1G5FA

Structure of linb complexed with 1,2-dichloroethane
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
294
structure length
293
Chain Sequence
b'LGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRLRPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,3,4,6-TETRACHLORO-1,4-CYCLOHEXADIENE HYDROLASE
molecule tags Hydrolase
source organism Sphingomonas paucimobilis
publication title Exploring the structure and activity of haloalkane dehalogenase from Sphingomonas paucimobilis UT26: evidence for product- and water-mediated inhibition.
pubmed doi rcsb
total genus 109
structure length 293
sequence length 294
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2000-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1g5fA00
3VXKA 3QM1A 3CN9A 2PL5A 1BCSA 2W6CX 4DSZA 3C5WP 4BTLA 1RP1A 3WWDA 2WHRA 4AXBA 4W9RA 1KEZA 5ALNA 4QWMA 5IVDA 4ARBA 5AOBA 3OM8A 5LZ4A 2JBWA 2W22A 1DX4A 5AK3A 3VDXA 4UBOA 4C4ZA 2BKLA 5E2IA 4H0CA 3H19A 4HAIA 3LS2A 3D4LA 2XUJA 4RPCA 2QOEA 2HDWA 2BUAA 3I2JA 3STXA 3VJMA 1JJFA 2QTBA 2VF2A 3VJLA 1CQZA 3KWFA 1X70A 2XMCA 2RONA 2E3JA 2WFLA 3D2BA 4OYYA 5EHZA 1A7UA 3OG9A 3OTQA 4X6YA 4JNCA 2WUEA 1DWOA 3P2MA 1CUGA 3ZI7A 2JF0A 1SCKA 2Y2VA 4G1FA 4LHEA 3RARA 5ALFA 4Y2SA 2XMSA 4Q3KA 2FUKA 3F97A 3WWEA 5AKZA 4ZXFA 1CUUA 1EB8A 4H7EA 5D6OA 5LP1A 1EINA 3A2NA 3PF8A 4BP9A 2DHEA 2PVSA 5JAOA 1GKKA 1QE3A 1R1DA 2ES4A 4B0OA 5A2GA 1J1IA 3ESAA 1WOMA 2PUJA 5C81A 5ESRA 3B3QA 2HA7A 3AZQA 3KXPA 3H2KA 3W05A 4K2AA 4L9AA 5K3EA 2G5PA 4KE7A 3I2KA 3WKAA 2WJ4A 3G0DA 3AIOA 3IUQA 4BE4A 3FSGD 3WA7A 4QDZA 1G66A 2PSHA 5D3ZA 4WFJA 3C8DA 3G9UA 4AO6A 3D3NA 1UT6A 1DQZA 1UOOA 4LXIA 5CRIA 4BVKA 3O9VA 4ZREA 5FLKA 1BRTA 1S8OA 2R11A 4AQDA 3I2IA 3WZMA 1NU6A 1EK2A 2PKYX 4MWTA 3FYUC 5C7YA 1K8QA 2XB6A 3HI4A 1MU0A 4CCWA 1QZ3A 4DNQA 1L7QA 1VA5A 1XRPA 3I2HA 5JADA 4PSCA 2HADA 2ACKA 4QEKA 2HU5A 4EZIA 2CUTA 1WHSA 2C0PA 1HLGA 3KSRA 4GW3A 3YASA 3UMJA 5JD4A 5HK9A 1N1MA 3ILSA 2DHCA 4C89A 1G5FA 5EHNA 2QM0A 4BE9A 1VZ3A 1TKRA 2AJCA 2C4HA 1XZLA 1G42A 2HRQA 1XLUA 3IA2A 4UHDA 4EY6A 3DQZA 4W63A 2ZYSA 3WLAA 3D2AA 5DYTA 5AP9A 3IUNA 2EDCA 4H7DA 4Y2QA 4MWSA 5AKJA 5CT5A 2Y6UA 2YH2A 4KRYA 3B5EA 5BOVA 5LZ8A 3ZLUA 3MVEA 3BJRA 1IUPA 4LYDA 1UK7A 1AURA 4CCYB 4F5ZA 2XMQA 2OPHA 1UZAA 4FDMA 4P9NA 1ODTC 4Z49A 3FVRA 1X2BA 4H7KA 3DYIA 3LP5A 1GQSA 5LZ7A 1HPLA 5LZ2A 2I3DA 2H1IA 2WU4A 1EVEA 3JW8A 2PM8A 3CCBA 1ZIXA 4DSAA 2HA0A 2BUCA 1XZCA 4DIUA 2CMFA 5DYYA 1MO2A 3IUMA 3GUUA 1GKLA 5ALXA 2C58A 1TK3A 3ANTA 1FFDA 5HKAA 5AHXA 4M0EA 4J0GA 2WJ6A 2GYWA 3A6ZA 4W1QA 5KBYA 1D07A 1Z68A 5ALJA 2JIDA 3MUNA 4HVTA 4H7HA 4OYLA 1P0QA 2OQVA 5FP0A 2X76A 3H18A 4C6HA 2HA2A 3KDAA 1L7RA 3IVMA 5YASA 2WTNA 4DM7A 1JU3A 5DNUA 2WSLA 3T52A 3U1TA 2OCIA 5FDFA 1XLVA 1RYYA 3EQ7A 1YS2X 4DMCA 5AM0A 1BU8A 3VVLA 5CT9A 2WIDA 2YXPX 4JH0A 2GZRA 1QOZA 3NUZA 1HKHA 1LPNA 4N8EA 4W1SA 1CRLA 5CMLA 1UWCA 5IVKA 3E0XA 3BF7A 3BF8A 3W9BA 4ZI5A 1LPPA 2ZSHA 1QIKA 1EI9A 3G9ZA 3WL5A 5AKIA 1TQHA 5AM1A 5JAHA 5A7HA 5AKYA 3RK4A 5CXUA 4UBKA 1CUIA 1UK6A 3ESCA 4ROTA 3QITA 4Q1VA 3S8YA 3I6YA 5CTAA 3A70A 4H77A 5A7FA 2HFKA 5CXXA 5F4ZA 3BDVA 2H7CA 2DR0A 5HF5A 4MYSA 4N8SA 1Y7IA 5D7BA 1K6EA 4K6HA 2P8SA 1SC9A 5A62A 2B4KA 5K3BA 2OG1A 5JZSA 2BJHA 1QGED 3CXUA 3FCYA 4J0DA 2ECFA 3UUEA 3HLKA 2GBFA 2VT6A 2C5FA 4MYDA 5DTIA 4LKOA 4JYMA 4UBNA 2VAXA 4PQEA 3T4UA 1KU6A 3R3YA 4GEGA 2HU8A 4OB7A 5EHXA 5H3HA 3M82A 3AIMA 2BGRA 3BIWA 5ALTA 4TVKA 1MN6A 3M83A 2O2HA 3O4HA 3L1IA 2UZ0A 2G63A 2C5GA 3DL7A 5AIBA 4RE5A 2B61A 4QDUA 4BRSA 4C4XA 1EHYA 4XX1A 4UUQA 4BAGA 5K5EA 4B81A 1ISPA 2VAVA 5AICA 5ALMA 1HBJA 2JGLA 3G0BA 2XUAA 3V48A 1G4HA 4QE3A 1YA8A 1GPLA 3SC2A 2QT9A 4XWGA 5AKEA 1JI3A 2QUAA 4A23A 2WQZA 3QMWA 1T4MA 4X71A 5CURA 5LKAA 3BE8A 3GA7A 1CUZA 1YAJA 5ALGA 1HDEA 2WHPB 1AX9A 3KD2A 2YASA 4AZ3A 4AN1A 4UFOA 3PUIA 1R3DA 3I2GA 1JFRA 4UHEA 2PUHA 4EB0A 1QO9A 4ETWA 1XZAA 3I1IA 2HFJA 1CUXA 4G4GA 2HA4A 4LIPD 5K3FB 2XUGA 4QLAA 2D5LA 1RWQA 2JEZA 3F8SA 1A8QA 2WG1A 3QPAA 3DDUA 4P08A 5EIEA 1CFJA 1O6FA 3BL8A 4OCZA 5AO9A 2WIJA 4QDTA 4BYMA 2CEKA 3DOIA 3C8HA 4J7AA 3STWA 1BS9A 2HA5A 4M0FA 4MQMA 4YASA 3C6BA 1J2EA 5EI5A 3ZLVA 2G4LA 2WUGA 1N5RA 2WKWA 5ALDA 4QDOA 1TCCA 4BDTA 4BCBA 1P0MA 2ACEA 5AI6A 5AM2A 4UHFA 1YCDA 5AKHA 3D2CA 5EHQA 4J0IA 4B82A 5LZ5A 5CT6A 5A71A 5D3KA 5JALA 3JYHA 4X95A 3G0CA 4Y9SA 4HS9A 5ALPA 3WYDA 4BAZA 2JGFA 4V2IA 3WL8A 1ZI8A 2XMGA 1XZGA 4HXFB 5A6VA 3WK4A 5FUMA 4BATA 5IVIA 3PFCA 2I03A 3IURA 1K4YA 5EFZA 3R3WA 4NMWA 4X7BA 1ZJ4A 2V96A 3FLBA 4UHBA 5AKGA 3RM3A 3BDIA 5C8VA 1FSSA 2CB9A 3NOXA 3N0TA 4DLNA 4EA6A 4IO0A 3WMRA 3IIIA 1J07A 4X85A 5AI4A 1OCEA 5HFAA 5BWCA 3K2IA 1XRQA 3HACA 3L1JA 1CUEA 1F0NA 4FFWA 7YASA 3M81A 1AZWA 4X6UA 1CLEA 2XUDA 4F21A 3VKFA 2J3DA 3FLAA 2WHPA 1IMJA 4RNCA 5ALYA 4EUSA 3D5EA 4FFVA 1GT6A 3DNMA 2ROQA 3E3AA 4LXHA 4MQLA 3L1HA 1M33A 2VQ6A 3ANSA 3C6XA 3OC0A 2HRRA 2PU5A 1UKCA 3ZWQA 4C88A 3LIPA 2BGNA 4N5HX 3G02A 1WCYA 1LPSA 3FYTA 4KR0A 5AKKA 1LZLA 3WIBA 1QFSA 4DMFA 2QUBA 1ZI9A 4OB6A 1CUSA 1H23A 3FAKA 4PF1A 5I8PA 4CG1A 2PU7A 2DCMA 1F6WA 1H2XA 4X93A 4B80A 1VE6A 1UK9A 1JMKC 2O2GA 1AMNA 2FJ0A 1MTZA 1VZ2A 3FCXA 3V9AA 1CQWA 4G8BA 1CUJA 3UUFA 5EIAA 5ALIA 2HL6A 2JGIA 3K6KA 1VXOA 5JAUA 4CIAA 4H7IA 5AIAA 1QIGA 5EGNA 5ALVA 2ZJ6A 4FHZA 4U2EA 4EHBA 4F60A 5AOCA 1U4NA 5AI8A 2WJ3A 3FSGA 2RHWA 3HZOA 4CIBA 4Y2YA 3PFBA 4RE6A 3WWOA 1CUFA 3IB3A 2QZPA 1FFBA 1VLQA 5KWJA 1XQYA 4B7ZA 4DMKA 2I3ZA 2PBLA 4X94A 4J3JA 1JU4A 2OAGA 3R41A 5HZGA 1X2EA 1FFAA 2BUBA 4DNPA 4OUKX 2VATA 2HA6A 5JYCA 4YX9A 1P0PA 3QBJA 4P92A 4AO8A 4G4JA 4KE9A 1ZD3A 3DYVA 4AMZA 5BV7A 2Z3ZA 4BDSA 4WDQA 1QIDA 1MX1A 5FRDA 1QLWA 4WY5A 3AINA 1PJAA 1QTRA 2XUQA 3OOSA 1YS1X 1R9NA 1GPNA 2C7BA 3RLIA 1DWQA 2XUPA 2C0QA 4ZV9A 2BFNA 1VXRA 1XZKA 4E15A 1KU0A 1J06A 2VA9A 4BBZA 5JZBA 3W04A 3WIOA 1CUVA 2WUDA 3ESBA 1IZ7A 4C4YA 2VEOA 5I9IA 3IUJA 4HXEB 2V9ZA 3A2MA 1OXMA 5JASA 4BZZA 1CV2A 4J0KA 4EY7A 4C87A 1JKMA 2RGUA 5AH0A 4OU5A 3AILA 4E14A 3HABA 1YR2A 2OGZA 1EVQA 4X00A 4FKBA 5C8ZA 3HXKA 3STYA 5CT4A 4AMYA 2RHTA 4U2CA 5A7GA 2XMDA 1N8SA 5HK8A 2Z8XA 5HF6A 4F0JA 2WFLB 1H2WA 4EBBA 2PSFA 3PUHA 4BB0A 4FOLA 4HZGA 2OLEA 4O08A 2OGSA 4Y2UA 3SWWA 2IIVA 2ONCA 5DJ5A 5SYMA 3CN7A 4ZGBA 3GFFA 1QIIA 2O7VA 2XI4A 2ZVDA 1MX9A 5DWDA 1WPXA 4FNMA 2GBCA 4KRXA 1EK1A 4PW0A 4YPVA 1ZGBA 1LBSA 3Q0TA 1JJBA 1GQRA 4DNOA 4AO7A 1EDBA 5CH5A 4Q3LA 4D9JA 4X3CA 5IVHA 4B6GA 1R9MA 1ODSA 4BC1A 1Q0RA 4B9EA 1AGYA 1UXOA 2V98A 4NZZA 1VJ5A 2DSNA 2XQIA 4FBMA 4MEAA 3V1KA 2QJWA 2CKMA 4JEIA 5FPPA 1W52X 3G0IA 4CFSA 1IVYA 4B9AA 4KE6A 5ALEA 4ARAA 4KYVA 4S0XA 3B12A 4HRXA 2RAUA 1UKBA 3G0GA 2GZSA 2B20A 1ZI6A 3G7NA 5K3DA 4KACA 4TPKA 5ISMA 4U2FA 1XZJA 1JMYA 3O9MA 3VJKA 4EY5A 1XZMA 1U65A 3AZOA 1Q83A 5DLPA 3VISA 3DEAA 2WFMA 3ZLTA 2VJCA 3PICA 5FXMA 1THTA 2CZQA 5AM4A 4JUIA 4OD0A 3WK8A 5ALWA 1MAHA 1XZIA 3M3DA 1HQDA 4IQ4A 1UOPA 3H2JA 2AXEA 4B83A 1DQYA 4ZWNA 5KREA 4UBLA 1VKHA 4FLFA 5CW2A 5CH8A 5HF9A 5I7UA 1TIBA 5HQ3B 3EQ8A 1B6GA 2OXEA 3TJMA 4CG2A 2QMQA 1SFRA 5JD5A 5ALQA 1LNSA 3V1LA 2PSJA 1LPOA 3I1YA 3GBSA 4G9EA 1E8MA 3FLEA 3C87A 3OURA 1UKAA 4FWBA 3V1NA 4GBGA 5AOAA 3VVMA 5HCUA 4I19A 4WCVA 3ZV7A 4BP8A 3K9BA 4I3FA 3DD5A 4NS4A 3FYUA 1MAAA 3H0CA 4LXGA 2OCKA 4PSUA 5AKXA 4Y2XA 3H2IA 5JAPA 3C6ZA 2QKYA 4TGLA 1DT3A 1Q0ZA 4PV7A 2GBIA 4BCDA 4UFPA 1BE0A 4DGQA 4M0MA 1LPAB 2I78A 4CI9A 4GXNA 5ALUA 4G4IA 1QIJA 2OAEA 1JT2A 4UBMA 2XUKA 1ZD2P 1F0PA 1EX9A 4DTCA 4G8CA 2Y6VA 1EH5A 4GDMA 1EDDA 2AJDA 2OCGA 4MXDA 4K6GA 4QA9A 1H22A 3G8YA 4N8DA 2XLBA 1R4ZA 4KAAA 3DKRA 1A88A 3QPDA 3C6YA 1ZD4A 1XZDA 3QZUA 1A8UA 4G9GA 3WL6A 4RGYA 1YA4A 3NWOA 3WKBA 5E4JA 2DFPA 5AM5A 1IUNA 5FPQA 4EY4A 3WWPA 2RI6A 2WG2A 3WJ1A 4BZWA 4LYEA 3BWXA 2XMBA 1E66A 1E5TA 3F96A 3WWCA 2EEPA 2QJRA 3WKDA 1XZBA 2ZYIA 4AZ0A 4E11A 3DL4A 2ZYHA 1ZGCA 4N5IX 3SK0A 3QPCA 5T4EA 3QYJA 1LPBB 1GPKA 4JYPA 5HF8A 2ORYA 2H7YA 2WHQA 3D7RA 1Y7HA 3LIIA 3IULA 1O6GA 3WKEA 4IHAA 1ZOIA 2XQGA 1BN7A 1P0IA 3W2TA 1IZ8A 5AJHA 4BCCA 3GELA 3C45A 1QO7A 3HEAA 3HJUA 1MT3A 3HC7A 5AK5A 5IH7A 4OPMA 2Y1KA 2QVBA 3OPMA 4X97A 1AC5A 1SCIA 2BCEA 4IH4A 1C4XA 1NX9A 3F98A 1CUHA 2J3QA 2O2IA 3NGMA 1ZIYA 1CUYA 5AKLA 1AUOA 4X91A 3WL7A 5FV4A 2IX9A 3H1BA 1ACLA 3MUOA 3W06A 3DJYA 4XIIA 2AJBA 4BC0A 2VSQA 3AZPA 3WI7A 1XRNA 4FTWA 2QS9A 1ZJ5A 1XRMA 3C43A 1UFOA 1CUAA 1CR6A 4U2GA 2OCLA 3AFIA 2PPLA 4UBJA 2WG0A 5DNVA 5ALSA 3PF9A 1EDEA 1XRRA 3WK6A 3O0DA 4GWLA 4DYHA 3S2ZA 4UBIA 2NW6A 1NU8A 4Y2TA 5IKXA 4Y2VA 5T4FA 3IBTA 4L3WA 1XKLA 2WM2A 5JARA 5AK4A 1C7IA 1QTIA 4KAFA 4X6XA 1XLWA 2O7RA 3STTA 2DQZA 3H2HA 3TEJA 4H18A 5HFNA 1LGYA 5FKJA 3WJ2A 1QJ4A 4Q05A 3AUKA 4HRYA 1W6RA 2HHAA 5FOQA 3R40A 3I28A 5E4YA 1QONA 4OB8A 4BRZA 4A5SA 1LLFA 5LZ9A 3EQ9A 5CH3A 2D0DA 3LCRA 4X92A 4BVJA 1U2EA 1ZD5A 5LIPA 2RIPA 2JGMA 4GECA 5LLSA 5DYWA 1FFCA 3C70A 4EY8A 2WILA 3STUA 4IH1A 4CCYA 1E8NA 1CUWA 1CPYA 4NVRA 4BTVA 3GZJA 1XQVA 1QIHA 1XZFA 4XVCA 3WA6A 3QMMA 4J0JA 3R3VA 3A2LA 3KOOA 4FLMA 1A8SA 4FBLA 2XUHA 3R3XA 4WJLA 5ALZA 3TRDA 3E4DA 1SOMA 4E46A 1ORWA 1PFQA 3O4JA 1U8EA 5ALLA 1XZEA 2GBGA 3I6MA 5JATA 5JANA 3WK5A 2CJPA 1W4LA 2CBGA 5T4BA 1BEZA 1I6WA 3FOBA 4G5XA 3QMVA 1L7AA 2FJPA 3KWJA 4KEAA 1H2YA 2VTVA 3HYSA 3STVA 3G9XA 2YYSA 1XQXA 2J4FA 3QH4A 2H9YA 3FNBA 1MNAA 2AJ8A 4B85A 4UFNA 1UOQA 3IDAA 2WIGA 1LPMA 3PI6A 4Q34A 2QXUA 4W1RA 2XMZA 1WB6A 3O4GA 1WHTA 1ETHA 3WYNA 2XUOA 3DOHA 5CT8A 2DQYA 3FYUB 4BVLA 2G5TA 2Z5GA 1CIJA 4UHCA 3AIKA 1DTEA 5LKRA 2XQKA 1XRLA 2JGJA 1DWPA 5DNWA 2H7XA 5BWBA 2XE4A 2ZJ7A 1XROA 1QIEA 3BIXA 2XQFA 1MNQA 2PSEA 2XUIA 4HXGA 2QR5A 1ODCA 2WUFA 2X5XA 1DINA 4W1PA 4BAUA 5EIHA 2IITA 4KAJA 3X3HA 3H2GA 4PSDA 5ALRA 5AM3A 2PSDA 4G8DA 3W9UA 1DT5A 4B84A 1JJIA 4YK7A 1R88A 4ITVA 2XMRA 5K3AA 4Q82A 1CUBA 1THGA 4WFIA 1N5MA 1E89A 4J03A 5DTJA 3WKCA 4Y2RA 4P93A 1T2NA 1OILA 1BN6A 4X90A 1ACJA 5HKBA 2JEYA 2XUFA 1AQLA 1LBTA 3E1GA 3Q8WA 1SCQA 3H04A 4AN0A 2GYVA 1MJ5A 3GROA 3FBWA 4WDRA 2R8BA 1TCAA 4GLBA 5T4HA 1WB5A 1YB7A 1QFMA 2JGEA 5E4TA 1BCRA 3WZLA 3DLTA 5C8XA 2ZSIA 1XZHA 1IUOA 3R0VA 4XJVA 1HL7A 1PV1A 2WIFA 3ICWA 2X8BA 2HU7A 3U0VA 2Y2UA 5J3JA 3BJMA 1CVLA 1AKNA 4OU4A 3BXPA 2HA3A 1EB9A 3FWHA 3EF3A 5AI0A 2WU3A 3ZPXA 3PE6A 4MJ3A 1W1IA 4QZVA 2WFZA 5AK6A 1TAHA 3N2ZB 5JZ9A 3JWEA 4C01A 4L72A 3H17A 4L0CA 2VJBA 4WY8A 3H1AA 4Y2JA 2DHDA 4ZRDA 3CCCA 2EDAA 1E8DA 4B0PA 1TCBA 2HIHA 1QIMA 4Y2PA 5AI5A 4U2DA 1BROA 2QRUA 1VOTA 1XKTA 3SX4A 4K6KA 2VJDA 4UPDA 4J0HA 1YB6A 3WK9A 4OSEA 4MEBA 1K5PA 4H7FA 5SYNA 1UK8A 1VE7A 1XQWA 3DKKA 2AJLI 1YASA 3DCNA 5LYYA 1WPRA 2OQIA 4AX4A 2GYUA 4PNZA 4FLEA 4Y7DA 3MGAA 3EIOA 1FJ2A 4H35A 4H7JA 3HSSA 4A16A 3I2FA 4GHWA 2XT0A 5KWIA 3ESDA 3DS8A 4UHHA 3RKSA 1B41A 4K5QA 1MPXA 2XQJA 4QWWA 2FX5A 1W75A 2Q0XA 2ZJFA 1USWA 4ZV7A 3QVMA 1XFDA 3PDCA 3ICVA 1ZICA 2JGKA 1W76A 1GGVA 4WFKA 4DNFA 2WTMA 5HQ3A 2WLSA 1YAHA 4AB1A 4I4CA 4HTAA 4QNNA 2K2QB 3R3UA 5ALOA 2XLCA 5JD6A 4FMPA 4QDXA 1EXWA 2WIKA 3D0KA 2ZYRA 4Q3OA 1CEXA 3G9TA 1DU4A 2HM7A 3WK7A 1H2ZA 4IH9A 4J0CA 1WM1A 2Z8ZA 3O95A 1R50A 2LIPA 2V97A 3LLCA 3WQHA 2XDWA 4CG3A 1K63A 1WB4A 3HRHA 6YASA 1CUDA 5ALHA 2Z3WA 1TRHA 4FNGA 1ORVA 1FFEA 3D59A 1Q84A 1BEEA 3F9CA 2J4CA 1Y37A 2VJAA 5ALKA 4GI1A 3O4IA 1DX6A 3R3ZA 4KE8A 4KJXA 1E3QA 2BAGA 3C5VA 5K3CA 4DMHA 2VT7A 1VA4A 3TGLA 5K3FA 1GXSA 1F8UA 1C7JA 4PO3X 4U2BA 3EBLA 5CBKA 1QIFA 3V1MA 3AJAA 3ED1A 3FVTA 1CUCA 3F67A 1YSCA 1GZ7A 1LZKA 4INZA 5AI9A 3I6ZA 1MX5A 2OGTA 2QXTA 4QLOA 2B9VA 5JIBA 1EA5A 2PX6A
chains in the Genus database with same CATH superfamily
1E3TA 1WV0A 4HDCA 4IHJA 3VXKA 2QX4A 3QM1A 3CN9A 1JEYB 4RZUA 4L7VA 2FA9A 2PL5A 3L0CA 4N3AA 3NHWA 1KO8A 4RIFA 4WCFA 4EVQA 4ID3A 3B1XA 3DQPA 1R0CA 1S0UA 2OV6A 1OASA 1Z0FA 4PFJA 2E55A 3VNQA 2WQ6A 4OXQA 4JYZA 1XWWA 1H42A 1QZZA 5TJ9A 4GKKB 2QL6A 4HJRA 2LIVA 1S2MA 4LTNA 4MGHA 4CTMA 1KEZA 5GZ6A 1DBSA 3I8XA 4JBNA 5ALNA 4DFDA 4Z51A 2R1VA 2YWJA 1R4MA 1Z5NA 1W0KA 1OFUA 2O05A 2JBWA 2W22A 5JROA 3ZK9A 3VDXA 2HHHB 2ICAA 2F3PA 5DM2A 1CQIA 3QK7A 4C4ZA 3FZGA 3QQ5A 3O31A 3AR3A 3M6UA 3D43A 4P5DA 4H0CA 2GWHA 1T2UA 1OWLA 4M1KA 3UJ8A 1WSAA 2ZXEA 5CGQB 2IP2A 2ZDGA 5A4JA 1JZQA 1QNLA 2NNWB 4HEHA 1N2BA 2AK2A 1OROA 4AU1A 5CIWA 4JC0A 5H70A 1DGQA 1ZK0A 3M1LA 4BVFA 3GW8A 1R6UA 3KB1A 1NYTA 2JA1A 3DAPA 4GL4A 1IPEA 3P9IA 2F3QA 1G8JA 2HMWA 1N33B 1T8SA 3I2JA 3STXA 2IWHA 1OPXA 1ZO8A 3RT9A 2FZGA 3CONA 4BO3A 1XJCA 2I33A 4HADA 5A4MS 1NQWA 1AK9A 1JDUA 1N2EA 4KLCA 4MYRA 3CLRC 1CQPA 4MHSA 4ZPJA 1JH9A 4HNUA 2IHVA 3D7KA 5CYOA 4IIVA 4ZYWA 3U60B 1Y4SA 4P0PB 4C7OA 1CHDA 2BDTA 2FX3A 5ECGC 1XR3A 2WINI 1QPZA 1NBHA 1FYWA 2XECA 3D0OA 2FZCA 2PJZA 3KWFA 2XMCA 4WKNA 3VNSA 5J47A 3R3JA 3CKMA 5IKEA 2WFLA 1P61B 3TINA 4BQRA 2AQ8A 2DKFA 2E5FA 3EDRA 4IS3A 2JANA 2LBPA 2A0WA 1NW6A 3A1EA 5A06A 5EHZA 1JP7A 5L4NA 2HK6A 1M75A 2F90A 3JV7A 4WVFA 5LNK1 4GVXA 3H9GA 2VNKA 1F7UA 3GEBA 2DFDA 4UUMA 1CUGA 3EC2A 2OWEA 1UJBA 3KDPA 4UM7A 2B3TA 3BMOB 2ONZA 1V11B 4YUWA 5JHHB 3ETLA 4R2IA 3EOZA 1U3TA 1II0A 2GFHA 3C8UA 4Q3KA 4YONB 2HB6A 4Y8VA 4BNFA 3OF5A 3JQBA 4R7TA 5J63A 4IUDS 1XD9A 1NIJA 1EB8A 5F4BA 1ISRA 4NX2A 3PF8A 5C1DA 2PMFA 2H2WA 5D5HA 1BCSB 4HDSA 3MJCA 4DRXA 4BP9A 2H3EA 4IPTA 1E96A 1J7KA 2PVSA 4UATA 4NATA 2XKAA 4GMKA 5A1JA 2J3LA 4Y9TA 5CDSA 1N2JA 2C31A 5KI6A 4MUMA 4TUYB 3UENA 3DOJA 2ZSAA 5KZMB 1VMEA 2ES4A 1Y9JA 1J1IA 2RD2A 3AG5A 1Z5WA 4EQ6A 4HF7A 5EERA 3PPIA 2E1PA 5BSHA 2PUJA 2X77A 1JN0A 1LBEA 4CKXA 2QV0A 5DTMA 5ICMA 2OD2A 4QTUB 1KNXA 1B7GO 2Q1WA 4K2AA 4U0JA 3I2KA 3LBIA 1QP7A 3G0DA 1X13A 1GAEO 3WHKA 3IUQA 3IP9A 4DR3B 1NC3A 2WU1A 3AP2A 4BE4A 4FQ5A 4LXQA 4KOAA 1AXEA 1KAMA 1Z4JA 3MNFA 3VUEA 3HDVA 1Y5RA 4UTZA 4B6JA 4B2IA 1MOQA 4M1MA 3OQBA 4AO6A 1KK1A 1ZIDA 1N0HA 3A26A 3D3NA 5DF1A 1YMUA 4P7JA 4CUJA 2VJQA 1WSDA 4ZC8A 2AWOA 1JXAA 1M34E 2A14A 3O9VA 4AUEA 3AM5A 4ZREA 3NHPA 1U5CA 7MHTA 2O5EA 3GO4A 2ZIFA 2O8VA 2EHJA 2F64A 3CUWA 1VLZA 4OXKA 4TTRA 1ZVJA 2W6OA 1QUEA 1Z4NA 2OGWA 1J24A 1LI7A 3PK0A 1G3RA 4R8KA 5CX4A 4IM7A 3WZMA 4IYRA 4XWKA 4D2IA 2PKYX 4DCNA 2H2DA 5DYIA 2XVMA 4KP7A 2MINB 4MWTA 3FYUC 5LC1A 4A10A 4CUKA 3ANMA 4N7MA 3U3XA 5C53B 1K8QA 2FSUA 2XB6A 3PRYA 2OBYA 1G38A 1WUHS 1PV2A 1MJGM 3EVBA 1OWOA 4OBXA 1QZ3A 2VJOA 1MUUA 3GFPA 2XB2A 2BDUA 4U3JA 2P9YA 4YAUA 4LF8B 3D0QA 3ORRA 3T1TA 1SWWA 3W9SA 4F9EA 3O26A 1T25A 2GARA 3DOCA 1ML4A 3IHKA 5AW9A 2X0RA 3D8HA 4NDZA 1CF2O 3W3AH 5JADA 4PRKA 3JQRA 5LP6F 1NR1A 2HADA 2ACKA 2JFZA 2CUTA 4A5OA 1WHSA 1L5WA 2C0PA 3ESZA 4YDSA 4XW2A 1O5TA 3TR5A 5K6AA 3KS9A 4AF6A 4OMCA 1N4DA 4PY2A 4DNXA 1OX4A 4DWWA 4JOSA 4MCHA 1U1CA 1Q1EA 1M6VA 4RM2A 4AG3A 3P9SA 1QAOA 3CSSA 5ENZA 1D9ZA 4JBYA 4HH4A 3SJ7A 4ZI7A 1YS6A 4K1XA 3TQCA 1FP6A 1OT3A 2CK3A 2X15A 3FPBA 4I5FA 3P4YA 1TKRA 1SG6A 2EQ5A 2RIRA 3V33A 3K0EA 3MT0A 1XLUA 4OSPA 4MB0A 3TIIA 2GRAA 1RQXA 2QMUA 5LA6F 3RRYA 1FS5A 2OK8A 3DEZA 3DQZA 3N5KA 3PYXA 1F8XA 1TK2A 4KDEA 2ZYSA 3S68A 3I9NA 4WAUA 1U9IA 2CBZA 3EQZA 5HBRA 1LBIA 2XNDA 3KSMA 4D9EA 4S1VA 3R3SA 5FFMA 2HPZA 4ZOBA 5DYTA 2ZFUA 5L95A 3MJ4A 3IPYA 4LPSA 4F3KA 1XZ8A 3DFMA 1SOAA 4UXHA 5JTUA 1QQ7A 1KDTA 4Q5IA 3OESA 2AR0A 1P5JA 1Z2OX 1QH0A 3A1WA 3QTTA 4WRRA 2DUMA 2HYIC 1Z5ZA 2JHCA 2VDNB 3T5GA 3PDWA 5FBHA 1ZN7A 4J16A 1V6SA 2C5BA 2ZR8A 2Y6UA 4L5AA 1UPXA 4IUCS 3K0AA 2JGDA 5JSZA 1IM8A 2PLNA 4RTOA 3B5EA 5LZ8A 4L0DA 2QD2A 4Q21A 2FGJA 2AV6A 1KKUA 2QQFA 3NIGB 4HLUC 4ZVSA 3ZYCA 1NVXQ 3BJRA 2NPFA 1HR0B 1FTSA 3GRYA 3A4YA 5FCDA 5A9RA 2XYHA 2YWGA 3IX7A 1CC1S 2QT0A 3F3YA 1X39A 3J7TA 5DW3A 1TF7A 2OPHA 1DAMA 4PBRA 1UZAA 4P9NA 2YTZA 4X84A 5BUSA 2HSDA 4BGDA 2AEMA 4RHTA 3FVRA 2NPIA 3ROGA 3UHAA 3WG9A 2WHYA 1GM5A 3OAAD 6PFKA 4M1WA 4HK4A 4KQKA 4M86A 1PLLA 2BMWA 3O94A 4BXOB 4LDZA 1V4BA 1CQJB 1X2BA 4H7KA 1TIPA 3GFTA 1DAEA 3DYIA 3R20A 5KYVA 1YMQA 4NE7A 4Z9AA 5LZ2A 2QT1A 3R6DA 3K0AB 3U16A 3K70D 5JRZA 4GLOA 2Y92A 3OOHA 4PTZA 1YGPA 3GC6A 3LW7A 4C5BA 3ABQB 3KAKA 3TIFA 4ENUA 3HCBA 1Z6XA 3V1UA 2PX2A 4L16A 4LZAA 2HA0A 4XDHA 2NU8A 3S55A 2ZSFA 2ZWAA 1LJUA 1E2MA 1FQJA 4NECA 4KHPB 2QN8A 4MKZA 3MS4A 3HQ4O 2Q5CA 1T26A 4I3GA 3BAFA 4IHJF 4A82A 2P9HA 4U6SA 1V4VA 5FQOA 1XELA 4JDUA 3UMCA 2C3MA 2D8AA 5H02A 3U4QB 3E1SA 1SU8A 3T0GA 1PR0A 2ZAYA 4D45A 2C58A 3G8DA 3LBYA 3QIVA 4UNNA 2D2XA 4O25A 1I13A 1E94E 2C9BA 3T5MA 1FFDA 4EG4A 2R9VA 4E5MA 1JDBB 2ORIA 5AHXA 1DRVA 1AT1A 4A3SA 2UUPA 3HL0A 1GKIA 1VE5A 5KBYA 5JSYA 1D07A 1JEQB 1T9CA 3K8ZA 2RB5A 2A78A 3CLKA 2JIDA 2AFIE 2X3YA 1KJ8A 4YJFB 4V0MA 3SY8A 1IZYA 1R6VA 2B5VA 3LXRA 3OE7A 3VR3D 3M6FA 5FP0A 4IO1A 1LLDA 2HA2A 3V4OA 1ADFA 1JBQA 4UNQA 1R66A 1UP6A 3T7KA 4K9LA 3IVMA 1B2LA 1JR6A 5YASA 1NZJA 2ODEA 4MRVA 5IAGA 3C8ZA 4DM7A 3EXFB 4AUNA 2P6RA 3BIJA 3E3LA 2WJIA 3ZU5A 3BZWA 4DAOA 3MGGA 3WBJA 1PS9A 3PNYA 4RA9A 5FWDA 3PXUA 3WLKX 2DPLA 5CVCA 2UZAA 4IWXA 3CR8A 3EK2A 4ALNA 2A4KA 3TLEA 2OCIA 4OXNA 3U1TA 5FDFA 4REMA 1EP1B 1HM5A 2Q8PA 2ZDHA 5ESXA 3PIRA 1L5KA 3AGPA 3EMDA 3IGFA 3EIUA 4J3FA 1RQLA 4RMNA 3N07A 1BU8A 2H1LA 2WE7A 2Y1XA 4N9QA 1W85A 4PRYA 1V1JA 3W8RA 4L5BA 1R6BX 1TTPB 2KB0A 3ILHA 4G6ZA 4C0LA 2YXPX 1XU7A 3R9XA 4JH0A 1T36A 2GZRA 2HMSA 3IAS6 3KP1A 4PO1A 2O2DA 3DV9A 1N3IA 2CV2A 1LPNA 2EJTA 5FFNA 3U56A 2FH5B 5DCLA 3EIWA 3EE6A 3KR2A 3E0XA 4J7CA 1C9MA 3U7RA 4P3OA 3QBTA 1MABB 4QBKA 1V71A 1LDNA 3IIJA 4PRZA 4L8WB 4V0RA 5H9WA 3QXJA 4IW3B 4JT9A 1NJSA 5JO0A 1OY1A 1E0KA 3G0OA 3ACCA 5HRAA 1ZH0A 3RRBA 2JAWA 1K3UB 2QUIA 2ZSHA 3CUYA 5ADVA 1TLTA 2BR3A 2EP5A 1MXFA 1V8ZA 3LHFA 3GRFA 2BBTA 3AF1A 3M4XA 5ECDA 4XVHA 3CRMA 3RG8A 3G9ZA 3BFXA 4YJDA 1QBGA 2ZTMA 4RPHA 5T7BA 1TQHA 2SCUA 2VHZA 2ZUDA 3RIMA 1QS0B 1MEEA 5AM1A 4FYYA 3BD9A 3DZIA 5HMMA 1RHQA 4HQKA 3RAJA 1M6WA 4N03A 1O57A 5CXUA 2WSMA 4E5UA 3HVRA 1IBKB 1BX3A 4AXXA 1Z3IX 2FRXA 4W7IA 2YQ5A 5EIBD 3LKBA 4ZEVA 4L4YA 1FSGA 2BY4A 3HCWA 4S24A 3ISJA 1UKEA 3K2QA 2NG1A 1T8YA 3IOYA 4K9OA 4MQUA 4Q1VA 4RABA 1DE0A 2Z1MA 4B44A 2MSLA 3S8YA 2Q7OE 1EM6A 4FMDB 3SLGA 1NNUA 5ENVA 3WNCA 1MMFB 5CJ2A 1YF3A 5M3BA 5KCMA 2ZIXB 1VBKA 2EOAA 2GI4A 3TLZA 3TW6A 2ZSJA 5D3QA 2X4IA 3S2SA 3BDVA 4GSYA 1I2MA 2BTOA 3NP9A 2R2AA 3BXOA 1MB2A 5LYJF 1GZ3A 2PQ2A 4N8SA 3VPCA 1Y7IA 4QOJA 1VM6A 5D7BA 2VQFB 2PJRA 4A2QA 2VYNA 2IY7A 1L5HB 1U5AA 4K6HA 4N39A 4RMJA 3BEDA 4J4TA 1DC5A 2XWPA 3L3BA 2BCJQ 1GZDA 5BQXA 4GX1A 5CA0F 4EJFA 1EEXB 3W3AA 4GRAA 4IDBA 3PUYA 5HZKA 1L4MA 4DGSA 3CWCA 4AKTA 1GQ2A 3OJCA 4R83A 1GVHA 4KU4A 4QIHA 3TXYA 1TCVA 5A5VA 4QBFA 3WGUA 5L3SA 1UBFA 3AI1A 1IFXA 1Q12A 4MVJA 5K3OA 2BJHA 1QGED 4BNLA 3OPVA 4BLVA 3U7QB 4J0DA 4JR2A 3PGMA 5EXTA 4KK3A 1CZKA 4DXAA 3PC4A 1SPBS 3RJTA 4E6PA 5BW8A 5AVXA 1PW7A 2JS7A 2QMZA 3HSYA 3IR7A 3CXRA 4ML3A 4YR7A 3N8GA 1JHPA 5NLLA 2QVZX 4KMSA 2X7HA 3D6VA 3FY4A 1ADGA 4L85A 2VL7A 3CVVA 3DMTA 1JAYA 2ODTX 3GAZA 4PC2A 3RVSA 3PZBA 4WCDA 2R6R1 2JAOA 4B87A 4EA7A 2H52A 1IHUA 3AY7A 3QRWA 5HE9A 4UBNA 2FEOA 2VAXA 3DZJA 3RRFA 5FHQA 3V9PA 5BSVA 1VL1A 1E5QA 4IDGA 5JE8A 4PQEA 2QZSA 3I6IA 1WHTB 4U0KA 2YVKA 4QM6A 1IBCA 5AHOA 5AMXA 4W9NC 1YBFA 1J9EA 2FQYA 2H2AA 2H8GA 3R3YA 1X8XA 4G1BA 5FFFA 4BKRA 3ZLJA 3NRJA 4QGGA 1NXQA 4QGAA 3JZFA 2CXXA 1I0LA 3M82A 3LXMA 1N5DA 3N39C 4K3UA 4KO8A 1Z8FA 1NUQA 5DHFA 5BSWA 4ABYA 6Q21A 5K0TA 3TRKA 5K8UA 1P77A 2BGRA 2HJRA 5ALTA 3A7DA 4FILA 1LY1A 1E5LA 1J1ZA 1XAJA 1IATA 2YFHA 3EZGA 3F9RA 3QFHA 4Q4JA 2R6HA 4NMLA 2ZRQA 3MG9A 2GCEA 3OCJA 4KXYA 4XTRA 3I04M 3JYQA 3OX3A 4IDAA 4WOPA 3P2YA 2UYGA 2GVZC 3F7OA 4L4XA 4C78A 1M54A 4BFCA 5TE9A 3UJDA 3L1IA 2EZUA 2B8EA 3QJGA 3HXOA 2C5GA 1U3VA 1QHYA 2B61A 2JGNA 3DOUA 3P0FA 2JVIA 3ZDQA 3KZOA 5CPFA 1IBMB 3R2JA 3HLYA 3L8EA 2CYCA 2LDBA 3TMKA 5IPFA 1SXIA 1KI4A 1DAKA 1M5UA 4P4LA 2WKSA 3DMPA 4KL8S 1U6IA 4BAGA 1T2VA 1ZN8A 1JFLA 3E3MA 2IGTA 1RP7A 3MMZA 3LG2A 2F62A 1YJ8A 3V3KA 4A0SA 1JDJA 3DNPA 4KVZA 4C1BA 1Z16A 1N5LA 1W36B 4OHWA 1RYDA 1BMTA 2B4YA 1KTIA 4FOPA 4TLCA 1RKBA 1AG9A 2F8SA 4BFSA 4J9UE 2IUEA 4IDPA 2GR9A 3ZQ6A 3Q40A 5AKEA 2EF0A 3HHEA 4GI3A 3AU9A 1JEYA 3SCZA 4YDQA 4KFUA 1E5XA 1GPJA 1SZJG 4KW7A 4AX8A 4HMQA 2W2LD 2FEPA 3E5MA 1IK4A 2V6FA 5LUAA 3W6UA 1R15A 2B6HA 2Q3DA 1EDZA 4BNDA 2I7DA 4S1WA 1LWOA 4F5WA 1YAJA 5GM2A 1HDEA 1JQJC 1NBIA 2ADOA 2WHPB 1Y8AA 2YS7A 2J9XB 1FP4A 2YASA 2YY6A 1RAEA 1E7YA 3I4LA 3K1YA 4B3IA 2GNPA 2FMTA 3KG2A 4JI8B 1GU0A 2ZVPX 3RBXA 1PSWA 2CFCA 1XC7A 4MRAA 1Y42X 3BRSA 3I6QA 1HTBA 3I2GA 4MUNA 4OHMA 5H8WA 1DBQA 1RZRD 4EF6A 3CEPB 4X1IA 1KJNA 1S7GA 3GP8A 1L7OA 2GRUA 4I1IA 1QO9A 3S1SA 2DH5A 3Q5DA 4C4AA 3RSFA 1FQKA 2HY7A 2VBFA 3E8XA 1WDTA 4G5RA 3S7ZA 2WF6A 2I3GA 2Q3CA 3D7MA 3D9QX 4E5NA 2VPTA 1GXSB 1Z5VA 3HBMA 4IXMA 3L2OB 4GQIA 5DRYA 2Y1LA 4Z99A 4C76A 5A5FA 4YMTA 1EXMA 2XUGA 5BWMA 2AJTA 4DARA 2QW0X 2P4SA 2R1TA 2I99A 4QLAA 1K6XA 3DQQA 2D5LA 1OGYA 1Y6FA 2AYYA 2QSJA 2OKGA 1ZD8A 3D3EA 2MWMA 1P3Y1 2YVAA 2ZPAA 1Z88A 4RPIA 5IN5A 3DDNA 5J2UB 1RM0A 4PC1A 4QYIB 3FF1A 2YHIA 3K9QO 5GOZA 4DLAA 1C14A 4HLQB 2AWNA 2EFYA 4MW2A 3ZD8A 3QG5A 2VQ3A 4CCSA 4M54A 2X8LA 2WIJA 5LB4A 4CXMA 4FI3F 4K8OA 3B1VA 1YZQA 2A86A 3Q3VA 4YTEA 3STWA 4QOIA 3DKVA 2EW2A 1WY7A 4M8IA 1E98A 2DJ5A 4FIZA 2V7BA 4GR4A 1JYEA 2I2BA 3DWEX 1CF4A 1RZVA 1DWUA 3HB1A 4MPJA 4ZEOA 3SC4A 1J2EA 5A0FA 2ZBQA 1V9CA 5DSXA 2J48A 1PQWA 3EYWA 3LDAA 4B4UA 3PNKA 1ZAKA 3VV3A 5CLFA 1E2UA 2WT8A 4LDPA 1T5BA 3JQ7A 1AKUA 4BCBA 4MQ5A 2AKAB 4KXFB 5HBGA 2C07A 2DR3A 1IN1A 3O8OA 5AI6A 4D9NA 3OZFA 2NZYA 3ETHA 4OHKA 5LSAA 1BX0A 2OSBA 3LP8A 1ST2A 2C3YA 1N8KA 3S44A 1NP6A 2Q9CA 5TNXA 4AWAA 3LUJA 3RTAA 5CNIA 4LNUA 4W99A 3ZE1B 2IYYA 5LZ5A 3ZX5A 3AH8A 1ZGAA 5CNMA 3DMRA 4DLXA 5CXQA 5JALA 1S9DA 3IUSA 5E6SA 2Y9PB 3RIHA 2O8BA 4X95A 1QFYA 5ABPA 1AHIA 2OV1A 3G5TA 3BA1A 4E4RA 4J2HA 3U26A 5ALPA 1NFQA 4X7RA 3WYDA 4O5AA 4D3YA 4QG3A 3ZU2A 3WL8A 3PRJA 5A5EA 5I6DA 2WTUA 1FS4A 3WHLA 1KH1A 1R64A 2IOHA 3JQ7B 4H17A 3SNHA 1U7HA 1RQRA 1L7BA 3QLUA 2WJPA 3AYXB 5FUMA 3F6RA 4FYKA 3H6HA 2J0SA 5G3ZA 3NC0C 1T3SA 2MYNA 1SELA 4H3KB 1XAHA 1EK6A 1IM5A 2ALJA 3DBHA 3JYNA 3A4MA 3NOOA 1XZQA 3GMTA 4K9KA 2YL2A 1C0IA 3IURA 3NQ41 4PZZA 3R7WB 4ZEXA 1M8FA 3WTBA 1ZJ4A 1ORRA 5LD2B 2D7JA 3BD7A 1ONBA 5GMOA 2V96A 3DTYA 2XWJI 3K0BA 4GP7A 5AKGA 1SPXA 3MFYA 1QFZA 1YE8A 1FSSA 1SUPA 4QXPA 3NHKA 1E3IA 2B69A 3NOXA 3N0TA 4AURA 3DE5X 2FR8C 3FHCB 4Q00A 4HNAB 3VNUA 3JZIA 5L6LB 2DBZA 2W0SA 4PYQA 3KAJA 1PL7A 4ZQIA 3W5JA 2UZIR 1TLFA 1J07A 1HDCA 1MAVA 1P7PA 2WM3A 4TLDA 4F7DA 3QU7A 1FYEA 3T7TA 4ITUA 5F2NA 2OMKA 3LX6A 1OJ7A 5AI4A 1HE5A 3R1IA 4MVJG 2UYHA 3O75A 4RZIA 4L51A 5CLLA 3B3GA 1USGA 1WRBA 5B4TA 2O6HA 4H3SA 3EVFA 2QRVB 3L1JA 3WRYA 4F92B 4BV8A 3V7NA 2G82A 5CFZA 3TW8B 5ARCA 4PC7A 3TSAA 2V7TA 5DW0A 5HSGA 7YASA 3F90A 3JALA 1BSVA 3HE3A 2E49A 3TLGA 2IY8A 3GJ0A 3RE1A 2XUDA 1FL9A 3D2LA 1RC0A 1F4LA 2OXRA 2GEVA 1MENA 1NRWA 1YB5A 1QCCA 2FRDA 4AD8A 3QEMA 2I1QA 2QD4A 1DXQA 4Z86A 4YNBA 5DZSA 4ZQFA 2GHTA 4HWPA 2J3DA 1L9KA 1IMJA 2WHPA 1F8YA 1QYWA 4RNCA 2EARA 1U2PA 3D5EA 1SH7A 4YECA 3S2YA 4EUSA 3DMHA 4RIHA 1RFLA 4Q47A 4EUHA 3DNMA 4R1QA 3H9JA 4JA0A 5LP6C 2ZUTA 2CY0A 5AJUA 4JJZA 3LVBA 2EKZA 4Q03A 5G0UA 2GB4A 3JQFA 4P4NA 1PGPA 1CEEA 3GLUA 4NF2A 2IS1A 3R75A 2PX4A 1FS6A 1MC4A 3OC0A 4QGBA 3W5AA 4PVDA 1U0EA 3REOA 4HRAA 4Z6KA 2HRRA 2YR0A 1QV6A 1ISMA 2OXCA 1KVTA 1ORDA 1SWVA 3ZE0B 1KZGB 2Q6TA 4WA8A 1E4YA 1SAYA 3BFPA 3VH1A 3AYZB 1FPQA 4B7CA 1KEEA 4DREA 3UPTA 1SIOA 4JL8A 2F1JA 2RAPA 5C8YA 2INGX 3BH6A 3OJEA 3N6VA 4QQFA 1POXA 4UVGA 3TLAA 1MV8A 5MFZA 3D1LA 3E8MA 1DKLA 3B9RA 4F4DA 2C2KA 3GFBA 2P3LA 2BWJA 4K05A 1P5HA 4Y2GA 3MRTA 3Q1LA 2GHQA 4DEXA 4ENRA 2NU6A 1N9GA 1SQGA 1ZI9A 3H42B 3OIDA 4IIDA 2XAUA 4E2WA 6ABPA 3K9FC 4EENA 4P54A 4OB6A 1CUSA 3BREA 3LV8A 3ZBTA 1G63A 3QXHA 4LI0A 4PF1A 3UF0A 3ZCQA 1T10A 4ZV4A 2Q3LA 1GPH1 4PAGA 2VVTA 4BQEA 3UAZA 1F6WA 4BIMA 5KYUA 2ENWA 3CZ9A 1OA0A 4B3XA 1E6EA 3GGDA 3GDFA 3H1GA 1TFRA 3JQ6A 1FNNA 1Q92A 5KJ1A 3B82A 4J76A 1JMKC 3DPUA 1UMCA 4P33A 1CD5A 2R5FA 2FJ0A 4M4SA 3L0SA 4MUEA 2NZXA 4EO9A 3MJVA 5CCDA 2F8TA 1NKVA 1ZG3A 2BM1A 2XCUA 3MXTA 5TEWA 3T7JA 2BHTA 2FEMA 4G8BA 4ZIRA 3SDZA 3UUFA 1BX1A 1GOTA 4BNKA 3PPWA 2I76A 3G8CA 5ALIA 2HL6A 3THYB 1VXOA 5HG0A 1QH1A 4ER3A 1D0IA 2MT9A 5IZCC 1KYVA 3NH6A 4QBTA 4C0WA 4CIAA 2XDQB 5L7TA 4CEHB 3C3EA 2ORWA 1JPUA 2COUA 2X7XA 3ETDA 4X20A 4DTIA 2P9CA 2PX3A 3KR0A 2CMGA 4N65A 2ZJ6A 3DOFA 3AEKB 2H4ZA 3FUXA 2QRLA 4P4SB 2DLNA 4U2EA 3HJGA 4WZ6A 1VDMA 4F60A 3ZVRA 3U3KA 3HVHA 1E7QA 5IS2A 3VA7A 3V4SA 1ZUNA 4HB0A 2EIHA 4JCCA 4NU0A 2QTWB 4CIBA 1SB8A 1Y5LA 4Y2YA 1NG9A 1XA4A 5E9QA 1QX3A 1XV5A 3T7AA 5KHOC 4MKHA 3BFVA 1QUFA 2QM3A 4ZU3A 4C6RA 3IB3A 4P7FA 3T4XA 3WZ2A 5EPUA 1RADA 5EZ5A 1SBYA 5BQ5A 1FFBA 2IS2A 1X6VA 1UL1X 2QMOA 1JDTA 1P45A 3GVPA 3QHPA 1QORA 4J0FA 1AKVA 3RRJA 421PA 3O8RA 4QVKA 5JNRA 4M8SA 1QVWA 2EX0A 4MJXA 2C2YA 4BMYA 1Z9BA 2ZSUA 5CG2A 1TUBA 1UMBA 2I3ZA 2LGJA 3OM0A 4HNQA 4JC5A 5BN3B 4RV4A 4PINA 4ZAGA 1CRQA 2WOJA 4J3JA 1NP7A 4QYXA 1T9GS 3K9CA 1JU4A 1CVIA 5B4VA 2QU8A 3IIMA 4QYWA 1XEWX 1C8KA 3AF4A 4RD4A 3VC3A 3W2GA 2P6MA 1PK8A 1UBJS 3COVA 5LMCA 3LTNC 3VU8A 1HSZA 4WE3A 4OM8A 1UCFA 1NYLA 2ZIXA 2FLWA 1QQ6A 1FFAA 2BUBA 4KFTA 4DNPA 4PZDA 4CLRA 2VATA 1UM9A 1KAGA 3A1NA 4OJNA 2EL9A 5JYCA 2IZOA 1B3BA 4YRQA 2X0FA 4YX9A 3N5CA 3GLIB 1KMQA 4P92A 4PG6A 1C4WA 4R54A 4AO8A 2ZM6B 4M2LA 2Z6QA 3AUUA 2WI8A 1W4BA 5MFPA 1SKAA 3FZYA 3R0JA 5CP8A 4W6QA 4EHHA 1ZU4A 2BI7A 4HATA 1RTTA 4LSMA 3C7KA 5FRDA 5K0NA 3U40A 3VAZA 4BE7B 5DLEA 5H82A 3OMLA 3MJEA 1H05A 4BC0A 4Q48A 4LOLA 2VC2B 2ZXFA 3FIJA 1GQFA 4XRGA 2GK3A 2ZCVA 2O6LA 4RF2A 4ZVTA 4A0QA 3P2KA 3RF7A 1R9NA 3QBEA 3QWFA 1GPNA 3TL3A 4QKQA 3M49A 5JMOA 2GLUA 3SXUA 4IY1A 5HWSA 3U81A 2FETA 4DV1B 4TKUA 2PE5A 1K68A 4MWOA 4MQEA 5BNTA 3FJ1A 1ZW6A 1DWQA 3OJ0A 1L4BA 1P2UA 1A9QA 1WTAA 3ORSA 5IJ0B 1Z62A 4RVNA 4ZV9A 2I67A 1VXRA 2IDMA 3PL1A 5H0IA 3ELDA 3TMAA 4N0EA 4O2BF 2JJ2A 2OV2A 1NXPA 1KU0A 1FTYA 3K0CA 4WESA 4WOJA 2V58A 5E0OA 4YN3A 4EA9A 4RYDA 4LHYA 4TRRA 4EYEA 5JV5A 1IEWA 2X41A 3PQDA 3LY9A 2A0KA 3WFJA 4BBZA 4BMPB 4A0HA 1R0XA 1YS9A 4KQMA 2JJQA 5ECYA 2X4DA 5BXYA 1IZ7A 1D6NA 4C4YA 2W2OA 1SD2A 1OC2A 2JFBA 1GD1O 4M9ZA 4MVXA 4NXNB 3OY2A 3Q2KA 4DV7B 5IUJC 3FPHA 3KUXA 2X0EA 1Z08A 4EHIA 4CJXA 3UY4A 4W9MC 1RYNA 3F6EX 3VR5H 1OXMA 1C9KA 1FUUA 4EG7A 1RKUA 1WCIA 3RUIA 1CV2A 2OD9A 3L84A 3LC1O 2Z56A 1XE3A 4JY7A 2FWBA 1T5SA 1CF9A 1Q11A 3MRXA 3RS7A 2ZTUA 1XJ5A 4ILEA 2XRFA 4FWIB 5G1NA 2OCAA 4FYVA 1NULA 2JL1A 3EOAI 3RTCA 2WJGA 3PTLA 2OGZA 2YN0A 2BV3A 1W4CA 3AR7A 1E63A 1T4GA 1RXEA 3T1YB 1YI1A 1OJLA 2HWWA 5C8ZA 3E7DA 3HXKA 3T06B 1A5TA 4I1SA 3W0LB 4HQOA 3WS7A 4CHTA 1R8YA 1ULAA 1XTJA 2RHTA 1I14A 4B5LA 1FVFA 3RAFC 4RD6A 3GYBA 2C7PA 4FFLA 2IEYA 4UKDA 3GVXA 5DI9A 3H65A 3RBVA 5G3YA 1N0IA 1Z25A 3HZRA 3JQGB 3UICA 3WQRA 1T9BA 2WJHA 4ZRNA 1GRCA 2MSKA 4C4SA 5EUCA 3L8HA 3EC1A 1I3KA 4NIMA 2P1DA 4O4IB 5A4KA 4NH0A 1QRRA 5AVQA 2HXGA 2YNMC 1T36B 3N53A 1D2CA 3DM5A 3FSJX 3JY6A 4LWZA 2P0YA 3T3PB 1Z6PA 1GPAA 4G25A 1E2FA 3EH2A 3JPYA 1U7WA 3RYCB 5CGZA 4FEEA 4FOLA 1C8BA 2PMEA 4KQ1A 4HZGA 3RYIB 4UTRA 1PNTA 1V8BA 4CN9A 1A8PA 2O0LA 4HFNA 4CDRA 2A1UB 4W7HA 2XCRB 2O3QA 1HRDA 3UHFA 1M8GA 4FPXA 3QP9A 3IPRA 5T41A 5AW7A 2QRJA 3DT8A 3WNZA 1BMFA 4G56A 2B2XA 3L7IA 2XAAA 1G6KA 4HYEA 4ND2A 2II6A 3DH0A 3ZNNA 4A6XA 4AJ9A 3E9MA 3AVUA 4HQRA 4YXWA 5K03A 2NYVA 1ZSNA 2JKYA 3B48A 2X0KA 3FCEA 4CTOA 3NAQA 4WZAA 4BXOA 3NTOA 4GXQA 3ZZ1A 4EUNA 3LX4A 1R9JA 2XI4A 3LW8A 3HJNA 3NTVA 4GO1A 4H08A 4KPUA 4RF4A 2E37A 1MX9A 3G2HA 5DWDA 5F21A 3PNSA 5BSEA 3KSAC 4FNMA 2VH5R 1XKQA 4Q19A 4UVDA 1S2IA 3V8RA 5L8VA 1DIAA 1XP5A 3UJHA 3KO8A 4HQ6A 4WADA 2CMDA 1GQRA 1ICEA 2VZ9A 1FFXB 3OQIB 5REQB 4C1NA 3VKHA 4H6VA 4DMUB 4MIOA 3AVXA 2G6BA 3O7MA 3KSZO 5CH5A 2Y76A 4X8LA 4EATA 3UH0A 1TTTA 4D9JA 1KFCB 1W96A 2CCGA 3DG9A 5FB3A 2NUTB 1OX5A 5IVHA 2IXGA 3VO9A 1DCKA 5JDCA 1XVLA 1AQUA 3PA6A 4U7JA 3SHTA 5IK2D 2DFTA 1Q6YA 2DGDA 2BR5A 3EXHB 4GZ3A 3ROEA 2PL1A 4DCPA 3RHTA 1ODSA 1RZUA 1T0HB 2EP8A 2TECE 4FUQA 5KYWB 1LV7A 2XWQA 4BQIA 2XVXA 2Z09A 4NJOA 1TZJA 1U5BB 2WAXA 5F77A 4PS0A 3ZHSA 3V4PB 3FOFC 1P39A 1UWVA 3IT3A 4O02B 2EX4A 4F1WA 2J4DA 3VI3B 4CMEA 1ZRNA 3FETA 5K8JB 1BVUA 3DBRB 5BYJA 2O06A 4DV4B 4JEIA 3D7LA 4N9WA 3OM1A 5C1IA 2P0AA 4XUDA 3GCGA 4LNHA 2CK3D 2IH2A 4FYWA 4CMGA 1VPTA 3LQKA 2WJJA 4XARA 4CFSA 2NLOA 1XXHA 2RGYA 1K88A 1RMTA 2C29D 3ELYA 4DN6A 1WLYA 2BE7A 2C3PA 3CRZA 4RXTA 2TRSB 4BNJA 4ESEA 3ASUA 4KPUB 4Y6SA 3ES9A 3GEPA 4XCXA 4BVBA 4H3VA 1ZUWA 1ESCA 5BSGA 5EXSA 3H5LA 3L4EA 1DADA 4TKLA 1SVOA 2CKDA 4CDMA 4LSWA 4L9RA 4PYNA 4YMVA 1ATIA 2RCYA 3AESB 4Q1FA 1OXBB 2JLVA 2BTQA 2RKBA 2RAUA 4PQGA 2X2OA 2XGGA 1PZMA 1TEZA 2XNHA 2C0CA 4HZIA 4J94A 3KXKA 4K1LA 3G7NA 3UO8B 4DJFC 5IF9A 2PUEA 2G80A 1JIXA 3DAOA 3FOZA 1C1XA 1MOPA 5B2ZA 3RBZA 5ISMA 3QOWA 5E3IA 1U31A 2PD3A 1HX7A 4LF6B 1DUVG 1I36A 4D4MA 1N8NA 2YZKA 3AJEA 4GR5A 4V24A 4UDYX 4TTIA 5FBQB 4LSZA 3VNAA 5GWXA 1T6BY 3VJKA 2NXNA 1T15A 4FIDA 4QICA 3ORYA 3FBGA 1Q83A 1ADBA 2ARKA 2C4UA 4JASB 1RBQA 1WMFA 3VHRA 1KBZA 1DC6A 2OORA 3OIYA 4H1WA 3VISA 1MCZA 1UXGA 3PJGA 1T1IA 4F8YA 1KAEA 1QZUA 1ZEJA 2H17A 3DEAA 3KTAA 2R7MA 4X3PA 2DHRA 5D8DA 3ZVKA 4GC5A 2XV1A 3ELUA 3FDJA 3MTAA 3SQMA 1P5RA 2WFMA 2YWFA 4PXSA 1GILA 2VJCA 3PICA 3VZBA 1XPOA 4TS3A 2C77A 1WTCA 2CZQA 4OD0A 4YUXA 3IBCA 2G88A 4ZI7B 1UBEA 4MINA 2AOUB 3GEEA 4ZT3A 2NZJA 3F4KA 5ALWA 4CLEA 1CEQA 3DW3X 4OP3A 1P1HA 1A9PA 3D8NA 4QX6A 2VPIA 5KCZA 2FWMX 1B74A 2PRKA 4ZCSA 4NJEB 2ISSD 3OTWA 1HQDA 1QM5A 1VI2A 4LXUA 1PZNA 3H2JA 4B43A 3U7JA 1K7FB 2P9BA 3JVUA 2G70A 4MRRA 4B83A 2I4IA 5IK2A 3IMEA 1LRKA 3WGMA 2AHRA 4F12A 4JUAA 3DLHA 1JZTA 4G0MA 1PWYE 4UBLA 3MAGA 4FLFA 2GMWA 4HNSA 3FMIA 4G0VA 5CW2A 2JAQA 4AMGA 1RRVA 1ZY2A 2HGSA 1T8RA 1TIBA 1LLCA 3DP7A 3ZJYA 5BVGA 5HQ3B 3F46A 2R0QC 1KA9H 1OZFA 1DIOB 1R0SA 2AN4A 3GRZA 4KBFA 4EQ6B 3EXG2 4IX9A 2XY4A 4K03A 3KEGA 3M3PA 4M21A 4CG2A 1G20E 4YEDA 3ZZ0A 2MINA 1EWTA 3KXLA 4LY9A 3RFTA 3ANNA 3OF2A 2OHHA 4EKGA 1G20A 2FW8A 3L6UA 1LNSA 1LDMA 3MWFA 3SOZA 3HUTA 4F06A 1CY0A 1BD4A 3I1YA 4ZGGA 1O6BA 4INOA 4BECA 5MN5A 3E2IA 2JIZA 5CFPA 1Z4IA 1JHXA 3I12A 2ZUBA 2C20A 3LSYA 4TV8B 1MJNA 1NW7A 5GGYA 3P0IA 2IH4A 2B82A 4ESVA 3UJCA 2G5CA 2AC4A 3SOPA 1J8YF 3VOSA 4XGKA 3R3HA 1ES9A 5TGDA 1Q1BA 3VZDA 3OURA 5SZJA 1G8PA 1NN3A 3V2HA 3ORQA 1SU4A 1KJQA 1Y3CE 5AVRA 1JB1A 1LEHA 3W5DA 1U8UA 1V1RB 2I4TA 2VJMB 3UT0A 3VVMA 3HYCA 5EQFA 1ZN9A 3A31A 4I55F 4OO3A 5K7SA 4WCVA 3ZV7A 4BP8A 3K9BA 5JHGB 2B5WA 3DD5A 3SVTA 2FPPB 3BE5A 3IAM6 4D4GA 4ZFNA 3IT2A 3FYUA 4NCXA 1RXVA 2NUBA 2HQOA 3GV0A 4CDNA 4R6XA 2DWQA 3PXCX 4AP9A 4D42A 4EDFA 2BKAA 2IEAA 4YFYA 4IVQA 5AKXA 4QJBA 3TLYA 2G04A 4UTVA 1NPTO 4Y2XA 3L8MA 4AECA 4G41A 3DDCA 4RLSA 3HVJA 4R3NA 1U0GA 3C6ZA 3RC2A 3B1WA 4TGLA 1U2GA 1DT3A 1KQ3A 3GLHB 1Q0ZA 5A0VA 1TEXA 4PV7A 4F7WA 4EECA 1C1HA 1Y3HA 2RHHA 3A1FA 4OOFA 1DBPA 4BCDA 4MWCA 5J4KA 1P7CA 1BE0A 2REBA 3U4IA 1FRQA 4M0MA 3R8CA 4BX8A 3NHAA 3QYFA 2B30A 2I78A 4O33A 3T1NA 4LYAA 4CI9A 1RHJA 3FZQA 3GT3A 4GXNA 3NBMA 4C06A 3U17A 1F12A 1QIJA 1OGIA 1JT2A 2D1SA 4MKGA 4RTLA 1F0PA 2OV8A 4Y1FA 1ISGA 1Q0UA 5J58A 4HUQB 2IPXA 4LEIA 1LI4A 4TZ6A 3CVUA 2VK8A 1M2OA 4P36A 3EF0A 5BMVA 1JA9A 4OHCA 1WUJS 1QKJA 1R0WA 1ZH4A 1NF9A 2BF7A 2XJ4A 2A5LA 3G2OA 4LXYA 5DK6A 2QGZA 3V8NA 2J9ZB 3JQ9C 5JWOA 3WISA 3K1ZA 3JTEA 1KWGA 1VCMA 5L3VA 3MT7A 4W8HA 4QA9A 3WLSA 4WZZA 3G8YA 3Q10A 3THXB 4KAAA 1WMBA 2GZMA 1SHKA 3ZY2A 5A5GA 1RXSA 3JZDA 1SD1A 3ZDZB 4IUBS 5JXJA 1XZDA 1LF5A 3WGOA 1A8UA 3IJ5A 2Y8EA 1BKDR 1Q0LA 2CVOA 2F9MA 2DM6A 1E3SA 3SE0A 1MO6A 2TSYB 4IJMA 4Y30A 1WP4A 1Y1LA 1ENOA 2HMAA 1W9MA 1I3OA 2NYAA 3GWGA 4I8XA 3KKOA 1U7PA 1EBUA 2H11A 2VUHB 4IHJB 4ZVNA 2RI0A 2YY7A 4EY4A 3WWPA 4A27A 4D1YA 1TA0A 2JATA 2HNAA 2WG2A 4XD2A 4NULA 1W2WB 2QLFA 1S7CA 1UKYA 3EVDA 4LYEA 1DLIA 2PNFA 1R0KA 3F96A 1JTFA 1S8NA 1HNXB 3CG0A 4MWBA 2JZNA 1L1RA 5LQCA 3U5ZB 3TDKA 3V8MA 3R4CA 5J2TB 1WUKS 4KHZA 4MVJD 3CGWA 1XZBA 2G9UA 4XWTA 4WKGA 1GUYA 2D2EA 1XWIA 4A03A 1GZSA 1BH6A 3D6UA 3J81A 4RGBA 1PJRA 2XYPA 2Q0SA 1JIVA 1UBSB 3S99A 2NQTA 1PJ4A 2OOSA 2WB2A 2JC3A 3HCAA 3VJRA 1KEVA 1J22A 2X5NA 1TM2A 3KHKA 3QYJA 4YJ2A 1KERA 2X8AA 3DXYA 5LOVA 2E5LB 1Y3FE 1ZISA 3K0KA 4GYKA 5C7IO 4REQB 1IAVA 4CEIB 4PFQA 4TL9A 1GPKA 4JYPA 1TT7A 5HF8A 1D1SA 1UDXA 4D41A 3HYTA 4R51A 5KYTA 2P8JA 1LDGA 3GVCA 3FWPA 1RI4A 4QT0A 1O6GA 2NIPA 4KQGA 4NBUA 4IHAA 3DSRA 3DBLB 1HRKA 1AIPA 1NMQA 1VIVA 1ZOIA 4NHEA 4WJKB 3LUHA 3D4BA 1P0IA 1HTWA 2HWUA 3KKKA 4YRJA 2ATVA 2IK8A 1OPRA 2WV7A 3W2TA 3WBFA 1EVZA 4RQTA 2O59A 1H6CA 3GELA 2JLWA 3C24A 4WUVA 1H6BA 1TM1E 1X87A 4N0MA 1QYVA 3G5AA 4ZQHA 3TG8A 4RIIA 1PU2A 1CLUA 2H0RA 4HAXA 1PTJC 4KMMA 1V6CA 2I91A 4BOYA 3HC7A 2RJOA 3EPPA 1TJNA 3ZCRA 4RXMA 1T9AA 2Y1KA 2W4QA 3S1LA 1L5GB 5GONF 3F78A 1D5WA 3QEMB 2J46A 3HDGA 2OCYC 3EBOA 3MGBA 3ZV3A 5HJEA 2O8DB 5B1SA 2VK2A 2QTRA 1HEUA 3CZ5A 3LH5A 4KQXA 1R7RA 2HLPA 4KOEC 4MUFA 4AQYB 1W25A 3JTMA 1W5SA 3AHDA 3S2FA 5CA1F 2BCEA 3X1DA 4EK9A 1A4IA 1YIDA 3ESQA 2EYUA 2LRHA 3JALB 4PLHA 5B58T 4ITRC 5AVSA 3F98A 1U7OA 4DZRA 1STOA 3NCHA 4DBZA 3K53A 1JX6A 1YKSA 5JBNA 1W94A 5K8VA 3MBKA 3VZRA 5E9AA 3SEQA 4YPOA 3NGMA 1CUYA 4ENQA 2Q46A 3O73A 2VZLA 1HDRA 3WL7A 4EG3A 1IK6A 1F2UA 1NN0A 4CG0A 3Q7QA 2XA2A 4NNJA 1YRBA 4EEKA 2FPRA 3E84A 3QVUA 3UA3A 2HPVA 2CL5A 1I7QB 1JLLA 4US1R 3OIFA 4LYGA 5KMGA 5F9FA 4HFMA 1T0BA 3QTBA 4D98A 2AJBA 1NUPA 1UBGA 3NBKA 4IL5A 4O2BA 3MIIA 5DGTA 4UAVA 5EZSA 3RK0A 2QVYX 3VNRA 4CLDA 2JLYA 3TOZA 3WI7A 2WIAA 4B4DA 1GUZA 4DM3A 5EWJA 5CEFA 4EUFA 4FTWA 4QQKA 3GLFE 5LCXA 1ENYA 2P6NA 2QS9A 1PDVA 2AIRA 4NBLA 2H8KA 3HKBB 4RETA 5G0VA 3WBBA 1ZJ5A 1ZOSA 5TIIA 2VUTA 5FWAA 4F4JA 2NTYC 3RVJA 3C43A 1MVLA 1GUBA 2TS1A 5DOVA 3N2KA 4R01A 2RHBA 1ZL0A 2CJWB 2B2CA 2XA9A 4JUCA 2OCLA 4OA8A 5F7ZA 4DJDC 5I3CA 2FW0A 5DNVA 3KZVA 2B36A 5JDIC 3EVAA 1J7JA 4KYIB 3DMFA 1SO8A 2WR8A 2XYQA 2GBLA 2WWTA 2VUSA 3ZV6A 4BY9E 3O0DA 4D79A 2I8CA 3HPQA 1QQTA 1MBZA 2CWDA 1BTOA 4K86A 3D6MA 1FNMA 4RVOA 1SZCA 1U2QA 1DEHA 1NU8A 2IU6A 4CNQA 1HNNA 4JHLA 1KDZA 3EB9A 2C5AA 3Q9SA 3OVMA 1X8JA 3EUWA 5DNEA 1LJ8A 3IBTA 4JMLA 3G2LA 2F3TA 1MOZA 4NBRA 1TAQA 4XVQA 5JARA 5CXSA 2KX7A 2QAGC 2GCNA 3JASB 4KAFA 4YJ3B 5DT9A 2QVLA 1E3DA 3G49A 1ZJJA 2DQZA 4XM2A 3LPCA 4BFVA 4JLJA 3HGMA 1B2RA 3EEQA 1GYPA 4MTCA 4ATNA 4AQ7A 3OQPA 1QGUB 2H85A 3TEJA 4CLOB 4H18A 4OH1A 3U4DA 5DM0A 1JSLA 4IUYA 4ECEA 4B71A 2H1FA 2JLCA 3RSZA 1GFIA 1DV1A 4NG4A 3DE3X 1WMEA 3TYXA 2GERA 2ZJ3A 3A9RA 4Q7LA 3WJAA 3OJXA 2C3UA 4B6RA 2RHOA 5LMZA 2JHPA 4XUGB 2RSLA 2PUCA 3PJRA 1U9IC 2FSSA 3HDYA 2BEVA 1DFHA 4FT2A 1X3SA 4DQVA 3LLMA 4RORA 4HRYA 1YBHA 2W6MA 3OZIA 3H8SA 2GD2A 1QONA 4HDNA 4RELA 1NI4B 1GL3A 1TYEB 2OOKA 1CHNA 3CRVA 3IILA 4WZBB 1SC3A 4MUAA 1LLFA 1IQPA 1R18A 1XMVA 3G6KA 4XB2A 4QDJA 3KL2A 1JQ5A 2P6PA 4HD8A 4QYIA 1DJLA 3P9QA 4UMDA 3H11A 4J16C 4OVKA 2F3RA 3V55A 2NZUG 1W19A 3BZBA 3U62A 4RENA 1WKCA 3NORA 3OICA 4BNMA 4EW2A 5BQFA 1NA5A 1ZD5A 1M8JA 2ZJ4A 2Y1CA 4IGKA 4DSTA 2R85A 4EW6A 5C8DA 1OBVA 2X5KO 1GJRA 2Q45A 2JGMA 2BGIA 2Y0BA 3FRIA 2K5UA 3TI9A 2F59A 2P75A 2ORED 3HDTA 4GECA 5HRCA 5LU9A 1EESA 3FX2A 1K27A 5D84A 5DYWA 1FFCA 4DDUA 1NX6A 4LYJA 1VI5A 2WILA 1W5AA 2HAEA 2Y99A 3ZWVA 1I0IA 2D4HA 1BA2A 4GS5A 4CCYA 4Q9DA 1R8SA 4LRUA 4DRZA 4JD5A 4II3A 3GZJA 4B48A 1UBMS 1DDOA 2I3BA 4TTPA 4ISBA 4PYKA 3VSAA 3CVWA 4XVCA 3VAAA 3C5CA 4ALIA 3MJHA 3H05A 1P3DA 1KC3A 5EZYB 3RJMA 1A8SA 1CR4A 4FBLA 3VYUB 2EXXA 2RG1A 1BJRE 3K9HA 3VR2A 4WJLA 3AEXA 1FY2A 5BR1A 3TRDA 4H3HB 3CMCO 4E46A 2PX8A 3SEZA 4ZAWA 4C6TB 2WAOA 4PNEA 1RJ9A 2G4CA 1PFQA 2BE9A 1QAMA 1NQVA 1U8EA 4WZBA 3I61A 3FCAA 2RB4A 4M36A 5DXJA 3DWGA 1IZ9A 4MB2A 1G6OA 4ZKEA 1GCIA 2AA3A 2FZKA 2GX6A 1E9FA 3KUCA 4OL9A 1C30B 4JLKA 4ND4A 2GN2A 4BGUA 3ZWMA 2AW3A 3WK5A 2IZ1A 2XEXA 1S1MA 2OUIA 1EMDA 3B13B 5JY6A 1M34A 1W4LA 1URPA 3LWZA 5DGDA 4Q1CA 3SYTA 1X80B 5K4AA 4WQMA 3EUAA 4JBIA 5H4HA 3EWIA 3KZMA 1I3NA 3ZU4A 1J5EB 1XVUA 4G5XA 3QMVA 4KK4A 3P2IA 4RKWA 4TYPA 3DTTA 1O4VA 4RMHA 4KEAA 2V6MA 4RCVA 2ZVQX 3HWWA 3IEVA 3DDHA 4A2PA 1K86A 1X8KA 4KWCA 1U2DA 3LQYA 1AQYA 3ZNQA 3ZU3A 4AUMA 2YYSA 2GBPA 3IPAA 5J40A 1F2VA 4MV3A 4QPPA 1PCXA 1VL6A 2PWBA 2PGIA 1PHRA 1ZM4A 3MBOA 4DMRA 4OIMA 1FJHA 3IAAA 5FR1A 2H9YA 2IGBA 4HUQA 1QC5A 1UFKA 4BB9A 1HT0A 2BR4A 3P7MA 4G1CA 4Q3CA 1KE2A 2NX2A 3HUEA 3LT2A 5F76A 5KQGA 1Q7RA 4F11A 2AJ8A 1I5EA 2PUTA 2X9GA 1CE8B 1SR8A 1VRWA 1YRYE 2BHRA 2JI4A 2JJ2D 2NOAA 3IDAA 2A9PA 3LI2A 2DUUA 1U11A 2WKRA 3E70C 4L6IA 3U4AA 5JMWA 3PI6A 4OHOA 2P68A 4JU8A 2QXUA 4LNAA 4W1RA 4EYOA 1MIOA 1PG0A 1MJFA 4GBED 4HDRA 3WNDA 1SU6A 1WB6A 2NWQA 3O4GA 2I6TA 2I5PO 1NE2A 4LJKA 3UWPA 3BD8A 3M7IA 3VBEA 3U48A 1G21A 1H4QA 4JJ6A 2FN3A 2XUOA 4TWJA 4LY6A 5LQDA 3DOHA 4URWR 3B1ZA 1Q3TA 4CM3A 3L4KA 3FYUB 3FRJA 3QOXA 4HB4A 4HXYA 4DKXA 3IMFA 4BVLA 5A3QA 2Z5GA 5AJWA 4NMXB 1ZP6A 3VZCA 3H7IA 2B3DA 1OWPA 2ERYA 2GK4A 3BMNB 2CMHA 4K9NA 4OGFA 1DTEA 4NQRA 2WWWA 2XQKA 1U0FA 1RD4A 2KMLA 5F3DA 2Q4RA 1BIFA 4MA4A 3K96A 3PHJA 4TSRA 4NENA 5CX1B 1VPVA 3A3NA 4LDJA 4XEUA 1U3WA 2OO3A 1J33A 2R5WA 2QROA 7REQB 3EEBA 2W2XA 2ZUFA 4FGSA 1GDDA 1TYDE 1YB4A 1DCMA 3U7FB 4BNUA 4A23A 3QXXA 4W5NA 1PL0A 1FFWA 3V2GA 4DG8A 2YVUA 2GPBA 1GR1A 3EGXA 2VRNA 3PQ7A 5J5VA 4LOJA 5AW3A 2NP7A 3KOUA 2XUIA 2XKJE 4J2OA 2Q3HA 4Z1MA 5F7OA 3AHIA 3EZ9A 5I48A 3GLGE 1X94A 1U28A 1Z0SA 2Q9AA 3F6SA 4LRTB 4HDOB 4IEIA 4KXMA 4BAUA 4NZNA 1XHFA 1GG5A 1E1YA 1AF4A 1FU8A 2YIVX 3B8HA 4IEEA 4KAJA 3L04A 2C2GA 4OKSA 3A9TA 4QARA 1T24A 5HIAA 3NLLA 4G81A 3T3MB 1PK7A 3N8HA 1NVGA 4QUDA 1J9GA 2NAPA 3BE6A 2XMRA 4ITVA 3GZTB 4Q24A 5E95A 3UJBA 3A4TA 1RXCA 2OZPA 3BH7A 1DMSA 3Q3GE 4QPDA 5BQOA 3O21A 5B7QA 2JIRA 2W11A 3A06A 2HYDA 3QSGA 1RWBA 3UCEA 1GDTA 1THGA 4WFIA 2C8KA 3DF7A 4O6VA 5B55A 1JA0A 5KC9A 3EDQA 4LC1A 2D74A 3ROXA 4Q6BA 4J03A 2O2JA 4Y2RA 4CR7A 2NPOA 1XEXA 4Z9BA 1H3FA 1JAIA 1NBWB 2ONKA 2ZLBA 1QG4A 3N6RA 2W43A 1ACJA 2A1TS 1GGKA 4IQ8A 5ADUS 2YJGA 3CW8X 3G13A 3K32A 4BV2A 1AQLA 1PJ8A 1V7QA 5EUBA 4R81A 1ZCAA 3E1GA 3JQCA 3AW8A 3F1LA 4F3CA 4UEJA 1XLTA 1EP2B 3ZK7A 4LN1A 3RS5A 2XCOA 5B2EA 4DR2B 3UGQA 3GROA 2UVDA 3C4QA 3EGEA 1UIMA 1Z7EA 2YFYA 4P7KA 1WBBA 1KK2A 2NTVA 2EJBA 1E1RD 4RJ2A 4K6OA 4GLBA 4NNPA 4MICA 2B4TO 4QJ3A 1BRMA 5AW4A 1GT91 2KWIA 5T4HA 2P2DA 4M6WB 1UXHA 1WB5A 1IBLB 4YRNA 3OH8A 3Q87B 3HV2A 1C81A 2PCJA 4XWOA 3T1HB 2JGEA 2GCOA 1IN8A 5IJAA 4V1CA 1Q74A 2Q9UA 3RRZA 4MB6A 2WWHA 2X9LA 1CY8A 1L3BA 2GAJA 3DLTA 4ZOEA 1BS1A 2F1IA 2UV8A 1A50B 4G0NA 4ZDJA 1EKXA 2ZSIA 2BEJA 1EM8A 3UOGA 1IUOA 2BLNA 3R0VA 4TYQA 4GZ6A 4XJVA 3P0HA 2G28A 2PL3A 4RD0A 5J3JA 2FR8A 2GPTA 4UTOA 5EWMA 3S8MA 5CHEA 5KJFA 2QU7A 1CVLA 1H2BA 1AKNA 3CZPA 3HA5A 4KR6A 3ZUPA 2HA3A 4TL6A 2GSDA 3FPLA 1XTRA 4TN5A 4YRMA 4HFJA 3DZKA 3ESYA 3PUWA 4L8VA 3B6JA 4RDIA 4L1KA 5KNBH 1OQAA 3PE6A 4K88A 3MN1A 2KLBA 1GL6A 4MJ3A 2PRZA 4R3UC 5DN6A 4RTPA 3II6X 4I4TB 4OHPA 3WICA 1WEHA 3ADOA 4YCDA 5IH3A 3THXA 2IYQA 2OHFA 3HNPA 4I1PA 1ESDA 5FAXA 2EP7A 3B70A 3JWEA 3ERCA 4CKCB 2EFDB 3O3CA 3T0FA 4YJKA 4Z1MD 2VXCA 4ZYZA 1I7NA 2R6DA 4D81A 2AZTA 3LTEA 4Y2JA 1E1LA 2H29A 2DHDA 3G7UA 4HP8A 5AVWA 2M6KA 3TLXA 1DDGA 2HJWA 4CQLB 3NKVA 3VYVA 2EDAA 3ET4A 3NS7A 2YFQA 2J09A 2ZU6A 5TPZD 4U2DA 3SS7X 2ZJAA 3A05A 4Q12A 5ES4B 4QRIA 1QRSA 4Q9HA 3DB2A 4MS1B 1AHHA 2WIBA 3VNBA 4DJAA 4WBNA 1M1NB 4NU5A 2WOOA 1GRVA 1VG8A 4K9RA 3I34X 3SC6A 3CJTA 4F85A 4US2R 2Y9MB 4WCFC 1NNEA 4PZ0A 4DR1B 3Q8LA 3O1JC 1U1GA 3QX3A 1HT1E 2X8WA 1NE7A 4MEBA 3OQHA 1CDZA 4FZRA 2R6FA 4U6NA 3WHIA 1J97A 1UK8A 2NN3C 1KEKA 1XQWA 1ZQ9A 3V46A 3DKKA 3ENQA 1T2EA 3B6IA 3I92A 1O97C 3R9KA 4GFDA 3W2HA 4CM9D 4DJEC 1I8TA 1Z15A 2QXYA 1LKZA 2OQIA 2SICE 4HYYA 1EX1A 2I9KA 4AX4A 2FWIA 4B5KA 5BORA 4UM9D 1PEAA 1XB2A 2FPPA 2GYUA 4PNZA 3ROQA 2HN9A 1KIFA 1NDUA 3MGAA 4BQSA 2HHJA 3KYCA 2CSUA 3MCUA 2ZCJA 3EIOA 1Q0QA 1FJ2A 1P2GA 4OTZA 4IV5A 4H35A 3JQ8A 3HSSA 2Z2IA 5K09A 2EVWX 2IP4A 3VPBA 2XT0A 1G3MA 2DTEA 4EG0A 3HB5X 4OQZA 2IJGX 5KQPA 1RYMA 3ESDA 3AMVA 1Q91A 4L8YA 5FORA 4CZ2A 4N40A 3AVYA 4IWNA 3IQFA 4M38A 4UHHA 4A8TA 5L45A 4RTMA 5AD1A 3P9XA 5CM8B 3HEMA 1KYTA 1N0UA 1XCJA 2QJTA 3Q3EA 5J23A 3E03A 3SN6A 4BLTA 1O8BA 3QW2A 3M6XA 1W75A 3PNBA 1FTQA 1SRRA 3WYGA 3CRRA 2MYTA 1EE1A 2H06A 1OH6A 4YJHA 1T6XA 3QVMA 2Q7XA 1XFDA 2HJHA 3FXAA 3IXMA 3ICVA 3PV0A 1C5KA 2X2PA 1PGQA 2QN6A 1CRZA 3IP6A 4MYCA 1ZICA 5B1YA 2J9RA 1X7XA 1GGVA 2BI4A 3I5UA 1RRGA 2W98A 1J39A 4WFKA 3M1IA 4EJ2A 1D6JA 1FVOA 1YVUA 2HLDD 2Q3FA 3OJOA 2WLSA 3L1UA 2IU0A 2IIQA 2LZ0A 2FPIB 1P6QA 1PQ4A 3NBFA 4YV1A 2DPYA 5JISA 5ER9A 1T5HX 4A2CA 4AY5A 1OLXA 1OU0A 1W29A 2K2QB 5JVDB 5FI3A 2PVCA 5ALOA 2XLCA 1IDOA 8GPBA 5FTWA 1UMDB 1O08A 3RTGA 2O5RA 1KMMA 2ETXA 2PD4A 3CLSC 2JI6A 4QDXA 4XD7A 2WIKA 4ETNA 3PI7A 1SNYA 2VYVD 4DT1A 4M37A 1ZM2A 2BKUA 2Q3JA 1JQKA 2HM7A 3EFEA 4TTJA 3NDBB 4JYAB 3RS2A 1J4AA 4L5IA 2GPSA 4YQFA 1P1JA 4EW3A 4XGNA 5EN4A 1Y4UA 4LRYA 5EGSA 1WHSB 3EZFA 3HO6A 5DWVA 4J6EA 2G1AA 2Y77A 4ISCA 1QHHB 3O2JA 1WXGA 1IJBA 3EZLA 3IBSA 4J0CA 4OHBA 4Z3KA 1KYWA 2ZR0A 1W2GA 4I6GA 1WM1A 2Z8ZA 5EMJA 4F91B 1EWYA 1FB5A 3VSDA 4QVIA 2OBLA 5EJ5A 2HSZA 4DEVA 3A3YA 1FU4A 2HBZA 2GPWA 2W9XA 4HQNA 5LNK6 4BUJA 4KN8A 2V97A 3E2PA 3DEFA 2GM5A 1YIOA 2IX3A 3D6JA 3LLCA 5DU2A 1HT2E 3A3KA 3N1UA 3SSOA 1Y3AA 2O8FB 5KYGA 3PTAA 4J1NA 1WB4A 3HRHA 2CLKB 2PV0A 3A32A 4CNBA 1F51E 1GADO 4RK6A 1TRHA 5DSZA 1NSYA 1YR9A 2ZI3A 1SUAA 2JB9A 2IOQA 3COWA 3EDYA 2WYUA 3FHLA 3IJPA 1C7FA 1DRJA 4I50B 3N2YA 1XRJA 2CLEB 4CMBA 1UKZA 1RZ3A 1T4BA 5CLGA 3I9V1 3R76A 4CIYA 2CHFA 1W5TA 1XVVA 2GDZA 1AU9A 1II8B 2JA2A 3IAXA 1Y37A 3KLMX 3VDMA 1ZGJA 1GRNA 2FFRA 2UDPA 5ALKA 5EYPA 3FI9A 3TIVA 1YBAA 4CV1A 1CCWA 5HRUA 3TTVA 3WAKA 1NYQA 3U13A 1FFSA 3A1CA 3PWZA 1DOAA 3CF0A 5K3CA 2P4EA 3RC3A 3ZE7A 1BXGA 3T7DA 5A3SA 4DIBA 4B6OA 2ACWA 4UEOA 1RU3A 1X0VA 2A9FA 1ECCA 2GAFA 2CVHA 2OMEA 2P9FA 3NBUA