FDMA 2WJ3A 4NMWA 2Z5GA 4H7HA 2VEOA 4RPCA 2XQGA 4G4GA 1MTZA 5LZ4A 3PF8A 4LYEA 3HABA 1MU0A 4Q34A 3WLAA 1MN6A 4DYHA 5BV7A 4QDUA 4QE3A 2BCEA 4MYSA 4UFNA 4GWLA 3G9UA 3G0GA 2GBCA 1BU8A 5FRDA 1BE0A 4X90A 5ALHA 2DFPA 1N5MA 4TPKA 4A23A 2XQKA 4HTAA 1NU8A 1SFRA 3LIPA 5JD5A 4AB1A 4EZIA 1QIIA 3FLEA 1GZ7A 2HFJA 3WKEA 4L9AA 1YS1X 5AI0A 2XUHA 4LXGA 2IIVA 3STUA 4N5HX 3STYA 4B9EA 4Q3LA 2EDCA 1PJAA 1IUPA 4AN1A 1T4MA 5YASA 3EQ9A 2YASA 2XT0A 1Z68A 4J0HA 3FYUB 1YSCA 1RWQA 4EB0A 1CUBA 3I2FA 1VKHA 2VTVA 3AINA 4E14A 4G5XA 4G9GA 3F96A 3AZPA 1QFSA 5DYYA 3BJMA 3G7NA 4N8SA 5AI8A 3SC2A 4AX4A 3H17A 3NWOA 4BAUA 3GBSA 3H04A 4HRXA 2XMDA 3U1TA 4X6XA 1R9MA 3WKDA 4KRXA 3LS2A 4CFSA 3I28A 3WK7A 4IO0A 4KAFA 4X6YA 1LGYA 3WZMA 4BRSA 1EXWA 1XQXA 2JGLA 4QLOA 2CUTA 3G9ZA 4UBOA 5JAPA 2HA3A 5I9IA 4Y2YA 4KJXA 4X85A 5ALGA 3DS8A 3FLAA 1E3QA 3IB3A 4W63A 2H9YA 5CT5A 2VJCA 3ANTA 1IMJA 1YA4A 5AK3A 2O7VA 3DOHA 1BRTA 4QNNA 4X00A 1AX9A 1YCDA 1ZI9A 4BP8A 3H18A 1W76A 2JGJA 2PSEA 3IURA 2WHPA 1JJIA 4OB6A 4HVTA 2RHTA 3I2IA 1CUIA 1ISPA 1DQYA 3DL7A 4OD0A 1BCSA 3WK6A 5AI9A 3WIOA 2PX6A 4KE7A 3HJUA 4HS9A 5T4FA 2G5PA 1TRHA 5HF8A 1XLWA 3RKSA 2QJRA 4O08A 1XLUA 3QVMA 1GKLA 3H19A 5ALFA 1ACLA 3QMMA 1UKAA 1QIGA 3R3UA 3G8YA 4JNCA 3T52A 2R8BA 4W1QA 2XUIA 4KE8A 2HIHA 3D4LA 3WWEA 2QMQA 5IH7A 4P92A 5ALVA 4J0IA 4FLMA 5FPPA 2BUAA 4CCYB 3WA7A 1LPPA 5LKAA 3I1YA 3D5EA 4GBGA 3H1BA 4J0CA 3WK9A 2HADA 3TRDA 4B0OA 2XQIA 1T2NA 2GYVA 3DYIA 3FYUC 1SCKA 2HA5A 2VF2A 5AJHA 4ETWA 4Y9SA 5K3EA 5D6OA 1XRMA 1CUJA 2W22A 1QIJA 4K5QA 4K6HA 4G4IA 5C7YA 1R1DA 4ZWNA 4X94A 3FVRA 4DNOA 2RGUA 4XX1A 3IDAA 4AN0A 3G9TA 4Y2XA 5LYYA 2OLEA 4PV7A 5JALA 3L1JA 3H2JA 4HAIA 4WCVA 1QTIA 3WWPA 3W05A 2EDAA 5K5EA 2OAEA 5ALMA 4EBBA 5JARA 1A7UA 4H18A 4E46A 3Q8WA 2PBLA 3B5EA 2RIPA 4C4ZA 2G4LA 3E3AA 5CBKA 2OQVA 1ZJ4A 5E4JA 4OSEA 2Y2UA 3NGMA 3BXPA 3CN7A 2WFLB 3D2CA 5HFAA 2HU7A 1VZ2A 2XQJA 1P0MA 1CIJA 5AIBA 4W1RA 4MQLA 1UXOA 3R40A 1DT3A 2WU3A 1DWQA 2XMGA 3VJKA 5FDFA 3D2BA 1EB8A 3ILSA 5K3AA 2V98A 2XLBA 5JAUA 1D07A 5AM1A 4DSAA 3O4IA 4L3WA 3A6ZA 1XQWA 5AI6A 3I1IA 3TJMA 3N0TA 3IUNA 1TK3A 2WFZA 2VQ6A 5EGNA 5HZGA 3PI6A 2WSLA 2PUHA 4DNQA 1GPNA 1FSSA 3TEJA 5A2GA 2OCLA 3O95A 2HFKA 5ALXA 2WLSA 4AO6A 4FMPA 5T4BA 4LHEA 4OYLA 5ALNA 4WFKA 3GROA 4UHDA 1QONA 4X3CA 1XFDA 4J03A 4F0JA 1YS2X 1N1MA 5LP1A 3HLKA 4F60A 3AIMA 3UUEA 3FYTA 2XMQA 2ES4A 2HL6A 4B81A 1ODCA 3ICWA 3RARA 2QRUA 3O4HA 2H1IA 3BF7A 5DJ5A 5CXUA 2ECFA 4DNFA 5I8PA 3ESBA 2JGMA 1J07A 5JD6A 5CW2A 1VJ5A 1UOPA 3N2ZB 1JT2A 5AM4A 1LZKA 4X71A 2XMBA 1DT5A 3M3DA 1XZHA 3PUIA 1E89A 1IVYA 4BP9A 1DINA 2WIFA 3D7RA 3WK8A 2XMCA 1QIHA 1ZI8A 2ZJ7A 2DHDA 2XE4A 2O2IA 5JADA 2HRRA 3CCCA 1G4HA 3WI7A 2R11A 2BJHA 2ZJ6A 3HXKA 2XMZA 2YXPX 4BZWA 5E4TA 5A6VA 2XI4A 4EA6A 2V9ZA 5FP0A 3UUFA 3STXA 4EHBA 1UWCA 2AJDA 3JWEA 3W9BA 2HA0A 1WOMA 5EHNA 4N8EA 3HRHA 3IIIA 4TGLA 3G0BA 2RONA 4BVJA 1M33A 1JU3A 2DHEA 4P93A 2I3DA 1RYYA 1O6FA 3KXPA 3D0KA 5EI5A 4X92A 1R9NA 3QITA 3ZLUA 2CZQA 4OPMA 2ORYA 3O0DA 1MPXA 5AKJA 2VAXA 3U0VA 1QO9A 4KE6A 5EHQA 3OTQA 3H2IA 4ZRDA 3S8YA 5HF9A 4UBKA 3ZLVA 4UHBA 4K6GA 1Y7IA 4ROTA 2JF0A 1MNAA 1CLEA 4MWTA 3I6YA 4BATA 4EY7A 2QS9A 4FNGA 3AIOA 1VXOA 4J0JA 1MX9A 3V9AA 2VJDA 1DQZA 3M83A 2JIDA 1K5PA 2HA2A 4L72A 1ZI6A 1N5RA 4ZI5A 1CV2A 6YASA 3STTA 1UFOA 4HXFB 4B7ZA 2YH2A 2O2HA 3DDUA 2LIPA 4G4JA 3CXUA 3DEAA 2HU5A 2X76A 4DMHA 2XLCA 2C58A 1FFDA 3BJRA 5FUMA 4Y2JA 3LP5A 4IHAA 4C6HA 4BE9A 5F4ZA 3PFCA 3AJAA 4L0CA 1ZJ5A 3QPAA 3WIBA 4OB8A 1EB9A 2B61A 3AUKA 2Y6UA 1WHTA 4I4CA 4JYPA 2OGTA 5ALPA 1MNQA 1YB7A 3PICA 5T4EA 1LBSA 4N5IX 1GPKA 4AMYA 3HEAA 4FHZA 2WHQA 4QEKA 1TCCA 3OC0A 1VE6A 2FJ0A 2PSJA 2XUDA 4E11A 1CUEA 4FKBA 5AKXA 5K3BA 2WG0A 1XRLA 3PDCA 4FFVA 3FSGA 4OB7A 5DNWA 3O4JA 2HA6A 1OXMA 4M0FA 2WTMA 4UHHA 3VISA 1EA5A 3VKFA 1XRPA 5FXMA 3DNMA 2Y2VA 5C8ZA 1HKHA 4QWMA 2X8BA 3G9XA 1AQLA 1N8SA 5LZ5A 3DJYA 3P2MA 4WDRA 1U4NA 3V1MA 3OPMA 1G66A 1XZLA 2VSQA 4X93A 5IVHA 5CH3A 5ALKA 2WUGA 2OCKA 1ODSA 1WB6A 5AM2A 5C8XA 3OM8A 5JYCA 1AKNA 4PSCA 3STVA 1CVLA 3IVMA 5FPQA 4EY5A 2DQYA 4UPDA 4QDXA 1XZJA 1MO2A 2WKWA
chains in the Genus database with same CATH superfamily
3VH4A 4D0NA 1P2SA 2IOQA 3WVNA 1CEXA 2CFIA 4RD2A 4UHJA 3VAYA 3I42A 2Y0CA 4ZKEA 3VNAA 4FD2A 4M88A 1DE0A 3L5OA 4N7RA 4YI3A 1SY7A 4DSOA 4YWHA 4ZGBA 4KPEC 1ABBA 3M6UA 5AJXA 5FPKA 2O5CA 2PZLA 3NVMB 4IIXA 1WUHS 2QT9A 2ZRCA 4DUPA 4NCIA 4YV0A 5AW4A 1JLSA 1IAVA 1TOAA 1UBJS 4J91A 4O63O 1QHEA 4D46A 5EE5B 1U2DA 5LWHA 3EQZA 2XIJA 2KMLA 3H6HA 2PS1A 3GARA 3L1HA 1PTJC 2IHKA 2RHMA 5ELLA 5AXAA 5TR9A 2KLHA 4K81B 3V48A 4EPWA 1T0BA 4HK4A 1V8DA 4UUQA 1UPBA 5F12A 5AW9A 3Q7RA 5AUNB 2BI7A 3CH4B 1OASA 3HU1A 3AOEC 3JQFC 1X77A 4UU1A 3N74A 4ZVRA 2WYOA 2GERA 1FC0A 3BMOA 2WSYB 4GD3Q 3V1LA 2V0CA 3DLCA 2UVPB 2QZSA 1V16B 4AYWA 4B85A 5KCZA 2FOXA 4ZEMA 3JYQA 3MUNA 3REQB 1AM4D 1DUSA 3P2IA 4YB8A 2B6NA 3RYTC 3F90A 3IBTA 4DYVA 4CIBA 4WBNF 3CZQA 3OI7A 1DJMA 3FZNA 3TD2A 5HZMA 3CB4A 4HFNA 4ECAA 4JX9A 4ZDKA 4P0QB 3U3ZA 4BZPA 1INLA 1N3YA 1QIFA 2G70A 4YJGB 2XAAA 4ARBA 4WJLA 4Z8YA 3R5SA 4YHBA 4DRXA 1Y7HA 4PFSA 4QQKA 4C0SA 2YOGA 3VJRA 4B7XA 5EJFA 4LISA 3UKJA 2OV8A 1QIMA 2PKEA 1EA7A 1B76A 1TADA 1WE2A 1U2EA 3ONWA 2XZOA 2MOKA 4OQMA 3VDXA 3R24A 3OC6A 2VIIA 2QU8A 2DPHA 2EBUA 2HPAA 4N03A 4RC9A 3KAKA 2YWHA 3JZMA 5GAJA 3VKHA 1NJ1A 1PNOA 1Q3HA 5TPZA 1UH5A 3KCQA 4AC9A 1A5TA 3O3MB 2XUPA 3AESA 4G5RA 2I4MA 2I4IA 2JFFA 3COYA 3RTDA 3HNRA 2AHRA 1CDDA 3ENQA 4X3OA 2O8CB 2PGOA 1NP6A 2Q1WA 3HFJA 5F77A 1E92A 3PP8A 2Y0DA 2CKDA 3I2HA 3S3TA 1X7YA 1XRRA 1K9SA 1NA5A 1CS0B 2FP3A 2V4ZA 3CTMA 4RV5A 3ZV7A 1NUPA 3FPAA 4LV5B 4RENA 3RGWS 3SSMA 3EFHA 5TRTA 3UFBA 4I1YA 1G5IA 5TIIA 3KJGA 3C7DB 4GW3A 1HE8B 2GA8A 5DHSA 3QG5A 3I5UA 3QNWA 3GT0A 3OCXA 4QJBA 2MSLA 2QVLA 4M8NE 4YMLA 2PZKA 3AHJA 1BCRA 2JGKA 2P0EA 4MW1A 4II7A 3H4TA 4RVHA 1VSUA 1VL5A 2G76A 2GETA 1H2BA 1SKAA 1H5UA 3K16A 3Q10A 2C2MA 3VVBA 3MT7A 5DYTA 5F76A 4AQ7A 5GM2A 1W4CA 2UZ1A 5CX1B 3TIFA 1ZXBA 3ZDAA 1R18A 2EFEB 3CRW1 2AMFA 4TLEA 4Z7QB 4WNAB 3EDCA 1WKVA 5DMHA 1NU6A 3GJQA 3JV7A 2F67A 3K0KA 8LDHA 3MINA 2D7DA 1YVPA 5F4BA 1AF4A 4Z54A 3C39A 4IHKA 5F2OA 1KE2A 3F3MA 5A0VA 2VBCA 1AG9A 1DWUA 4RK7A 1AGPA 5B6PA 5HGXA 1QGUB 2VXBA 4O1HA 4LYJA 1OGJA 2DLNA 4UEQA 1LVGA 2C84A 4IIDA 4ZHQB 5BNZA 4JIMA 1EU1A 2RH8A 2ZYSA 1GZDA 1C0PA 2WFLA 3GBPA 3BREA 2NU8A 3TZLA 4HVCA 5BN3B 2C96A 1JLKA 1T6NA 3AIKA 4HAOA 1Z3CA 3UICA 2PRIA 5ITZA 1MABB 4EK9A 1ZL0A 1PV2A 3GMIA 3QENA 3GLKA 4MS1B 2F17A 1GFWA 4C04A 4HLQB 1W5AA 2W6CX 4OQEA 5J4YA 1OAAA 4MO2A 1VSQA 4BU0A 3HJNA 2GXSA 4NCXA 2VWQA 1MT3A 3A2MA 3U4IA 2YS6A 2XVYA 3FH0A 3GJRA 3D0RA 1LBHA 2QM3A 4CTJA 1KARA 5CDUA 3OZGA 1M6VB 1LX6A 2NPIA 3X1WA 4G0VA 1XLVA 1IH8A 2FQXA 3ACCA 3BAZA 3PQCA 3ZK8A 3AOGA 1YE5A 3MAGA 3QPCA 3AR3A 3VV3A 3TLBA 3FNFA 3KOOA 2J0QA 1GNSA 3RVLA 1G98A 4JGIA 2FMUA 4NFYA 1NI4A 4CEHB 3IP6A 2J5RA 1X9IA 1FU7A 2OILA 4BEWA 1MRZA 3IIJA 3B6MA 4IPTA 3TW8B 1G5FA 3ISVA 3U31A 5B3LA 1IUNA 2Q46A 1UWLA 4ZZ3A 2XBLA 3K1TA 2A35A 4KXQA 2Q62A 3GVPA 3HM2A 1YHNA 1E4EB 2H1VA 3MAAC 4IEFB 5AO9A 3EH2A 3W78A 4H1HA 4TRRA 1OLXA 2HJVA 3O1JC 3K70D 2Q28A 3UOAB 4FNMA 4DMRA 3LUFA 2IEGA 3WLIA 4C7JA 1GG2A 1A2QA 2FW6A 2YKGA 1GUAA 4MWCA 4XWOA 3D6JA 2FQ1A 5FULA 4J90A 1YI0A 3S2FA 2HIMA 3ZVRA 4I19A 4OUKX 1G8PA 3GIDA 3QF4B 2JFPA 3SG0A 1LFAA 1NPDA 1O5IA 4XWKA 5KYXB 3D54D 3W6OA 4TM8A 1F5SA 3FCUB 2G1UA 1JG4A 5D3KA 3PVSA 3OZDA 4PY2A 4IDEA 3SC2B 5D3ZA 2F3PA 4ENPA 5E9WA 1SVIA 2YMPA 3JATA 4X41A 1EFRA 2R7MA 4NE2A 3OQBA 4TLCA 4BNYA 4E4RA 6AT1A 3R9XB 2CLDX 2YVAA 3RAEC 4BUZA 1MO4A 2VDQB 3C1OA 3T3OA 5ITSA 3BH0A 1PWXA 3EZYA 3GRAA 1JTVA 2CCKA 3HLYA 4A0SA 3WRXC 3H1AA 1R8QA 1HDGO 4YQYA 4AUMA 5IH7A 2VP2A 1K88A 4K9OA 5LP6A 5C1OA 4YRAA 1B4DA 3D81A 1C29B 1X1BA 1XHEA 3H11B 4JB8A 4OI0A 2PJZA 4WBXC 1SCAA 3U7JA 1AO0A 3KV3O 4MWDA 2HREA 1AKTA 4CXMA 2PMKA 3RT7A 4WY5A 3HDGA 1YA6A 4BE4A 1O87A 3DE6X 3RVNA 4DR3B 4Q21A 2GTPA 3JWGA 4QUIA 4RGBA 3D3EA 1C9MA 1M2VA 4FGJA 1M34A 4XJTA 1GDTA 3NATA 4L95C 4BKRA 1WWKA 2XUFA 5JVDF 4J4TA 3S5JA 3VM6A 4L3OA 5FAKA 1EVLA 4AS2A 1LPAB 3FLBA 2C7QA 3CW8X 3SEFA 3WB1A 3ZXUB 2GLUA 3OOWA 1I3MA 1CUCA 1AC5A 1E6EA 4JUCA 2W37A 3QHPA 3BD7A 5DLPA 5ADHA 5FWXA 1KTIA 3GLGE 3NANA 1B6GA 1K6IA 2H5EA 2BFBA 2TECE 3GI1A 5HK9A 3LDFA 4EJSB 1JT9A 3KJEA 1NSFA 3TNFA 4X7MA 1LBQA 3CURA 5DSXA 2VN8A 2DKOA 3WGIA 1J0CA 1GGEA 1QDUA 4OATA 5KOYA 1XLTA 3Q2OA 4R1MA 1MF7A 2V0NA 3MIZA 4KI7A 4F3TA 1R4MB 1DO2A 4KQ9A 1NFQA 2KPOA 4DSUA 1V8OA 2WD9A 3E3MA 4IH9A 4QUGA 3WLOA 3U7HB 2Z1MA 1ZCBA 2NU6A 5DEIA 3GB9A 1HK7A 4XASA 2QW8A 2QN1A 3KZXA 4R2MA 4ZT4A 2I67A 2O2ZA 1EZ4A 1LI5A 2P2SA 4CIAA 2B37A 1MQ8B 3QHAA 4KXMA 2LR0A 3ZJUA 5HG0A 2IYVA 2YJ5A 5K20A 3OF3A 5GONB 3ORFA 2J6BA 1D6SA 4RTPA 2JJ8A 3W5UA 5K4AA 3FJOA 4DGQA 3AMVA 5E3HA 4MYUA 5J2UA 4YJ3F 3GLFE 1HETA 3SJCA 4S0ZA 2TYSB 1WLSA 1ZM4A 2DTDA 3B1KA 5KKAA 3RAGA 3KHSA 1T4CB 5CLLA 5KWEA 1RAAA 3LWDA 1KIMA 2WPNA 3E22B 4YBZA 4A3SA 5FL7D 4AVYA 2VHCA 5IBPA 1VP3A 2R60A 5JAOA 1DTWB 1SOVA 2EFHB 1Y9JA 5K4GA 3WAKA 3K05A 4DLBA 1CBUA 2BEKA 4LMPA 3N8IA 3ZLBA 4JBGA 3Q3JB 1N6NA 4ZCPA 4BCCA 4HRVA 3QPVA 3ADCA 1YHYA 5EPUA 1XZFA 4ETIA 1EESA 1OIXA 3DVAA 4LHVA 5EHXA 3U60B 1EG7A 1QMGA 1SXHA 1C7RA 3EDQA 4KSCA 1YC2A 3KZCA 4EPXA 1F2TB 1LPOA 4FONA 5T8KA 4MHTA 5JASA 1NBMA 1NURA 4WXMA 4Q16A 4Y2TA 1HUQA 1J22A 5IKXA 1A8HA 1MW9X 4OV6B 3M4YA 3TFQA 2Q3HA 3JYLA 3AZQA 3E9YA 1OA1A 1EM8A 1PNRA 3M4JA 1GAWA 2I2XB 2CN1A 1FUKA 2QUAA 3NOXA 3QFHA 4J8PA 1CDZA 2B4TO 4OU5A 4QYIB 1II8A 2I3AA 4H6VA 5BYJA 2AFVA 4LKOA 3ZY6A 1XF1A 2ZAYA 4Y6GB 3AZOA 4Z9XA 2YJ3A 3OOHA 4I9NA 2WZBA 2PQ2A 4RQTA 5FO0A 1TRKA 3UB3A 4D6YA 4EO4A 3I61A 2EOAA 3A06A 5JZSA 5M04A 1YL5A 2CNBA 3CX3A 1J99A 2JD0A 5C81A 4EBFA 3ZJTA 3GT7A 1QC5B 3EMKA 2MYNA 5DXAA 4DABA 3QOWA 3SWWA 1ZMRA 1BXKA 3I8XA 4PLWA 4R0VA 2GDZA 1DCTA 1JX6A 1G0NA 2XNJA 3L84A 4G23A 3TJRA 1XZBA 3HG7A 3UPUA 3GX1A 1T9GR 2Q0XA 2XEDA 4UAJA 5DNDA 5ITWA 2HSGA 3R9IA 3NHRA 1H2WA 4NBRA 3A27A 3FSEA 1SC1A 2FMTA 1Q3KA 4BV9A 2C4WA 4DLKA 1JI3A 4KIUA 4MIEA 1HH4A 2X7XA 4NH4A 1WRBA 4N0DA 1S2GA 2DBYA 4NIMA 1E1KA 3ZVKA 1JPVA 2D1FA 3CJQA 1H2EA 1SUCA 4PTZA 1GT6A 4R9NA 2Z2JA 4KITB 4C07A 2L17A 4F1KA 4QNMA 3VPDA 5LYJB 1FQOA 4OI1A 3RAJA 4X97A 3W4KA 4ND3A 4AJPA 4G3XA 2NU7B 1V7QA 1ST3A 1O0BA 2UZIR 4J6FA 1XD2B 1IY1A 4NL4H 4CIVA 1BN6A 1WP9A 1B23P 3DLAA 5CDTA 5BSWA 3WOHA 1ZS9A 3Q5EA 1B0UA 4I36A 1E1QD 4O29A 3U48A 4ARZA 5LKRA 2IBMA 2FSGA 4PRZA 4DV0B 4LY0A 1P4RA 2ZE7A 2C04A 1KEEA 1I3CA 2NXEA 1EXDA 4WH0A 1CF2O 1QLWA 3L1KA 1XHFA 1Z4KA 4Q7JB 5JSQA 1JHPA 4H35A 4I1PA 2G4CA 3CX7A 1XT6A 8MHTA 4KDCA 2RJ3A 1UPUA 2K2QB 4HDOB 3N6XA 1J1ZA 4FUQA 4YMWA 1E9RA 1Z45A 4L8YA 2IWRA 4NH0A 3VSBA 2I3ZA 3CZCA 5ENDA 4O5AA 1P7WA 1HEIA 5B1SA 2XDYA 2Y66A 4TVOA 1DU4A 3JZIA 4QECA 2G1JA 2A59A 1KP3A 3KTDA 4FEAA 5AP9A 3H13A 1W1UA 3FXAA 1SBHA 1AXGA 5B7NA 1DP4A 5JNTA 2AEMA 2PKYX 5F3WB 2ZREA 3BIJA 1MJGM 1K86A 3A6FA 3WLTA 2HUNA 3PNVA 4US2R 2OO3A 1KZGB 2P62A 3E9EA 3FWPA 5F1YA 1Q2XA 4MS3A 2Z56A 1NZFA 1XTRA 5BWNA 1VI5A 2DUMA 3DF7A 4PS1A 3E2MA 1BE1A 4FWBA 4IS3A 4DTIA 4ADSG 3BERA 3IT0A 4N5DA 5TT1A 2ONJA 1BDMA 3ZD7A 1U65A 4HDRA 1ECJA 1ULZA 3JQ9A 3JX9A 4JVOA 4V2UA 3TBFA 4FBLA 1TAGA 1L3CA 3CIOA 2PT5A 3T9AA 1W36D 2KWIA 2OM6A 2H11A 3PQ6A 1I7QB 3LLCA 5CXXA 4RVFA 2HPZA 1YDEA 1E2PA 2X4IA 4ZDJA 5KX5F 1ZSVA 2Q29A 2ZJFA 4FHEA 4XPIB 5KYUA 5IX8A 4YR9A 1SHUX 2P1DA 5BUCA 5D8DA 2PZ8A 4E51A 5KNCD 2OBBA 4IXTA 5DWQA 3RVDA 3UG7A 1W2HA 2HB6A 1EK2A 4OF4A 4Z7OB 4JLNA 3D02A 2VR1A 3FTCA 4HDAA 2HA4A 1P19A 1T5BA 2G28A 2ZTMA 5DGTA 3UB4A 1IYZA 3H5VA 3VPAA 5I4IA 1VYHA 1EFDN 3R7BA 4B17A 2C8VA 2JLSA 3TR0A 1BWQA 2FZ5A 3IOYA 2JBAA 1GTVA 2BGKA 2W0SA 3BMCB 3C41J 3TM5A 3ZNNA 4EPTA 1YAHA 3IULA 2P4QA 1JEAA 3FUXA 3T3IA 4B4VA 4D3YA 3S2EA 4A1OA 3LP6A 5JLJA 1XROA 2QRZA 2REOA 4GZLA 1M75A 2Q6VA 5JFOA 1L4EA 1ISGA 3FPKA 3NNNA 3R0ZA 1KKMA 3NIBA 1U99A 4Y67A 1BS9A 1TUEA 4JA2A 2WD8A 4MTCA 4XUCA 2CZCA 2X3UA 5CNIA 2HGSA 1ITZA 3T3MB 3BJZA 4LBZA 4BO9A 1IXSB 3PC4A 3COPA 3LL4A 2H1OA 2V1UA 1I8TA 2FU5C 1EP3B 2KBFA 2IVFA 2ODPA 5L3SB 2QTNA 4TRJA 4ZVUA 5JZBA 4QUBA 2ZCUA 2HV8A 2RGYA 5KTSA 3NYIA 1JL3A 4KIGA 3HSYA 1JR3A 1FFBA 2QIOA 3A32A 1QQ6A 3CE6A 3PR1A 1CERA 1WSWA 2B4KA 2QW1A 4KLRA 1Y63A 1WXHA 4JAVC 4RKWA 3TEMA 4OJMX 4QREA 1NN5A 1ZNYA 2W6QA 3KUKA 5IBRA 3UQYS 4OLBA 2WWXA 3D6HA 5B2ZA 3NJRA 3S99A 3VC7A 4RJTA 2F59A 1NUAA 5ALLA 2AJLI 4B43A 3PFGA 1GAQA 4RE5A 3T95A 1C7JA 2PNFA 2YWJA 1PKXA 4HBZA 1JP7A 2Z1NA 2J46A 1N92A 2XCUA 3NUQA 2A8YA 4QPZA 1JBQA 4TKLA 4UHKA 1QRSA 3HPQA 5IBCA 4R8KA 3OM9A 3L8MA 1RYHA 3PIIA 3FAZA 3AJDA 1S2OA 3TSWA 1EFTA 1GCUA 3FSJX 4FD3A 1LI4A 4GWGA 4LJAA 2CXOA 4JL6A 3WNVA 2JEYA 5ADWA 3T6KA 3P9SA 2JGAA 3C6XA 1E1NA 1ECBA 3ESAA 5CYOA 2WU4A 4LC0A 1YBVA 4D8YA 3W5BA 3FIJA 3RABA 3OLQA 3M9XA 3UG6A 5AW7A 3K92A 3TZQA 3UAVA 1MV5A 4JV5B 3GW8A 3L6RA 1U7HA 4TVKA 4OHVA 2ONCA 5FH9A 3UPTA 5EXPA 5LQNA 4E70A 1SQGA 2DPXA 1OIWA 1NJFA 2PQMA 2UVPA 3IBGA 4HJRA 1M34E 1V16A 4GBJA 1Z7GA 2ZZKA 5G3ZA 1T3TA 1R0RE 5LQUA 3RV3A 1D7AA 1UBKS 5DM60 4RVOA 2P9ZA 1Z6XA 1G16A 3HBAA 4AJ1A 2XXJA 4ANFA 4FE7A 3T5PA 1VHQA 4BFLA 2C83A 1U8CB 5EMHA 2R47A 8GPBA 2QORA 2AZMA 2VTEA 2RAUA 1CJUC 2XITA 3WY9A 4GX5A 1WY5A 1WF6A 2CWDA 2R5WA 3IMKA 4LJ4A 4WBNB 5ICCA 4RD0A 4DMUB 4MCJA 2F3RA 3G68A 2YY5A 1Y8RA 5A3SA 3IE1A 1YHZA 5EJ2A 1FTGA 1YAJA 3CSUA 5C1DA 1T13A 3HFRA 3PDUA 1FDOA 2ZRAA 3CINA 2DJIA 1WLYA 4IIVA 2VH2A 5IDQA 4YXWA 2E7ZA 3DFFA 3TTWA 2F00A 2GDJA 2EFCB 4IIUA 5A71A 4DUYB 1Q1GA 3TQHA 3E9CA 1U0RA 3CISA 4GX0A 3UVEA 3V1KA 1G64A 2P0YA 3RJ5A 2JLUA 2O8CA 3P4UA 3PSHA 3OPXA 5JRDS 3G59A 3Q9LA 3ML1A 3D1VA 4WADA 1B2LA 1M72A 3EZ7A 3VJMA 4U6NA 5JCJA 2XRYA 4XWGA 3IKJA 4QQFA 1A98A 5A7FA 4R0NA 3WRVA 1FYEA 3OEWA 5TV2A 2JFNA 3WGYA 1VMAA 3ESRA 1V2HE 2ZRHA 4BC1A 1J06A 1PFKA 4ER6A 4TS3A 4P54A 4DLNA 2JJYA 4J76A 3N59A 2OP1A 1VCMA 3TOVA 2XKBA 2OYRA 3R7SA 5DYNA 4L07A 5CX1A 4B46A 2X8JA 3R6DA 4X8OA 2H9AA 2PRKA 1BXRA 4BZZA 4DDTA 1Q0ZA 2EX4A 3BZBA 1SZDA 2IYYA 3RFCA 4F2DA 4PN3A 4DA4A 2QLBA 4UVDA 2GZAA 3OICA 3SXUA 4IDGA 1E9VA 4NYJQ 2XCRB 1YQTA 1XCJA 2OECA 2PHZA 4XVCA 4MYDA 5EGSA 3PGLA 3B1ZA 1S1MA 1W52X 1C9KA 1OHHD 3GP5A 1NBME 3CLHA 3RYHB 1T5LA 4ITUA 4MI3A 2AXPA 2HJWA 2HOQA 3GA7A 1JDVA 4I6JA 4JLKA 3D0QA 1L5NA 3ZY5A 3ZU3A 5BN3A 2Q07A 1ZIPA 1U5BA 3GHHA 1W34A 5A4MS 1Y34E 2H54A 4YH1A 3U09A 4EL5A 2YZKA 1P31A 2E4VA 2XWPA 4TZ6A 1JNYA 1MVNA 2FNAA 1DV1A 2WUEA 3KELA 4PG7A 4MS1A 4R8SA 3R7AA 2ENUA 1J0DA 2P6UA 4ZRMA 1IXYA 2ZLBA 3CJTA 1E5TA 3DXYA 1DJPA 4CR6A 2AHOA 2EW2A 2IU0A 4MMYB 3LO5A 3TSZA 5B6IA 1RWXA 2QZPA 1I51A 2PH1A 4BFXA 4PYIA 1M6VA 3IOMA 4IDCA 4R3NA 1MP0A 1ONBA 2KM1A 1TCVA 3A3NA 3FJ1A 3PEUA 1EEXB 5B58C 1QWSA 2HMSA 2WC1A 5DBFA 2EQ5A 3A3OA 4O4LF 4O2LA 4B3SB 4GHWA 1UAYA 2VUTA 3SQWA 3GPBA 2BMVA 1NW4A 1KK1A 2Q8QA 2FPIA 2V1XA 2NTNA 1M10A 1J7JA 1JR4A 3UWMA 1J8MF 3SR3A 5HCNA 2GTIA 4YAIA 4MUBA 5EQFA 3TW8A 1B73A 3SC3A 4PO8A 3GC6A 3NBXX 3WIEA 4YRJA 3NIFB 1L7PA 2RKOA 4IJ6A 3LZCA 1RCFA 2BUBA 4I9FA 2ZOSA 4Y6OA 5AHOA 1E4EA 3F5QA 4MR9B 4XLTA 1KMCA 4P3NA 5DHTA 3WQHA 3B6EA 5BOSA 3NASA 1U3TA 4NESA 4NQRA 5HOEA 3EPKA 2WU1A 2F8MA 3LUCA 1LVHA 2R44A 3CV3A 1CCWA 4MS4A 4E0BA 5JJIA 1AF7A 3WMRA 3OE4A 3IEKA 2CNLA 2P78A 3GZJA 4JJ8A 3PS9A 1OFTA 1GUDA 4UBNA 4XWAA 5IH3A 2B2CA 3QF4A 2X3FA 3OU6A 1PGQA 1B1AA 1YE3A 2P77A 3C1AA 4BEBA 3R0JA 3ZU6A 2WOOA 5I8WA 3CVJA 3I0MA 2PXHA 1AV6A 1G1MA 1CY0A 2O5VA 3PU6A 3KJIA 1NMYA 4RV4A 3GFPA 3ADBA 3F4BA 3X44A 4B4OA 1RJGA 1SQ0A 2X1VA 3EGIA 3R9XA 1L7AA 1R6TA 4M54A 4ZQHA 3CUWA 3VDNB 2YR0A 4FFOA 5JJ5A 4RNCA 3L6EA 1V37A 1PJZA 2V58A 5I9LA 3CVXA 4A91A 1N0IA 3ER9A 1DWPA 2X9QA 3PGKA 2XUQA 3M6XA 1PFYA 2RGDA 1QRDA 3FPBA 4QICA 4AJLA 2GEFA 4D5EA 1XXHA 1YQUA 2YJNA 3H11A 1PTKA 2N42A 2VL7A 3EFOB 2ZR9A 5F23A 2KB0A 4XIYA 4MR7A 4PAGA 1ZIYA 1AOXA 2GA9A 2DT8A 3ESDA 5HJ5A 2WG2A 1P4SA 4RAOA 1HDXA 3FETA 3IUYA 4W5OA 1E3WA 2OZLB 2RK6A 3ABZA 3O3OB 1W87A 1KP9A 4ZCLA 5ILGA 2IK8A 4QM7A 1TVKB 3KB1A 1KOJA 4OLJA 3ZIAA 2YNMA 4ZEVA 1XTTA 3A6HA 1P4AA 4HQLA 3PWKA 5H3HA 2PMDA 1XJWA 4B5LA 2VDUE 2ZT8A 5HOQA 1K6XA 2YHIA 2P9BA 5F2EA 2D1RA 1N57A 4D4LA 3LOQA 2WKRA 1Z8NA 2W48A 3D1JA 1BD4A 4DAEA 5JVDB 6ADHA 1E9AA 4J7CA 4M0PA 4ZC1A 1HDYA 4HDMA 1XAHA 5DM4A 3ROMA 1R8XA 2XRMA 3RRXA 4OU4A 3FSGD 4D42A 5HKOA 5ELXA 2I2AA 1XQ1A 3B1VA 4LZLA 2C61A 2ID7A 1N9ZA 2VC2B 3UJ8A 5L6LB 4G84A 1XZEA 2DRIA 4HAZA 4DBZA 2XD4A 5CH5A 5D5PA 1ZD8A 3CC8A 3ROEA 1QU3A 1MW8X 1GQSA 4C88A 3X1MA 2WHXA 5C35A 4CLRB 4FQ5A 1BQ3A 2R5NA 1LLCA 1Q7BA 2V3VA 4HP8A 5AHXA 3PGXA 1TQ6A 4ZU1X 5FJJA 1ACJA 2R1TB 3HHPA 1CHDA 3JTMA 3PC7A 3MFYA 1HE2A 4UPVA 5JANA 1CUHA 1XZKA 4G01B 4E09A 1N6KA 5I4CA 2JASA 3AWDA 1HLGA 1ZAKA 4XSGA 1ZINA 2V97A 2WWTA 3G5LA 4ECEA 4MV6A 4GG1A 3CLSC 1WU7A 3EA0A 4CLDA 1GPAA 3KD2A 4FIZA 3ZOKA 2C5AA 2JHFA 2WFMA 1Z47A 3F6RA 4TTPA 1U90A 4FQ7A 5H4HA 4ITVA 5GJWC 3F7NA 2CBGA 3R23A 4F71A 1FK8A 4PG5A 1PT7A 3LK6A 4XWTA 1OT5A 2GD1O 3KOZA 2C54A 1RWMA 1Q0RA 1U4SA 1UZNA 3E22A 3BXOA 3HFGA 3VHRA 3W2GA 5E1MA 5C37A 4GQIA 3OEEA 4RD4A 4YJ3B 1DTWA 1XMOB 1GQ2A 2RD2A 5LD2C 1I6WA 1EP2B 4KC0A 1G20A 4X1YB 2AFRA 2ZE5A 4HNAB 4E15A 1VA5A 5FFFA 2WVJA 1T4BA 3OEYA 4MA0A 4ILEA 4R2WA 1T2VA 2AEJA 1DBRA 1YZQA 2JA1A 1EGMB 1C0LA 4H59A 2XT9A 1XQ9A 4BU1A 4Q1CA 3WGVA 5AW3A 5CYGA 4F3KA 5L6MB 3BTVA 3DOCA 1Y1RA 3KQPA 3V2HA 5FOQA 2ZRDA 3TGLA 3JQRA 5LN1A 1RRPA 4DM7A 3VU1A 1BJRE 3E4CA 4BCDA 1RI4A 4BLRA 4B7UA 2HSDA 2QYSA 1PR5A 2VKTA 4KPUB 1E2DA 2QTFA 2BD0A 2YICA 3B6ZA 4HGYA 4Q6WA 3UK2A 5FD8A 3C87A 3JVDA 2QUHA 3PXEA 3PT5A 2A33A 4AKGA 3KLNA 4B48A 5IUJC 3HCFA 4QYIA 4W9NC 3PNYA 4BVEA 5A2QA 2ZYWX 4UNIA 2H4XA 2QM0A 1Y4DE 1SG0A 5AVWA 3CO5A 3GAMA 3HP1A 2P9CA 4ZCMA 3CU5A 2QRKA 2RH4A 3TLCA 2H9IA 1CC1S 3IUMA 4MQBA 1QC5A 3X1ZA 2H7XA 3FYHA 2YJTD 3CFYA 3N9IA 4KTTE 4TTAA 4OO3A 5F78A 4X61A 4BNGA 5FV4A 1R12A 2V54A 4ZXFA 3WR5A 1Q7EA 4RTSA 1CULC 3UHOA 2P4UA 2GM5A 1JFFB 2X2EA 4DSTA 4IH4A 2QPTA 4PC2A 3D3JA 3HEMA 2ZTSA 4JQSA 1G18A 1EE1A 5HX7A 3C3DA 1JEQB 4K40A 3TOCA 3M6FA 3VOBA 1TVMA 2AMYA 3LWNA 2JGEA 2HWYA 4TT3A 4Y7DA 3S8MA 1I3KA 4CM1A 2PCJA 4LF9B 3RU2A 3OG9A 1EAYA 3VPGA 1ID1A 1MXFA 4MUIA 4OKIA 3B6JA 5DK6A 4WLFA 3RUPA 5LYJA 3DP7A 1V1RA 2MWMA 2AZTA 1KEZA 2ZJ1A 3QIAA 1NJGA 2LZ0A 1FP4A 2ARKA 2NU7A 3K5IA 1YDFA 4L5JA 4JI3B 3W8FA 4A03A 1W5FA 1H23A 1XD2A 3F6YA 1G4UR 3U7EB 3EN0A 3NNSA 2NVUA 3QBEA 4M89A 1HYGA 1PR6A 1J1IA 4HTFA 2IUFA 1XFAA 3MTGA 5IW8A 3SKYA 4F21A 1L4NA 1OI3A 2R7KA 3AKCA 3DAGA 1R5BA 4MV0A 3U81A 3WDKA 3UJHA 2EVWX 2J0UA 2FP4B 2N46A 3L8ZA 4ILKA 3GNQA 1FNDA 5DEOA 4MWOA 2NZXA 2N1BA 1US8B 1XTSA 3C97A 3P0JA 1WMAA 1LVUA 4E2ZA 5JCOC 3H3JA 3V46A 5I8ZA 3WQRA 2MJLA 2D13A 4U9HS 1D1SA 3HXTA 1RXUA 1OR8A 5I47A 2B9VA 3KQTA 3VYRB 1GY8A 2CKMA 4JL5A 1RDFA 3N6RA 5FKJA 5AKYA 1SURA 2VYVA 3QWAA 2WIDA 3DHVA 1VQ1A 1XF9A 1UPFA 1W19A 2WSBA 3MTDA 3L79A 2WSSD 1YZKA 2YFKA 2DUNA 3OCCA 3LHFA 2I0FA 2R2AA 4PQRA 1KP2A 1OT3A 3PNOA 3QWIA 4WLOA 3Q0IA 5EJ8A 4MVJP 3ESYA 3IDFA 2GN0A 2L42A 2PD6A 3HDYA 3ONEA 1SKQA 4KSYA 4PICA 4RMIA 4J75A 4LXHA 4C4PA 4OLHA 3SBEA 4GAEA 1Q1ZA 2R8ZA 2XZDA 5AM5A 1LBTA 2LKDA 3C43A 3VNRA 4K9DA 3GQBB 4M1QA 5LMNB 3Q7IA 2YWXA 3K0EA 1GIAA 1VG8A 3PZBA 1X74A 4YRFA 1F0KA 1IWBB 1KI3A 1M54A 1M7HA 3MPUA 1U98A 2Q8PA 4OXQA 3VR5A 4Q3NA 4MGIR 2Z6VA 3W6NA 4DLXA 3TX2A 1IEWA 1ESEA 4IWXA 4M1OA 2J3JA 1RWOA 3FHLA 3HJGA 3LC2O 3MWYW 3P9YA 2CVPA 1JHUA 1DC5A 5TF0A 3CRNA 3SLRA 1SG6A 4F3RA 3K0SA 4N3CA 3G13A 4XGNA 4LDRA 4RY8A 1USVA 1QDEA 1QGOA 2J9FA 5DBOA 4JMLA 3JXEA 4N39A 3UYKA 2NZVG 5JSHA 1GPUA 4XPIA 3DE2X 4JLJA 1PFUA 5L3QB 2Q4OA 4OGFA 1UC9A 2WIGA 3FTNA 3OHSX 1FXWA 1KK0A 4J43A 3IX7A 4P86A 4E08A 4HWRA 2VZLA 4ZYLA 1JJBA 4D3ZA 4I50A 1SCIA 2VNJA 1SIBE 5KX5B 4S0XA 4KP7A 1CY8A 4DR4B 5JOQA 3ZGXA 5G0SA 2QGNA 1UK6A 1KPGA 1NBIA 1ZEJA 4G63A 2R66A 4X7RA 4B82A 3DOUA 1H0HA 4URUR 4ZV7A 1RRGA 3B3FA 2QNBA 2IPOA 3BMCA 3U9SA 4Q00A 5MN6A 2ZS7A 2NQ2C 4OH1A 1Y3HA 2EQBA 1H4SA 5JNLA 5KHAA 5JH7A 4LJSA 1WDWB 2DWPA 2WD7B 2G9VA 3HI4A 2ZJ2A 2YHUA 5CLQA 3KQNA 1SBCA 3CWZA 4L8FA 2A5YB 1FUIA 4PZEA 3PUHA 2ZB7A 2DR2A 1QQ5A 1GAEO 5DASA 3KIPA 2BFNA 4G0XA 4NOKA 4N01A 2VDJA 4YV1A 1NW6A 1NR5A 2AXEA 1E3JA 3OU2A 2QTHA 1I2DA 2R00C 1FRVA 1I4TD 4RULA 4G09A 1XZIA 6LDHA 2Q5CA 1DTSA 2ZQZA 5L3SA 1I01A 3I04M 2C5GA 3KX2A 2WZCA 2I6TA 3OQJA 4G89A 3S6JA 1DRUA 1OBFO 3AB7A 4AF7A 2V7PA 4Q12A 5F35A 1M66A 2P2NA 2BONA 2EATA 2QJOA 3EQ8A 2B20A 4M1KA 2WI8A 5I7OA 3G2IA 3NDIA 2GAFA 4LXTA 4HY3A 1X86B 3ZX5A 2HK8A 3VX4A 4YRIA 1PTJA 2EFGA 2LIVA 5IT4A 1NASA 4JLOA 4CMIB 2NXWA 2JFVA 3FA2A 3OPYB 1RJFA 1YULA 1WEHA 3D7SA 4KACA 4CKXA 2CEKA 1KY5A 2PMWB 2NPOA 1Q74A 4I8XA 4REQA 3JQFA 4NE9A 4NQZA 4V0OA 1UK8A 1SZCA 5CT9A 3TEFA 1L5VA 5IS2A 5I45A 2ZBFA 3IS3A 3FPGA 3D6NB 3ED5A 2B0JA 3C15C 1XN4A 4L74A 1SK8A 4KXXA 4U2GA 3GRVA 1GZVA 5EWJB 1ZMTA 4DVGA 4KREA 1Y3BE 3DCIA 4I1OA 4JOQA 1VZ3A 5GVSA 2B30A 3B1YA 4GYJA 4J6EA 3FOEC 5JJKA 3JQQA 4F38A 3VYSB 4Q4HA 4I5DA 1QFYA 5KIAA 1WQ3A 1EDZA 2Y1XA 3ETLA 5E9AA 3T4XA 4MIYA 3CBQA 4O2BF 3C7AA 5ICMA 1XXHE 2UUCB 3GEHA 4UUBA 4KCGA 3EZXA 3SZMA 5C8YF 2JJ1D 5IRCD 1IN8A 2IH4A 2HMUA 1KOGA 3VNVA 4NPAA 2ZAOA 4NFLA 3IEMA 1OXSC 1VXRA 3AP3A 1ORVA 3I9V6 4P5EA 5IC5A 2GD2A 2I3BA 1U80A 7GPBA 5EXSA 5K03A 1OWPA 4RIFA 1CUZA 1NUUA 3IAXA 1OTXA 4NOJA 1KI1A 3MQ2A 3N2IA 1NBWB 1K8RA 2JIMA 4JB0A 2EWMA 3C6BA 2SECE 1DBVO 4LOHA 4LMBA 3SJZA 4YRCA 4YHHB 4MW9A 1YB6A 1EHYA 1G6OA 5IANA 1AKUA 3FFAA 3MW8A 2HIGA 1COWA 2YIJA 3KEFA 3WJ2A 1RW4A 4TT3D 1EP9A 3WB0A 4BCBA 3A25A 3IQEA 1OXTA 1VFPA 1XHLA 2WAYA 4ZT7A 3TFWA 4YCDA 4LOJA 1WB5A 3T0IA 4L0QA 4JR1A 1GL3A 4DUGD 4ZOBA 1N3LA 1VHDA 1AKQA 3KOMA 4V0LA 2WQ6A 2BP7A 2FSUA 4QXMA 2HD4A 3CCBA 2DERA 3IBFA 1VLQA 4OJKA 1Z6ZA 2REBA 1ZITA 3FKSA 4N3GA 5C0OE 3WADA 5TLSA 1FBTA 4K6CA 4TXHA 4H7JA 1WDLA 2A0YA 3EDRA 1VOTA 4AL4A 1OC2A 2V7VA 3SX0A 4B2YA 3DTVB 3VVMA 2EC5A 3PYXA 4BNDB 1D8AA 4F93B 1Z08A 4FZRA 2JG3A 5TMBA 2EYUA 4YCCA 2XAUA 3B5IA 1ZJJA 2HQSA 2OFWA 2JFOA 3D6FA 5K1ZA 2J3QA 3VR6A 2A7QA 3BWBA 4BUJA 1KI9A 1QTRA 1B14A 2DSNA 3B9RA 4TVSA 4G4SP 2XUGA 1R88A 2X0RA 4HNQA 2JLVA 1TQHA 4TYWA 5DI9A 3WLEA 3ZD8A 3IAS6 2P40A 3JPYA 2ZTUA 4HVAA 1ZC3A 2GYWA 2YYSA 3C48A 4Q93A 3CPJB 4BNFA 4G26A 4UEOA 4EJ0A 4YRMA 4C7OB 1Z6PA 4UXHA 2DPMA 3JD2A 1I6MA 4ZYYA 3GD5A 5AW6A 1USGA 4HXEB 1N7JA 3AM4A 3OUZA 2EZTA 2D0IA 3IAFA 2QN8A 3KJHA 3NYWA 3IV6A 4HNGA 1XGKA 1LKZA 5HJ7A 3KVVA 3R4VA 5IT5A 1G20E 1P1BA 2FEMA 1KZHA 3JWIA 4QJIA 4ZV4A 3T4PA 4R2JA 4LF8B 3B3QA 3A9UA 4IP0A 4UCFA 3WYGA 1KHTA 1M8KA 2QTBA 3FBWA 5LB4A 1N5JA 4BWFB 3GUYA 4OYYA 1ECGA 4Q1AA 4WW0A 1AHHA 2ABWA 2BKXA 5B1IA 4UASA 2D8AA 4TYMA 5GZ6A 3HZOA 4A9AA 1SN7A 4GXRA 3RYHA 2X7JA 3R3HA 4DLPA 1J2YA 3HL4A 1G4AE 4GFDA 2ZPTX 4PWZA 4QXPA 1FFAA 5JHGB 3IOBA 4QD3A 3TK1A 5K3OA 3JYPA 1VL2A 4UC0A 4N48A 3LTEA 4M0KA 1E0JA 3DDSA 1RBYA 2DGDA 4JT4A 5TEWA 1NG9A 3F4KA 1PV1A 4O4IA 2YZ7A 4BRWA 4P38A 3WGJA 3VR4A 3A9RA 4OXXA 5BO5A 3T3DA 1ULUA 5B58T 5B30A 2R4QA 2F3UA 2D2XA 2GXQA 3EY9A 1Q44A 5E6RA 3SE0A 1KDOA 1E3EA 2O07A 1J39A 3HVHA 4ZDWA 2H2DA 4EVIA 2JANA 2ZRKA 1M0TA 3U1BA 3E23A 3QVUA 2QUJA 3NHWA 4R1QA 1CUFA 5DGDA 4MJ3A 2ZAMA 3GJ0A 4M9QA 1VMDA 2AE1A 2ZB8A 1U0JA 3WL6A 4JYMA 2QXYA 5TXGA 2FZLA 3T15A 3DNPA 2EEZA 4OCZA 4K6FA 3BWXA 3WDSA 5A4DA 1YUMA 2GZSA 4TRNA 1QGDA 2NQ8A 2X42A 2DR0A 4NC9A 4LFCB 1CUXA 3T5CA 4KH1A 5HM8A 4JQOA 4WFQA 3IP5A 3TLAA 2G7MC 4O4LB 5JDIC 3K8QA 1P2DA 1ZD4A 1E2LA 1HTBA 2OMKA 1FQWA 2ZG6A 4JASB 3VQTA 4F12A 5B3AA 4N3BA 4B3FX 1HPLA 1UKCA 2D74A 3G02A 2I2DA 1RQLA 1HFJA 3GRRA 5EOVA 4URXR 1BA3A 3WRXA 3W5DA 4Q9IA 1KDYA 1MJFA 2PSHA 1KKUA 1XO1A 1YV9A 5AYVA 1YRBA 2Y9PB 1TAQA 5AI5A 3QEMB 2AXQA 2IGTA 4UFOA 5ERXA 3I2JA 3WSTA 1P33A 2G3YA 4Y1FA 2WU8A 4UTPA 2XOKA 1Z7BA 1GQOA 1VLMA 1AV7A 2GVNA 1OLOA 4FFWA 3QV1A 1XCBA 3KR0A 1L4UA 3MK31 4MVYA 1F4LA 1CD5A 4YJFB 3AF5A 1M0WA 3RAFC 3C6YA 4LIPD 5M34A 5LZ9A 3AV3A 3R2JA 1NVWQ 3G6WA 3GRYA 2ETVA 1N0HA 1L2TA 4N7BA 4I4TF 4IMIB 5GMOA 1AMNA 4LRXA 3L8GA 2D4HA 4RHEA 5TS3A 3TQIA 1LJUA 2GJKA 2OT3B 4B73A 5TX7A 3AR8A 1NM5C 1RBMA 3UWOA 1LEHA 4M0MA 5HCIA 2WJ3A 1P61B 3A31A 3E84A 2NP7A 4EKNB 4DCSA 1CZLA 3EFOA 3GJ5A 2IYRA 3LHSA 1E4VA 2JH9A 3PGJA 1DCKA 1KYWA 5DHAA 3CIFA 3TRFA 4F4JA 2BTEA 3U9TA 2GI4A 2ZWAA 2XYHA 4WSOA 3ASZA 1GJRA 2OZLA 3N2YA 5BQ5A 1EGQA 3T5GA 2PIDA 5LZ4A 4RX1A 1RYBA 3NGXA 1TVKA 3HABA 4JJFA 3W0LB 3PTAA 2A0XA 1MU0A 1ZRNA 2G07A 4RXMA 5FFNA 3BEDA 3DZCA 3MMZA 1XTPA 5HS4A 3K32A 3RYCB 2GEBA 1XALA 4WKNA 1LF0A 1J8VA 4G5GA 2QZZA 1HWYA 4YAWA 2G9UA 1R0KA 1QH9A 2XVMA 4L08A 4NARA 1V8ZA 1C7ZA 3IAUA 3T9BA 4DV3B 1VJCA 3GJ3A 2E5LB 1YS4A 3KKPA 4MGHA 3H5TA 4GWLA 4C2UA 2GBCA 5G0VA 2QRPA 2IYNA 3TRKA 4KZKA 5JVDA 4MUFA 1RMQA 4J3FA 1YWGO 4XB6B 5FRDA 3ST7A 3UJDA 4E94A 4AZVA 4F5WA 2LE0A 4MTLA 3EULA 1NKTA 2A0KA 3LQQA 4HEHA 5G41A 3JAMA 2DFPA 1MDBA 2M9MA 2WZQA 4LQ4A 3IIKA 4IXMA 3WV5A 3D3QA 3DONA 3TIXB 5FHQA 4A8TA 5H81A 4MVCA 1M2NA 2HMYB 4REOA 3KPJA 3WYAA 3JD0A 1FSFA 2OOSA 3OETA 3ZZTA 4CLRA 2PGDA 4ZEWA 2G9NA 3PYLA 1NU8A 1SFRA 3O4VA 1T5DX 2Y4NA 4B3RB 3H84A 1KTVA 3LXXA 3EXFB 4H15A 4Z4EA 2EARA 2DFNA 3ASYA 4NTZA 3ZS8A 5CK4A 1JEYB 4QPCA 3L18A 4V1CI 5LBUA 4GZ3A 1UBLS 2FG5A 4ZO9A 4QQRA 3TI7A 4DV5B 2I22A 3BRQA 4LMRA 4CMHA 3NWJA 2Q3BA 2P30A 1RE1A 2LNDA 2BF7A 4TN5A 4IG9A 1DEAA 4OFXA 1FNSA 3GMTA 4M1TA 4YCAA 1PS0A 1AZSC 1XAJA 3TSAA 2J3KA 3RF7A 1ESDA 3I5MA 2FPRA 1VGQA 1JPNA 4R1TA 5FBQB 3FR7A 4G2TA 4GVPA 4Q3LA 3IJPA 4REMA 4IKEA 5E8JA 3ROTA 4DEYA 4YP6A 3LMKA 2BFWA 4DB4A 4MK4A 3RSZA 4PYKA 4AN1A 4CUJA 2VSOA 4AJNA 1UXJA 2OHHA 3EQ9A 4EFDA 4YJ3A 1I36A 2ANCA 2AWNA 3HGTA 5E4FA 4BO8A 3VNUA 2AXNA 2A1TR 2ZI5A 4X1YA 3C14C 4HNAA 4UE6A 3GJXC 2WMDA 1U9CA 1Z68A 3T7AA 1CQPA 3N8NA 1UPAA 2JHPA 1G21E 1WHTB 3AR6A 3NVDA 4RK6A 3C3EA 4LTNA 3PCXA 2G67A 2EQAA 3IAHA 3I2FA 2QLLA 1WXXA 2VTVA 3AINA 1DZ3A 4BVAA 4XQCA 1QSGA 4Z9BA 3C4VA 2Y92A 2RGGA 3IB6A 4G5XA 1T1JA 3OZXA 5SY6A 4KPUA 3TG8A 2Q4RA 1YQEA 2A4KA 3BJMA 4UDOA 2B5OA 4B6SA 3RC8A 3FOWA 3A3KA 2A58A 4YMSA 1VYUA 3H17A 2OEPA 1QZZA 3V4RA 4NU6A 5AVXA 3LBYA 4G0PA 4HRXA 3WLMA 1FVXA 4X6XA 1R9MA 1TC2A 4Q24A 3LNTA 4E3WA 3W2HA 3BQNB 3E9RA 6REQB 1W94A 3N7UA 1UQUA 4RUKA 1N8KA 4O3MA 1ZBQA 3COWA 4I4IA 4N40A 2WV9A 3P9IA 6PFKA 3ZHSA 3QUBA 1P6XA 1YZFA 4IO0A 1A2KC 2A92A 5IMBA 1Y6ZA 4W8HA 1DBPA 4X6YA 4IWNA 1E0DA 3NM4A 3PPVA 4GKVA 4BQFA 1FPQA 1EYZA 4QLOA 1QH1B 3GN2A 2I76A 1JFFA 2UUPA 2FI1A 4UBOA 3WG9A 2VPXA 1E98A 4NLLA 4GDFA 3PQ5A 5CHYA 2PZGA 4M8IA 4PZDA 3K1YA 3I01A 4F2GA 1JEQA 1R2QA 1DLJA 3MJDA 3HXLA 1F8FA 3WIDA 4YN3A 3COSA 1CRPA 2ODNA 1RIIA 3OIVA 4BN5A 3IB3A 3PJDA 3V4FA 5FNVF 1QR6A 1XRSB 4IZHA 2NV0A 1T5SA 1W73A 3ABSB 2VP5A 2PUBA 3KV1A 3O8BA 5DSZA 2W2PA 2B3DA 1ZNQO 3IPLA 4LZZA 2QJTA 2CNWD 2O7VA 2QRQA 3DOHA 3ITKA 4YONB 3EPHA 1ODIA 2EFJA 3F7TA 4BP8A 3RBZA 4JYZA 3AB3A 3O21A 2IP2A 2FP4A 4ZXPA 3ASVA 5CLGA 1W7AA 1HLFA 1W4RA 1T9KA 3F3SA 3MGKA 3I2IA 4RORA 1TE2A 4XA8A 1UDBA 3EK2A 1DIBA 1CY6A 4L51A 4EUKA 1PGNA 1XVTA 4NV1A 2Z83A 3P26A 3S1LA 4DCNA 3E9MA 2PRZA 4Y3UA 1N1EA 1Z4PX 3KU1A 1NMZA 2LD4A 4HO1X 3N2KB 2GCPA 1JZTA 2VAPA 3DFMA 4XE5A 3ZI4A 3NIDB 1IBSA 2L69A 1H1LA 2MT9A 1RHKA 2FSHA 1NY6A 4IFIA 2G5PA 4X8HA 2C98A 8ABPA 1RFLA 1TRHA 4UMDA 4URVR 4ZZ1A 1NVFA 3LTNC 2WWFA 4MV8A 4O3FA 4Q3AA 2JJQA 5EXEA 2Y93A 1GUZA 1OIVA 2XD9A 2QJRA 4IWYA 4WKPA 4ZAGA 4JCOA 3UT5A 1JHOA 5JO0A 1A9PA 1ICEA 1UZUA 5K3SA 2Z5LA 2HNBA 5I9TA 4NBWA 4RJLA 3A11A 2ZWOA 4HX5A 4N0EA 4NZPA 3OZSA 5D87A 4BIIA 1DRKA 2ZSKA 1UBRS 5DHQA 1U0GA 3SU8A 3K9FC 4GOMD 5ER9A 1S89A 4HWOA 4RTQA 4DEXA 4J0EA 3I83A 1QOQB 1NG1A 1KRXA 2E4YA 4RD3A 3ISTA 2OE2A 2OV3A 3K5PA 3PNBA 5GOZA 5I6DA 4KE8A 1C4KA 3D4LA 4FMBB 4G97A 4JBXA 4JI6B 2YZNA 1XKQA 1BU5A 3BD6A 2YFQA 5L3QA 4W7HA 2AVNA 3IPXA 2OVBA 5CVUA 2BUAA 2ORIA 3VTKA 3PIDA 1SKBA 2YVLA 2OHJA 2H1LA 1QYDA 4JI5B 3RVPA 2G72A 4BLWA 4YRRA 1KK3A 3FNRA 4PC1A 3OZAA 1H93A 2Q7DA 3H75A 2DKFA 4FFBB 1V5FA 3KVRA 1GKYA 4LBWA 4B8ZA 1T2NA 4ZU6X 3DYIA 4HH4A 3MG9A 4AULA 1PKEA 4ETWA 3P9RA 3RTGA 2VJQA 1GP2A 2PNJA 4L4RA 4DLWA 2VA8A 2WM8A 2C20A 4HZIA 1KPHA 1RRKA 2UZAA 2WP8J 4ZO6A 5HXAA 1GRVA 5D6OA 4ZEOA 5FI5A 1TLTA 3UPDA 2IZ0A 4LHXA 4Q3CA 4YAUA 1QX3A 2FN9A 2JA2A 1V9LA 3E05A 3MMPA 3PDHA 5FV7A 3RLFA 3MXTA 2CFOA 1R1DA 3TRIA 2BFCB 4LW8A 2DETA 1MHPA 1A9OA 4L9WA 4I55F 3JQEA 4QX6A 2ZDQA 4DNOA 1E2EA 3OHMA 3OZWA 3VR2D 2RGUA 3IDAA 2C57A 4AN0A 1XCGB 4CQNA 521PA 3HB7A 1WPQA 2FPGB 1BQEA 3EMVA 5LYYA 4BKQA 1KH2A 3S1SA 1Q0UA 1XSEA 4LYAA 1NTOA 4X7PA 5JALA 3ORQA 1FUYB 3DNFA 4Q9HA 3IRUA 4HAIA 3NG1A 4XFJA 4N5NA 2M1ZA 4DN6A 2PEYA 3QTBA 4WCVA 1L5YA 4ZI3A 2E4XA 3ILVA 1XCMA 4HBGA 1CQJB 3IUSA 4CMIA 3PCTA 2XE6A 3OPYA 3Q5GA 3SKVA 3QHQA 3X2SA 2JKVA 1OH6A 4EQ6A 3JRWA 4UARA 1X8XA 4I9GA 5EE1A 4EBBA 3NS7A 5CCEA 4K9RA 5JARA 1G8AA 5C7LO 2Z98A 1KE1A 4E6EA 2MYTA 4F4DA 2IC5A 3TJZA 5IHPA 1D0SA 1IHDA 3VZSA 4QOSA 3C16C 2W2TA 3BIFA 2KYRA 2CBXA 1EFPB 3SYLA 1YZYA 4BNZA 5B4VA 2O4CA 1JIIA 1CKEA 3E3AA 2QTVB 2ZRBA 3NBQA 4FS3A 3SFVA 1X80B 3UYLA 3AONB 4IX9A 4P4LA 1H1DA 2BJVA 5TMPA 4E5MA 3TLMA 5E4JA 3WFZA 3HJCA 4OSEA 3EZFA 4LF7B 1MR3F 3L6OO 3BXPA 1TUIA 1D7OA 2FR0A 4U02A 1VYVA 4GR9A 1ELOA 2OO7A 9MHTA 1FJGB 1NRIA 3NC4A 4HOYA 5EXTA 4O2BB 3A10A 3FOFC 1P7PA 4RQBA 4XDGA 3MQFA 3KDPA 3K7EA 4BS9A 1RLJA 3C98A 3UC5A 5LOVA 3ZNQA 4DCVA 4QGSA 5C8YB 1MORA 4C03A 2CXNA 3B70A 3QVJA 3K1AA 1S8FA 5K0LA 1R7RA 3PBKA 2QM8A 1DWQA 4BOYA 3OX1A 4C4SA 3MLEA 3RVBA 5FR2A 4W8OA 3NB0A 2UYHA 4CDMA 1XMSA 1EB8A 5GVRA 2AE2A 4DS3A 5BNFA 2V98A 2RJNA 3V7UA 2VF5X 3E7XA 4IQGA 3NHZA 1E9BA 2JI9A 4IVNA 4KMSA 1OKKA 3IUNA 4ASUA 1TK3A 3PRYA 3GGCA 4AJHA 1I10A 4DR1B 1SXJC 3UT6A 4L73A 3JY6A 5EESA 3C24A 4BO5A 3OX3A 1NNI1 1M8PA 5EZYF 3WP1B 2ZWPA 1N6HA 4K8OA 4PFQA 2X5NA 2XTJA 5JS8A 3QSGA 3SX2A 2J30A 1GPNA 5JPDA 1HDRA 3DTVA 1C5KA 3PLRA 3QVGA 3PQ7A 4PPFA 2DOKA 2R6AA 3O95A 4AO6A 5ALXA 3SZOA 4EPYA 3FNEA 4FYMA 5T4BA 3KYDB 1I1OA 4WOPA 1E2IA 1PFWA 1ZGHA 1ZXXA 1MVLA 4IYJA 5AQEA 1P81A 1WL8A 5BYKA 1RPZA 3AVUA 4XGQA 3H16A 2XTNA 3EPLA 121PA 4G5SA 3THSA 4WZAB 4TLMB 1VB3A 2WMYA 3KBBA 2IUUA 3T7EA 3D8BA 1XJ5A 1YFKA 3B82A 4ZJYA 2B6HA 3DT6A 4C7OA 4GC9A 2VPYA 3A4VA 1SWVA 3MJEA 4DL9A 3M6WA 4J03A 2XYQA 1YS2X 2IXEA 3O8LA 5LP1A 5LXTA 1GCOA 2R6JA 5EC8A 5EVCA 2PLAA 3GDGA 3DQPA 4F60A 1AHPA 2CL5A 3N8HA 3OJFA 3AIMA 4ZYWA 1P1HA 3FYTA 2Z0MA 5EIWA 2ZANA 2ZYVX 3HKDB 1ODCA 3M5CA 3QVTA 2E6UX 2XYRA 4D0SA 1IZ9A 3RARA 1XV5A 2SKCA 4XX0A 4FDLA 2AN9A 3AO0B 2R87A 1WW2A 3EGDB 1JIVA 2O2CA 3ZWNA 4F9TA 4XWYA 1AQ6A 1SELA 1M3SA 4EG4A 4HAXA 5EL0A 5DJ5A 5K51A 3TTYA 4PFJA 1HDIA 3JALB 4UMFA 4J2TA 2QE6A 1QU2A 3BA6A 4RJKA 1U6IA 4FEGA 3WLPA 1K7EB 2FF7A 4LSZA 4UVEA 3O7WA 1V2GA 3RF6A 4YV2A 4MX8A 1DRWA 4WK2B 1ES9A 2VG8A 1DAMA 5C3MA 2QYOA 3IP8A 5K0JA 4B76A 5IC4A 2VLBA 3NU1A 2WF8A 2NGRA 3FD8A 5CFQA 4B1FA 3VGJA 1JT2A 2ATXA 4P8RA 4BJHB 1LZKA 2FEWB 2P69A 4X71A 5U4QA 4AF8A 1H2FA 4DY6A 1MKYA 3I9MA 4DGSA 4G9BA 1D6JA 1VHWA 3M3DA 4DA7A 4ZI7A 4BXOB 3PUIA 2I4NA 2K2WA 2Z9BA 2WIFA 3WS7A 3D7RA 3ZV6A 3NZEA 4J3NA 3WK8A 1H1TA 4D8VA 5KQMA 4JHLA 5M29A 1AGRA 1BW9B 2DQ4A 3GCDA 1TYCA 5KQGA 3VMFA 3UCFA 1M5RA 2ZP1A 4YQZA 2ZJ7A 5ECGC 1JHVA 4RS3A 1Z39A 2R68A 2XE4A 1PWEA 2O2IA 1XTVA 1L9KA 4OMUA 5ESDA 1EVZA 1DAKA 2AK2A 4Q1EA 1FP6A 3CPEA 1W0KA 3G8BA 1OH7A 3GA0A 4O4LA 4YRZA 2WYIA 3QVLA 2ZJ6A 3LNCA 1KMHA 3TE7A 1JE1A 3V4ZA 4BZWA 2RGCA 4TN1A 4Y9DA 1Q50A 5LCXA 4DCOA 3L7YA 1CEYA 3K2EA 3N70A 4G8JA 5DBIA 2GH1A 4BX2A 5F33A 1NQXA 1N7HA 1KY3A 1FB5A 1YB5A 2PGIA 2RGEA 2AZDA 1OBVA 2OD2A 1YTLA 1H69A 3F2VA 4JGBA 2TS1A 4IJKA 4LWOA 4HZUB 1UP6A 1SAYA 2WWVD 4BZXA 2X3YA 1DUIA 2AN4A 4MRNA 3QEMA 3JWEA 5L4NA 3W2FA 2I91A 1FDUA 4RTOA 3MCVA 3BXEA 1G8GA 4TLAA 1ONPA 1C1XB 1KJYA 3DJFA 5EHNA 4D79A 4Y9RA 2PMBA 3U4DA 2PKRA 3OAAA 2RONA 4YJFA 2ZJ4A 3ZZ0A 2CL6X 9ATCA 1RYYA 1T1IA 5FNZA 3CLRD 1O6FA 4NR0A 2JI8A 3D0KA 2O2JA 3FRJA 3F71A 3PTZA 4J2HA 5EI5A 4ERXA 3AX6A 3LDUA 4L75A 1OPRA 2OCBA 4OPMA 2ORYA 2DLDA 4AKEA 3O0DA 3CT4A 5FYDA 2QE7A 3NFRA 1JGTA 1U2SA 3LF1A 2FEXA 4I4TB 2NNWB 2E1RA 2ZU6A 5AT1A 1U3UA 5EHQA 4D9EA 1DKNA 1VL8A 1VSVA 2YWRA 2W7TA 2H06A 4K6GA 3KETA 5A6SA 1NRXA 4JQZA 2IT1A 1OTYA 1JIXA 1Y1PA 4FX2A 2ZJBA 1E3IA 1GZ6A 1RADA 2V03A 3LGXA 4EG5A 4ROTA 2Q8NA 4L7VA 3OQNA 4F5YA 4FR2A 2VYND 4TZ0A 3DDOA 3DP9A 4WV3A 4LNAA 4IZOA 5E8RA 2JB9A 3ZDCA 4BATA 2Z6AA 3NPAA 1R0ZA 1SQSA 4OQPA 2PH3A 1GR0A 2WA2A 1TJPB 3D4NA 3LY5A 1Z25A 3NO4A 4R8VA 3UK1A 4YWJA 1J5PA 2NACA 2WOJA 4J0JA 4PLPA 3O8CA 4ZPXA 4JLMA 1KFJB 2QZJA 3VKUA 2QVXX 3IQFA 1KJNA 3DULA 5EERA 3AETA 5HUHA 1WBDA 2VNSA 2E4AA 1C7FA 3PDJA 3TECE 4V38A 1P7CA 4K46A 4L72A 5CEFA 1CV2A 3LQFA 2VH5R 2Q5FA 3DPUA 3BH6A 3K0CC 3STTA 2WVHA 4TQAA 3LPMA 3FFTA 2CXXA 4ZD6A 2VS1A 3I1JA 2JI7A 4HXFB 1UBFA 4M0DA 4PZAA 3ZUPA 1NYLA 3RRYA 1LK7A 4LJ9A 4JLAA 3P2KA 4LX0A 1DO0A 3W6UA 2RKWA 4ZMSA 1FDIA 2O2HA 2W6ID 4NBKA 1I7DA 2BFDA 5B36A 1K5GA 3DEAA 4D45A 3CG4A 2HU5A 5E6SA 1U9YA 1P0FA 2WF7A 3QKWA 4CEIA 4JP3A 1D2EA 2ZT7A 2M6KA 1ZH2A 2AQIA 5JMOA 4M7RA 5CNMA 1P9RA 2AVDA 4HLCA 4BE9A 3E2IA 4L9SA 4RLFA 1DFGA 4W9NA 4B6OA 1TJ3A 2QN2A 3MJTA 3AJAA 1KJ9A 3E7PA 3NHPA 4HWTA 2C3PA 4OUDB 4C6TB 5DM2A 1NC3A 3FR8A 1JKIA 2G04A 1JG3A 1QZXA 4OB8A 3BYZA 1FVFA 1N6PA 3AUKA 5BR4A 3E2PA 1M6HA 5HZHA 3ESZA 2JCBA 1WHTA 4I4CA 1I1QB 1P80A 4EDHA 5LQRA 3VU9B 4JDPA 4I7EA 5DT9A 4F5EA 2OGTA 4TV9F 4WKGA 1YB7A 3PICA 1OWNA 5E1BA 1LBSA 4MV1A 1CP2A 4N5IX 1N77A 1K6JA 4ITRC 3NWEA 2COKA 4WGGA 3WQSB 3QUCA 1JLHA 4YCLA 1HE4A 3V4LA 4PHFA 2PLNA 4KJZA 2PSJA 1L1RA 3GLQA 2O7QA 3MBIA 3ETJA 1I4OA 2A78A 3QLUC 3H9CA 4XOIA 4BWGA 4MVJD 4BBPA 4E11A 5IDXA 2O57A 1ZK0A 3WHPA 4LKRA 3EG9B 3PDCA 2MSDB 2AN3A 3BPSA 1YUBA 3AUTA 4L1KA 2AN5A 2LV8A 5DNWA 4HFRA 4BNXA 4ED9A 2GJSA 3OZVA 1TMOA 3MMXA 4XR9A 3GLHB 5B55A 2C29D 4MKZA 1DXQA 2WTMA 3LBHA 3DVRX 4K7JA 4NEGA 2GM4A 1MB2A 1SC4A 3KS9A 4BPBA 3TW0A 2P9EA 2LUOA 3BFPA 1JG7A 4OI2A 4GMXA 1D5WA 2E85A 2WKQA 2QLMA 4G1UC 3TKLA 4XWWA 1K68A 4I1IA 5H59A 4D2IA 1G8HA 5KNDA 2RAVA 2I33A 2C2BA 3RSQA 5BUSA 1RHQA 5JCOA 1P5HA 5TQ0B 3UOGA 3MM4A 3M1IA 4NJEB 3V1MA 3GGPA 3AM3A 1U0SY 2H2FA 1ADBA 1SXIA 3C6QA 3CKYA 4MPRA 3FNGA 1XZLA 5A02A 1M67A 4X93A 3RBAA 1J20A 3W8EA 1B6TA 4RTKA 1BKYA 3IIMA 4I4LA 2C94A 1NYQA 3SPXA 1F2VA 2EZUA 4KXYA 1M1XB 3CHYA 5D6NA 1ZJ6A 1ZMBA 5FNVB 1RZUA 5ALKA 3R9KA 1ZK4A