1G5FA

Structure of linb complexed with 1,2-dichloroethane
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
294
structure length
293
Chain Sequence
LGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring the structure and activity of haloalkane dehalogenase from Sphingomonas paucimobilis UT26: evidence for product- and water-mediated inhibition.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
molecule keywords 1,3,4,6-TETRACHLORO-1,4-CYCLOHEXADIENE HYDROLASE
total genus 109
structure length 293
sequence length 294
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2000-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1g5fA00
1H23A 3K2IA 4B6GA 4X6YA 4U2GA 4DMHA 5JADA 2GBIA 5AJHA 2WG0A 2WFZA 2B20A 5CT4A 3D5EA 2Q0XA 3C43A 4EZIA 1AKNA 3H2IA 2VA9A 4QDUA 3UUFA 2PVSA 1TCBA 3WK4A 4UHDA 3BXPA 3PI6A 5ALOA 4BBZA 4I3FA 1QIKA 3WL8A 4E14A 3QPAA 2WUDA 1JI3A 3BF8A 3G0GA 4NS4A 3DLTA 3H04A 3I2FA 5HCUA 1R88A 2OAEA 4RE5A 2IIVA 5HQ3B 4ARBA 2QJRA 3VJMA 3C6YA 4G4IA 3W9BA 4W63A 1ZJ4A 3LIPA 3GUUA 1J06A 2WHPB 3N0TA 1D07A 2Z5GA 5AICA 1F6WA 2JGJA 4ZV7A 3GZJA 4X7BA 3OTQA 4UBJA 3BF7A 1DWOA 1AUOA 2P8SA 1R9MA 4QZVA 1DT3A 2AJ8A 1CUWA 3VDXA 5AKJA 5I9IA 3C87A 4W1RA 3WKEA 4Y2JA 4FMPA 4CG2A 1NU8A 2PSEA 4G8BA 3UMJA 4X94A 4UHFA 1IUPA 3C5WP 4GI1A 5ALZA 1JU3A 1MT3A 1UOQA 3X3HA 4K6HA 4U2EA 4EBBA 2C5FA 4CIAA 4BTVA 3DJYA 4OCZA 2XUQA 1MJ5A 1ETHA 1H22A 5ALUA 5EHQA 2JIDA 1CUYA 5EIAA 4X93A 1NU6A 3G02A 5D3ZA 5ALNA 1R3DA 1MAAA 4IH1A 3V1NA 3WK6A 2XMQA 1UK8A 2V98A 2RHTA 3C6BA 4XIIA 1EB8A 3DL4A 3MGAA 4DMKA 3G0BA 3QMWA 5ALDA 3HC7A 2WFLB 5FV4A 1Q83A 2FJ0A 5ALSA 5HKAA 3OG9A 3IUJA 2O2IA 2GBCA 3ILSA 5EHZA 2E3JA 3BJRA 4MWSA 1K63A 4XWGA 1ZD5A 1IZ8A 4FTWA 5EIEA 4HTAA 1J1IA 2XUIA 4FHZA 4AB1A 1VKHA 4PSCA 3G9UA 5ALVA 1BN7A 3PFCA 1JU4A 2JBWA 5JAOA 1EHYA 4LXGA 3KD2A 5H3HA 2HA3A 3WMRA 4DLNA 3WYDA 3ANSA 1JFRA 1CUVA 5BV7A 1X2BA 2JEZA 1KEZA 4HAIA 3I1YA 4EB0A 3HXKA 1VE6A 4KEAA 3AJAA 1YCDA 2QXUA 4DGQA 5AI8A 4AMZA 4OYYA 3IDAA 3OOSA 4YPVA 5E4YA 2HIHA 5EI5A 5HF8A 4X6UA 5K5EA 1HKHA 4W9RA 1K8QA 1AMNA 4UPDA 1XZLA 4Y2XA 2OGSA 1EX9A 4FBLA 2XT0A 3F98A 4BB0A 4X90A 1CUUA 4X00A 1LPOA 1WHSA 4UUQA 1OILA 1CUEA 1QO9A 4TGLA 3I28A 1GXSA 2AJBA 1P0MA 5DNUA 4KACA 4U2CA 3LS2A 3KWFA 4FLEA 5KREA 4KRXA 2QR5A 1PV1A 4U2DA 3MVEA 1LPBB 5JARA 2IITA 2XMZA 5DJ5A 4B9EA 4OUKX 5AKKA 3WYNA 4E46A 4XJVA 2D0DA 4P92A 2O7VA 4C01A 4B85A 2RONA 1XQVA 4FDMA 1CUJA 2QTBA 1FFCA 4KAAA 4G8DA 3V1MA 1E89A 1CRLA 3B3QA 3H2HA 2OCGA 2JGKA 4B80A 4OYLA 4KE6A 5A7GA 1H2WA 2WJ6A 3WKAA 2C58A 4MYDA 4EY4A 3AILA 1SCIA 2VT7A 5JANA 2JGLA 1EK1A 4EA6A 1UT6A 5A62A 4KE9A 3ZLTA 2H1IA 2XLBA 5DTIA 5HQ3A 1SCKA 2I78A 5FXMA 3V1KA 4U2BA 4BCCA 5CH5A 1CV2A 4QLAA 3IIIA 2I3ZA 3D59A 2CBGA 1GZ7A 1TKRA 2VJDA 4MQLA 3QPCA 5AKHA 3I6ZA 1LZLA 1XZIA 1XZFA 4P93A 1CQZA 3DD5A 1DX4A 3QMVA 3K6KA 2X76A 3WKCA 3IA2A 5AM1A 1T2NA 2AJDA 3H17A 4LXHA 1AGYA 2B9VA 1XFDA 3AUKA 2Y2VA 4JYPA 5JAUA 1IUNA 1T4MA 4FOLA 3I6YA 2XMBA 5ALPA 4KAFA 4N8DA 2QKYA 2WFLA 4MQMA 1XZKA 5LZ8A 5DWDA 4G1FA 4M0MA 3WIOA 1FJ2A 1ODTC 2PU5A 2CUTA 1QIJA 1UKBA 4UFPA 3W05A 2R11A 4HXEB 4Y2QA 1FFEA 2BJHA 4C4ZA 1TK3A 4XX1A 4HRYA 5AI6A 1CUFA 4AX4A 3M3DA 2YH2A 1L7QA 4O08A 4PSDA 5K3FB 1K6EA 3WWCA 4WFJA 2JGFA 5T4EA 1ORWA 3VISA 1BEEA 1QFMA 1A8QA 4H7IA 1CIJA 3EQ8A 5K3DA 5T4FA 2O7RA 5CXUA 2Y1KA 2WHRA 5JZBA 4Q3OA 5AIBA 2G4LA 3S2ZA 1MNAA 3ICWA 4N5IX 3K9BA 3NGMA 1YAHA 2PL5A 2HA2A 5DTJA 3VVMA 4I19A 3DCNA 1A88A 2HA6A 1VXOA 5JIBA 1PFQA 7YASA 1LZKA 3H2GA 3TGLA 1WHTA 3H1AA 3FAKA 3F97A 4FKBA 1UXOA 1UOOA 1E5TA 3BWXA 2XQFA 4IHAA 1ZD2P 1ZD4A 3FYUC 1XZAA 4OB8A 4DNOA 2OAGA 4HXFB 2GYVA 3HSSA 4UBMA 1LPSA 1Q0RA 2Z8XA 4J7AA 1TAHA 2XLCA 4Y2SA 1U4NA 3A2LA 4C4XA 2ZVDA 1ISPA 1BEZA 2WFMA 5F4ZA 1AC5A 3DQZA 4GDMA 1WPXA 5ALRA 3QZUA 5FOQA 4E15A 2VTVA 3DYIA 1CQWA 3WI7A 2JEYA 3PICA 5LIPA 1A8UA 1RYYA 5DYWA 4GECA 5T4BA 2OQIA 1W4LA 4UBNA 3AIMA 4DTCA 3WK7A 4K5QA 1CUDA 4X97A 4BC0A 4QNNA 4EY6A 1G42A 4EUSA 1DWPA 2BUBA 3WWEA 1ZOIA 3HEAA 2ZYSA 1CUGA 4OSEA 3SWWA 5CXXA 2CZQA 4CI9A 2JGMA 2R8BA 1LPPA 3I6MA 4DSAA 1R1DA 3WKBA 4Q1VA 2OLEA 3ZLUA 1L7RA 4OPMA 5EHXA 2ZYIA 3JWEA 2QUAA 5LZ2A 2VATA 1DQYA 4K2AA 3QYJA 5DYTA 4Q05A 2VJCA 1DQZA 2QT9A 1U2EA 4EY8A 1P0IA 1QIGA 3W04A 2Z3ZA 5HF9A 2OGTA 3MUNA 4AN1A 1XRNA 4INZA 4F60A 4AZ0A 2JGEA 1SOMA 1YAJA 3KWJA 4LHEA 1Z68A 3QVMA 5JALA 4RPCA 3SX4A 1TRHA 2YASA 4AQDA 5FUMA 4UFNA 1MX9A 3CCCA 2QVBA 2VEOA 3V48A 1C7JA 2VT6A 1KU0A 4H77A 3ICVA 1Y7IA 4BZWA 3LP5A 3ANTA 4J0HA 3FCXA 1EDEA 2WIKA 1SFRA 4OU4A 1LPNA 4P9NA 3G0CA 5BWCA 3QPDA 4H0CA 2H9YA 1QTIA 1H2XA 4X85A 5JD5A 3C6ZA 3R0VA 2AJLI 5LZ4A 1XZGA 2WSLA 4HXGA 5K3FA 3O95A 1G4HA 4CCWA 5DYYA 4U2FA 4UHEA 5AKYA 4N8EA 5A71A 2DR0A 4QDZA 4B7ZA 4IH9A 4BE4A 5HF5A 1DT5A 2XUDA 4G9GA 2GYWA 3OC0A 3FSGA 4DIUA 5D6OA 2C4HA 4FBMA 5EFZA 4B0OA 3FLAA 4FWBA 1CUIA 1VA5A 4PO3X 1F8UA 2XQGA 1Q84A 2OGZA 3UUEA 1IMJA 2Y6VA 3I2HA 2B61A 3IULA 2DSNA 2RAUA 1F0NA 3B12A 1JJBA 4DNFA 1XZCA 3ESAA 2WJ3A 5C8VA 3BDIA 4AXBA 4FNMA 3RK4A 3HYSA 4W1QA 2WILA 1SCQA 5HKBA 2RI6A 1QGED 1QIIA 2QS9A 1XQXA 2WU4A 4H7KA 3O4HA 3ZI7A 3DEAA 1J2EA 2NW6A 1HQDA 5LLSA 3DL7A 4JNCA 2QM0A 2ZYHA 2CKMA 4Y2UA 3G7NA 1JJFA 2BGRA 2XQJA 1GKKA 2H7XA 1UOPA 5C7YA 5JASA 2PBLA 1XLUA 4AN0A 1UK9A 2ECFA 1OXMA 1H2YA 4DNPA 3G8YA 3T4UA 4ZREA 4F0JA 1XQYA 3WZMA 1U8EA 2OCIA 1A7UA 1DU4A 2DHCA 4G4JA 5ALMA 3AZQA 1MX1A 5CT6A 1R50A 2OCLA 4HVTA 1QJ4A 3D3NA 2Y2UA 5EHNA 5K3EA 1VLQA 1QO7A 3STXA 2RIPA 2X5XA 2OG1A 3QH4A 5K3AA 3AFIA 1XKLA 2GBGA 3C6XA 3VJKA 4F21A 2WU3A 2WIDA 3U0VA 3WL7A 5A7HA 1E66A 5CBKA 3DNMA 5HZGA 4NMWA 4A23A 4H35A 3I2IA 3BDVA 4UHBA 5DNVA 2Y6UA 4IO0A 4G8CA 3GELA 2XUPA 2XMDA 1B41A 4G9EA 5AKEA 1W1IA 1ZD3A 4D9JA 2HFKA 5E2IA 3EQ9A 4BRZA 1EI9A 3Q8WA 1DINA 1YB6A 5LKRA 3LLCA 1X70A 4PW0A 2C0QA 4X6XA 3C70A 3IB3A 3P2MA 4GXNA 1CLEA 5BOVA 2WHQA 1JMKC 3IURA 2X8BA 4KRYA 4H7DA 3WJ1A 2WHPA 2Z3WA 1P0QA 1MNQA 5ALKA 5SYMA 5JAPA 2DFPA 1H2ZA 1EXWA 4UBLA 3STYA 1UWCA 1K5PA 4G4GA 2C0PA 5JD6A 4WJLA 1XLVA 4UFOA 1WOMA 1BU8A 4J03A 1THTA 1ORVA 1QIMA 3FLEA 4CG1A 2ES4A 3HZOA 5HF6A 1ZIYA 1VZ2A 2XUHA 4B9AA 2HM7A 4BAUA 2EDAA 1VZ3A 3RM3A 1EK2A 1RP1A 3DYVA 2K2QB 2WUEA 1VA4A 4QA9A 3HJUA 1BCRA 4V2IA 1GT6A 3A70A 2WLSA 3H0CA 1XZMA 3U1TA 3R3UA 1XRMA 4ITVA 1E3QA 4L72A 4ZGBA 2I3DA 4AO6A 2XQIA 5LZ9A 5CT8A 2OXEA 2XDWA 3FSGD 4I4CA 3EIOA 3L1JA 2C5GA 3AZOA 1CUXA 4DM7A 3WZLA 1GQRA 1GGVA 4B83A 1AZWA 1QOZA 5A6VA 4C4YA 3C8HA 3O4IA 4K6GA 3R3WA 1LBSA 4S0XA 5KWIA 1YASA 5AK4A 3PDCA 5HFAA 1LNSA 1LPAB 4PSUA 4GBGA 1L7AA 1WB5A 3PUIA 3STUA 4B82A 1BE0A 1E8NA 4L3WA 4ETWA 2G5TA 1UK7A 4KR0A 4XVCA 4PNZA 4UHHA 2WKWA 2WG1A 4E11A 2XUJA 3RLIA 2HU8A 2BFNA 3A2MA 1LLFA 5K3CA 4X92A 4H18A 4GEGA 1XZBA 3FNBA 4N8SA 4Y2VA 2G63A 1XRQA 2XUAA 1N5MA 2XUOA 4GW3A 4ZWNA 4BRSA 2HHAA 4WCVA 3TEJA 1UZAA 2WG2A 4YK7A 3WJ2A 5AHXA 3ESDA 1JJIA 5KBYA 3HRHA 1MPXA 1MAHA 1UFOA 4GWLA 1UKAA 5ALWA 3HACA 3T52A 5IVIA 4WFKA 2VJBA 5K3BA 3O9VA 3QMMA 5AI4A 3AIKA 2VJAA 5EGNA 1YR2A 3CCBA 1UK6A 2XMCA 3VKFA 2HDWA 4J0CA 2HFJA 3DKRA 1CUBA 3R3XA 3A6ZA 1ZI8A 2CB9A 2FUKA 3H2JA 3GA7A 5FPPA 3R40A 2CJPA 2O2HA 2HA7A 2RGUA 1FFAA 3BE8A 1TQHA 4KE8A 2XE4A 4EHBA 5FKJA 1WPRA 2Z8ZA 3D2AA 2QZPA 2J3DA 3FVTA 5CMLA 1FFBA 3R3VA 4LYEA 1XZHA 1IUOA 2WUGA 1ACLA 3STVA 2XMSA 4BDTA 4IH4A 5ALQA 4CG3A 5A7FA 1ZJ5A 2HADA 3DKKA 1DWQA 1EA5A 5ESRA 1W52X 3MUOA 1Y7HA 4KYVA 1DTEA 4HS9A 5LP1A 3G9XA 4MJ3A 5KWJA 1XROA 2PSFA 2UZ0A 4BTLA 4ROTA 3D2CA 1VJ5A 3WA7A 2JGIA 5E4TA 2OCKA 4H7EA 6YASA 4DNQA 1Q0ZA 1HLGA 1QIHA 1CUSA 4FFWA 1G5FA 4L9AA 1GKLA 1QLWA 2J4CA 2PSDA 1VE7A 5AM4A 4BDSA 4Y2RA 4AMYA 2BUAA 3A2NA 4ZXFA 1YA4A 4QDXA 3AIOA 4BZZA 4BATA 3F96A 1C4XA 2IX9A 3S8YA 1YSCA 5ALLA 2VAVA 5ALJA 2VSQA 4EY5A 3WA6A 3O0DA 4HRXA 4MEAA 4WDRA 4Q3LA 2D5LA 4LYDA 1JKMA 4ZRDA 1YS1X 3DS8A 2ZJ7A 1C7IA 1F0PA 1QIDA 1TCCA 4C89A 3QM1A 5AIAA 4TVKA 4QWMA 1CFJA 4CCYA 4LXIA 1VOTA 2VAXA 5ALGA 2ORYA 4CIBA 5IVHA 5IH7A 2QMQA 5ALEA 3EQ7A 1XRRA 5FRDA 3E3AA 4EY7A 5IKXA 4K6KA 3G9TA 3I1IA 5AOBA 2WQZA 2QOEA 2O2GA 1ACJA 4J0DA 2WTMA 2H7YA 1XRPA 4KE7A 4ARAA 4C6HA 5LYYA 5LKAA 3M81A 5ALFA 3TJMA 4PV7A 2XQKA 3LIIA 4BVKA 3N2ZB 3F67A 2CEKA 2GZRA 1LGYA 3PUHA 2ZSHA 3I2JA 1TCAA 4FLMA 1GPLA 4W1PA 1ZI9A 4NZZA 4W1SA 1Y37A 4DMFA 3WL6A 3I2GA 5FPQA 4BAGA 3LCRA 2PM8A 2BCEA 4A16A 3ED1A 2DQZA 1XZJA 5C8ZA 1R4ZA 3CN9A 4M0FA 4Y2TA 5DNWA 3ZV7A 1WM1A 5C81A 5AKZA 2GZSA 3I2KA 2OQVA 1YB7A 2XI4A 1RWQA 2GYUA 1QIEA 4Y7DA 5AKXA 1QTRA 5A2GA 5IVKA 4J0IA 1EVQA 3GBSA 2V97A 2H7CA 4UBKA 5JYCA 4OB6A 2DHDA 5AI9A 1CEXA 5IVDA 3JYHA 3OURA 3WWDA 4AO7A 1FFDA 3NOXA 2ROQA 1MN6A 4C88A 4HZGA 5I7UA 5AOAA 3IBTA 3WQHA 4Y9SA 1TIBA 3H1BA 4B84A 5D3KA 4C87A 1XZDA 4OU5A 2HU5A 1YS2X 3CXUA 1YA8A 4QWWA 2ZSIA 2QXTA 3QBJA 3WIBA 5FLKA 3IUQA 4FNGA 2I03A 3R3ZA 1W75A 4Y2PA 4RNCA 1CUAA 2PSHA 2ZJFA 3Q0TA 1EVEA 3V9AA 3C45A 1MX5A 5JATA 1BN6A 5CT5A 3G0DA 4BE9A 2PSJA 3F8SA 5D7BA 4UBIA 4M0EA 2ZJ6A 1GQSA 5ALYA 1EDBA 3ZWQA 4H7FA 5AOCA 3BL8A 4KAJA 1E8MA 4QDTA 3O4JA 3EBLA 3SK0A 5J3JA 4AO8A 2G5PA 1BCSA 4JH0A 4UHCA 2BKLA 2WIJA 3E4DA 4ZV9A 1X2EA 4J0JA 3WK8A 1ZICA 5BWBA 3IUMA 5CH8A 5AK6A 2ACKA 3D7RA 3VVLA 1O6GA 3AINA 3BIWA 5HK9A 1W76A 1XZEA 3KDAA 2AXEA 3DDUA 4IQ4A 2V96A 5AM2A 1MTZA 2EEPA 4G5XA 4DSZA 2AJCA 2PUJA 4YX9A 1CR6A 3H2KA 1U65A 3WL5A 4BCDA 1ZI6A 2ACEA 4LIPD 4H7HA 2LIPA 3E1GA 3M82A 3PF9A 5AM5A 4P08A 3FLBA 1HPLA 1UKCA 2GBFA 3ZPXA 4NVRA 3WWOA 1QZ3A 1XKTA 3L1HA 3PE6A 5AKGA 3ESCA 1NX9A 3FVRA 3GFFA 4KJXA 1IVYA 5AKLA 3SC2A 5AP9A 3C5VA 5FP0A 1OCEA 4ZI5A 1J07A 4MXDA 2JF0A 3STWA 1XQWA 1HBJA 4JUIA 5SYNA 1CPYA 2XMRA 4N5HX 1CVLA 1GPNA 3WLAA 3KXPA 1QFSA 2J3QA 4YASA 3O9MA 1CUHA 1LPMA 2OPHA 4X91A 5AKIA 1GPKA 3AZPA 1QIFA 3L1IA 4WFIA 5CTAA 5AI0A 4UBOA 5DLPA 3IUNA 2XUGA 4WDQA 3W06A 4J0KA 4RGYA 5AK5A 4B0PA 1ODCA 1FSSA 5CT9A 3D0KA 1BS9A 2WTNA 3H18A 1EH5A 3FYUA 2HU7A 4GLBA 5JAHA 3DOIA 1I6WA 2XMGA 5I8PA 1WB6A 4FLFA 4BP8A 1XLWA 5C8XA 2FX5A 5CH3A 1HL7A 2QJWA 4OD0A 1MU0A 2VQ6A 3WK9A 2W22A 2YYSA 1JT2A 3FWHA 3W9UA 2YXPX 4Q3KA 2DCMA 1XRLA 2WIGA 2W6CX 4Y2YA 4BCBA 1AURA 1BROA 3G0IA 2PX6A 2XUFA 2PU7A 2HA0A 1BRTA 1O6FA 4FFVA 1LBTA 4LKOA 2PUHA 1R9NA 5LZ7A 5AI5A 4DMCA 5JD4A 1KU6A 3RKSA 3ZLVA 3IVMA 4PF1A 5ALXA 5JZSA 3B5EA 4MWTA 4TPKA 3JW8A 4X3CA 1W6RA 4Q82A 3KOOA 4F5ZA 2WUFA 3EF3A 5ISMA 1DX6A 5YASA 3D2BA 2HRRA 1USWA 2BAGA 4BAZA 4DYHA 1B6GA 5CW2A 2RHWA 4OB7A 2FJPA 5EIHA 5E4JA 3NUZA 3GROA 4JEIA 2HL6A 3HABA 1ZGBA 1AQLA 3RARA 5AO9A 1PJAA 4BP9A 5AH0A 3H19A 5CURA 4J0GA 1P0PA 3R41A 1ZGCA 3V1LA 3FBWA 3WKDA 4BYMA 2EDCA 2V9ZA 5LZ5A 4AZ3A 1VXRA 4RE6A 3BIXA 3WWPA 1A8SA 1N5RA 1N8SA 4B81A 2XB6A 5ALTA 3PF8A 1IZ7A 3HLKA 3FOBA 3C8DA 1SC9A 4QE3A 3M83A 1ZIXA 2PPLA 4A5SA 3VXKA 1HDEA 2WM2A 3OPMA 4MYSA 3BJMA 3FYTA 3TRDA 3NWOA 1N1MA 4QEKA 2QUBA 4JYMA 2VF2A 2BUCA 2DQYA 4WY8A 2HRQA 5HFNA 3E0XA 1THGA 1ODSA 1CUZA 2B4KA 2WJ4A 3QITA 3D4LA 3R3YA 1S8OA 1G66A 2QRUA 2C7BA 2HA4A 1QE3A 4PQEA 4CFSA 3ESBA 3STTA 1EINA 4X71A 5AK3A 1QONA 1EB9A 4QLOA 2CMFA 5HK8A 3HI4A 5FDFA 3PFBA 2J4FA 4GHWA 3G9ZA 1CUCA 2BGNA 1K4YA 4MEBA 3DOHA 4CCYB 3FCYA 3VJLA 2XUKA 1WCYA 1AX9A 5T4HA 4J3JA 4Q34A 4WY5A 1EDDA 5AM3A 1JMYA 3O4GA 3FYUB 2PKYX 4X95A 4QDOA 4BVLA 4H7JA 4Z49A 4BVJA 3WK5A 1E8DA 1MO2A 3F9CA 3CN7A 5AM0A 2ZYRA 1WB4A 4L0CA 1M33A 4BC1A 2WIFA 5ALHA 3OM8A 5CRIA 3W2TA 2ONCA 2HA5A 5ALIA 3YASA 3KSRA 2DHEA 5JZ9A
chains in the Genus database with same CATH superfamily
2C2YA 4D42A 4GOKA 1E7QA 5DRYA 4UQPA 3B20A 3W4JA 3K2IA 3RNLA 3WIDA 1PT6A 1Y3DE 2B5VA 2GHQA 4TZ6A 1ZOSA 4X6YA 2GA9A 5DI3A 1PJ4A 4R2KA 4J4TA 3EGDB 4J1QA 3O8RA 1T34A 2OFWA 1SD5A 4RPIA 5JS6A 1IK4A 1FMCA 2I80A 5CA1A 1ECBA 2PCLA 1G8YA 2B20A 4KGZA 2C3OA 5LYJF 1TVCA 3C43A 1PS9A 3L7NA 4HZUA 3TQIA 3K8QA 2PO7A 3CZ9A 3EGVA 4LMBA 3R5XA 4QDUA 4DAOA 4F38A 3V4RA 2PVSA 1TEXA 3LYHA 4Y1FA 2CF5A 3A3YA 5BN4B 1FP4B 4BO5A 4EOGA 1Y6ZA 3OU2A 2R7LA 5M2QA 1DBWA 4MNTA 7MDHA 2QUIA 3PI6A 2GM3A 3EBPA 3FCOA 3Q15C 4TXJA 2KBFA 2GJAA 3V46A 1GQFA 3AC0A 3V7WA 2MMGA 4CMJA 4BBZA 1YL6A 1RXWA 3PNOA 5FYQA 1UDAA 1QIKA 3WL8A 4E14A 3EIHA 2ZREA 3COYA 3EYAA 4JR2A 1S2NA 5F73A 3GV0A 1NDQA 3GWZA 2D4HA 3T4PA 1N6RA 4JOBA 3EZLA 5CU7A 1QGOA 4LS3A 4NS4A 4U39A 3DLTA 3NGXA 2H9IA 4F2GA 3LECA 2K6GA 5IYZF 1R4NA 4EJ0A 2DE0X 4Z3DA 1X15A 4IEEA 1L4BA 1DQPA 5GOTA 3ZWDA 1KDPA 1LSJA 4PEVA 4PZEA 3PWZA 3F2IA 2XV1A 4YQZA 4YJHA 1C3JA 3HCCA 5F9MA 1B43A 3VC1A 3VJMA 1IIRA 5BNZA 1VHLA 4I2VA 1ICIA 3GLHE 4AK9A 4RD6A 3AR5A 3DFFA 5EJAA 2WUVA 4RV5A 4DE5A 1TTTA 3ZNQA 1QK3A 3GR6A 3LIPA 4YR9A 1ZRNA 5TX7A 1J06A 5TVGA 4ZCIA 3S2UA 3X0DA 4ZJYA 2BKVA 5CXQA 5EKDA 3KQQA 2GWHA 3ZDXB 4XQCA 3E7XA 5KKAA 3D31A 2Z5GA 4QYIA 1NBHA 3RG2A 3SLGA 1MV5A 5AICA 4QJIA 4K9RA 4Q93A 4A73A 4BYGA 5JSQA 4Z9YA 3GZJA 2Q9UA 4NY1A 3M8KA 1V0JA 3OPXA 4GPIB 1VL5A 4BFZA 4I36A 3VO2A 3OTQA 1HZJA 1TUEA 3GARA 3ORSA 1RHJA 5BSTA 4FI3F 3KE8A 3SM9A 4RHYA 1GAXA 4JI2B 2GKSA 2W6IA 4LZPA 3TNYA 3EXEB 3TI9A 2C9YA 3FFWA 4JB8A 2VTBB 5KYWB 3IAEA 4I5GA 4E5SA 3JQ7B 2SKEA 3KSZO 4V03A 1H5UA 1KBZA 4DPMA 1DRJA 2C8LA 4K88A 1KI4A 1N75A 4IWNA 1T3GA 2VQ3A 1OJLA 1CUWA 1XZPA 1ZITA 3TCNA 3HXTA 1TT7A 2VPYA 1I2MA 3KB6A 3VPHA 1DUVG 4N5MA 4R41A 1YR9A 4MW2A 4YC7A 5AKJA 4LOIA 1I4DD 5JAIA 3C87A 1VMDA 2ZU6A 1Z63A 1M8KA 1IBRA 3AQIA 1RVDA 1SBQA 1JG7A 3GLKA 3P27A 2ODTX 4Y2JA 3F3YA 3K5PA 5CNKA 4CG2A 2H2WA 4IIVA 4P4UA 3BXEA 2G4VA 2OG2A 4FEAA 5JAPA 1TECE 4ZVQA 4BNUA 3QSYA 1XDGA 2WVHA 2PSEA 3ZQ4A 1G8PA 1J8VA 3PRHA 4BRUA 5GWXA 5LOVB 2DPMA 4NNJA 4GI1A 1AO0A 1JU3A 4BY9E 1NE2A 1UOQA 2ADFA 3EODA 4HY3A 3U3JA 4RFVA 4KDCA 3WYFA 4K28A 4LSGA 1LNQA 1T91A 2AX3A 1ILEA 1KBQA 5CVUA 4Q7MB 2IPOA 4GRDA 4UAJA 4CIAA 4BTVA 4RTKA 3ESZA 4OCZA 1F4VA 1PNOA 2XUQA 1MJ5A 1WULS 4OEHA 2ECQA 3L06A 1FXWF 2ZS9A 3LPCA 4RZSA 1KOFA 5EHQA 5EKUA 4ZVSA 3VPBA 4KX3A 4KUGA 3S1SA 1L0BA 1RRVA 4X93A 5TMPA 1JG1A 1GZHB 4FZJA 3R76A 3U3KA 3LTNC 2PS1A 1R3DA 1NDUA 1XN4A 1V9SA 4IGEA 1XTJA 4RXUA 4XGIA 2ZPTX 3V1NA 4ES6A 4X20B 5BNFA 1BQ4A 3TD9A 1KF0A 2E1PA 2X9NA 4MRAA 2V98A 1ADJA 2RHTA 2XB9A 3C6BA 3DM9B 1SBZA 2O2CA 3H7IA 4O2BA 4XJSA 5E6RA 4A10A 3FF1A 1G8KA 4X84A 2XPCA 3BD9A 2OVBA 5FV4A 2FJ0A 4M1ZA 2QLFA 3OG9A 1U3CA 2X0DA 4MIEA 1G59A 2FF5A 1EG7A 4II2A 3PXEA 2O8BB 3Q7PA 3AEUB 3F6YA 3TRIA 4FB5A 5KVCA 1EBBA 3BJRA 3KXDA 3LGSA 1Z36A 1ZGJA 1N2CB 1NQWA 4WOBA 3LPLA 1GU7A 5FI5A 4D4IA 2DMRA 4FTWA 1QRUA 1HDYA 4TS9A 4HTAA 4ND8A 1LSOA 5K4HA 2ZK7A 4OOFA 4KDRA 4AQ7A 2PZBA 5A0FA 1DIBA 3FZNA 2FWNA 5ALVA 1P29A 3KDSE 4QJ3A 16PKA 1V37A 2HREA 2OWEA 4OMCA 1JU4A 4Y2HA 1B0PA 3NYQA 5EZYB 4AKEA 1BX1A 1V16B 5JAOA 3FUTA 3HUTA 4E03A 1B3RA 4CFZA 1ADGA 4NE9A 4LXGA 5EXTA 2O2DA 5EIXA 1N32B 3WNDA 5JDIC 4ZO7A 1N2ZA 5A5FA 5K0CA 3Q7IA 2HA3A 2ETVA 2C5EA 3LRTA 2VTEA 5JS8A 4C5BA 1X1QA 1TF7A 3RW9A 1YVRA 1XNJA 2A9KA 4I9HA 4D9MA 4HWKA 3I5UA 4UVHA 1I0LA 1OTYA 1X0XA 1CUVA 4GGMX 3ZHXA 2GXAA 3K9LA 2F3SA 1O0SA 3AYZB 3LUJA 3TZHA 1VHTA 3ZWXA 4LJKA 2VPIA 4PC7A 1M83A 4RM3A 1FP6A 1U0TA 3Q3VA 1J2JA 1L5RA 3O2QB 3TJRA 4M1WA 4AMUA 1OIWA 1JHXA 1PNTA 1A2OA 3AKDA 2CNNA 2NIPA 1X1RA 1F17A 3JPYA 2QXUA 1VBKA 1ZK2A 4WLOA 4KWHA 2WE7A 1Y3CE 1A27A 1A8PA 4HMOA 4NECA 4NI5A 3H2BA 4AYTA 4BMOB 4BQRA 1XD2B 4ENTA 1OB2A 3GRZA 1UBHS 2ZBQA 3UFBA 5C53B 1K98A 3B53X 2YINC 2R6ZA 2VG8A 3NVMB 4L4XA 4BX8A 3KJHA 3C7KA 4K03A 3T5MA 1N9GB 4X9XA 4X6UA 4CNBA 1I4OA 4YREA 3PQFA 2I6QA 3EXIA 1GZ3A 1NOJA 3EW7A 3MCZA 3OX4A 4M6WA 5C2JB 4FNOA 4QO7A 2ZETA 5LDHA 1LLCA 4H31A 4IFTA 4W9RA 1E64A 2RGBA 4Q4JB 5C5EA 5GADl 1K8QA 5J43A 1AMNA 1ESNA 2ESRA 4LRSB 5IJAA 3FPJA 2B0CA 4UPDA 3KP1A 3TLEA 1XZLA 2EFYA 1BG6A 1F6BA 3DT9A 4Y2XA 4A7PA 2RK4A 5JMWA 4C2BA 4AS1A 4GI7A 2IEZA 3KKMA 4QGFA 5CJPA 4JYBA 5CDUA 2PANA 2A3NA 4G89A 3FYHA 3MWKA 1GUYA 4WOKA 2PZFA 4X90A 3PYMA 3G5TA 5K51A 3UV7A 3HM2A 1LPOA 3A3PA 5BR8B 1WHSA 4FYVA 1O6BA 1A8HA 5DBHX 4EO4A 4ZK2A 2PIDA 4WSOA 4FIDA 3WGKA 3QEAZ 4TOIA 1Z8DA 3TZ6A 4EK9A 3PNYA 2M2IA 1CUEA 1Y1PA 2WRZA 3ZHCA 1QO9A 1GFSA 2JBHA 3HXMA 3LA6A 3LWDA 3I9LA 3I28A 1IHPA 2ZRLA 4DUPA 3FZEA 1YVUA 1JR3D 2A1UA 1UZLA 5F7ZA 2AJBA 2HIGA 3Q6NA 4D5GA 4Q4HA 1P0MA 2YNMD 3DMPA 3OT5A 4MI3A 3R4VA 1JFFB 4TQ9A 4U2CA 1EE9A 1LC3A 5DTEA 1QYRA 3EPLA 4LW8A 4P5DA 1X3SA 3KLMX 4H6VA 1UXJA 4KP7A 1NV9A 4KRXA 1XNHA 4J2TA 2QR5A 1QG6A 4UNQA 4UDOA 1HOTA 3R7WA 1LPBB 1OBHA 1LY1A 3PGKA 3PLRA 5E7QA 2ONKA 1H1LA 3BIOA 1NBEA 3SYMA 2WJGA 3M5CA 4KC0A 1FDTA 2IITA 3CY6A 1U3GA 2XVYA 3Q88A 4DPKA 1A0OA 2C00A 4FHGA 4B9EA 4F3RA 1KFKB 1QKKA 5AKKA 4NEHB 4F8JA 1PUJA 1ATZA 2D0DA 1ZM7A 5HCIA 2O7VA 1EFKA 2FQYA 1F4LA 2XVMA 2OCXA 4PLHA 1L4EA 5DCLA 1E6EA 1UFVA 1ISRA 4FDMA 3HYCA 2F7SA 1CUJA 1KY4A 3N7AA 3DXYA 3UGQA 3ZE1B 1L5GB 1R8JA 3R8FA 1OFIA 1PIWA 1P91A 1ZINA 3V1MA 1E89A 1V1RB 3H2HA 2OILA 3Q0IA 5F12A 2VDWB 2IU6A 1ECPA 1YCGA 2QPOA 2QQGA 2P35A 1GNVA 3FWNA 4CMAA 3SIRA 4FD2A 2OK8A 3F5DA 5I4BA 1EP1B 3U61B 1Q6ZA 4MYDA 4JLSA 4MA4A 3C6MA 4LGMA 1JIJA 2JHFA 4R0VA 3TK1A 2QN2A 4BO4A 1YZQA 1WZCA 2V5UA 1E94E 1HX7A 3GGOA 1ZO8A 2VT7A 1KQNA 2C2HA 3WSTA 5JANA 4NBRA 1QGDA 4JC0A 4PYRA 2JGLA 1UZUA 2R8RA 2Z1DA 1UT6A 4XGRA 5CIWA 2A0FA 4ZU1X 1WUIS 3UMFA 2P2NA 5A62A 1C41A 5TC4A 2PGNA 4TWRA 3C24A 4RETA 4KITB 3WIVA 3RE1A 1I3LA 2PBRA 3SYLA 3DWGA 1J9EA 3OX3A 2VPZA 2Z57A 3PJFA 2JVJA 2I78A 3RH0A 4CUZA 3BMOB 1CSEE 4PPNA 5FXMA 1R0XA 2ZPUA 4MTLA 1OWLA 3A1SA 1O97D 3OZIA 5DTQA 3V1KA 4BCCA 4JV5B 4QLAA 5EOVA 2H1SA 2J9RA 2DHQA 2E7ZA 2X1VA 3IIIA 2IZ5A 2HHLA 3D59A 3HLTA 2CBGA 3JRNA 2XB2A 3IQXA 3K53A 2JFWA 4N0PA 1F4PA 3HXQA 2VJDA 4MQLA 3ISVA 2M1XA 2X5NA 3AONB 3G17A 3IT0A 3GAMA 2GCOA 3E53A 1NRJB 3KHKA 3UJCA 4K6FA 4HB0A 4CMEC 3CINA 4CJXA 2DFVA 4FU0A 4CEJA 3N9IA 2GN4A 1M6WA 1KVRA 1V45E 4NH0A 5ILGA 2C92A 2ZJAA 4GP7A 4MQEB 5T8KC 5CVJA 5DOZA 4IIJF 4YQYA 2O20A 2HUNA 1A77A 5AM1A 4JLDA 5LU8A 4YV7A 3NUQA 1K0UA 2CLLB 4CEJB 4PO1A 3WLPA 1B1AA 1NRXA 4LXHA 3H17A 3X1KA 2ZB2A 2B9VA 4G1EB 1XFDA 2WDZA 2X2OA 4EECA 1FJXA 4GR9A 3UAWA 1PD0A 2AG0A 1TKAA 4BN0A 4TT8A 4KB5A 2VPPA 4NOMA 3GG9A 1I2AA 5DNYB 2KE5A 1C1XA 4FOLA 3UMMA 4AY4A 2YBDA 1ZIDA 2J67A 5ARBA 2OZVA 4QUDA 2UV8A 4IDNA 1RRPA 4KAFA 4WXPA 4YWHA 2CJFA 3UMBA 2IYPA 3PQ6A 2OTCA 3ZXSA 2JFYA 1HE3A 4AKHA 4O29A 2JC3A 3JCZA 5DWDA 2V5AA 4G1FA 4M0MA 5IAJA 3O3OB 4KOAA 5TQ2B 4AZ3B 3TZQA 2M9MA 1RHUA 3QUBA 4KN6A 4P4NA 5IT0A 2CUTA 2YS7A 1AM4D 4NK5A 1X1DA 3HVKA 4KQEA 2P27A 2ZE6A 1M74A 2SCUA 5EQFA 3EAFA 2J3KA 5KAPA 4JEUA 1KYVA 3DVLA 4O25A 2XYPA 1FQWA 3IRVA 2B7BA 2R11A 3A8TA 1Z4OA 3DUFB 3VO8A 1FFEA 4NP6A 4MR9A 2H52A 1NJFA 4KVZA 4J49A 2L2QA 4MS4A 5JO9A 5CFZA 1TK3A 5F1KA 3WYGA 2PSSA 3CNHA 4F86A 2FWMX 2XCOA 3TLJA 3JAWB 1YJXA 1II9A 4RAOA 2BJWA 4LE1A 1E18A 2EV9A 5AI6A 1YL7A 1P2UA 2QENA 3ZUPA 4LHXA 4XLZA 2C59A 1ZNXA 4C04A 1YS7A 2EFDB 1JQAA 4MVYA 2FR1A 3M3DA 4W5NA 4HX2A 2JARA 4A0SA 3PPXA 2VXCA 2X2EA 5B4TA 2QQFA 1VJTA 1MB4A 4BNLA 3T5PA 2H18A 3PA8A 5CEFA 2VP9A 4PSDA 2AZ4A 1S2OA 5AVUA 4KUEA 4ZARA 3MJ4A 3DQPA 5BYJA 3GH1A 3OZDA 1LQUA 4KN8A 4NPCA 3LXUX 1P9RA 1ZUNA 1JIQA 2JGFA 1VMKA 1W4AA 4NH4A 4PN7A 3VISA 2A9RA 1VKOA 3I73A 4EKGA 2RH5A 4HGPA 2PT9A 3NWBA 1A8QA 3IR6A 4H7IA 2ID9A 4PLVA 4ZJUA 1S0UA 3GCGA 4JVSB 1X7XB 3A36A 4HNSA 4PLTA 3QVLA 2FCRA 1L5OA 2FEPA 1M7BA 1LLQA 1QK4A 3LYAA 3PKJA 4LRTB 5F64A 5HTKA 4DVJA 1PQ4A 4D4GA 3T3NA 2VO1A 3QBTA 1BU5A 2RCYA 3UHJA 3IBCA 5HKKD 2ZYVX 1R8YA 4ENVA 5AIBA 3EF1A 1QWSA 3LT5A 4CL0A 4L50A 3ODPA 4LDQA 2HJSA 4GO1A 4LTDA 2GO7A 4NJMA 4AW9A 2EHDA 4R7ZA 3G2MA 5ITSA 4TS1A 2G40A 4RDIA 1TB4A 1WKVA 3AF6A 3QX9A 2PL5A 2HA2A 3DHYA 1L2TA 1KO7A 3EIFA 1SVWA 1UEJA 2VC2B 3A05A 1M6VB 1DCMA 3GRCA 4HDNB 2OD7A 4I19A 4JIGA 1DJNA 1IUKA 3K1TA 3MQFA 4YH1A 3R7BA 4AYWA 3LZ6A 1KTVA 2O6LA 3NLLA 2Q3DA 3E7FA 1RM3A 1JR2A 1WPGA 1MD9A 2D62A 2QWXA 3LUGA 3T9BA 1Z4NA 2Y1WA 5K1ZA 4O3MA 1HT3A 2EXXA 1WHTA 3H1AA 4IZ6A 1TT5A 1UXOA 1UOOA 2HV8A 2OXRA 1YDWA 1UR5A 3BWXA 3IKVA 3AEKB 2QZSA 2DPLA 4H59A 1DAEA 1MQSA 2Z4SA 3H5OA 4GWKA 4MPJA 4XASA 3RIHA 3NNSA 2GYVA 1HT1E 2VK4A 4KH1A 4UAUA 3HP1A 4WCFB 5GGXA 2F43A 1LPSA 3RRXA 1O9BA 1J7KA 2VYCA 4IJQA 4ARZA 2EVWX 2H07A 3B38A 2CNWD 2Z8XA 1QANA 3DLAA 2XLCA 1M2EA 4MGIR 4EFKA 5CX4A 1S8NA 3AUJB 1U4NA 1R2QA 1FNNA 2XE8A 3A2LA 3LAWA 4Y2SA 1AV6A 1ORIA 2HSZA 3NJRA 2WC1A 1BEZA 3QLTA 4DKJA 2I6SA 5F4ZA 1AC5A 3KV3O 3N86A 3ZWVA 4GDMA 3TZLA 2QZZA 1D5WA 3DGFC 3O3MB 3QOFA 4C03A 4ZPJA 1WXWA 3KZ1E 4EJSC 1U1IA 2ZVQX 1OZFA 3RVPA 4D3SA 2QE7D 2I9KA 2XXAB 3IAUA 3I6QA 5FOQA 3WMFA 1CQWA 5GV7A 2LNDA 1OZGA 2D1TA 1SBTA 4E3ZA 1WSWA 3G13A 4JYZA 1A8UA 1RYYA 2OC9A 1ONNA 1SC1A 4L3VA 3N53A 1LC0A 5T4BA 4ENWA 4B4OA 3F8WA 3V8NA 2AV6A 3CKKA 3WISA 4RLHA 4NDAA 1WEHA 2OQIA 3NTRA 3R8XA 4X60A 1KI6A 3LC2O 3NONA 2OZPA 4V3CA 5JCJD 4Z5XA 4KI0A 5F1OA 3R9KA 1SY7A 4UARA 2GN1A 5BVHB 4U9HS 1HMYA 1Q7RA 1KMHB 5BRNA 4R1QA 4FB4A 3FBTA 4R69A 3K6SA 3DVAA 1TZKA 4RK7A 3ENZA 3ZVMA 3RYHB 3K35A 4C2TA 2SBTA 3OLXA 4QNNA 2H4YA 2AFHA 5BOSA 2D0OB 1YRWA 3T5DA 2AL7A 1J2UA 1J0AA 4RGQA 3JAKB 3SEFA 1RRMA 5CDGA 1L5SA 1CE8B 4HC4A 4I4NA 4QU0A 1DBSA 4OYHA 4JI1B 4BZQA 1DEHA 1H5QA 5CFLA 3G82C 5EKSA 2ZYWX 1Z5VA 4RYDA 3EGEA 4DCOA 2ZRBA 3AK4A 8ATCA 4YRNA 3P2YA 4N0EA 2XGJA 2C94A 3T7CA 1VYTA 5JBNA 1QGUB 4R1UA 2EWMA 4EWLA 1D1QA 2DUJA 2HZBA 3GT3A 3HJFA 1AKEA 3V4ZA 1LKZA 2C07A 3K0CC 2B8WA 3VOAA 1PR6A 2NXNA 5ES4B 4WERA 4CI9A 2PH3A 4EYSA 2RI0A 2GJKA 3VTKA 2VHZA 1SJ9A 1M34A 1R1DA 2XDAA 1PUIA 2II6A 4KCGA 3T7JA 5KYNA 3UWPA 5HUJA 1KI8A 4YAEA 5EXSA 4H1UA 1QV9A 5JPIA 3ZR4B 3LO8A 2A0WA 4MUGA 3KZVA 4RV4A 3T7IA 4MVJA 2ZCUA 4LBYA 3F3SA 2NGRA 3N0VA 3GLIE 4N12A 3QBDA 1NQ5A 3OZRA 4CN8A 4HYYA 4BNZA 3INGA 5A9RA 2QUAA 2P67A 1PK9A 4ZPXA 1E9AA 1BS1A 4JLJA 3KL2A 4OA8A 3QYJA 4GNRA 5DYTA 3AUAA 2IH4A 3GQBB 2BEVB 2VJCA 3BBPA 5IZCA 1F6DA 3OETA 2J8ZA 4YRFA 1FNDA 4A3SA 2H1HA 2WINI 1M1YA 4YY3B 5DDIP 1KKMA 4XTCS 1JFTA 2BJVA 3E18A 2JRLA 5C1PA 3ZJUA 2VSNA 3L46A 3JQGA 2J4DA 2NVOA 3K09C 3LBNA 4A26A 2Q9CA 2XDYA 4HDNA 4M87A 3UAYA 2WYIA 2I76A 1XTBA 4BEJA 1CHDA 3IVGA 3LD9A 1C5KA 3GUZA 5TGZA 2G9RA 3RO7A 1Y1RA 4IKOA 2Z3ZA 4IUDS 3W04A 5MGBA 3MUNA 4AN1A 4XM0A 4UEOA 3O8BA 3Q5EA 2BHNA 4JVNA 3F7OA 3SC2B 2KPOA 2JGEA 1KQPA 1SOMA 1YAJA 3KWJA 4LHEA 5DM0A 1Z68A 1QQTA 1V96A 2OB1A 4AL4A 2D2IA 4C4OA 2WZQA 3JYLA 4EMTA 1E3WA 6Q21A 1OI4A 5A06A 3EZ2A 1CDDA 3EMDA 2WF9A 3JAMA 3ZBQA 2VF4X 4CDGA 3EFHA 4MGZR 3ECSA 1TRHA 3SJUA 2YASA 1GARA 4AQDA 2BTEA 1XWFA 3IQGX 3RSZA 1SBHA 5G0VA 4G5QA 3GX1A 5I47A 1CF4A 4MZXA 4MVJF 4LJ9A 5DM1A 1GGJA 4BNTA 4CUJA 4F97A 3OI7A 3GRYA 5LOVF 2NAFA 5GONB 2VEOA 4BJ6A 3V48A 1Y4UA 4BV8A 2YJNA 2WF7A 2ZBEA 3CIOA 3I92A 2P6NA 4RD2A 4KQCA 3FPSA 5F2KA 3ZQKA 5BUSA 2PZKA 3IUBA 2QR3A 2WIKA 3EXFA 4BFLA 3VC7A 3GDOA 4OU4A 2G28A 4Y1RB 5KOJA 2MDTA 1M54A 1XTIA 4P9NA 3G0CA 5BWCA 1RJWA 4GSKA 3BQNB 1Z3IX 2F8TA 3UH1A 4H0CA 2H9YA 3TUZC 2PLNA 1HR0B 2QGFA 3OIFA 5JD5A 3CEMA 3GAZA 5FV7A 3KKNA 3C6ZA 4BO2A 2AFVA 2AJLI 4I6GA 1N1EA 4XYGA 2QV7A 3F7TA 4UVEA 2LP4Y 1RFLA 4XDYA 5DM2A 3TB6A 4FIZA 2FQWA 3SJAA 3NTQA 4EPYA 2Q21A 4UOEA 3VZPA 2CJXA 4XH9B 1L6RA 5AKYA 2P2LA 1C2TA 1DZ3A 4F2WA 5KVSA 5K0NA 2CKDA 2C82A 4KQXA 5A71A 1MP0A 1OXBB 2FVYA 4MAFA 3GCXA 4QASA 4P81A 5ENZA 5K0JA 3ISTA 3JS5A 1UBMS 3U4MA 2X0EA 4KMMA 1SQSA 5C7OO 4AY5A 4IH9A 1P1FA 3Q1KA 1DELA 1J24A 1GUAA 3MJDA 5HF5A 2NVUA 1Z5GA 5HILA 1WZ2A 1TU3A 4HDKA 3MTBA 2XUDA 4I3GA 2IY9A 3F78A 3H2ZA 1ZBQA 1GQ2A 4G9GA 2M6SA 1RXIA 5GIPE 5A5DA 5EUMA 4GKAA 2BISA 3SXJA 2VYVA 3K71B 4DUYB 5EFZA 3BERA 4EB6B 3QF4A 2RD2A 3OEYA 3L8HA 4B0OA 1Y8ZA 4MPDA 4FWBA 4NDNE 1CUIA 3UMSA 2A5LA 4X7PA 2I6FA 4L2IB 5IAAA 5HE9A 1LTHR 4GU5A 1E2FA 5CLGA 1X7ZB 4CM8A 5JVDF 2PT5A 3OZFA 5KWSA 1Q1GA 3I72A 3N8IA 3RVOA 3UA4A 3E3MA 4BMVA 3GVIA 4B6JA 1WR8A 2NXEA 3NBFA 5HJ5A 4LGCA 3N8KA 3ABIA 3I2HA 4N82A 5A4FS 4G07A 3HWX1 2DSNA 2F1RA 4HSEA 5BWLA 3IOYA 2Q8PA 4DNFA 4LTMA 3VZDA 4UE6A 4E5PA 2CXXA 4E4TA 5C8VA 2Q2VA 4AXBA 4DBVO 4OHKA 4EW6A 2WM8A 2REBA 1FQKA 3GUHA 4QICA 4ENPA 2D7CA 4LV6A 4BN4A 3GJ4A 2WILA 5HKBA 1VDZA 3ANYB 3KL4A 2RI6A 5I6DA 1KO1A 3BKWA 5TT1A 3RRYA 2XOXA 1XQXA 4FCWA 4IILA 2UZAA 1SKMA 3TDNA 1J49A 1N3IA 1U9JA 1OKKD 5TPWA 5JPCA 1F7VA 2FR8A 2XRFA 2PL9A 2X2FA 4BNNA 4H7KA 1D2RA 2CLEB 1Z7WA 1XCPA 4I6EA 4D80A 2GUGA 3EDRA 2R6DA 3USZA 3WHPA 1X1SA 3DEAA 1ND5A 1V3UA 4L0MA 4MQFA 5B1EA 5AVKA 1EGHA 3T3MB 4MJXA 3FAZA 1XJQA 3GEBA 2CLMB 2FZ4A 4CLOA 4RX1A 5DNEA 3FBGA 1CNFA 1HQDA 4K9QA 4K8OA 2VCYA 4QBFA 4YI3A 3TXXA 4YMHA 1P4AA 4ZAWA 2JBAB 2WPDD 4BNFA 1VI2A 2ZWPA 4QG7A 4UVIA 4DWWA 4NRDA 3RIXA 2P2DA 2LW7A 1AY0A 2P5TB 3TQCA 1SELA 2VDMB 3L7OA 4Q4AA 2OV8A 5J2TF 1J20A 1M9NA 5I7SA 5KNBA 1JJFA 1WV0A 2QP4A 3KKZA 5JMPA 4KNYA 5JCPA 3FOCA 3ZTTA 4ALKA 5I8WA 3EVDA 1YQTA 3KSBC 1UP6A 1XLUA 3DG9A 1LDYA 4AN0A 4GMGA 1YJBA 2YJTD 1UK9A 2UUPA 3B6MA 2WKPA 1U7PA 4TTIA 4TSFA 3BUSA 5ECGC 5FUWA 2Z1NA 2IZ7A 3CF6R 1Q0QA 1UC8A 1EE1A 2GN6A 5TVKA 3WIUA 3L92A 3OE7D 3TL3A 4OXQA 1KZ6A 3T4UA 5B3KA 2NN3C 1KP3A 3IJPA 4HEJA 4KQIA 3PDHA 4MV4A 5IAOA 1QG2A 4JVOA 1RMQA 5ILQA 1I3KA 4KXMA 1ZU5A 2H0RA 2NZJA 4QFDA 3NAQA 3ROFA 3WZMA 1B73A 4CYMA 1X7YA 2O8EB 1E4EA 2RI1A 1U8EA 4FW9A 2YHIA 2UYHA 1XWWA 4BU0A 4G0WA 1PL6A 2WWVD 3WWZA 4V0OA 4J7CA 1PJTA 3T0FA 3VA7A 2V8BA 3N39C 1TTPB 1MX1A 1U2GC 3EXG1 1Q0LA 1SZCA 3FNEA 3RWOA 4UATA 3ULKA 1SURA 2X8JA 1XT6A 3HBLA 4HVTA 3D3NA 2Y2UA 2CDAA 1BVRA 1EUDA 1OROA 3SD7A 1UANA 1RD4A 2ZIXA 4F4FA 4D3DA 4W8OA 3STXA 1TEVA 1U3WA 1E96A 1G21B 2EIXA 1YRQA 3GJSA 3KRTA 5JECA 2IC5A 1LS1A 3UWMA 4RKQA 3IPXA 4KK4A 1P19A 1EHIA 3UAZA 2RMKA 3QH4A 5K3AA 2NXCA 2G4CA 3C98A 1VLLA 1W34A 2CNWA 2WW8A 3AV3A 3CH5A 4Q9DA 2B8EA 4K26A 4O4IF 4IXDA 4BKMA 4D3ZA 4E5NA 3OPNA 1F14A 1P45A 4L15A 5G4KB 1Q15A 3OWXA 3V1TC 3PZRA 3AM5A 4BO7A 4NZMA 4JBNA 4KO8A 3DCIA 2M6RA 1QVRA 2VHWA 3KBOA 4IBOA 1PI3A 2QP3A 4DRZA 4EGSA 4F21A 3SNKA 3RWMB 3A4VA 5KNDH 4KR7A 4B3RB 1FFWA 1IL0A 2WIDA 4QO8A 4RFSB 4ZVLA 3H8VA 5T3YA 5A5EA 4NF2A 1CJVC 4FCTA 2HCRA 4YP6A 4KTVE 1CYDA 1WF3A 3IOEA 4B3JA 4RA6A 1E2DA 3COWA 4L8GA 4ZAFA 1CK4A 4C7MA 3BVPA 3M34A 2I3AA 4UC0A 2ZVPX 5LOVA 1BXRA 1DAOA 4IIGA 4K9NA 5FOWA 1G1MA 3JTMA 4PYKA 3TKLA 3QJGA 4S35A 1PNQA 2B5WA 2J6BA 2HT6A 4I9UA 2F6RA 4Y30A 1RZRA 3LFHA 4C0LA 2CE2X 3DZKA 3Q3HA 4WGFA 4D26A 1CYEA 2QLJA 1G3QA 1YOBA 2V6IA 3KXLA 4G9EA 1LI5A 1PQPA 2HMTA 4XB2A 1KYWA 5TARA 1MAVA 4D9JA 5IC5A 4EL0A 2VNAA 3PQCA 5E2IA 3EQ9A 5FTKA 3WBBA 5BXYA 5JWRA 4BRZA 3B3GA 2GN0A 1XJWA 1EI9A 1K27A 1QGUA 1AG9A 1YB6A 2TSYB 2BFCA 3Q8WA 4Z9AA 4M7RA 5H81A 3CCFA 4DQ0A 4N5DA 1HFWA 3QWBA 1SXJD 3QVWA 3AXTA 4PW0A 3R6TA 1QGYA 3L8ZA 1KJYA 2Z5FA 3JVUA 1I1NA 3C70A 3HDHA 2OBYA 2YY7A 1J99A 3LY5A 3LQFA 3IB3A 1BCRB 2JAXA 2R7KA 3FNGA 4OH7A 3NC1C 4MYRA 2AOXA 4PS1A 1XTUA 1JMKC 2J9YB 3UPTA 3VYSB 1W94A 2X4LA 2R4UA 4PSAA 1AA6A 3P2IA 4OGWA 4V0LA 2Q0QA 1TVKB 2XSZA 3WB9A 2WHPA 1FTQA 2WPNA 1UBEA 5FOXA 3ZE7A 4E0BA 1IY8A 2C1EA 1TADA 3JR3A 4KSCA 3R9WA 5B4UA 2VFAA 4O4IA 5BQXA 5C7IO 4J16A 1ZESA 3F4BA 4GFDA 5B2ZA 4TM8A 3UK2A 1NWCA 1WD5A 3CH7A 3STYA 1CRWG 3E0QA 4D92A 3KLBA 4I1IA 5IYZA 4MQUA 1T2DA 1X19A 2Z0MA 3FFTA 1RXCA 4HJXA 4PTYA 2ORVA 1DLIA 4IQ0A 2GD1O 1XLVA 2H2AA 2OHVA 3WNBA 3HJGA 5CFQA 2I55A 1TE2A 2AC4A 3VU9A 3HQ4O 1DKQA 4QBHA 1W6UA 4WKGA 3ANLA 1NVDA 5EJIA 1G5RA 4BNMA 2NUAA 1KOGA 2V55B 2JVKA 2PMCA 1R7RA 2HQOA 1LJ8A 4S2UA 4HB3A 2JGRA 1TJ5A 4JD5A 5JRJA 4WESA 3BXXA 3ADBA 1ORVA 2VH5R 5EN4A 3LT1A 1XTVA 3LX4A 1TI7A 4XR4A 1JZTA 3VDQA 4ARIA 4WFQA 1U7HA 2WP0A 4OJMX 2NADA 2XGSA 2BM9A 2VUSA 4OQ4A 5KQRA 5M04A 1W35A 1WE2A 3WLRA 4K1LA 2XUHA 3TLMA 4BIMA 4OQQA 4C22A 3I0NA 2EBUA 1HLDA 2CXUA 4MHSA 5LNK1 6REQA 4CIVA 4D4JA 1PSDA 3MN1A 5KPJA 1EK2A 1GTMA 2Q5HA 1RP1A 821PA 2K2QB 1K88A 2R1UA 3KOMA 1FZQA 4QA9A 1J8QA 4EITA 5DNAA 3HJUA 1M72A 3GNLA 2GK4A 3UAOA 5FD8A 4O33A 3CSSA 3SYTA 4WK2B 4JKYA 4EHIA 1F38A 1F8YA 4CGZA 4TLDA 3LWZA 1XO1A 3JQBC 1COWD 3NTXA 2E48A 4GPEA 4MCAA 4MR8B 2PL1A 2QGZA 3UK6A 2D5IA 2W70A 5KYXA 1MBZA 3INYA 2H2DA 3B5JA 1ULHA 3CZ5A 3QG5A 2HZ7A 1ZRSA 4OATA 3SIPA 2CMGA 1G20A 5TGTA 1OH5A 2FKNA 3QVGA 4D9CA 4Q7LA 1G7RA 2XQIA 3OE1A 1IFXA 1XN1A 2IDZA 3QEJA 4B3IA 4E30A 5KNDA 1FW8A 2XDWA 3FSGD 2ODBA 3WXMA 2F2TA 4OSOA 2I8AA 1JLLA 3ITEA 2WTXA 4OFBA 3AZOA 2Q1YA 3B3AA 3WZLA 3D64A 2FN9A 4B83A 5H8WA 5KMGB 1PN3A 3MSCA 3O82A 1RADA 3DHWC 3GA5A 4CF3A 1YRAA 1ZN2A 2QLMA 2C77A 4R2LA 4BVBA 4ER0A 1MLDA 1K6IA 2WWGA 2EJBA 2R65A 3KQYA 3LTEA 4YONB 3AVWA 1JE0A 1MXFA 1UQTA 2CNOA 2VWQA 4U7DA 2FE4A 1E2JA 1IHUA 3OOYA 1GVNB 2EP8A 3PR1A 3R3WA 4H17A 1IHXA 3C5CA 3U4HA 4D9HA 2RE8A 1KS9A 4QVGA 1LBSA 4S0XA 3D6FA 5G41A 5KYKA 4D97A 1PR3A 1LNSA 2G88A 2P11A 4PSUA 5G1OA 2P6UA 2N1MA 4MUKA 1WB5A 3SQLA 3B1XA 3ELDA 3QBEA 4L3WA 2G5TA 4UVDA 1PGOA 4MEJA 4UW9A 1BD3A 4PNZA 4A82A 2RC5A 3LSYA 1RYDA 1M1XB 5GZ6A 1QVWA 2IE8A 2XNKA 1I2DA 2WG1A 3FJ1A 4OSPA 4R68A 1U81A 3ICOA 3BBLA 2AKEA 1TJPB 3BFJA 4N0MA 4QATA 3W8EA 1Z33A 1WF6A 2WB4A 2BEUA 1BHJA 3GZTB 1T36B 4JLWA 4TM7A 1W0CA 3N0XA 1XA3A 5HVNA 4B32A 3JQQA 4OGKA 5GM2A 3V2GA 1IQUA 1FXWA 3GW8A 1S2IA 1E79A 1RAHA 2HB6A 2RGAA 5LQSA 4ZHSA 1YOVA 3DLBA 4NCHA 1NE7A 2DKOA 1M8FA 1NMYA 2EFEB 1U80A 2H4HA 2ZWIA 3LBYA 2QEQA 3ZNPA 4DREA 5LJIA 5TF4A 2YHAA 3AR6A 2G63A 1P5HA 4V0NA 1E5XA 1N78A 4ENUA 5IMBA 4EJSA 1YBHA 4IVQA 5K7SA 2XUAA 1O0BA 4JT4A 4GW3A 4YJ3B 2HHAA 4WCVA 4XRGA 4HWGA 1MXHA 3MWEB 2QMHA 2ORIA 2V03A 3GJRA 4YK7A 4FR0A 4X8MA 3NVKI 4ZRNA 5AW0A 2P2ZA 3ESDA 1WJGA 3KCNA 3U3RA 3V42A 3CO5A 2OB2A 4PIPA 2CT8A 1Z06A 2R87A 1AD2A 1O9GA 1FQJA 3DQQA 1K66A 5FOSA 5KBYA 2MT9A 1IBKB 3HRHA 2VKTA 1XAIA 2AMLA 1PZMA 3VTFA 5D5HA 1EWKA 1PV2A 3KJZA 1CQJB 3L01A 3PIDA 4DTIA 4NCAA 2O52A 4HH0A 4TLCA 1HT2E 2YFHA 4O2LA 3UQYS 2VPQA 3LK7A 4NG4A 3PQ4A 1F2UB 2IEDA 3WV4A 1Z2OX 1GJRA 2QN8A 3C3JA 4IXTA 4HS4A 3JALA 4QPNA 2VJBA 5LUBA 3EUFA 2ZWOA 3IERA 3M1YA 3EGCA 3PSAA 4TTVA 2CLSA 4KSYA 3HR4A 4ZOEA 1B8OA 3T1NA 4BNYA 2CL7X 3QMMA 2XKBA 2ZTUA 5DGHA 2VJAA 1NBMA 4ESEA 1KI2A 3GJZA 3ZDQA 3ZEAA 5BSKA 2WZDA 1T0BA 4WVLA 2P4HX 4X5OA 4Q4JA 1PGJA 2IOFK 1H2HA 3AY0A 3LX8A 3R0JA 3O7MA 3TE6A 3VR4H 3IDOA 3M5WA 5I7FA 3ADCA 4KO4S 2HXYA 4DEXA 3VKFA 5IJ0B 1CF2O 2CXSA 1LRLA 3GEHA 3KWLA 3PSHA 1JMVA 2MSWA 4QRDA 3ND8A 4Z4CA 5DLYA 2FSGA 4B8YA 2ZIWB 4KQ1A 3A6ZA 1R0WA 2JI9A 1T29A 3OUZA 5E1DA 3AL2A 3RT7A 4HYEA 1Y3FE 1EBUA 2G1JA 3B82A 5FUBA 4B17A 1WZEA 1GAEO 1GZ4A 1PTJC 3GT4A 3ELYA 1U8FO 1NPTO 4AP9A 4CXMA 3TW8A 3R9XB 4LY9A 1KDZA 2H5IA 2PLWA 5DTMA 1V39A 4HFJA 4FGKA 2HTFA 3H8SA 4RW0A 1BMQA 1F51E 2GZHA 1E2PA 4MUHA 1RKBA 4M4SA 1YD7A 3UEOA 2PD4A 2ZIEA 3AHIA 4JJKA 1RHRA 1AKYA 3EQZA 3HCNA 4KE8A 4NZNA 1OY1A 2B25A 3DFKA 4JSTA 4EHBA 3JWGA 3R0XA 4BLWA 4Q1FA 4C3UA 2Z8ZA 1Z5PA 2QZPA 3ADPA 2DFKB 4AT1A 3W34A 4OGLA 4BMPB 3R3VA 2A0KA 3V1YA 1FU8A 5EWMB 4MPTA 5IXYA 2ZZMA 2JJ2D 4JOCA 3LDUA 1Y81A 1NVTA 4IFEA 4DIDA 2R9VA 3C3KA 5D8DA 3V3TA 1Z37A 4C7JA 4PLYA 5J5CA 2Z9BA 4D6YA 4RDXA 4BTEA 2YWDA 2WUGA 5F52A 1Q44A 5LD2C 3RSCA 3HCAA 1P7ZA 2WSIA 3RUDA 4BDTA 4EQ6A 5HYVA 1FLAA 5KMGA 1OBOA 2RH9B 2QMYA 3JAKA 3NB0A 2Q6VA 5HW0A 1JG4A 3NHBA 5GJVC 4HWRA 5JWHA 2FXIA 1ZY2A 3J7TA 4C4TA 5IVPA 1JQJC 1RQ7A 2DQ4A 3M6IA 4RTLA 3ONNA 3PNKA 1ZJ5A 1CE8A 2Y77A 2XT9A 1EVLA 1U5BA 1X1AA 2HO4A 5KQLA 3LHDA 3USCS 3FUVA 4DXHA 4A15A 3QU5A 4I9FA 2ET6A 1J6UA 3NC0C 3I9V6 4A8JA 3EMKA 3WAKA 1NMEA 3IT3A 3OJCA 4NENB 1OVGA 3MUOA 3L4KA 2B78A 3CHYA 2F64A 3W1VA 4TYWA 1Z6AA 1SXJB 2QRQA 1V6CA 4E1VA 1ZWKA 1C9KA 2BH9A 3G2KA 2XYHA 2NUPA 2C0CA 3PQ5A 2K7FA 5KWJA 3UC9A 4R1OA 2V6BA 1Y80A 1T9BA 3L7IA 4BEBA 2GA8A 3JU3A 1UPAA 2ZYUX 1X39A 3MTDA 4Y98A 1VJ5A 1WZUA 1KRXA 2FN3A 1K2WA 1Z8HA 2DAPA 1I4TD 3WA7A 1F2DA 3VR0A 5E4TA 5M34A 2HLPA 1IN4A 1CG6A 2VTDA 2FPLA 6YASA 4FR2A 2ZW9A 2FGKA 4DNQA 1Q0ZA 2YJGA 4H6PA 4G81A 2QJOA 1SU7A 4KR9A 3AVXA 3PQ8A 4RK0A 5J58A 4WZBE 4L9AA 1GKLA 1QLWA 2J4CA 3KAJA 2VWHA 4ZT4A 5AM4A 5JSYA 1VPDA 5NLLA 2UKDA 3NT2A 1OI2A 3FJYA 4CKEB 1A9SA 3EARA 4QDXA 3AIOA 1B8NA 1Q3KA 4M8NE 5G40A 3BMNB 1VCMA 2Q6KA 5CJ2A 3F96A 4YN3A 1YSCA 1YZLA 4Q15A 5KQGA 5F98A 4PFQA 2AOWA 2X77A 2F8MA 5ALLA 4ZIRB 2NPOA 1NFFA 4XSVA 7MHTA 3K92A 1MR3F 2ZJBA 1M10A 3WLNA 3ZU2A 2HQBA 2BEJA 1SQ5A 1KERA 4Q3LA 2JGNA 2D5LA 2QUZA 1EUYA 2DJIA 4MUEA 1A9RA 2NU7B 2YZKA 5C18A 1GV1A 1F0PA 2ZIXB 4U2KA 1QIDA 3OAAD 4ZP1A 1H2FA 4MCIA 3QM1A 1MC8A 2HRBA 4DLYA 1SULA 4TVKA 1XSEA 3ZU6A 4CUKA 1IVSA 2X7XA 3H7AA 4JI6B 1I7LA 4OBXA 1OTXA 4EABA 3HKEA 3VNBA 4Z53A 5ALGA 3T7KA 2GD2A 5A05A 4I1PA 3K2QA 4BLTA 3V7UA 4BQFA 2V3CC 4F7WA 1PZHA 2XHZA 1OH7A 5IVHA 2LRHA 5IBRA 4TWJA 3AP2A 1N77A 4NJMB 2OBMA 3F5QA 4PFKA 1DIGA 2BY4A 4NXMB 3WTBA 1XRRA 4L8FA 1RI2A 4RKYA 5CX1A 2UUAB 1ORTA 1G4AE 3PQ2A 1ONOA 1VJ0A 4I55F 4C43A 4EY7A 5IKXA 3L02A 5L6LB 2FW9A 1VG8A 2JH8A 1N57A 1SBIA 3BWBA 3L43A 4XVQA 5I5GA 2W42A 4E5UA 4YALA 2HKIA 1E1QD 3K05A 5DM4A 4CNQA 3N2YA 3OZEA 2BIFA 5E6UA 4BQOA 5KJ6A 1M3SA 1VB3A 4PSKA 5LKAA 1I30A 2AFIB 5JSZB 2F3RA 3E8XA 3RSQA 2E4WA 3OKAA 2W4MA 3DHEA 4ZDWA 3AF3A 2JAQA 3VVCA 1QQAA 1XDZA 3FX2A 4L22A 3IV9A 3F67A 2OECA 3N74A 5KWEA 1G8HA 1M0WA 1OREA 3TTVA 1X8KA 5E6SB 3UHAA 4BOYA 3PKIA 1EX7A 4RVHA 3DW3X 3FWKA 3FHTA 1LGYA 5KTTA 3BS4A 3I2JA 4ZOAA 4U02A 4FLMA 4EUKA 3FFXA 3W3AD 3VHXA 2R84A 2P3LA 3VYUB 3NYIA 4GKVA 3G9QA 2FZEA 2JASA 4Q16A 4IVNA 1IVNA 3WL6A 3OZVA 2YHUA 3RRZA 1DL5A 4J16C 3ZWMA 4F6RA 2J3MA 4F1KA 1YBMA 3IXLA 4MYHA 2VAPA 3D7SA 4W6QA 5K0ZA 2IPXA 4M83A 2CVOA 1B3BA 3MWDB 5IDYA 5CR9A 1WY7A 3ZD7A 2FP3A 2BCEA 3IKTA 1OIVA 3B48A 4PYLA 2C2OA 3EYWA 1FRZA 1N25A 2VSOA 4JL6A 3S6JA 4YCMA 1X8LA 5BWOA 1XZJA 1VKZA 5C8ZA 1UKZA 3CN9A 4Q6BA 1V9LA 2C3UA 2IHZA 3Q3GE 4K6CA 2OZLA 2HOQA 1UBKS 1W5TA 2QW1A 3Q3JB 4Y2TA 1L9XA 2NU8B 1NOIA 3DB2A 5AKZA 4JP2A 2YFKA 4MKXA 2OQVA 2OV1A 2BFBA 2PO5A 4E6PA 2PX4A 5H1YA 2GYUA 3EZFA 3MFYA 1KY2A 2ZRQA 3JALB 4Y6SA 1G8JA 5BV0A 1X7ZA 2IUTA 1O6ZA 1IAQA 2B69A 4V1CI 3ISJA 5J4KA 5LCXA 3SJZA 3W9YA 1WMBA 4QTUB 2GPWA 2NQTA 2WVAA 1FRNA 4J0IA 2ZJYA 4P54A 1UP4A 5JSFA 3GBSA 2WR8A 2FFQA 4BNXA 2NQ2C 2Q6LA 1GHTA 4PYOA 3BFVA 2H7CA 2C2WA 1VIYA 4HZUB 4ND5A 4TXNA 1G8MA 4X1KB 4UASA 3ELWA 2WF5A 1F06A 5TR9A 5JYCA 4G8JA 1EM6A 2CLOB 1ZJYA 4WXMA 4OQLA 2PX8A 3WWDA 4HB4A 1KH3A 1DARA 3CLRD 1NVBA 3W5HA 3I3OA 2PR7A 4P8RA 1XEAA 2GZAA 2OFXA 4U8HA 4HZGA 2YV3A 2DR3A 4CEIA 2VWGA 2Q3CA 1HF3A 3WQHA 1SEPA 3KTDA 4M0LA 3NHJA 3BDAA 1TIBA 2W37A 4EX7A 1YTUA 2F3TA 2WTUA 3SFZA 3NH6A 1OXSC 3EW9A 1Z56C 5FULA 1HK7A 4UZEA 1A7KA 1Z2DA 2Q6IA 3HY4A 3P0IA 4DR5B 3PI7A 4Z99A 3LCUA 1OH8A 4B33A 3AIIA 3DEJA 4NFHA 1RWVA 5JY6A 1I1OA 5KYYA 2CVPA 4ZA2A 1T0UA 2FMIA 2QVXX 4O4LF 4QWWA 4A8HA 4B45A 2QRKA 3DP9A 3P2KA 5KCMA 1H8HD 5AVWA 1RXVA 1RLTA 4GX2A 4ZRMA 1ZG3A 1JWLA 3QBJA 3AH8A 1E3SA 3EIEA 1O8CA 3FPFA 3HO6A 1WBDA 4UU8A 2AHRA 2D5AA 2I03A 4GI5A 5BV2P 4C29A 4TMVA 2CN1A 1NJ2A 4ADSG 5BSMA 3DBHA 4URXR 1D8TA 3AVUA 5A1TA 3LY8A 1GZVA 3V1UA 5AJYA 3BWVA 3VKVA 1MT0A 1EJ6A 3KJQA 3H0KA 3E3LA 2YZNA 2VJOA 2B1GA 2QE6A 1OV4A 1JSLA 1XQ9A 5LPNA 4MVJH 3GDHA 3C45A 1ADYA 5JJLA 1GU1A 3RFVA 1CULC 3S28A 4XIIA 2QNBA 1Q0TA 1NNI1 1HZZC 5CEEA 1KIAA 1XUOA 1C3VA 3OU7A 4GPAA 4U9UA 3FTNA 4OQPA 4EPWA 2JFNA 4P4GA 2ZJZA 2O05A 2XAAA 1JDJA 3CWZA 3OICA 3OJOA 3ONFA 5BQPA 5B7PA 2I99A 4BJ3A 3RKUA 1ZQ9A 1KHHA 1ENOA 3WYAA 4OXXA 3GRPA 5E9JA 2ZUCA 4HMQA 5L7YA 4HNHA 4B3SB 2I2BA 4GUDA 5K09A 1XZQA 2WTAA 2Q1TA 3A6HA 2GO1A 2VYVD 1TVEA 1GEEA 1Z0ZA 2ZPAA 3JARA 4ILEA 1L4YA 1O77A 1AK1A 4B44A 1E8MA 1PEKE 1LVGA 5C0OE 4Y6RA 2F4NA 3O4JA 3QXHA 3HB7A 1WABA 1JFFA 5J3JA 2PRIA 4Q3EA 1NUSA 1BSVA 2X5OA 3EG5A 4MX8A 4AO8A 1M6NA 3AGPA 2BFBB 5IF9A 3GEGA 1BCSA 5JEEA 1VIAA 1BGWA 3ANMA 3G5UA 4I2NA 5DIFA 3K6RA 1G7TA 3DBRA 1G8SA 3WK8A 4JI7B 4NFYA 3PX3A 3FLMA 3U1BA 1PGQA 1ZICA 2YJZA 4FFBA 4FR5A 4RPJA 3PT9A 1XYGA 4B76A 4CMHA 5BWBA 5CYGA 3GOHA 3C1AA 3KQUA 2XA9A 1AKUA 3GIDA 2O57A 3O9ZA 1GQOA 5AK6A 5AVRA 5C9ZA 3D7RA 3KT3A 1XVTA 4L16A 4C4SA 4AROA 3NANA 4LQCA 1I5OA 4S12A 1FP2A 1J97A 5BNTA 1ZSYA 2P2YA 2HHHB 5F5NA 4DDMA 3KSAC 2J30A 1IHDA 5HJ7A 3AEXA 3KDAA 1JAHA 3HDQA 3URMA 2OD2A 4HPXB 5HBRA 4RHEA 3REFA 2QSYA 4IQ4A 1OSNA 1Y9JA 1BE6A 1MTZA 4IDDA 3VR3A 1GQYA 1AK2A 3MIZA 3SVTA 4TKZA 5CITA 2B3DA 2PUJA 1G5IA 3H2KA 2PRYA 2QT1A 1N9GA 4WJZA 3EJWA 1Z22A 3RPEA 3A6FA 2R5WA 5DGIA 3RNOA 4OFXA 3D8UA 1JFVA 1NM5A 1ZI6A 3HZZA 2NAPA 2ACEA 2IFTA 2I4TA 3L0DA 4LIPD 2Z43A 4H7HA 2H4ZA 3T8YA 2P6RA 1N7JA 1PX0A 1CDOA 1JHYA 1UZMA 1EFVB 2OL4A 2Q4BA 2YXBA 3CF4G 3PBKA 4XIYA 5M3BA 4ZT7A 3R3SA 1F20A 6NULA 1NVWQ 9MHTA 3QLUA 2M6KA 1RFGE 4MUBA 2D59A 1RLOA 1DG3A 2PRZA 3JQ8A 2XDQA 4JEHA 2ZFUA 2W00A 3NH9A 5CA1F 4FMDB 5H7XA 3ZPXA 1II8A 4NATA 4NVRA 3RC7A 1Z4PX 5BMOA 5BN5A 2Q1WA 2J9ZB 1HUQA 2ZE7A 4HN2A 1KQGA 4IRMA 3L1HA 3HB5X 2EKQA 3AI3A 3ESCA 1T5BA 3PB3A 4KJXA 1GAWA 3PA6A 2JDIA 4PC2A 4DCJA 4F2HA 5JZMA 2H17A 4UAGA 2QAJA 3SGLA 2VQFB 3N3BC 3QJ5A 1FYDA 1NF2A 2IP4A 4F46A 3C97A 3VAAA 5D3MA 2JF0A 2HV9A 2G08A 2C9DA 1DEAA 1HBJA 1W5FA 5SYNA 1E2NA 1SUCA 2F9LA 2Z5LA 3OEHD 4DR3B 1ST3A 2OY0A 4H1WA 3H1PA 4N5HX 4UREA 3ERCA 3HKCA 2IY8A 4LVOA 4P84A 4AF6A 1F60A 1VG1A 3F1LA 2J3QA 5ADUS 5B6JA 1C3LA 2BFPA 3L5OA 1QFYA 2YQ5A 1CUHA 1LVUA 3D3QA 4MITA 2O23A 1G17A 1MO4A 4MUXA 1ZFNA 1XCOA 3AESA 3H1GA 1NSTA 4X91A 5LA6A 3TLXA 3QXCA 2VPWA 4DV6B 4ZEVA 1GPKA 5BMVF 2YNMA 1EX1A 3U3OA 1TCVA 5K05A 1R6XA 2CHUA 3H1EA 4QSMA 4YCBA 2H65A 1RR6A 1Y1QA 4MVJD 4P2BA 5JRDS 1B8PA 1QF9A 2JHAA 1FL9A 1FJHA 3NOQA 4BMDA 5E1BA 2Q8QA 3OM0A 4OGFA 5HUQA 4UNIA 2OO7A 4TL9A 4WDQA 4P4TA 2KBEA 3HJRA 3TQOA 3Q11A 3W06A 4B0PA 4AYXA 4IJKA 1ODCA 2F9FA 1HY3A 3ZGXA 3FD8A 1EGMB 2Q5IA 4WNYA 1N2BA 1U31A 5EMMA 2IX3A 2XKJE 3H18A 3OQIA 1FUYB 2HU7A 3LW7A 2IYYA 4K9DA 4N5NA 4RLSA 4OBWA 3I01A 5COBA 3RS7A 4FLFA 1K8YB 3UK1A 1NN5A 3T35A 4D99A 1HL7A 2QJWA 3NATA 3W79A 3P97A 1UDBA 1T5TA 1VP3A 2BFEA 2VQ6A 3A28A 3NETA 5ED4A 1M34B 2W22A 4IDBA 4LJYA 1VKRA 1KMCA 2GCNA 4IX1A 2YN2A 4NULA 4QVKA 2I4MA 1XRLA 1PAUA 4GLOA 4IF6A 3VO9A 4Y2YA 1Q91A 1XMIA 1EWVA 3S99A 3VV3A 3CUWA 4F71A 5HZMA 2X7HA 2QG6A 1BROA 2BN4A 4ZYZA 2ZRGA 2XVXA 2ZVJA 3C7DB 3G0IA 4P3NA 4Z4QA 3KJIA 1COZA 3EDYA 2HA0A 4RQTA 1AGXA 1BRTA 4NIMA 1E59A 2JKVA 4EA8A 4WIAA 4FFVA 1RIIA 4R9UC 2KX7A 2QX4A 1LBTA 4L2IA 3V2IA 1GFIA 3BICA 1R9NA 4CM5A 3K5WA 3VR5H 3EDQA 5AI5A 3O2JA 1DPFA 3ND9A 4QPJC 4C5CA 2J0SA 1GTVA 5JD4A 3FCCA 4J4BA 1I13A 4JLUA 3VHLB 4H60A 4YPOA 1ZUNB 1GAQA 1NZJA 2C42A 1UPUA 4RJKA 3WRXA 4CTOA 2GEVA 3SPXA 4DCVA 5JZSA 1SXJC 1Q20A 3E3NA 4MWTA 3IELA 5IARA 3JW8A 3O73A 4X3CA 1G55A 3BWMA 4HDAA 4WA7A 1N7HA 3IKMB 2H29A 3RVBA 1A9XA 1MRSA 5KOYA 3C16C 3N07A 4BKRA 4V1CA 2OZEA 1PSZA 1KQOA 5H3CA 2HPAA 3OQBA 3GWGA 4N49A 4EBFA 2UVDA 1DX6A 4KPYA 1J1UA 4LF4B 2IOFA 5YASA 1Z34A 3DOEA 3T3HA 2HRRA 5SY4A 4MVWA 3IBFA 2DGDA 4RHUA 4BAZA 5A1JA 3GN2A 2EW8A 2PUEA 1I4WA 3QKSA 3CMCO 5H5JA 1LH0A 4OB7A 2C7PA 1CY0A 1MOPA 1R0RE 2FSVC 5IEBA 4EHFA 3IMKA 4RM2A 3CLKA 1TUIA 1PR4A 3D0QA 5EIHA 4G0QA 4LOJA 2CHGA 2O6HA 1BA3A 4CMCA 3JWHA 3BMQB 2P75A 4X8LA 2X9GA 4DA9A 5G0WA 8ADHA 4DV1B 3IAXA 4N39A 5EUBA 2CLFB 4GICA 3RARA 5JG7A 1VG9B 2X0NA 4ML3A 5LP6B 3GEMA 2AIRA 4EYKA 2D00A 1AF4A 3I5MA 2J3JA 3K16A 3NUGA 3KM0A 4M3NA 2BYTA 1K6MA 3KT6A 5K8VA 4WZBA 4DJEC 4F9TA 1HNWB 1DOHA 3TIGA 4N65A 5DBEX 3KVVA 1ZRMA 3A26A 2JHCA 2PBFA 4I3HA 1WSAA 3V1LA 1KZYC 3FBWA 3G1WA 2C04A 3OZXA 3TKYA 4YAIA 5LZ5A 4AZ3A 3AGQA 3FSJX 1U0NA 4ZCPA 3BJEA 4RD3A 3BIXA 2WYOA 3CRZA 4DLLA 3CUUA 3UXMA 1XTPA 2AOUA 4EARA 1T15A 2Z1MA 3HDJA 4WAUA 3NWJA 2EL9A 2FQ1A 3T6KA 4W9NC 2I2XB 3D0OA 4R84A 1LK5A 3HCWA 4DBLE 4E13A 4TN5A 2I87A 5BQ5A 1BWQA 1U5CA 1WDLA 1GCOA 4IVPA 2DP4E 3FOBA 3GH3A 3HLKA 1AHHA 5FBQB 3WO1A 2O50A 1ULUA 2ZQ5A 2G82A 4LYHA 1OLSA 1UWLA 2RAPA 2A5GA 3LWBA 1N5LA 3U31A 4BEWA 1K3TA 1AKQA 1XFAA 1SB9A 4G25A 4HH1A 3GD5A 2C57A 4JQCA 1HDEA 4UHKA 5BW6B 3QLVA 1H94A 1Z2AA 5GJBA 1KDRA 4NCKA 3NAGA 4M99A 1HETA 3TW4A 2EX1A 4EPXA 2BEKA 1X14A 2MOKA 3WGGA 1AMUA 2RGRA 3OJXA 1CFZA 3W0LB 4HDMB 1JB1A 2NUTB 4BMYA 1AVTA 2UXBB 3FYTA 2JLRA 2AKAB 3ETDA 2HJGA 2PEYA 3QVXA 1EP9A 1VLMA 4UKDA 2GTHA 3L8DA 3PXAA 3UB4A 3HBAA 4QEKA 4I66A 4A8JC 5K4AA 1IYZA 5KHAA 4PXYA 2OYRA 4F4HA 2V7UA 5CUQA 1D4FA 5T64A 4Q9IA 5F2NA 1QPZA 3NHZA 3UIEA 1THGA 2WJIA 3K3PA 4PC6A 3F71A 4O59O 2CJWB 4TTAA 4QHSA 4AJHA 2WJ4A 3AU8A 1JWBB 3DV2A 3R24A 3R3YA 3H5NA 1EIWA 1B0AA 5J2UF 3ZWPA 3DFZA 2X4GA 4ZI7F 1P7VA 2HMWA 5LP6A 4TZKA 2G25A 1TPYA 2C4MA 3O3NB 5EXDA 5AVOA 4PQEA 3CZMA 3G8BA 5FO0A 3P0JA 3ZD9A 1EZ4A 5G1NA 3ESBA 3STTA 3WGTA 2K7ZA 2QI9C 2BKAA 5CB8A 1L4KA 1XHFA 2QTMA 2R6GA 1QONA 1GPH1 3IQEA 3NAMA 3IALA 4JHLA 1GLNA 1WNTA 4FWIB 4XX0B 3IV6A 3N8NA 5TV2A 2HW8A 4QLOA 3CO0S 2NP7A 2ATVA 1BRMA 1A8IA 4HUQB 3N5KA 3ZWCA 3MJVA 4JLPA 2REQB 1K2VN 1Y7PA 1J9GA 4GP9A 5LR6A 3F9IA 2P2CA 3W3ZB 3A25A 3PJDA 3THYA 4NZPA 1CNMA 4DF3A 1B76A 3WRYA 1IXRC 3HWSA 2IODA 3KO8A 1RLIA 2AWNA 1IWPB 1STOA 1U9CA 2JKYA 3KTAA 1M2KA 2ZJ4A 4GHWA 4OJKA 5EE3A 3CRMA 4K46A 1R4NB 1CUCA 2W6JA 1U0EA 3LKZA 3P52A 5IBQA 3T4EA 1M0TA 1QHEA 1E0KA 1V5IA 3DT6A 3QU9A 2JA2A 3DP7A 4KLCA 1M2OB 1SHUX 3D8HA 4FGSA 1C81A 3FVQA 4KPFC 2ZUWA 3DOHA 3ZE0B 4PVCA 4KHPB 3ZKWB 1TO2E 4RSGA 5DYIA 2XUKA 3WDSA 3UGJA 4S1PA 3TSZA 5ED0A 2PY6A 5F21A 4GEKA 1G20B 4WY5A 1C8LA 1SZDA 4FOOA 1GNLA 3HBJA 3PWSA 2RHRA 1HSZA 1L7DA 4L5IA 2BHRA 5LM3A 2ODPA 1CY4A 1H3NA 2QN3A 4IM7A 5BUQA 4DT1A 2A1UB 1NJ1A 1TUBB 4GE3A 3D1LA 1L5YA 4TV9B 1JMYA 1KVUA 3A3KA 3DE2X 3OY7A 2KI5A 1GZUA 3DBLB 1XVAA 4HTFB 4CF7A 2AW3A 3LX6A 1R37A 3G5AA 1OGIA 4H7JA 1A9PA 4ERXA 5FNZA 2UYQA 3SVLA 1X8JA 4CHGA 5U9CA 3D6JA 4RVNA 3K2EA 3RTEA 4JFAA 5L8VA 4ZQBA 4XOIA 3H5VA 4IJMA 1PT9A 3F9CA 4WECA 3BMOA 1ZN9A 2NSJA 4BGIA 1USGA 2IE0A 2PZGA 4WD3A 1MH1A 5REQA 3L8EA 1G9SA 4TKVB 2PGOA 2C3YA 3R20A 4U7HA 3BH7A 2ZYRA 1WMDA 4WNCA 1YA6A 4PO8A 1VGVA