1G68A

Pse-4 carbenicillinase, wild type
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
266
structure length
266
Chain Sequence
SKFQQVEQDVKAIEVSLSARIGVSVLDTQNGEYWDYNGNQRFPLTSTFKTIACAKLLYDAEQGKVNPNSTVEIKKADLVTYSPVIEKQVGQAITLDDACFATMTTSDNTAANIILSAVGGPKGVTDFLRQIGDKETRLDRIEPDLNEGKLGDLRDTTTPKAIASTLNKFLFGSALSEMNQKKLESWMVNNQVTGNLLRSVLPAGWNIADRSGAGGFGARSITAVVWSEHQAPIIVSIYLAQTQASMEERNDAIVKIGHSIFDVYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE PSE-4
publication title Insights into the molecular basis for the carbenicillinase activity of PSE-4 beta-lactamase from crystallographic and kinetic studies.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 98
structure length 266
sequence length 266
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1g68A00
1KE3A 2V20A 2ZM8A 5EPHA 3VP0A 3VP3A 1TDGA 3C7VA 3ITAA 4Y0UA 1NYMA 4ID4A 3Q81A 5F1FA 1IELA 3PBSA 5DF9A 4KZ9A 3VFFA 2EXAA 4GKUA 4XUZA 3HVFA 4KENB 3ZG8B 2G2UA 1JWVA 2HDQA 4LENA 4ZAMA 1K4EA 4JXGA 5FQ9A 3MXRA 4P85A 5IHVA 3BFEA 1L0DA 1XPBA 5JYOA 4ZTKA 5BOHA 3MZEA 3O3VA 1PWCA 2H5SA 1LL5A 2JE5A 4QHCA 5EOOA 1M40A 5FQQA 5FQJA 5HFOA 5TFQA 2Y2GA 3IWIA 4MNRA 4DXCA 4P0MA 1G6AA 3N6IA 4C6YA 1XA7A 4BQMA 2JC7A 1FCMA 3IF6A 4E3JA 3OC2A 1KE4A 1IYQA 4OONA 1KGGA 3MZDA 3BLMA 1EI5A 1CI8A 4QB8A 2WAEA 1KE0A 4OLDA 2XD5A 3A3IA 2P9VA 1YLZA 3UNWA 3ITBA 1IKIA 5KZHA 4GB7A 3E2KA 4KQRA 5GLDA 2R9WA 4RVAA 3UPPA 1PIOA 3OPLA 4GOGA 1AXBA 3IF5A 3Q82A 3ZG0A 2X01A 3UE1A 3MFDA 1L2SA 3C4OA 1K57A 1YLYA 4JLFA 3V50A 4S2NA 3HUOA 2OV5A 4D2OA 1RGYA 3MKEA 4R23A 2ZQ7A 1YMSA 4R0QA 4BD1A 2C6WB 4BJPA 4KZBA 4DF6A 3FZCA 1PWGA 1MBLA 3ZGAB 2Z2LB 2G2WA 5J8XA 2JBFA 1ERMA 4WMCA 1BUEA 2B5RA 3HLDA 4NETA 4X55A 1GA9A 2C5WB 4K91A 4WMCD 1H8ZA 2PBYA 3OPRA 5EUAA 1NJ4A 1L0EA 5CGSA 1E25A 4IVIA 2WKIA 5DF8A 2HP5A 3QHYA 1SDNA 3UPOA 3GRJA 2EX9A 2WUQA 2Y55A 3S22A 3AGFA 2ZC5B 3FWLA 3OZHA 4U0XA 4BL2A 1MXOA 2ZD8A 3C4PA 4QY5A 3BFCA 2Z2MB 1KGFA 1QMFA 1K55C 3IXHA 4OP8A 4OPQA 3VOYA 5CEDA 5GLBA 3C7UA 4P87A 4RX2A 1PWDA 2IWDA 1L0FA 4WZ4A 5CXWA 3SH9A 1JWPA 1MWTA 3ZG9B 1MPLA 5EOEA 4OLGA 2WGWA 3HLBA 1O7EA 3SS3A 2ZMAA 1NZOA 4MBFA 2CC1A 1HZOA 2EX8A 3IXBA 1MY8A 1YLJA 3N7WA 3IXGA 4L0LA 4OPRA 1FR6A 2DCFA 3ZVTA 4GNUA 4S2MA 4E3MA 4O7DA 4S2PA 5FI6A 2J9OA 5CTMA 2Y2MA 3VMAA 1IKGA 1XA1A 3GV9A 2RCXA 3WS2A 1BULA 1ES4A 3IHAA 2WADA 4ZJ3A 1KVMA 1C3BA 4N92A 2Y2JA 5AQAA 3V3SA 4IEDA 4Y0TA 3W4OA 1ZG6A 4S2KA 1PZOA 2OSUA 4ZDXA 3G35A 1N9BA 3IF6C 3IQAA 4RA7A 1FSWA 1K4FA 4QU3A 1BLCA 1NRFA 2XGNA 1K38A 3IH9A 5E2HA 1S6RA 1GA0A 5CHUA 4OOLA 5E2FA 4PM6A 1KDSA 2DRWA 3CMZA 3NI9A 3UE3A 1E4DA 4ZJ1A 3N4IA 4DDSA 3NCKA 1LL9A 3AGEA 5F83A 1XKZA 3HBRA 5E43A 4KZ4A 3HUNA 1TEMA 3M2KA 1MWRA 3HLCA 2IWBA 4UA7A 1S0WA 1YM1A 5GHYA 5KSHA 3W4QA 3OCNA 5CERA 5TGFA 3CJMA 1BLPA 4R3BA 1IYPA 1K57C 3IT9A 2J7VA 4OOYA 3VP1A 3GR2A 4E3NA 1IEMA 4A5RA 4S2NC 3SOIA 4N1XA 1Z6FA 3BECA 5DF7A 1KGEA 2XEPA 5F82A 2H0YA 1JVJA 4PPRA 1JTGA 3PAEA 4MEZA 1LLBA 1NYYA 4JBFA 4X56A 4B88A 1J9MA 3ZDJA 1XX2A 5DVAA 3S4XA 1GHIA 3LCEA 3VOZA 1FR1A 1XXMA 4BLMA 1PZPA 1VM1A 3ISGA 4FSFA 3NIAA 3DTMA 4IBRA 3UPNA 3P09A 3HLFA 2EFXA 3UN7A 1FQGA 4E6WA 5CTNA 2ZC3B 5E2EA 3G30A 5HAPA 2ZM2A 4JXWA 2VGJA 1RGZA 1W7FA 4ZJ2A 1RP5A 4OQIA 1L0GA 3RXXA 3I7JA 1PI5A 3V3RA 3VP4A 3ZG7B 1W8QA 4N9LA 4PM9A 2ZQAA 2QZ6A 5EE8A 3VFHA 1ZKJA 3WRTA 1KDWA 4IVKA 2XF3A 4BENA 3G2ZA 4DE1A 1VQQA 5FATA 2Y2HA 2FFYA 3FKVA 4OOMA 1ZC2A 3TSGA 3W4PA 4DE2A 5DTTA 3S1YA 2ZLYA 3SS4A 1IYOA 4YINA 1HTZA 5EVIB 3BFGA 4DXBA 2Y2LA 3HLGA 1NY0A 4X69A 5L2FA 3VSKA 3M6HA 3G32A 5JYPA 2WYXA 4BL3A 2HP9A 5HW3A 4HESA 1LI0A 4FD8A 3IHBA 5FI7A 1SHVA 1ESUA 1EWZA 4OPYA 4Y0OA 1I2WA 4GDNA 4UA6A 5A90A 1YT4A 3B3XA 3FKWA 4JF4A 1YLWA 1K6RA 2HDUA 2Y2OA 2XFSA 1U60A 3P98A 2WZZA 2OLVA 2PU2A 4R4RA 5M1AA 5KSCA 4Y7PA 4EQIA 1CEGA 1WYCA 3OCLA 4KG5A 4X68A 5FQKA 5CHJA 2EX6A 3TOIA 1LI9A 4FCFA 5F1GA 1SKFA 3G31A 4K0WA 4X53A 4WEJA 4U0TA 1Q2PA 3PAGA 3IXDA 5HL1A 3MKFA 1HD8A 4DRTA 3BLSA 3Q7VB 4PM8A 4LV1A 3PBRA 4RYEA 1K56D 4PM7A 3UO9A 2ZQCA 4UHUA 1PW1A 3N8SA 5GL9A 2X71A 4B4XA 5FSRA 5HAQA 2XDMA 4UA9A 1NZUA 4U3TA 4JXVA 4S2IA 2Y4AA 3QNCA 4OKPA 2Y59A 3UY6A 4KZ6A 4JF5A 3UDXA 3DWZA 3ZVWA 3V39A 4R1GA 3BFFA 4OQHA 5CRFA 3PBOA 3A3FA 2HPBA 3OPHA 1BSGA 4GD8A 3RXWA 5AQ9A 4E3IA 4KZAA 5EECA 1KVLA 4JPMA 5FA7A 1K54C 3PBNA 4JKTA 4GZBA 4N1HA 1CI9A 2ZQ9A 1I2SA 3SH8A 1GHPA 1IYSA 4XUXA 3W8KA 4EV4A 4WELA 3GSGA 5EVLA 2Y2NA 5TR7A 4E3KA 3PBTA 4LV0A 3WS0A 4RX3A 5FASA 3O88A 4X6TA 3ZG5A 4KG6A 5CECA 3DWKA 1YLPA 3A3JA 3NDGA 2A49A 1GCEA 2DNSA 2J9PA 4WM9A 1LHYA 3V5MA 2ZM0A 5HAIA 1FOFA 4P6BA 4F94A 2XH9A 4KG2A 4XXRA 3WS5A 3LY3A 3BEBA 4S2JA 4OH0A 1FSYA 3AGDA 4C75A 2XLNA 3WRZA 3HLEA 4EBPA 5M19A 1SDEA 1HVBA 3C5AA 2Q9NA 4JXSA 5AQ7A 1CEFA 1MKIA 2FFFB 2Y2IA 4ZBEA 1DJCA 2EXBA 5FAOA 5GHXA 2ZQDA 4OP5A 5EVIC 5G18A 5CHMA 2XR0A 3PTEA 4QD4A 3UDFA 3ZFZA 4GN2A 3IF6B 4NK3A 1K54A 1ONGA 1O07A 1W5DA 3IH8A 1SCWA 3DW0A 4MLLA 1XP4A 3WWXA 3Q1FA 2P9VB 2IWCA 1W79A 4KZ8A 2H0TA 4GD6A 5DTSA 4EUZA 2ZJ9A 4PM5A 3CG5A 3IWQA 4KQOA 3WS1A 1ES5A 1MWSA 2HDSA 4K0XA 3NY4A 3VSLA 2Y2QA 5D3OA 2ZC4B 3RJUA 4E3LA 2H10A 5U47A 4EWFA 4N9KA 1DY6A 4KQQA 4WBGA 2Y91A 2Q9MA 4E6XA 4LCLA 4OQGA 1H8YA 3ZCZA 4CJNA 4Z9QA 5KMWA 1N4OA 2BLSA 3G4PA 1ERQA 1I5QA 1TDLA 3MXSA 4YFMA 3D4FA 4DE3A 4S2OA 1PYYA 2XK1A 1BLSA 3FYZA 1PI4A 3NBLA 3HLWA 1Q2QA 2UWXA 2XD1A 3TG9A 5A93A 1GHMA 2JCHA 3BM6A 1YQSA 2QMIA 4GDBA 5EVIA 5FQIA 3BYDA 3ZHHA 1BTLA 4WEKA 5EVID 4EBLA 5A92A 3EQUA 1Y54A 3NDEA 1M6KA 1TVFA 4BD0A 4HBTA 5FAPA 2Y2KA 4WZ5C 3N8RA 2PU4A 5AQBA 4PMAA 2WZXA 4MBHA 2GDNA 1BZAA 2WKEA 3Q7ZA 2XFTA 3FV7A 1XGJA 5CGWA 2HP6A 4UAAA 3M6BA 3WS4A 5GLCA 5HX9A 4FH2A 2I72A 3BRMA 3MZFA 1G68A 1QMEA 2A3UA 4QJGA 4DE0A 2EFUA 4Q8IA 2QPNA 1W8YA 2WGWB 5FDHA 2XQZA 1NXYA 1BT5A 1PW8A 2WAFA 1FCNA 2VGKA 1BLHA 3HL9A 3EQVA 4JF6A 4R3JA 3ZNTA 3G34A 2WKHA 3GTCA 1K56A 2RL3A 3A3DA 1ES3A 4QY6A 1YMXA 4KZ5A 3SH7A 4B4ZA 1FCOA 4M3KA 3BFDA 1DJBA 1K6SA 4HBUA 3GQZA 1ZG4A 4KZ7A 4E3OA 2ZQ8A 5I94A 4R4SA 4OVDA 3E2LA 3LY4A 2WK0A 1MWUA 3Q7VA 4CPKA 5FAQA 5M18A 5FI2A 5FQMA 1EROA 4WYYA 1RCJA 4MBKA 5GLAA 4FH4A 3VP2A 1YLTA 2V1ZA 4WZ5A 5A91A 2E8IA 3G2YA 3HUMA 2OLUA 2ZC7A 4C3QA 3SS5A 4OQ0A 5HARA 1ONHA 2V2FF 4KZ3A 3Q07A 2EX2A 1JTDA 1CK3A 3N8LA 4H8RA 3NC8A 4LV2A 3GMWA 3ZNYA 5E2GA 1ESIA 2HDRA 4LV3A 4S2LA 1WE4A 3JYIA 5CEBA 1H5XA 3M2JA 4LCMA 2ZC6B 1JWZA 3LO7A 3MBZA 5DTKA 3UDIA 2BG1A 2X02A 4EBNA 1K55A 4DKIA 2WGVA 3QNBA 2Y2PA 3A3EA 3CZDA 2J8YA 2P74A 3O87A 1WYBA 1ALQA 4HEFA 1XGIA 2WGIA 4DDYA 3GVBA 3IWOA 5GHZA 1DJAA 3O86A 2R9XA 4OPZA 3PBQA 1E3UA 3LEZA 3OPPA 5CGXA 1ES2A 1K25A 1E3UD 3UE0A 1OMEA 3HREA 4IBXA
chains in the Genus database with same CATH superfamily
1KE3A 1ZHHB 2UV0E 3PBSA 3T1XA 4KZ9A 4XUZA 4MN6A 3ZG8B 2HDQA 1JWVA 1V9YA 3LIDA 5IHVA 1OTDA 2WKQA 1Y28A 5BOHA 3VE3A 2KLIA 1PWCA 2H5SA 3IX4A 2NUPC 5FQJA 1XA7A 2J80A 4BQMA 3IF6A 1F5MA 1KE4A 1EI5A 4QB8A 2WAEA 2XD5A 3A3IA 1YLZA 1IKIA 5KZHA 5FEFA 3VOLA 5HWVA 5AVEA 4II7A 4JGRA 3ZG0A 2X01A 3MFDA 1L2SA 2HZ5A 1TD5A 3V50A 3NULA 3R7WB 1YMSA 4R0QA 2C6WB 4KZBA 1D06A 3ZGAB 2G2WA 5J8XA 3BW6A 4WMCA 4EU0A 2C5WB 1F9IA 4O0PA 1P9WA 3OPRA 1OTIA 3OBFA 1E25A 5DF8A 2HP5A 3QP5A 1SDNA 3S22A 3OZHA 3FWLA 1AWIA 4LGWA 3U2AA 2Z2MB 1KGFA 5CEDA 4RX2A 4P87A 1L0FA 4MMNA 3SH9A 1JWPA 1MWTA 3E4OA 3B33A 2WGWA 3IS2A 4MBFA 1HZOA 2EX8A 4L0LA 3N7WA 3IXGA 3ZVTA 2EWVA 3MQOA 5CTMA 2W1TB 1XA1A 3GV9A 4KQDA 2RCXA 4Y3IA 3IHAA 4ZJ3A 4N92A 4Y0TA 3W4OA 3A0VA 3G35A 3IF6C 5EM1A 4MN5A 3DBAA 4JGPA 1BLCA 1GA0A 4OOLA 3NHQA 3UE3A 4ZJ1A 3N4IA 3NCKA 2W3FA 3HLCA 1GSWA 2V0UA 1UGUA 3T4KA 1BLPA 5LBRA 4A5RA 3SOIA 5J7EA 5FL3A 2H0YA 1YSPA 2V1BA 4PPRA 4DJ2A 4JBFA 1J9MA 1FR1A 1MZUA 1VM1A 3ISGA 3NIAA 1UWNX 4IBRA 3P09A 2KDKA 3HLFA 2EFXA 2QJ7A 4HHDA 2XRNA 5HAPA 3L7HA 1RGZA 4ZJ2A 3I7JA 1PI5A 1W8QA 3H82B 3MMHA 3TJZC 4R3AA 4BENA 1FILA 4O8GA 3G6OA 2GJ3A 1HTZA 3BFGA 3ZQ5A 5L2FA 2WYXA 4BL3A 2HP9A 1D7EA 2KX6A 1S4SA 1EWZA 2FZ0A 1I2WA 1YT4A 3CPTA 1K6RA 3UB6A 3UB5P 1OJ5A 3P98A 5M1AA 4R4RA 5F69A 4Y7PA 4EQIA 2J3WA 3OCLA 5FQKA 5EFWA 3B42A 4FCFA 3G31A 2XA7M 4R6LA 2XSSA 3IXDA 5HL1A 5HWTA 2W3GA 1HD8A 4DRTA 3Q7VB 3UB8A 5A8BA 4PM7A 2DMWA 4U3TA 2W3DA 5L07A 4JXVA 2BTFP 4F3LB 3UY6A 4KZ6A 4JF5A 3UDXA 3ZVWA 4R1GA 4OQHA 2JKRI 4KZAA 4JPMA 3DTEA 1K54C 4GLQA 3T4JA 1CI9A 2L1MA 3FPVA 1GHPA 4I3JA 4EV4A 5EVLA 3E98A 3MXQA 3PBTA 4LV0A 3WS0A 2OAP1 4KG6A 3DWKA 1YLPA 3NDGA 2A49A 2DNSA 1LHYA 3V5MA 5HAIA 1YSQA 3WS5A 3LY3A 1JNUA 3BEBA 4S2JA 4OH0A 3S7NA 1V9ZA 2XLNA 2OOLA 3HLEA 5AJGA 2Q9NA 1KOUA 1MKIA 5EVEA 4FUWA 5EVIC 2OWHA 5G18A 2XR0A 2W27A 3LI9A 1W5DA 3DW0A 2K7SA 1XP4A 1K0KA 2IWCA 1W79A 5DTSA 4GD6A 2ZJ9A 4KQOA 2HDSA 3VSLA 5D3OA 4E3LA 2ZC4B 4QPRA 1DY6A 4EW7A 2Q9MA 4Y15A 4LPZA 1GSXA 3G4PA 1I5QA 1PYYA 2XK1A 1BLSA 1PI4A 1OTAA 3HLWA 2XD1A 3TG9A 3SZTA 4GDBA 3ZHHA 4EXOA 4WEKA 4BD0A 2Y2KA 3N8RA 1BZAA 3DTIA 4GS9A 2XFTA 5CGWA 2PHYA 4FH2A 2I72A 2LB5A 1NWZA 4QJGA 4DE0A 1VHMA 1GSVA 2QPNA 4R70A 1PW8A 1BT5A 1NRJA 2WAFA 1FCNA 5F82A 3ZNTA 4UQIM 3A3DA 2W3EA 4QY6A 1YMXA 3MJQA 3KSFA 1DJBA 4HBUA 3BY8A 3CUEA 2ZQ8A 4OVDA 3E2LA 3LY4A 4CPKA 4WYYA 5DKLA 5A91A 1VEUB 2BASA 3HUMA 2V0WA 4CLCE 2ZC7A 3DAVA 3VV4A 2HGVA 4G3VA 3T1QB 1JTDA 3N8LA 2INWA 3GMWA 2HDRA 4NXFA 2YKHA 1H5XA 3DTKA 3EGDC 2XA7S 4WL9A 3A3EA 2J8YA 2K31A 4I3AA 3GVBA 1DJAA 3KSGA 2QWSA 4LRZE 3HCYA 3UE0A 4R23A 5EPHA 3VP3A 2JHEA 4Y0UA 1NYMA 2JN7A 4UEYA 3K3CA 5DF9A 2A2LA 3VFFA 3F1PA 4BMWA 2G2UA 1K4EA 1L0DA 5G4ZA 4EESA 3O3VA 1LL5A 4CLCB 2QYBA 4MNRA 4C6YA 1S1YA 1FCMA 1IYQA 1LL8A 3BLMA 3FPWA 4OLDA 2P9VA 4KQRA 1Y4OA 5GLDA 3UPPA 4IHQA 4H6JA 5F5YA 3T4LA 5HDSA 5TJJA 2IA2A 5HWWA 2VV6A 3IF5A 4HOIA 4I38A 1YLYA 4JLFA 5DFXA 3MKEA 2ZQ7A 3LUQA 3FZCA 1BUEA 1X0OA 4K91A 4WMCD 5EUAA 1NJ4A 1TF1A 5CGSA 3TRCA 3GRJA 2WUQA 4QY5A 4ESPA 4OP8A 2P7JA 1WA9A 3MQQA 4HY8A 4WZ4A 3QP1A 5EOEA 3MSHA 1OT6A 1O7EA 2ZMAA 2CC1A 1FR6A 4S2MA 4E3MA 2YKFA 2Y2MA 1IKGA 2ZMFA 3KO6A 1BULA 3WS2A 1IOUA 1XJ6A 1TS6A 4QWOA 1KVMA 4GHIA 1NLZA 2HV1A 2Y2JA 4IEDA 2ZL1B 2PRFA 1N9BA 4HIAA 3IQAA 5G4YA 1FSWA 1K4FA 2XGNA 1K38A 5CX7A 4JGQA 4MDZA 1KDSA 2DRWA 3NI9A 1LL9A 3AGEA 5F83A 3BJNA 3HBRA 1TEMA 3M2KA 4DMZA 2IWBA 5GHYA 2XROA 3OCNA 2PR5A 5TGFA 4O01A 3IT9A 4E3NA 2J7VA 4OOYA 1S4RA 1IEMA 3EOIA 1KGEA 3F1PB 4IUKA 1JVJA 3PAEA 4MEZA 4ETXA 3E4QA 4X56A 4B88A 5FDSA 1XX2A 3IBRA 1GHIA 3S4XA 1VETB 3VOZA 1PZPA 1W63Q 4PKYG 3UN7A 1F98A 3A0SA 2HF6A 2ZC3B 3G30A 4JXWA 1RP5A 2WKPA 3V3RA 1UWPX 4N9LA 1XJ4A 2ZQAA 3VFHA 5EE8A 3H9WA 3WRTA 4EEPA 1KDWA 3C38A 3EEHA 3D3OA 4KUOA 3FKVA 4OOMA 1ZC2A 3W4PA 3S1YA 2ZLYA 4DJ3A 3HLGA 1NY0A 3VSKA 3M6HA 5L8MA 3G32A 3T4OA 2PAVP 3IHBA 1BYWA 3HJIA 4ARZA 3H7WB 1YLWA 5HL6A 2HDUA 2Y79A 1P0ZA 2Y2OA 1U60A 2VZWA 5KSCA 2VEAA 2KOIA 3K3DA 1LI9A 2JKFA 2PT7A 4WEJA 1TS8A 4U0TA 1Q2PA 2Z6DA 4GW9A 3BLSA 3PBRA 4BBUA 4B4XA 5GL9A 4UA9A 4NXEA 2Y4AA 1N9LA 1VB6A 1F2KA 3NOPC 1SZVA 3A3FA 4GD8A 3RXWA 4E3IA 5AQ9A 1OJGA 1I2SA 5EM0A 5HD3A 3W8KA 5TR7A 4WF0A 2G7UA 4X6TA 3K2NA 5CECA 3JVUA 3A3JA 2J9PA 4R38A 4WM9A 4P6BA 2XH9A 4KG2A 4HQAA 3S7PA 2LB9A 4WN5A 3WRZA 4LRYC 4NXBA 1SDEA 1OTEA 2EXBA 5GHXA 1OT9A 1ACFA 4QD4A 4GN2A 3IF6B 4NK3A 1K54A 1O07A 4MLLA 2A24A 3WWXA 3QP2A 4EUZA 3CG5A 1MWSA 4K0XA 5U47A 2W1RA 5IT5A 4E6XA 4LCLA 5HDCA 4CJNA 3RFBA 1N4OA 4YFMA 3D4FA 4DE3A 4S2OA 3FYZA 2HJ9C 4HH3A 2VGLS 5EVIA 3R4KA 1BTLA 4EBLA 5A92A 3EQUA 3NDEA 1L3LA 3EGXC 1M6KA 2PU4A 1MC0A 4I39A 2PD8A 5GLCA 5HX9A 3BRMA 1CF0A 5F68A 1QMEA 5HSQA 4Q8IA 4E04A 1W8YA 2WGWB 3IS2B 5FDHA 4YWZA 1BLHA 4X25A 4XT2A 4KZ5A 3SH7A 1FCOA 2ZOHA 3BFDA 2K2NA 4HJ3A 2VA0A 5I94A 2WK0A 3LICA 3T50A 5M18A 3VP2A 5GLAA 2V1ZA 3SS5A 4OQ0A 3T1RA 5AVFA 4KZ3A 2V2FF 1TS7A 2P08A 2EX2A 3NC8A 3ZNYA 3ULFA 4LCMA 3UB7A 1PFLA 4DKIA 2Y2PA 3TE8A 2P74A 4HEFA 4DDYA 3C30A 3IWOA 3O86A 2R9XA 3PBQA 1E3UA 3LEZA 3OPPA 1K25A 3F1OA 2V20A 1OTBA 2ZM8A 3VP0A 1TDGA 2O9BA 4ID4A 1IELA 2L4RA 3F1NA 2EXAA 3HVFA 4KENB 4ZAMA 3MXRA 1Z09A 2P04A 3BFEA 4P85A 1XPBA 5EOOA 5FQQA 1M40A 3CLOA 5TFQA 2Y2GA 1G28A 3IX8A 4LFUA 4DXCA 1G6AA 3N6IA 2AVXA 2V9AA 3UB9A 1KGGA 3MZDA 4RQ9A 2E8JA 3CITA 2QJ5A 3ITBA 3E2KA 2R9WA 3OPLA 2EWWA 5L10A 2M7VA 3UE1A 3W2ZA 3E0YA 5HPFA 3B47A 2NUTC 4S2NA 3HUOA 4D2OA 4EERA 5HPIA 1PWGA 1MBLA 4EEUA 2JBFA 1ERMA 2B5RA 3HLDA 4NETA 3CPTB 1OPXA 1L0EA 2WKIA 4WLAA 3UPOA 2Y55A 3AGFA 1MXOA 1YKDA 2ZD8A 3C4PA 3LR3A 3BFCA 1QMFA 3VOYA 5GLBA 3S7QA 3IBJA 1PWDA 2QKPA 2IWDA 3E4PA 4WUJA 4K08A 3ZG9B 1MPLA 1G6OA 1SKOA 3HLBA 1CQAA 1NZOA 3IXBA 1YLJA 4OPRA 2DCFA 4O7DA 4HP4A 3QP8A 1TS0A 2J9OA 3VMAA 4EQ1A 3JVVA 1DP6A 1ES4A 2WADA 3V3SA 4KUKA 4L9FA 1PZOA 2OSUA 4ZDXA 4QU3A 5E2HA 4M4XA 5TBMA 4CLCC 3MQ0A 3CMZA 2VJWA 1XKZA 5E43A 4KZ4A 1S0WA 1YM1A 3CJMA 4R3BA 3VP1A 1IYPA 4X1MA 4S2NC 3P7NA 1N9OA 1Z6FA 3BECA 2XEPA 5F6AA 1LLBA 4HI4A 2ZMVA 3LCEA 3LR0A 1XXMA 2JKTI 4EETB 3T4QA 1LSWA 3DTMA 4B9OA 1ZTUA 1DP8A 3C8CA 4E6WA 1FQGA 5CTNA 2JKTM 2ZM2A 2D01A 1W7FA 4PM9A 2QZ6A 1ZKJA 4DE1A 5FATA 2FFYA 3MFXA 1IYOA 2QHKA 1G5UA 4DXBA 4NG2A 4BWIA 5JYPA 3UE6A 5HW3A 4HESA 4Q0HA 1LI0A 3R7WA 5FI7A 1SHVA 4GS9B 4OPYA 4Y0OA 3QP6A 3V67A 4GDNA 4HH2A 4ZRRA 4NEED 3LR5A 2XFSA 2EA9A 4NKPA 2J3TC 1P9RA 2OLVA 1CEGA 4KG5A 5F1GA 1SKFA 4K0WA 4X53A 3NJAA 1CJFA 5DFYA 4DN0A 3MKFA 4LV1A 4RYEA 1K56D 3UO9A 3LIAA 4UHUA 3N8SA 2VX8A 2X71A 5FSRA 2XDMA 4PAUA 1NZUA 4B93A 2Y59A 4Z1WA 2W1TA 3V39A 1A0KA 1OMEA 5EECA 1KVLA 4JKTA 3LFVA 3T4SA 3EEAA 3SH8A 3O5YA 4XUXA 4WELA 2Y2NA 5DJUA 4G3WA 1DP9A 3FC7A 3CHWP 1FOFA 1FSYA 4EBPA 1HVBA 2VGLM 3C5AA 5AQ7A 1CEFA 5J3WA 4ZBEA 2ZQDA 4OP5A 3UDFA 2L0WA 1ONGA 3PXPA 1T1BA 3LIBA 1SCWA 3RH8B 3Q1FA 1FIKA 2P9VB 4KZ8A 2H0TA 1STZA 3IWQA 3WS1A 3MS6A 3T1SA 4H6JB 3NY4A 4ETZA 3RJUA 4HJ4A 2H10A 4N9KA 2Y91A 3H82A 4OQGA 1H8YA 3ZCZA 4Z9QA 2Y8HA 2BLSA 1TDLA 2H28A 4GJ4A 3NBLA 1Q2QA 2UWXA 5A93A 1GHMA 1YQSA 1T19A 2QMIA 5FQIA 3BYDA 5EVID 2CMNA 4GCZA 1TVFA 4WZ5C 5AQBA 4PMAA 2WZXA 2I9VA 2GDNA 3Q7ZA 4MBHA 3KYZA 3FV7A 4P6ZS 2HP6A 3MR0A 4YNRA 3M6BA 3WS4A 1G68A 2EFUA 3CAXA 4PHTA 4OQIA 1NXYA 3S7OA 4R3JA 3EQVA 3G34A 2WKHA 1T1AA 4L9GA 3GTCA 1K56A 2RL3A 2B02A 2PYPA 4B4ZA 4M3KA 1K6SA 3GQZA 1ZG4A 4KZ7A 4BBTA 1YAXA 3Q7VA 4GHIB 5FI2A 1EROA 4FH4A 1YLTA 5FEGA 2E8IA 2PDRA 5HARA 3UMDA 4F3LA 3OLOA 5E2GA 4LV3A 4S2LA 2O99A 2D02A 1WE4A 3NOTC 3M2JA 1JWZA 3LO7A 3UDIA 1DRMA 2X02A 1K55A 2WGVA 3QNBA 3CZDA 1WYBA 1XGIA 2WGIA 4Y5FA 2VV7A 2JKGA 1T18A 3LEQA 5CGXA 1ES2A 2O0YA 1E3UD 5EV0A 3T12B 3HREA 4IBXA 3C7VA 3C2WA 3ITAA 3Q81A 5F1FA 1NLYA 5IU1A 4GKUA 4LENA 3KSHA 4JXGA 4LLOB 4Q0IA 1W63M 5FQ9A 2Q0OA 3D9YA 1YPRA 5JYOA 4ZTKA 4D60A 4BBVA 3GECA 4I5SA 3MZEA 4QHCA 2JE5A 5HFOA 3RTYA 3IWIA 3PYPA 4P0MA 4ME4A 2JC7A 4E3JA 3OC2A 4OONA 1CI8A 4Y2FA 1KE0A 3UNWA 4CLCD 4GB7A 4RVAA 1PIOA 4GOGA 1XJ2A 1AXBA 1XJ3A 3Q82A 3PHYA 3C4OA 1K57A 4AFIA 2OV5A 1RGYA 2PR6A 3QP4A 4BD1A 4BJPA 4FOFA 4ARZB 4DF6A 3KSIA 2Z2LB 4X55A 1ODVA 1GA9A 1H8ZA 2PBYA 4MCWA 2O9CA 4IVIA 3QHYA 2EX9A 2ZC5B 2B18A 4U0XA 3VE4A 4BL2A 1PNEA 3IXHA 4OPQA 1K55C 3C7UA 3EWKA 5CXWA 3MF0A 2R78A 3BQAA 4OLGA 3SS3A 3FG8A 1MY8A 4I3IA 2VV8A 3CWFA 4GNUA 4EUVA 4S2PA 5FI6A 2M7UA 1XFQA 4CQHA 3LI8A 1C3BA 3BWLA 5AQAA 1ZG6A 4S2KA 1VEUA 4RA7A 1NRFA 1HLUP 3IH9A 1S6RA 5CHUA 5E2FA 4PM6A 2J3TD 1E4DA 1S66L 2B95A 1XFNA 5HZHA 1EW0A 4DDSA 2JKRM 2V1AA 3LGOA 3HUNA 1MWRA 3OOVA 4UA7A 2VK3A 4YOFA 5KSHA 3P01A 3W4QA 2OAQ1 5CERA 1K57C 3T4TA 3UMEA 3GR2A 4N1XA 5DF7A 1JTGA 3U4LP 1NYYA 3ZDJA 5DVAA 2A24B 4BLMA 1LT0A 4FSFA 3UPNA 4Q0JA 4CLCA 5DKKA 5E2EA 2VGJA 4HNBA 3RXXA 1L0GA 3VP4A 3ZG7B 2OWJA 4X1LA 4IVKA 2XF3A 3G2ZA 1VQQA 2Y2HA 3TSGA 4DE2A 5MC7A 5DTTA 3SS4A 2PYRA 4YINA 5EVIB 2Y2LA 4X69A 2V8FA 4FD8A 2VLGA 1ESUA 4Y17A 1IFQA 4IJGA 4UA6A 2ACGA 5A90A 3B3XA 3FKWA 4JF4A 2WZZA 2PU2A 1H8MA 1WYCA 4XT2B 4X68A 5CHJA 2EX6A 3TOIA 5K5BA 3PAGA 3ICYA 5DJTA 2WKRA 4PM8A 2ZQCA 1PW1A 5HAQA 2PD7A 2M1CA 3QNCA 4S2IA 4OKPA 1LSVA 3DWZA 5CRFA 3BFFA 3SW1A 4FTXA 3PBOA 2VKSA 3KYEA 2HPBA 3OPHA 1BSGA 2HJEA 3KYQA 5FA7A 3PBNA 2FH5A 4GZBA 2ZL1A 4HJ6A 4N1HA 5KIZA 1J3WA 2O9AA 2ZQ9A 1IYSA 3GSGA 4E3KA 4RX3A 2W3HA 4LRXC 5FASA 3O88A 1N9NA 3F1OB 3LR4A 3ZG5A 1GCEA 2GNXA 2ZM0A 4F94A 3F1NB 2W0NA 4XXRA 4JGOA 2V8CA 3AGDA 4C75A 4IUHA 5M19A 3BY9A 2Z6CA 4JXSA 2FFFB 2Y2IA 3LYXA 1DJCA 5FAOA 5CHMA 3PTEA 3ZFZA 1S1ZA 3IH8A 1VETA 4PKYA 3PR6A 4P6ZM 3A0RA 3IX3A 4PM5A 2PBDP 1T1CA 1ES5A 2Y2QA 4NXGA 4EWFA 4KQQA 4WBGA 2ZOIA 4G3KA 5KMWA 1ERQA 3MXSA 1D1JA 2MJ6A 3CI6A 3TW8A 2JCHA 3BM6A 5HD5A 1H0MA 3CUEC 3L9KA 1Y54A 3HJKA 4HBTA 5FAPA 5HDDA 2WKEA 3JPUA 1XGJA 4UAAA 3H7WA 5C5KA 3MZFA 4MN7A 2A3UA 3ZYTA 2GZAA 1MKMA 1SKOB 2XQZA 2VGKA 3HL9A 4JF6A 1ES3A 3LIEA 1P97A 1LSXA 4HP9A 3KX0X 4E3OA 1S67L 2ZBBA 3GDIA 4R4SA 5I5LA 1MWUA 5FAQA 5FQMA 1RCJA 4MBKA 3NOUC 4WZ5A 4L9EA 3G2YA 2OLUA 4C3QA 1ONHA 2GX5A 3Q07A 1CK3A 1H3QA 4H8RA 3NECA 4LV2A 1ESIA 5TBMB 3JYIA 5CEBA 5IS1A 2ZC6B 3MBZA 5L09A 5DTKA 2BG1A 5J4EA 4EBNA 3LIFA 3O87A 1ALQA 4Y13A 5GHZA 4UQIS 1PRQA 4OPZA 3BQ8A 3D72A
chains in the Genus database with same CATH topology
1KE3A 2V20A 2ZM8A 5EPHA 3VP0A 3VP3A 1TDGA 3C7VA 3ITAA 4Y0UA 1NYMA 4ID4A 3Q81A 5F1FA 1IELA 3PBSA 5DF9A 4KZ9A 3VFFA 2EXAA 4GKUA 4XUZA 3HVFA 4KENB 3ZG8B 2G2UA 1JWVA 2HDQA 4LENA 4ZAMA 1K4EA 4JXGA 5FQ9A 3MXRA 4P85A 5IHVA 3BFEA 1L0DA 1XPBA 5JYOA 4ZTKA 5BOHA 3MZEA 3O3VA 1PWCA 2H5SA 1LL5A 2JE5A 4QHCA 5EOOA 1M40A 5FQQA 5FQJA 5HFOA 5TFQA 2Y2GA 3IWIA 4MNRA 4DXCA 4P0MA 1G6AA 3N6IA 4C6YA 1XA7A 4BQMA 2JC7A 1FCMA 3IF6A 4E3JA 3OC2A 1KE4A 1IYQA 4OONA 1KGGA 3MZDA 3BLMA 1EI5A 1CI8A 4QB8A 2WAEA 1KE0A 4OLDA 2XD5A 3A3IA 2P9VA 1YLZA 3UNWA 3ITBA 1IKIA 5KZHA 4GB7A 3E2KA 4KQRA 5GLDA 2R9WA 4RVAA 3UPPA 1PIOA 3OPLA 4GOGA 1AXBA 3IF5A 3Q82A 3ZG0A 2X01A 3UE1A 3MFDA 1L2SA 3C4OA 1K57A 1YLYA 4JLFA 3V50A 4S2NA 3HUOA 2OV5A 4D2OA 1RGYA 3MKEA 4R23A 2ZQ7A 1YMSA 4R0QA 4BD1A 2C6WB 4BJPA 4KZBA 4DF6A 3FZCA 1PWGA 1MBLA 3ZGAB 2Z2LB 2G2WA 5J8XA 2JBFA 1ERMA 4WMCA 1BUEA 2B5RA 3HLDA 4NETA 4X55A 1GA9A 2C5WB 4K91A 4WMCD 1H8ZA 2PBYA 3OPRA 5EUAA 1NJ4A 1L0EA 5CGSA 1E25A 4IVIA 2WKIA 5DF8A 2HP5A 3QHYA 1SDNA 3UPOA 3GRJA 2EX9A 2WUQA 2Y55A 3S22A 3AGFA 2ZC5B 3FWLA 3OZHA 4U0XA 4BL2A 1MXOA 2ZD8A 3C4PA 4QY5A 3BFCA 2Z2MB 1KGFA 1QMFA 1K55C 3IXHA 4OP8A 4OPQA 3VOYA 5CEDA 5GLBA 3C7UA 4P87A 4RX2A 1PWDA 2IWDA 1L0FA 4WZ4A 5CXWA 3SH9A 1JWPA 1MWTA 3ZG9B 1MPLA 5EOEA 4OLGA 2WGWA 3HLBA 1O7EA 3SS3A 2ZMAA 1NZOA 4MBFA 2CC1A 1HZOA 2EX8A 3IXBA 1MY8A 1YLJA 3N7WA 3IXGA 4L0LA 4OPRA 1FR6A 2DCFA 3ZVTA 4GNUA 4S2MA 4E3MA 4O7DA 4S2PA 5FI6A 2J9OA 5CTMA 2Y2MA 3VMAA 1IKGA 1XA1A 3GV9A 2RCXA 3WS2A 1BULA 1ES4A 3IHAA 2WADA 4ZJ3A 1KVMA 1C3BA 4N92A 2Y2JA 5AQAA 3V3SA 4IEDA 4Y0TA 3W4OA 1ZG6A 4S2KA 1PZOA 2OSUA 4ZDXA 3G35A 1N9BA 3IF6C 3IQAA 4RA7A 1FSWA 1K4FA 4QU3A 1BLCA 1NRFA 2XGNA 1K38A 3IH9A 5E2HA 1S6RA 1GA0A 5CHUA 4OOLA 5E2FA 4PM6A 1KDSA 2DRWA 3CMZA 3NI9A 3UE3A 1E4DA 4ZJ1A 3N4IA 4DDSA 3NCKA 1LL9A 3AGEA 5F83A 1XKZA 3HBRA 5E43A 4KZ4A 3HUNA 1TEMA 3M2KA 1MWRA 3HLCA 2IWBA 4UA7A 1S0WA 1YM1A 5GHYA 5KSHA 3W4QA 3OCNA 5CERA 5TGFA 3CJMA 1BLPA 4R3BA 1IYPA 1K57C 3IT9A 2J7VA 4OOYA 3VP1A 3GR2A 4E3NA 1IEMA 4A5RA 4S2NC 3SOIA 4N1XA 1Z6FA 3BECA 5DF7A 1KGEA 2XEPA 5F82A 2H0YA 1JVJA 4PPRA 1JTGA 3PAEA 4MEZA 1LLBA 1NYYA 4JBFA 4X56A 4B88A 1J9MA 3ZDJA 1XX2A 5DVAA 3S4XA 1GHIA 3LCEA 3VOZA 1FR1A 1XXMA 4BLMA 1PZPA 1VM1A 3ISGA 4FSFA 3NIAA 3DTMA 4IBRA 3UPNA 3P09A 3HLFA 2EFXA 3UN7A 1FQGA 4E6WA 5CTNA 2ZC3B 5E2EA 3G30A 5HAPA 2ZM2A 4JXWA 2VGJA 1RGZA 1W7FA 4ZJ2A 1RP5A 4OQIA 1L0GA 3RXXA 3I7JA 1PI5A 3V3RA 3VP4A 3ZG7B 1W8QA 4N9LA 4PM9A 2ZQAA 2QZ6A 5EE8A 3VFHA 1ZKJA 3WRTA 1KDWA 4IVKA 2XF3A 4BENA 3G2ZA 4DE1A 1VQQA 5FATA 2Y2HA 2FFYA 3FKVA 4OOMA 1ZC2A 3TSGA 3W4PA 4DE2A 5DTTA 3S1YA 2ZLYA 3SS4A 1IYOA 4YINA 1HTZA 5EVIB 3BFGA 4DXBA 2Y2LA 3HLGA 1NY0A 4X69A 5L2FA 3VSKA 3M6HA 3G32A 5JYPA 2WYXA 4BL3A 2HP9A 5HW3A 4HESA 1LI0A 4FD8A 3IHBA 5FI7A 1SHVA 1ESUA 1EWZA 4OPYA 4Y0OA 1I2WA 4GDNA 4UA6A 5A90A 1YT4A 3B3XA 3FKWA 4JF4A 1YLWA 1K6RA 2HDUA 2Y2OA 2XFSA 1U60A 3P98A 2WZZA 2OLVA 2PU2A 4R4RA 5M1AA 5KSCA 4Y7PA 4EQIA 1CEGA 1WYCA 3OCLA 4KG5A 4X68A 5FQKA 5CHJA 2EX6A 3TOIA 1LI9A 4FCFA 5F1GA 1SKFA 3G31A 4K0WA 4X53A 4WEJA 4U0TA 1Q2PA 3PAGA 3IXDA 5HL1A 3MKFA 1HD8A 4DRTA 3BLSA 3Q7VB 4PM8A 4LV1A 3PBRA 4RYEA 1K56D 4PM7A 3UO9A 2ZQCA 4UHUA 1PW1A 3N8SA 5GL9A 2X71A 4B4XA 5FSRA 5HAQA 2XDMA 4UA9A 1NZUA 4U3TA 4JXVA 4S2IA 2Y4AA 3QNCA 4OKPA 2Y59A 3UY6A 4KZ6A 4JF5A 3UDXA 3DWZA 3ZVWA 3V39A 4R1GA 3BFFA 4OQHA 5CRFA 3PBOA 3A3FA 2HPBA 3OPHA 1BSGA 4GD8A 3RXWA 5AQ9A 4E3IA 4KZAA 5EECA 1KVLA 4JPMA 5FA7A 1K54C 3PBNA 4JKTA 4GZBA 4N1HA 1CI9A 2ZQ9A 1I2SA 3SH8A 1GHPA 1IYSA 4XUXA 3W8KA 4EV4A 4WELA 3GSGA 5EVLA 2Y2NA 5TR7A 4E3KA 3PBTA 4LV0A 3WS0A 4RX3A 5FASA 3O88A 4X6TA 3ZG5A 4KG6A 5CECA 3DWKA 1YLPA 3A3JA 3NDGA 2A49A 1GCEA 2DNSA 2J9PA 4WM9A 1LHYA 3V5MA 2ZM0A 5HAIA 1FOFA 4P6BA 4F94A 2XH9A 4KG2A 4XXRA 3WS5A 3LY3A 3BEBA 4S2JA 4OH0A 1FSYA 3AGDA 4C75A 2XLNA 3WRZA 3HLEA 4EBPA 5M19A 1SDEA 1HVBA 3C5AA 2Q9NA 4JXSA 5AQ7A 1CEFA 1MKIA 2FFFB 2Y2IA 4ZBEA 1DJCA 2EXBA 5FAOA 5GHXA 2ZQDA 4OP5A 5EVIC 5G18A 5CHMA 2XR0A 3PTEA 4QD4A 3UDFA 3ZFZA 4GN2A 3IF6B 4NK3A 1K54A 1ONGA 1O07A 1W5DA 3IH8A 1SCWA 3DW0A 4MLLA 1XP4A 3WWXA 3Q1FA 2P9VB 2IWCA 1W79A 4KZ8A 2H0TA 4GD6A 5DTSA 4EUZA 2ZJ9A 4PM5A 3CG5A 3IWQA 4KQOA 3WS1A 1ES5A 1MWSA 2HDSA 4K0XA 3NY4A 3VSLA 2Y2QA 5D3OA 2ZC4B 3RJUA 4E3LA 2H10A 5U47A 4EWFA 4N9KA 1DY6A 4KQQA 4WBGA 2Y91A 2Q9MA 4E6XA 4LCLA 4OQGA 1H8YA 3ZCZA 4CJNA 4Z9QA 5KMWA 1N4OA 2BLSA 3G4PA 1ERQA 1I5QA 1TDLA 3MXSA 4YFMA 3D4FA 4DE3A 4S2OA 1PYYA 2XK1A 1BLSA 3FYZA 1PI4A 3NBLA 3HLWA 1Q2QA 2UWXA 2XD1A 3TG9A 5A93A 1GHMA 2JCHA 3BM6A 1YQSA 2QMIA 4GDBA 5EVIA 5FQIA 3BYDA 3ZHHA 1BTLA 4WEKA 5EVID 4EBLA 5A92A 3EQUA 1Y54A 3NDEA 1M6KA 1TVFA 4BD0A 4HBTA 5FAPA 2Y2KA 4WZ5C 3N8RA 2PU4A 5AQBA 4PMAA 2WZXA 4MBHA 2GDNA 1BZAA 2WKEA 3Q7ZA 2XFTA 3FV7A 1XGJA 5CGWA 2HP6A 4UAAA 3M6BA 3WS4A 5GLCA 5HX9A 4FH2A 2I72A 3BRMA 3MZFA 1G68A 1QMEA 2A3UA 4QJGA 4DE0A 2EFUA 4Q8IA 2QPNA 1W8YA 2WGWB 5FDHA 2XQZA 1NXYA 1BT5A 1PW8A 2WAFA 1FCNA 2VGKA 1BLHA 3HL9A 3EQVA 4JF6A 4R3JA 3ZNTA 3G34A 2WKHA 3GTCA 1K56A 2RL3A 3A3DA 1ES3A 4QY6A 1YMXA 4KZ5A 3SH7A 4B4ZA 1FCOA 4M3KA 3BFDA 1DJBA 1K6SA 4HBUA 3GQZA 1ZG4A 4KZ7A 4E3OA 2ZQ8A 5I94A 4R4SA 4OVDA 3E2LA 3LY4A 2WK0A 1MWUA 3Q7VA 4CPKA 5FAQA 5M18A 5FI2A 5FQMA 1EROA 4WYYA 1RCJA 4MBKA 5GLAA 4FH4A 3VP2A 1YLTA 2V1ZA 4WZ5A 5A91A 2E8IA 3G2YA 3HUMA 2OLUA 2ZC7A 4C3QA 3SS5A 4OQ0A 5HARA 1ONHA 2V2FF 4KZ3A 3Q07A 2EX2A 1JTDA 1CK3A 3N8LA 4H8RA 3NC8A 4LV2A 3GMWA 3ZNYA 5E2GA 1ESIA 2HDRA 4LV3A 4S2LA 1WE4A 3JYIA 5CEBA 1H5XA 3M2JA 4LCMA 2ZC6B 1JWZA 3LO7A 3MBZA 5DTKA 3UDIA 2BG1A 2X02A 4EBNA 1K55A 4DKIA 2WGVA 3QNBA 2Y2PA 3A3EA 3CZDA 2J8YA 2P74A 3O87A 1WYBA 1ALQA 4HEFA 1XGIA 2WGIA 4DDYA 3GVBA 3IWOA 5GHZA 1DJAA 3O86A 2R9XA 4OPZA 3PBQA 1E3UA 3LEZA 3OPPA 5CGXA 1ES2A 1K25A 1E3UD 3UE0A 1OMEA 3HREA 4IBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KE3 A;  2V20 A;  2ZM8 A;  5EPH A;  3VP0 A;  3VP3 A;  1TDG A;  3C7V A;  3ITA A;  4Y0U A;  1NYM A;  4ID4 A;  3Q81 A;  5F1F A;  1IEL A;  3PBS A;  5DF9 A;  4KZ9 A;  3VFF A;  2EXA A;  4GKU A;  4XUZ A;  3HVF A;  4KEN B;  3ZG8 B;  2G2U A;  1JWV A;  2HDQ A;  4LEN A;  4ZAM A;  1K4E A;  4JXG A;  5FQ9 A;  3MXR A;  4P85 A;  5IHV A;  3BFE A;  1L0D A;  1XPB A;  5JYO A;  4ZTK A;  5BOH A;  3MZE A;  3O3V A;  1PWC A;  2H5S A;  1LL5 A;  2JE5 A;  4QHC A;  5EOO A;  1M40 A;  5FQQ A;  5FQJ A;  5HFO A;  5TFQ A;  2Y2G A;  3IWI A;  4MNR A;  4DXC A;  4P0M A;  1G6A A;  3N6I A;  4C6Y A;  1XA7 A;  4BQM A;  2JC7 A;  1FCM A;  3IF6 A;  4E3J A;  3OC2 A;  1KE4 A;  1IYQ A;  4OON A;  1KGG A;  3MZD A;  3BLM A;  1EI5 A;  1CI8 A;  4QB8 A;  2WAE A;  1KE0 A;  4OLD A;  2XD5 A;  3A3I A;  2P9V A;  1YLZ A;  3UNW A;  3ITB A;  1IKI A;  5KZH A;  4GB7 A;  3E2K A;  4KQR A;  5GLD A;  2R9W A;  4RVA A;  3UPP A;  1PIO A;  3OPL A;  4GOG A;  1AXB A;  3IF5 A;  3Q82 A;  3ZG0 A;  2X01 A;  3UE1 A;  3MFD A;  1L2S A;  3C4O A;  1K57 A;  1YLY A;  4JLF A;  3V50 A;  4S2N A;  3HUO A;  2OV5 A;  4D2O A;  1RGY A;  3MKE A;  4R23 A;  2ZQ7 A;  1YMS A;  4R0Q A;  4BD1 A;  2C6W B;  4BJP A;  4KZB A;  4DF6 A;  3FZC A;  1PWG A;  1MBL A;  3ZGA B;  2Z2L B;  2G2W A;  5J8X A;  2JBF A;  1ERM A;  4WMC A;  1BUE A;  2B5R A;  3HLD A;  4NET A;  4X55 A;  1GA9 A;  2C5W B;  4K91 A;  4WMC D;  1H8Z A;  2PBY A;  3OPR A;  5EUA A;  1NJ4 A;  1L0E A;  5CGS A;  1E25 A;  4IVI A;  2WKI A;  5DF8 A;  2HP5 A;  3QHY A;  1SDN A;  3UPO A;  3GRJ A;  2EX9 A;  2WUQ A;  2Y55 A;  3S22 A;  3AGF A;  2ZC5 B;  3FWL A;  3OZH A;  4U0X A;  4BL2 A;  1MXO A;  2ZD8 A;  3C4P A;  4QY5 A;  3BFC A;  2Z2M B;  1KGF A;  1QMF A;  1K55 C;  3IXH A;  4OP8 A;  4OPQ A;  3VOY A;  5CED A;  5GLB A;  3C7U A;  4P87 A;  4RX2 A;  1PWD A;  2IWD A;  1L0F A;  4WZ4 A;  5CXW A;  3SH9 A;  1JWP A;  1MWT A;  3ZG9 B;  1MPL A;  5EOE A;  4OLG A;  2WGW A;  3HLB A;  1O7E A;  3SS3 A;  2ZMA A;  1NZO A;  4MBF A;  2CC1 A;  1HZO A;  2EX8 A;  3IXB A;  1MY8 A;  1YLJ A;  3N7W A;  3IXG A;  4L0L A;  4OPR A;  1FR6 A;  2DCF A;  3ZVT A;  4GNU A;  4S2M A;  4E3M A;  4O7D A;  4S2P A;  5FI6 A;  2J9O A;  5CTM A;  2Y2M A;  3VMA A;  1IKG A;  1XA1 A;  3GV9 A;  2RCX A;  3WS2 A;  1BUL A;  1ES4 A;  3IHA A;  2WAD A;  4ZJ3 A;  1KVM A;  1C3B A;  4N92 A;  2Y2J A;  5AQA A;  3V3S A;  4IED A;  4Y0T A;  3W4O A;  1ZG6 A;  4S2K A;  1PZO A;  2OSU A;  4ZDX A;  3G35 A;  1N9B A;  3IF6 C;  3IQA A;  4RA7 A;  1FSW A;  1K4F A;  4QU3 A;  1BLC A;  1NRF A;  2XGN A;  1K38 A;  3IH9 A;  5E2H A;  1S6R A;  1GA0 A;  5CHU A;  4OOL A;  5E2F A;  4PM6 A;  1KDS A;  2DRW A;  3CMZ A;  3NI9 A;  3UE3 A;  1E4D A;  4ZJ1 A;  3N4I A;  4DDS A;  3NCK A;  1LL9 A;  3AGE A;  5F83 A;  1XKZ A;  3HBR A;  5E43 A;  4KZ4 A;  3HUN A;  1TEM A;  3M2K A;  1MWR A;  3HLC A;  2IWB A;  4UA7 A;  1S0W A;  1YM1 A;  5GHY A;  5KSH A;  3W4Q A;  3OCN A;  5CER A;  5TGF A;  3CJM A;  1BLP A;  4R3B A;  1IYP A;  1K57 C;  3IT9 A;  2J7V A;  4OOY A;  3VP1 A;  3GR2 A;  4E3N A;  1IEM A;  4A5R A;  4S2N C;  3SOI A;  4N1X A;  1Z6F A;  3BEC A;  5DF7 A;  1KGE A;  2XEP A;  5F82 A;  2H0Y A;  1JVJ A;  4PPR A;  1JTG A;  3PAE A;  4MEZ A;  1LLB A;  1NYY A;  4JBF A;  4X56 A;  4B88 A;  1J9M A;  3ZDJ A;  1XX2 A;  5DVA A;  3S4X A;  1GHI A;  3LCE A;  3VOZ A;  1FR1 A;  1XXM A;  4BLM A;  1PZP A;  1VM1 A;  3ISG A;  4FSF A;  3NIA A;  3DTM A;  4IBR A;  3UPN A;  3P09 A;  3HLF A;  2EFX A;  3UN7 A;  1FQG A;  4E6W A;  5CTN A;  2ZC3 B;  5E2E A;  3G30 A;  5HAP A;  2ZM2 A;  4JXW A;  2VGJ A;  1RGZ A;  1W7F A;  4ZJ2 A;  1RP5 A;  4OQI A;  1L0G A;  3RXX A;  3I7J A;  1PI5 A;  3V3R A;  3VP4 A;  3ZG7 B;  1W8Q A;  4N9L A;  4PM9 A;  2ZQA A;  2QZ6 A;  5EE8 A;  3VFH A;  1ZKJ A;  3WRT A;  1KDW A;  4IVK A;  2XF3 A;  4BEN A;  3G2Z A;  4DE1 A;  1VQQ A;  5FAT A;  2Y2H A;  2FFY A;  3FKV A;  4OOM A;  1ZC2 A;  3TSG A;  3W4P A;  4DE2 A;  5DTT A;  3S1Y A;  2ZLY A;  3SS4 A;  1IYO A;  4YIN A;  1HTZ A;  5EVI B;  3BFG A;  4DXB A;  2Y2L A;  3HLG A;  1NY0 A;  4X69 A;  5L2F A;  3VSK A;  3M6H A;  3G32 A;  5JYP A;  2WYX A;  4BL3 A;  2HP9 A;  5HW3 A;  4HES A;  1LI0 A;  4FD8 A;  3IHB A;  5FI7 A;  1SHV A;  1ESU A;  1EWZ A;  4OPY A;  4Y0O A;  1I2W A;  4GDN A;  4UA6 A;  5A90 A;  1YT4 A;  3B3X A;  3FKW A;  4JF4 A;  1YLW A;  1K6R A;  2HDU A;  2Y2O A;  2XFS A;  1U60 A;  3P98 A;  2WZZ A;  2OLV A;  2PU2 A;  4R4R A;  5M1A A;  5KSC A;  4Y7P A;  4EQI A;  1CEG A;  1WYC A;  3OCL A;  4KG5 A;  4X68 A;  5FQK A;  5CHJ A;  2EX6 A;  3TOI A;  1LI9 A;  4FCF A;  5F1G A;  1SKF A;  3G31 A;  4K0W A;  4X53 A;  4WEJ A;  4U0T A;  1Q2P A;  3PAG A;  3IXD A;  5HL1 A;  3MKF A;  1HD8 A;  4DRT A;  3BLS A;  3Q7V B;  4PM8 A;  4LV1 A;  3PBR A;  4RYE A;  1K56 D;  4PM7 A;  3UO9 A;  2ZQC A;  4UHU A;  1PW1 A;  3N8S A;  5GL9 A;  2X71 A;  4B4X A;  5FSR A;  5HAQ A;  2XDM A;  4UA9 A;  1NZU A;  4U3T A;  4JXV A;  4S2I A;  2Y4A A;  3QNC A;  4OKP A;  2Y59 A;  3UY6 A;  4KZ6 A;  4JF5 A;  3UDX A;  3DWZ A;  3ZVW A;  3V39 A;  4R1G A;  3BFF A;  4OQH A;  5CRF A;  3PBO A;  3A3F A;  2HPB A;  3OPH A;  1BSG A;  4GD8 A;  3RXW A;  5AQ9 A;  4E3I A;  4KZA A;  5EEC A;  1KVL A;  4JPM A;  5FA7 A;  1K54 C;  3PBN A;  4JKT A;  4GZB A;  4N1H A;  1CI9 A;  2ZQ9 A;  1I2S A;  3SH8 A;  1GHP A;  1IYS A;  4XUX A;  3W8K A;  4EV4 A;  4WEL A;  3GSG A;  5EVL A;  2Y2N A;  5TR7 A;  4E3K A;  3PBT A;  4LV0 A;  3WS0 A;  4RX3 A;  5FAS A;  3O88 A;  4X6T A;  3ZG5 A;  4KG6 A;  5CEC A;  3DWK A;  1YLP A;  3A3J A;  3NDG A;  2A49 A;  1GCE A;  2DNS A;  2J9P A;  4WM9 A;  1LHY A;  3V5M A;  2ZM0 A;  5HAI A;  1FOF A;  4P6B A;  4F94 A;  2XH9 A;  4KG2 A;  4XXR A;  3WS5 A;  3LY3 A;  3BEB A;  4S2J A;  4OH0 A;  1FSY A;  3AGD A;  4C75 A;  2XLN A;  3WRZ A;  3HLE A;  4EBP A;  5M19 A;  1SDE A;  1HVB A;  3C5A A;  2Q9N A;  4JXS A;  5AQ7 A;  1CEF A;  1MKI A;  2FFF B;  2Y2I A;  4ZBE A;  1DJC A;  2EXB A;  5FAO A;  5GHX A;  2ZQD A;  4OP5 A;  5EVI C;  5G18 A;  5CHM A;  2XR0 A;  3PTE A;  4QD4 A;  3UDF A;  3ZFZ A;  4GN2 A;  3IF6 B;  4NK3 A;  1K54 A;  1ONG A;  1O07 A;  1W5D A;  3IH8 A;  1SCW A;  3DW0 A;  4MLL A;  1XP4 A;  3WWX A;  3Q1F A;  2P9V B;  2IWC A;  1W79 A;  4KZ8 A;  2H0T A;  4GD6 A;  5DTS A;  4EUZ A;  2ZJ9 A;  4PM5 A;  3CG5 A;  3IWQ A;  4KQO A;  3WS1 A;  1ES5 A;  1MWS A;  2HDS A;  4K0X A;  3NY4 A;  3VSL A;  2Y2Q A;  5D3O A;  2ZC4 B;  3RJU A;  4E3L A;  2H10 A;  5U47 A;  4EWF A;  4N9K A;  1DY6 A;  4KQQ A;  4WBG A;  2Y91 A;  2Q9M A;  4E6X A;  4LCL A;  4OQG A;  1H8Y A;  3ZCZ A;  4CJN A;  4Z9Q A;  5KMW A;  1N4O A;  2BLS A;  3G4P A;  1ERQ A;  1I5Q A;  1TDL A;  3MXS A;  4YFM A;  3D4F A;  4DE3 A;  4S2O A;  1PYY A;  2XK1 A;  1BLS A;  3FYZ A;  1PI4 A;  3NBL A;  3HLW A;  1Q2Q A;  2UWX A;  2XD1 A;  3TG9 A;  5A93 A;  1GHM A;  2JCH A;  3BM6 A;  1YQS A;  2QMI A;  4GDB A;  5EVI A;  5FQI A;  3BYD A;  3ZHH A;  1BTL A;  4WEK A;  5EVI D;  4EBL A;  5A92 A;  3EQU A;  1Y54 A;  3NDE A;  1M6K A;  1TVF A;  4BD0 A;  4HBT A;  5FAP A;  2Y2K A;  4WZ5 C;  3N8R A;  2PU4 A;  5AQB A;  4PMA A;  2WZX A;  4MBH A;  2GDN A;  1BZA A;  2WKE A;  3Q7Z A;  2XFT A;  3FV7 A;  1XGJ A;  5CGW A;  2HP6 A;  4UAA A;  3M6B A;  3WS4 A;  5GLC A;  5HX9 A;  4FH2 A;  2I72 A;  3BRM A;  3MZF A;  1G68 A;  1QME A;  2A3U A;  4QJG A;  4DE0 A;  2EFU A;  4Q8I A;  2QPN A;  1W8Y A;  2WGW B;  5FDH A;  2XQZ A;  1NXY A;  1BT5 A;  1PW8 A;  2WAF A;  1FCN A;  2VGK A;  1BLH A;  3HL9 A;  3EQV A;  4JF6 A;  4R3J A;  3ZNT A;  3G34 A;  2WKH A;  3GTC A;  1K56 A;  2RL3 A;  3A3D A;  1ES3 A;  4QY6 A;  1YMX A;  4KZ5 A;  3SH7 A;  4B4Z A;  1FCO A;  4M3K A;  3BFD A;  1DJB A;  1K6S A;  4HBU A;  3GQZ A;  1ZG4 A;  4KZ7 A;  4E3O A;  2ZQ8 A;  5I94 A;  4R4S A;  4OVD A;  3E2L A;  3LY4 A;  2WK0 A;  1MWU A;  3Q7V A;  4CPK A;  5FAQ A;  5M18 A;  5FI2 A;  5FQM A;  1ERO A;  4WYY A;  1RCJ A;  4MBK A;  5GLA A;  4FH4 A;  3VP2 A;  1YLT A;  2V1Z A;  4WZ5 A;  5A91 A;  2E8I A;  3G2Y A;  3HUM A;  2OLU A;  2ZC7 A;  4C3Q A;  3SS5 A;  4OQ0 A;  5HAR A;  1ONH A;  2V2F F;  4KZ3 A;  3Q07 A;  2EX2 A;  1JTD A;  1CK3 A;  3N8L A;  4H8R A;  3NC8 A;  4LV2 A;  3GMW A;  3ZNY A;  5E2G A;  1ESI A;  2HDR A;  4LV3 A;  4S2L A;  1WE4 A;  3JYI A;  5CEB A;  1H5X A;  3M2J A;  4LCM A;  2ZC6 B;  1JWZ A;  3LO7 A;  3MBZ A;  5DTK A;  3UDI A;  2BG1 A;  2X02 A;  4EBN A;  1K55 A;  4DKI A;  2WGV A;  3QNB A;  2Y2P A;  3A3E A;  3CZD A;  2J8Y A;  2P74 A;  3O87 A;  1WYB A;  1ALQ A;  4HEF A;  1XGI A;  2WGI A;  4DDY A;  3GVB A;  3IWO A;  5GHZ A;  1DJA A;  3O86 A;  2R9X A;  4OPZ A;  3PBQ A;  1E3U A;  3LEZ A;  3OPP A;  5CGX A;  1ES2 A;  1K25 A;  1E3U D;  3UE0 A;  1OME A;  3HRE A;  4IBX A; 
#chains in the Genus database with same CATH topology
 1KE3 A;  1ZHH B;  2UV0 E;  3PBS A;  3T1X A;  4KZ9 A;  4XUZ A;  4MN6 A;  3ZG8 B;  2HDQ A;  1JWV A;  1V9Y A;  3LID A;  5IHV A;  1OTD A;  2WKQ A;  1Y28 A;  5BOH A;  3VE3 A;  2KLI A;  1PWC A;  2H5S A;  3IX4 A;  2NUP C;  5FQJ A;  1XA7 A;  2J80 A;  4BQM A;  3IF6 A;  1F5M A;  1KE4 A;  1EI5 A;  4QB8 A;  2WAE A;  2XD5 A;  3A3I A;  1YLZ A;  1IKI A;  5KZH A;  5FEF A;  3VOL A;  5HWV A;  5AVE A;  4II7 A;  4JGR A;  3ZG0 A;  2X01 A;  3MFD A;  1L2S A;  2HZ5 A;  1TD5 A;  3V50 A;  3NUL A;  3R7W B;  1YMS A;  4R0Q A;  2C6W B;  4KZB A;  1D06 A;  3ZGA B;  2G2W A;  5J8X A;  3BW6 A;  4WMC A;  4EU0 A;  2C5W B;  1F9I A;  4O0P A;  1P9W A;  3OPR A;  1OTI A;  3OBF A;  1E25 A;  5DF8 A;  2HP5 A;  3QP5 A;  1SDN A;  3S22 A;  3OZH A;  3FWL A;  1AWI A;  4LGW A;  3U2A A;  2Z2M B;  1KGF A;  5CED A;  4RX2 A;  4P87 A;  1L0F A;  4MMN A;  3SH9 A;  1JWP A;  1MWT A;  3E4O A;  3B33 A;  2WGW A;  3IS2 A;  4MBF A;  1HZO A;  2EX8 A;  4L0L A;  3N7W A;  3IXG A;  3ZVT A;  2EWV A;  3MQO A;  5CTM A;  2W1T B;  1XA1 A;  3GV9 A;  4KQD A;  2RCX A;  4Y3I A;  3IHA A;  4ZJ3 A;  4N92 A;  4Y0T A;  3W4O A;  3A0V A;  3G35 A;  3IF6 C;  5EM1 A;  4MN5 A;  3DBA A;  4JGP A;  1BLC A;  1GA0 A;  4OOL A;  3NHQ A;  3UE3 A;  4ZJ1 A;  3N4I A;  3NCK A;  2W3F A;  3HLC A;  1GSW A;  2V0U A;  1UGU A;  3T4K A;  1BLP A;  5LBR A;  4A5R A;  3SOI A;  5J7E A;  5FL3 A;  2H0Y A;  1YSP A;  2V1B A;  4PPR A;  4DJ2 A;  4JBF A;  1J9M A;  1FR1 A;  1MZU A;  1VM1 A;  3ISG A;  3NIA A;  1UWN X;  4IBR A;  3P09 A;  2KDK A;  3HLF A;  2EFX A;  2QJ7 A;  4HHD A;  2XRN A;  5HAP A;  3L7H A;  1RGZ A;  4ZJ2 A;  3I7J A;  1PI5 A;  1W8Q A;  3H82 B;  3MMH A;  3TJZ C;  4R3A A;  4BEN A;  1FIL A;  4O8G A;  3G6O A;  2GJ3 A;  1HTZ A;  3BFG A;  3ZQ5 A;  5L2F A;  2WYX A;  4BL3 A;  2HP9 A;  1D7E A;  2KX6 A;  1S4S A;  1EWZ A;  2FZ0 A;  1I2W A;  1YT4 A;  3CPT A;  1K6R A;  3UB6 A;  3UB5 P;  1OJ5 A;  3P98 A;  5M1A A;  4R4R A;  5F69 A;  4Y7P A;  4EQI A;  2J3W A;  3OCL A;  5FQK A;  5EFW A;  3B42 A;  4FCF A;  3G31 A;  2XA7 M;  4R6L A;  2XSS A;  3IXD A;  5HL1 A;  5HWT A;  2W3G A;  1HD8 A;  4DRT A;  3Q7V B;  3UB8 A;  5A8B A;  4PM7 A;  2DMW A;  4U3T A;  2W3D A;  5L07 A;  4JXV A;  2BTF P;  4F3L B;  3UY6 A;  4KZ6 A;  4JF5 A;  3UDX A;  3ZVW A;  4R1G A;  4OQH A;  2JKR I;  4KZA A;  4JPM A;  3DTE A;  1K54 C;  4GLQ A;  3T4J A;  1CI9 A;  2L1M A;  3FPV A;  1GHP A;  4I3J A;  4EV4 A;  5EVL A;  3E98 A;  3MXQ A;  3PBT A;  4LV0 A;  3WS0 A;  2OAP 1;  4KG6 A;  3DWK A;  1YLP A;  3NDG A;  2A49 A;  2DNS A;  1LHY A;  3V5M A;  5HAI A;  1YSQ A;  3WS5 A;  3LY3 A;  1JNU A;  3BEB A;  4S2J A;  4OH0 A;  3S7N A;  1V9Z A;  2XLN A;  2OOL A;  3HLE A;  5AJG A;  2Q9N A;  1KOU A;  1MKI A;  5EVE A;  4FUW A;  5EVI C;  2OWH A;  5G18 A;  2XR0 A;  2W27 A;  3LI9 A;  1W5D A;  3DW0 A;  2K7S A;  1XP4 A;  1K0K A;  2IWC A;  1W79 A;  5DTS A;  4GD6 A;  2ZJ9 A;  4KQO A;  2HDS A;  3VSL A;  5D3O A;  4E3L A;  2ZC4 B;  4QPR A;  1DY6 A;  4EW7 A;  2Q9M A;  4Y15 A;  4LPZ A;  1GSX A;  3G4P A;  1I5Q A;  1PYY A;  2XK1 A;  1BLS A;  1PI4 A;  1OTA A;  3HLW A;  2XD1 A;  3TG9 A;  3SZT A;  4GDB A;  3ZHH A;  4EXO A;  4WEK A;  4BD0 A;  2Y2K A;  3N8R A;  1BZA A;  3DTI A;  4GS9 A;  2XFT A;  5CGW A;  2PHY A;  4FH2 A;  2I72 A;  2LB5 A;  1NWZ A;  4QJG A;  4DE0 A;  1VHM A;  1GSV A;  2QPN A;  4R70 A;  1PW8 A;  1BT5 A;  1NRJ A;  2WAF A;  1FCN A;  5F82 A;  3ZNT A;  4UQI M;  3A3D A;  2W3E A;  4QY6 A;  1YMX A;  3MJQ A;  3KSF A;  1DJB A;  4HBU A;  3BY8 A;  3CUE A;  2ZQ8 A;  4OVD A;  3E2L A;  3LY4 A;  4CPK A;  4WYY A;  5DKL A;  5A91 A;  1VEU B;  2BAS A;  3HUM A;  2V0W A;  4CLC E;  2ZC7 A;  3DAV A;  3VV4 A;  2HGV A;  4G3V A;  3T1Q B;  1JTD A;  3N8L A;  2INW A;  3GMW A;  2HDR A;  4NXF A;  2YKH A;  1H5X A;  3DTK A;  3EGD C;  2XA7 S;  4WL9 A;  3A3E A;  2J8Y A;  2K31 A;  4I3A A;  3GVB A;  1DJA A;  3KSG A;  2QWS A;  4LRZ E;  3HCY A;  3UE0 A;  4R23 A;  5EPH A;  3VP3 A;  2JHE A;  4Y0U A;  1NYM A;  2JN7 A;  4UEY A;  3K3C A;  5DF9 A;  2A2L A;  3VFF A;  3F1P A;  4BMW A;  2G2U A;  1K4E A;  1L0D A;  5G4Z A;  4EES A;  3O3V A;  1LL5 A;  4CLC B;  2QYB A;  4MNR A;  4C6Y A;  1S1Y A;  1FCM A;  1IYQ A;  1LL8 A;  3BLM A;  3FPW A;  4OLD A;  2P9V A;  4KQR A;  1Y4O A;  5GLD A;  3UPP A;  4IHQ A;  4H6J A;  5F5Y A;  3T4L A;  5HDS A;  5TJJ A;  2IA2 A;  5HWW A;  2VV6 A;  3IF5 A;  4HOI A;  4I38 A;  1YLY A;  4JLF A;  5DFX A;  3MKE A;  2ZQ7 A;  3LUQ A;  3FZC A;  1BUE A;  1X0O A;  4K91 A;  4WMC D;  5EUA A;  1NJ4 A;  1TF1 A;  5CGS A;  3TRC A;  3GRJ A;  2WUQ A;  4QY5 A;  4ESP A;  4OP8 A;  2P7J A;  1WA9 A;  3MQQ A;  4HY8 A;  4WZ4 A;  3QP1 A;  5EOE A;  3MSH A;  1OT6 A;  1O7E A;  2ZMA A;  2CC1 A;  1FR6 A;  4S2M A;  4E3M A;  2YKF A;  2Y2M A;  1IKG A;  2ZMF A;  3KO6 A;  1BUL A;  3WS2 A;  1IOU A;  1XJ6 A;  1TS6 A;  4QWO A;  1KVM A;  4GHI A;  1NLZ A;  2HV1 A;  2Y2J A;  4IED A;  2ZL1 B;  2PRF A;  1N9B A;  4HIA A;  3IQA A;  5G4Y A;  1FSW A;  1K4F A;  2XGN A;  1K38 A;  5CX7 A;  4JGQ A;  4MDZ A;  1KDS A;  2DRW A;  3NI9 A;  1LL9 A;  3AGE A;  5F83 A;  3BJN A;  3HBR A;  1TEM A;  3M2K A;  4DMZ A;  2IWB A;  5GHY A;  2XRO A;  3OCN A;  2PR5 A;  5TGF A;  4O01 A;  3IT9 A;  4E3N A;  2J7V A;  4OOY A;  1S4R A;  1IEM A;  3EOI A;  1KGE A;  3F1P B;  4IUK A;  1JVJ A;  3PAE A;  4MEZ A;  4ETX A;  3E4Q A;  4X56 A;  4B88 A;  5FDS A;  1XX2 A;  3IBR A;  1GHI A;  3S4X A;  1VET B;  3VOZ A;  1PZP A;  1W63 Q;  4PKY G;  3UN7 A;  1F98 A;  3A0S A;  2HF6 A;  2ZC3 B;  3G30 A;  4JXW A;  1RP5 A;  2WKP A;  3V3R A;  1UWP X;  4N9L A;  1XJ4 A;  2ZQA A;  3VFH A;  5EE8 A;  3H9W A;  3WRT A;  4EEP A;  1KDW A;  3C38 A;  3EEH A;  3D3O A;  4KUO A;  3FKV A;  4OOM A;  1ZC2 A;  3W4P A;  3S1Y A;  2ZLY A;  4DJ3 A;  3HLG A;  1NY0 A;  3VSK A;  3M6H A;  5L8M A;  3G32 A;  3T4O A;  2PAV P;  3IHB A;  1BYW A;  3HJI A;  4ARZ A;  3H7W B;  1YLW A;  5HL6 A;  2HDU A;  2Y79 A;  1P0Z A;  2Y2O A;  1U60 A;  2VZW A;  5KSC A;  2VEA A;  2KOI A;  3K3D A;  1LI9 A;  2JKF A;  2PT7 A;  4WEJ A;  1TS8 A;  4U0T A;  1Q2P A;  2Z6D A;  4GW9 A;  3BLS A;  3PBR A;  4BBU A;  4B4X A;  5GL9 A;  4UA9 A;  4NXE A;  2Y4A A;  1N9L A;  1VB6 A;  1F2K A;  3NOP C;  1SZV A;  3A3F A;  4GD8 A;  3RXW A;  4E3I A;  5AQ9 A;  1OJG A;  1I2S A;  5EM0 A;  5HD3 A;  3W8K A;  5TR7 A;  4WF0 A;  2G7U A;  4X6T A;  3K2N A;  5CEC A;  3JVU A;  3A3J A;  2J9P A;  4R38 A;  4WM9 A;  4P6B A;  2XH9 A;  4KG2 A;  4HQA A;  3S7P A;  2LB9 A;  4WN5 A;  3WRZ A;  4LRY C;  4NXB A;  1SDE A;  1OTE A;  2EXB A;  5GHX A;  1OT9 A;  1ACF A;  4QD4 A;  4GN2 A;  3IF6 B;  4NK3 A;  1K54 A;  1O07 A;  4MLL A;  2A24 A;  3WWX A;  3QP2 A;  4EUZ A;  3CG5 A;  1MWS A;  4K0X A;  5U47 A;  2W1R A;  5IT5 A;  4E6X A;  4LCL A;  5HDC A;  4CJN A;  3RFB A;  1N4O A;  4YFM A;  3D4F A;  4DE3 A;  4S2O A;  3FYZ A;  2HJ9 C;  4HH3 A;  2VGL S;  5EVI A;  3R4K A;  1BTL A;  4EBL A;  5A92 A;  3EQU A;  3NDE A;  1L3L A;  3EGX C;  1M6K A;  2PU4 A;  1MC0 A;  4I39 A;  2PD8 A;  5GLC A;  5HX9 A;  3BRM A;  1CF0 A;  5F68 A;  1QME A;  5HSQ A;  4Q8I A;  4E04 A;  1W8Y A;  2WGW B;  3IS2 B;  5FDH A;  4YWZ A;  1BLH A;  4X25 A;  4XT2 A;  4KZ5 A;  3SH7 A;  1FCO A;  2ZOH A;  3BFD A;  2K2N A;  4HJ3 A;  2VA0 A;  5I94 A;  2WK0 A;  3LIC A;  3T50 A;  5M18 A;  3VP2 A;  5GLA A;  2V1Z A;  3SS5 A;  4OQ0 A;  3T1R A;  5AVF A;  4KZ3 A;  2V2F F;  1TS7 A;  2P08 A;  2EX2 A;  3NC8 A;  3ZNY A;  3ULF A;  4LCM A;  3UB7 A;  1PFL A;  4DKI A;  2Y2P A;  3TE8 A;  2P74 A;  4HEF A;  4DDY A;  3C30 A;  3IWO A;  3O86 A;  2R9X A;  3PBQ A;  1E3U A;  3LEZ A;  3OPP A;  1K25 A;  3F1O A;  2V20 A;  1OTB A;  2ZM8 A;  3VP0 A;  1TDG A;  2O9B A;  4ID4 A;  1IEL A;  2L4R A;  3F1N A;  2EXA A;  3HVF A;  4KEN B;  4ZAM A;  3MXR A;  1Z09 A;  2P04 A;  3BFE A;  4P85 A;  1XPB A;  5EOO A;  5FQQ A;  1M40 A;  3CLO A;  5TFQ A;  2Y2G A;  1G28 A;  3IX8 A;  4LFU A;  4DXC A;  1G6A A;  3N6I A;  2AVX A;  2V9A A;  3UB9 A;  1KGG A;  3MZD A;  4RQ9 A;  2E8J A;  3CIT A;  2QJ5 A;  3ITB A;  3E2K A;  2R9W A;  3OPL A;  2EWW A;  5L10 A;  2M7V A;  3UE1 A;  3W2Z A;  3E0Y A;  5HPF A;  3B47 A;  2NUT C;  4S2N A;  3HUO A;  4D2O A;  4EER A;  5HPI A;  1PWG A;  1MBL A;  4EEU A;  2JBF A;  1ERM A;  2B5R A;  3HLD A;  4NET A;  3CPT B;  1OPX A;  1L0E A;  2WKI A;  4WLA A;  3UPO A;  2Y55 A;  3AGF A;  1MXO A;  1YKD A;  2ZD8 A;  3C4P A;  3LR3 A;  3BFC A;  1QMF A;  3VOY A;  5GLB A;  3S7Q A;  3IBJ A;  1PWD A;  2QKP A;  2IWD A;  3E4P A;  4WUJ A;  4K08 A;  3ZG9 B;  1MPL A;  1G6O A;  1SKO A;  3HLB A;  1CQA A;  1NZO A;  3IXB A;  1YLJ A;  4OPR A;  2DCF A;  4O7D A;  4HP4 A;  3QP8 A;  1TS0 A;  2J9O A;  3VMA A;  4EQ1 A;  3JVV A;  1DP6 A;  1ES4 A;  2WAD A;  3V3S A;  4KUK A;  4L9F A;  1PZO A;  2OSU A;  4ZDX A;  4QU3 A;  5E2H A;  4M4X A;  5TBM A;  4CLC C;  3MQ0 A;  3CMZ A;  2VJW A;  1XKZ A;  5E43 A;  4KZ4 A;  1S0W A;  1YM1 A;  3CJM A;  4R3B A;  3VP1 A;  1IYP A;  4X1M A;  4S2N C;  3P7N A;  1N9O A;  1Z6F A;  3BEC A;  2XEP A;  5F6A A;  1LLB A;  4HI4 A;  2ZMV A;  3LCE A;  3LR0 A;  1XXM A;  2JKT I;  4EET B;  3T4Q A;  1LSW A;  3DTM A;  4B9O A;  1ZTU A;  1DP8 A;  3C8C A;  4E6W A;  1FQG A;  5CTN A;  2JKT M;  2ZM2 A;  2D01 A;  1W7F A;  4PM9 A;  2QZ6 A;  1ZKJ A;  4DE1 A;  5FAT A;  2FFY A;  3MFX A;  1IYO A;  2QHK A;  1G5U A;  4DXB A;  4NG2 A;  4BWI A;  5JYP A;  3UE6 A;  5HW3 A;  4HES A;  4Q0H A;  1LI0 A;  3R7W A;  5FI7 A;  1SHV A;  4GS9 B;  4OPY A;  4Y0O A;  3QP6 A;  3V67 A;  4GDN A;  4HH2 A;  4ZRR A;  4NEE D;  3LR5 A;  2XFS A;  2EA9 A;  4NKP A;  2J3T C;  1P9R A;  2OLV A;  1CEG A;  4KG5 A;  5F1G A;  1SKF A;  4K0W A;  4X53 A;  3NJA A;  1CJF A;  5DFY A;  4DN0 A;  3MKF A;  4LV1 A;  4RYE A;  1K56 D;  3UO9 A;  3LIA A;  4UHU A;  3N8S A;  2VX8 A;  2X71 A;  5FSR A;  2XDM A;  4PAU A;  1NZU A;  4B93 A;  2Y59 A;  4Z1W A;  2W1T A;  3V39 A;  1A0K A;  1OME A;  5EEC A;  1KVL A;  4JKT A;  3LFV A;  3T4S A;  3EEA A;  3SH8 A;  3O5Y A;  4XUX A;  4WEL A;  2Y2N A;  5DJU A;  4G3W A;  1DP9 A;  3FC7 A;  3CHW P;  1FOF A;  1FSY A;  4EBP A;  1HVB A;  2VGL M;  3C5A A;  5AQ7 A;  1CEF A;  5J3W A;  4ZBE A;  2ZQD A;  4OP5 A;  3UDF A;  2L0W A;  1ONG A;  3PXP A;  1T1B A;  3LIB A;  1SCW A;  3RH8 B;  3Q1F A;  1FIK A;  2P9V B;  4KZ8 A;  2H0T A;  1STZ A;  3IWQ A;  3WS1 A;  3MS6 A;  3T1S A;  4H6J B;  3NY4 A;  4ETZ A;  3RJU A;  4HJ4 A;  2H10 A;  4N9K A;  2Y91 A;  3H82 A;  4OQG A;  1H8Y A;  3ZCZ A;  4Z9Q A;  2Y8H A;  2BLS A;  1TDL A;  2H28 A;  4GJ4 A;  3NBL A;  1Q2Q A;  2UWX A;  5A93 A;  1GHM A;  1YQS A;  1T19 A;  2QMI A;  5FQI A;  3BYD A;  5EVI D;  2CMN A;  4GCZ A;  1TVF A;  4WZ5 C;  5AQB A;  4PMA A;  2WZX A;  2I9V A;  2GDN A;  3Q7Z A;  4MBH A;  3KYZ A;  3FV7 A;  4P6Z S;  2HP6 A;  3MR0 A;  4YNR A;  3M6B A;  3WS4 A;  1G68 A;  2EFU A;  3CAX A;  4PHT A;  4OQI A;  1NXY A;  3S7O A;  4R3J A;  3EQV A;  3G34 A;  2WKH A;  1T1A A;  4L9G A;  3GTC A;  1K56 A;  2RL3 A;  2B02 A;  2PYP A;  4B4Z A;  4M3K A;  1K6S A;  3GQZ A;  1ZG4 A;  4KZ7 A;  4BBT A;  1YAX A;  3Q7V A;  4GHI B;  5FI2 A;  1ERO A;  4FH4 A;  1YLT A;  5FEG A;  2E8I A;  2PDR A;  5HAR A;  3UMD A;  4F3L A;  3OLO A;  5E2G A;  4LV3 A;  4S2L A;  2O99 A;  2D02 A;  1WE4 A;  3NOT C;  3M2J A;  1JWZ A;  3LO7 A;  3UDI A;  1DRM A;  2X02 A;  1K55 A;  2WGV A;  3QNB A;  3CZD A;  1WYB A;  1XGI A;  2WGI A;  4Y5F A;  2VV7 A;  2JKG A;  1T18 A;  3LEQ A;  5CGX A;  1ES2 A;  2O0Y A;  1E3U D;  5EV0 A;  3T12 B;  3HRE A;  4IBX A;  3C7V A;  3C2W A;  3ITA A;  3Q81 A;  5F1F A;  1NLY A;  5IU1 A;  4GKU A;  4LEN A;  3KSH A;  4JXG A;  4LLO B;  4Q0I A;  1W63 M;  5FQ9 A;  2Q0O A;  3D9Y A;  1YPR A;  5JYO A;  4ZTK A;  4D60 A;  4BBV A;  3GEC A;  4I5S A;  3MZE A;  4QHC A;  2JE5 A;  5HFO A;  3RTY A;  3IWI A;  3PYP A;  4P0M A;  4ME4 A;  2JC7 A;  4E3J A;  3OC2 A;  4OON A;  1CI8 A;  4Y2F A;  1KE0 A;  3UNW A;  4CLC D;  4GB7 A;  4RVA A;  1PIO A;  4GOG A;  1XJ2 A;  1AXB A;  1XJ3 A;  3Q82 A;  3PHY A;  3C4O A;  1K57 A;  4AFI A;  2OV5 A;  1RGY A;  2PR6 A;  3QP4 A;  4BD1 A;  4BJP A;  4FOF A;  4ARZ B;  4DF6 A;  3KSI A;  2Z2L B;  4X55 A;  1ODV A;  1GA9 A;  1H8Z A;  2PBY A;  4MCW A;  2O9C A;  4IVI A;  3QHY A;  2EX9 A;  2ZC5 B;  2B18 A;  4U0X A;  3VE4 A;  4BL2 A;  1PNE A;  3IXH A;  4OPQ A;  1K55 C;  3C7U A;  3EWK A;  5CXW A;  3MF0 A;  2R78 A;  3BQA A;  4OLG A;  3SS3 A;  3FG8 A;  1MY8 A;  4I3I A;  2VV8 A;  3CWF A;  4GNU A;  4EUV A;  4S2P A;  5FI6 A;  2M7U A;  1XFQ A;  4CQH A;  3LI8 A;  1C3B A;  3BWL A;  5AQA A;  1ZG6 A;  4S2K A;  1VEU A;  4RA7 A;  1NRF A;  1HLU P;  3IH9 A;  1S6R A;  5CHU A;  5E2F A;  4PM6 A;  2J3T D;  1E4D A;  1S66 L;  2B95 A;  1XFN A;  5HZH A;  1EW0 A;  4DDS A;  2JKR M;  2V1A A;  3LGO A;  3HUN A;  1MWR A;  3OOV A;  4UA7 A;  2VK3 A;  4YOF A;  5KSH A;  3P01 A;  3W4Q A;  2OAQ 1;  5CER A;  1K57 C;  3T4T A;  3UME A;  3GR2 A;  4N1X A;  5DF7 A;  1JTG A;  3U4L P;  1NYY A;  3ZDJ A;  5DVA A;  2A24 B;  4BLM A;  1LT0 A;  4FSF A;  3UPN A;  4Q0J A;  4CLC A;  5DKK A;  5E2E A;  2VGJ A;  4HNB A;  3RXX A;  1L0G A;  3VP4 A;  3ZG7 B;  2OWJ A;  4X1L A;  4IVK A;  2XF3 A;  3G2Z A;  1VQQ A;  2Y2H A;  3TSG A;  4DE2 A;  5MC7 A;  5DTT A;  3SS4 A;  2PYR A;  4YIN A;  5EVI B;  2Y2L A;  4X69 A;  2V8F A;  4FD8 A;  2VLG A;  1ESU A;  4Y17 A;  1IFQ A;  4IJG A;  4UA6 A;  2ACG A;  5A90 A;  3B3X A;  3FKW A;  4JF4 A;  2WZZ A;  2PU2 A;  1H8M A;  1WYC A;  4XT2 B;  4X68 A;  5CHJ A;  2EX6 A;  3TOI A;  5K5B A;  3PAG A;  3ICY A;  5DJT A;  2WKR A;  4PM8 A;  2ZQC A;  1PW1 A;  5HAQ A;  2PD7 A;  2M1C A;  3QNC A;  4S2I A;  4OKP A;  1LSV A;  3DWZ A;  5CRF A;  3BFF A;  3SW1 A;  4FTX A;  3PBO A;  2VKS A;  3KYE A;  2HPB A;  3OPH A;  1BSG A;  2HJE A;  3KYQ A;  5FA7 A;  3PBN A;  2FH5 A;  4GZB A;  2ZL1 A;  4HJ6 A;  4N1H A;  5KIZ A;  1J3W A;  2O9A A;  2ZQ9 A;  1IYS A;  3GSG A;  4E3K A;  4RX3 A;  2W3H A;  4LRX C;  5FAS A;  3O88 A;  1N9N A;  3F1O B;  3LR4 A;  3ZG5 A;  1GCE A;  2GNX A;  2ZM0 A;  4F94 A;  3F1N B;  2W0N A;  4XXR A;  4JGO A;  2V8C A;  3AGD A;  4C75 A;  4IUH A;  5M19 A;  3BY9 A;  2Z6C A;  4JXS A;  2FFF B;  2Y2I A;  3LYX A;  1DJC A;  5FAO A;  5CHM A;  3PTE A;  3ZFZ A;  1S1Z A;  3IH8 A;  1VET A;  4PKY A;  3PR6 A;  4P6Z M;  3A0R A;  3IX3 A;  4PM5 A;  2PBD P;  1T1C A;  1ES5 A;  2Y2Q A;  4NXG A;  4EWF A;  4KQQ A;  4WBG A;  2ZOI A;  4G3K A;  5KMW A;  1ERQ A;  3MXS A;  1D1J A;  2MJ6 A;  3CI6 A;  3TW8 A;  2JCH A;  3BM6 A;  5HD5 A;  1H0M A;  3CUE C;  3L9K A;  1Y54 A;  3HJK A;  4HBT A;  5FAP A;  5HDD A;  2WKE A;  3JPU A;  1XGJ A;  4UAA A;  3H7W A;  5C5K A;  3MZF A;  4MN7 A;  2A3U A;  3ZYT A;  2GZA A;  1MKM A;  1SKO B;  2XQZ A;  2VGK A;  3HL9 A;  4JF6 A;  1ES3 A;  3LIE A;  1P97 A;  1LSX A;  4HP9 A;  3KX0 X;  4E3O A;  1S67 L;  2ZBB A;  3GDI A;  4R4S A;  5I5L A;  1MWU A;  5FAQ A;  5FQM A;  1RCJ A;  4MBK A;  3NOU C;  4WZ5 A;  4L9E A;  3G2Y A;  2OLU A;  4C3Q A;  1ONH A;  2GX5 A;  3Q07 A;  1CK3 A;  1H3Q A;  4H8R A;  3NEC A;  4LV2 A;  1ESI A;  5TBM B;  3JYI A;  5CEB A;  5IS1 A;  2ZC6 B;  3MBZ A;  5L09 A;  5DTK A;  2BG1 A;  5J4E A;  4EBN A;  3LIF A;  3O87 A;  1ALQ A;  4Y13 A;  5GHZ A;  4UQI S;  1PRQ A;  4OPZ A;  3BQ8 A;  3D72 A; 
#chains in the Genus database with same CATH homology
 1KE3 A;  2V20 A;  2ZM8 A;  5EPH A;  3VP0 A;  3VP3 A;  1TDG A;  3C7V A;  3ITA A;  4Y0U A;  1NYM A;  4ID4 A;  3Q81 A;  5F1F A;  1IEL A;  3PBS A;  5DF9 A;  4KZ9 A;  3VFF A;  2EXA A;  4GKU A;  4XUZ A;  3HVF A;  4KEN B;  3ZG8 B;  2G2U A;  1JWV A;  2HDQ A;  4LEN A;  4ZAM A;  1K4E A;  4JXG A;  5FQ9 A;  3MXR A;  4P85 A;  5IHV A;  3BFE A;  1L0D A;  1XPB A;  5JYO A;  4ZTK A;  5BOH A;  3MZE A;  3O3V A;  1PWC A;  2H5S A;  1LL5 A;  2JE5 A;  4QHC A;  5EOO A;  1M40 A;  5FQQ A;  5FQJ A;  5HFO A;  5TFQ A;  2Y2G A;  3IWI A;  4MNR A;  4DXC A;  4P0M A;  1G6A A;  3N6I A;  4C6Y A;  1XA7 A;  4BQM A;  2JC7 A;  1FCM A;  3IF6 A;  4E3J A;  3OC2 A;  1KE4 A;  1IYQ A;  4OON A;  1KGG A;  3MZD A;  3BLM A;  1EI5 A;  1CI8 A;  4QB8 A;  2WAE A;  1KE0 A;  4OLD A;  2XD5 A;  3A3I A;  2P9V A;  1YLZ A;  3UNW A;  3ITB A;  1IKI A;  5KZH A;  4GB7 A;  3E2K A;  4KQR A;  5GLD A;  2R9W A;  4RVA A;  3UPP A;  1PIO A;  3OPL A;  4GOG A;  1AXB A;  3IF5 A;  3Q82 A;  3ZG0 A;  2X01 A;  3UE1 A;  3MFD A;  1L2S A;  3C4O A;  1K57 A;  1YLY A;  4JLF A;  3V50 A;  4S2N A;  3HUO A;  2OV5 A;  4D2O A;  1RGY A;  3MKE A;  4R23 A;  2ZQ7 A;  1YMS A;  4R0Q A;  4BD1 A;  2C6W B;  4BJP A;  4KZB A;  4DF6 A;  3FZC A;  1PWG A;  1MBL A;  3ZGA B;  2Z2L B;  2G2W A;  5J8X A;  2JBF A;  1ERM A;  4WMC A;  1BUE A;  2B5R A;  3HLD A;  4NET A;  4X55 A;  1GA9 A;  2C5W B;  4K91 A;  4WMC D;  1H8Z A;  2PBY A;  3OPR A;  5EUA A;  1NJ4 A;  1L0E A;  5CGS A;  1E25 A;  4IVI A;  2WKI A;  5DF8 A;  2HP5 A;  3QHY A;  1SDN A;  3UPO A;  3GRJ A;  2EX9 A;  2WUQ A;  2Y55 A;  3S22 A;  3AGF A;  2ZC5 B;  3FWL A;  3OZH A;  4U0X A;  4BL2 A;  1MXO A;  2ZD8 A;  3C4P A;  4QY5 A;  3BFC A;  2Z2M B;  1KGF A;  1QMF A;  1K55 C;  3IXH A;  4OP8 A;  4OPQ A;  3VOY A;  5CED A;  5GLB A;  3C7U A;  4P87 A;  4RX2 A;  1PWD A;  2IWD A;  1L0F A;  4WZ4 A;  5CXW A;  3SH9 A;  1JWP A;  1MWT A;  3ZG9 B;  1MPL A;  5EOE A;  4OLG A;  2WGW A;  3HLB A;  1O7E A;  3SS3 A;  2ZMA A;  1NZO A;  4MBF A;  2CC1 A;  1HZO A;  2EX8 A;  3IXB A;  1MY8 A;  1YLJ A;  3N7W A;  3IXG A;  4L0L A;  4OPR A;  1FR6 A;  2DCF A;  3ZVT A;  4GNU A;  4S2M A;  4E3M A;  4O7D A;  4S2P A;  5FI6 A;  2J9O A;  5CTM A;  2Y2M A;  3VMA A;  1IKG A;  1XA1 A;  3GV9 A;  2RCX A;  3WS2 A;  1BUL A;  1ES4 A;  3IHA A;  2WAD A;  4ZJ3 A;  1KVM A;  1C3B A;  4N92 A;  2Y2J A;  5AQA A;  3V3S A;  4IED A;  4Y0T A;  3W4O A;  1ZG6 A;  4S2K A;  1PZO A;  2OSU A;  4ZDX A;  3G35 A;  1N9B A;  3IF6 C;  3IQA A;  4RA7 A;  1FSW A;  1K4F A;  4QU3 A;  1BLC A;  1NRF A;  2XGN A;  1K38 A;  3IH9 A;  5E2H A;  1S6R A;  1GA0 A;  5CHU A;  4OOL A;  5E2F A;  4PM6 A;  1KDS A;  2DRW A;  3CMZ A;  3NI9 A;  3UE3 A;  1E4D A;  4ZJ1 A;  3N4I A;  4DDS A;  3NCK A;  1LL9 A;  3AGE A;  5F83 A;  1XKZ A;  3HBR A;  5E43 A;  4KZ4 A;  3HUN A;  1TEM A;  3M2K A;  1MWR A;  3HLC A;  2IWB A;  4UA7 A;  1S0W A;  1YM1 A;  5GHY A;  5KSH A;  3W4Q A;  3OCN A;  5CER A;  5TGF A;  3CJM A;  1BLP A;  4R3B A;  1IYP A;  1K57 C;  3IT9 A;  2J7V A;  4OOY A;  3VP1 A;  3GR2 A;  4E3N A;  1IEM A;  4A5R A;  4S2N C;  3SOI A;  4N1X A;  1Z6F A;  3BEC A;  5DF7 A;  1KGE A;  2XEP A;  5F82 A;  2H0Y A;  1JVJ A;  4PPR A;  1JTG A;  3PAE A;  4MEZ A;  1LLB A;  1NYY A;  4JBF A;  4X56 A;  4B88 A;  1J9M A;  3ZDJ A;  1XX2 A;  5DVA A;  3S4X A;  1GHI A;  3LCE A;  3VOZ A;  1FR1 A;  1XXM A;  4BLM A;  1PZP A;  1VM1 A;  3ISG A;  4FSF A;  3NIA A;  3DTM A;  4IBR A;  3UPN A;  3P09 A;  3HLF A;  2EFX A;  3UN7 A;  1FQG A;  4E6W A;  5CTN A;  2ZC3 B;  5E2E A;  3G30 A;  5HAP A;  2ZM2 A;  4JXW A;  2VGJ A;  1RGZ A;  1W7F A;  4ZJ2 A;  1RP5 A;  4OQI A;  1L0G A;  3RXX A;  3I7J A;  1PI5 A;  3V3R A;  3VP4 A;  3ZG7 B;  1W8Q A;  4N9L A;  4PM9 A;  2ZQA A;  2QZ6 A;  5EE8 A;  3VFH A;  1ZKJ A;  3WRT A;  1KDW A;  4IVK A;  2XF3 A;  4BEN A;  3G2Z A;  4DE1 A;  1VQQ A;  5FAT A;  2Y2H A;  2FFY A;  3FKV A;  4OOM A;  1ZC2 A;  3TSG A;  3W4P A;  4DE2 A;  5DTT A;  3S1Y A;  2ZLY A;  3SS4 A;  1IYO A;  4YIN A;  1HTZ A;  5EVI B;  3BFG A;  4DXB A;  2Y2L A;  3HLG A;  1NY0 A;  4X69 A;  5L2F A;  3VSK A;  3M6H A;  3G32 A;  5JYP A;  2WYX A;  4BL3 A;  2HP9 A;  5HW3 A;  4HES A;  1LI0 A;  4FD8 A;  3IHB A;  5FI7 A;  1SHV A;  1ESU A;  1EWZ A;  4OPY A;  4Y0O A;  1I2W A;  4GDN A;  4UA6 A;  5A90 A;  1YT4 A;  3B3X A;  3FKW A;  4JF4 A;  1YLW A;  1K6R A;  2HDU A;  2Y2O A;  2XFS A;  1U60 A;  3P98 A;  2WZZ A;  2OLV A;  2PU2 A;  4R4R A;  5M1A A;  5KSC A;  4Y7P A;  4EQI A;  1CEG A;  1WYC A;  3OCL A;  4KG5 A;  4X68 A;  5FQK A;  5CHJ A;  2EX6 A;  3TOI A;  1LI9 A;  4FCF A;  5F1G A;  1SKF A;  3G31 A;  4K0W A;  4X53 A;  4WEJ A;  4U0T A;  1Q2P A;  3PAG A;  3IXD A;  5HL1 A;  3MKF A;  1HD8 A;  4DRT A;  3BLS A;  3Q7V B;  4PM8 A;  4LV1 A;  3PBR A;  4RYE A;  1K56 D;  4PM7 A;  3UO9 A;  2ZQC A;  4UHU A;  1PW1 A;  3N8S A;  5GL9 A;  2X71 A;  4B4X A;  5FSR A;  5HAQ A;  2XDM A;  4UA9 A;  1NZU A;  4U3T A;  4JXV A;  4S2I A;  2Y4A A;  3QNC A;  4OKP A;  2Y59 A;  3UY6 A;  4KZ6 A;  4JF5 A;  3UDX A;  3DWZ A;  3ZVW A;  3V39 A;  4R1G A;  3BFF A;  4OQH A;  5CRF A;  3PBO A;  3A3F A;  2HPB A;  3OPH A;  1BSG A;  4GD8 A;  3RXW A;  5AQ9 A;  4E3I A;  4KZA A;  5EEC A;  1KVL A;  4JPM A;  5FA7 A;  1K54 C;  3PBN A;  4JKT A;  4GZB A;  4N1H A;  1CI9 A;  2ZQ9 A;  1I2S A;  3SH8 A;  1GHP A;  1IYS A;  4XUX A;  3W8K A;  4EV4 A;  4WEL A;  3GSG A;  5EVL A;  2Y2N A;  5TR7 A;  4E3K A;  3PBT A;  4LV0 A;  3WS0 A;  4RX3 A;  5FAS A;  3O88 A;  4X6T A;  3ZG5 A;  4KG6 A;  5CEC A;  3DWK A;  1YLP A;  3A3J A;  3NDG A;  2A49 A;  1GCE A;  2DNS A;  2J9P A;  4WM9 A;  1LHY A;  3V5M A;  2ZM0 A;  5HAI A;  1FOF A;  4P6B A;  4F94 A;  2XH9 A;  4KG2 A;  4XXR A;  3WS5 A;  3LY3 A;  3BEB A;  4S2J A;  4OH0 A;  1FSY A;  3AGD A;  4C75 A;  2XLN A;  3WRZ A;  3HLE A;  4EBP A;  5M19 A;  1SDE A;  1HVB A;  3C5A A;  2Q9N A;  4JXS A;  5AQ7 A;  1CEF A;  1MKI A;  2FFF B;  2Y2I A;  4ZBE A;  1DJC A;  2EXB A;  5FAO A;  5GHX A;  2ZQD A;  4OP5 A;  5EVI C;  5G18 A;  5CHM A;  2XR0 A;  3PTE A;  4QD4 A;  3UDF A;  3ZFZ A;  4GN2 A;  3IF6 B;  4NK3 A;  1K54 A;  1ONG A;  1O07 A;  1W5D A;  3IH8 A;  1SCW A;  3DW0 A;  4MLL A;  1XP4 A;  3WWX A;  3Q1F A;  2P9V B;  2IWC A;  1W79 A;  4KZ8 A;  2H0T A;  4GD6 A;  5DTS A;  4EUZ A;  2ZJ9 A;  4PM5 A;  3CG5 A;  3IWQ A;  4KQO A;  3WS1 A;  1ES5 A;  1MWS A;  2HDS A;  4K0X A;  3NY4 A;  3VSL A;  2Y2Q A;  5D3O A;  2ZC4 B;  3RJU A;  4E3L A;  2H10 A;  5U47 A;  4EWF A;  4N9K A;  1DY6 A;  4KQQ A;  4WBG A;  2Y91 A;  2Q9M A;  4E6X A;  4LCL A;  4OQG A;  1H8Y A;  3ZCZ A;  4CJN A;  4Z9Q A;  5KMW A;  1N4O A;  2BLS A;  3G4P A;  1ERQ A;  1I5Q A;  1TDL A;  3MXS A;  4YFM A;  3D4F A;  4DE3 A;  4S2O A;  1PYY A;  2XK1 A;  1BLS A;  3FYZ A;  1PI4 A;  3NBL A;  3HLW A;  1Q2Q A;  2UWX A;  2XD1 A;  3TG9 A;  5A93 A;  1GHM A;  2JCH A;  3BM6 A;  1YQS A;  2QMI A;  4GDB A;  5EVI A;  5FQI A;  3BYD A;  3ZHH A;  1BTL A;  4WEK A;  5EVI D;  4EBL A;  5A92 A;  3EQU A;  1Y54 A;  3NDE A;  1M6K A;  1TVF A;  4BD0 A;  4HBT A;  5FAP A;  2Y2K A;  4WZ5 C;  3N8R A;  2PU4 A;  5AQB A;  4PMA A;  2WZX A;  4MBH A;  2GDN A;  1BZA A;  2WKE A;  3Q7Z A;  2XFT A;  3FV7 A;  1XGJ A;  5CGW A;  2HP6 A;  4UAA A;  3M6B A;  3WS4 A;  5GLC A;  5HX9 A;  4FH2 A;  2I72 A;  3BRM A;  3MZF A;  1G68 A;  1QME A;  2A3U A;  4QJG A;  4DE0 A;  2EFU A;  4Q8I A;  2QPN A;  1W8Y A;  2WGW B;  5FDH A;  2XQZ A;  1NXY A;  1BT5 A;  1PW8 A;  2WAF A;  1FCN A;  2VGK A;  1BLH A;  3HL9 A;  3EQV A;  4JF6 A;  4R3J A;  3ZNT A;  3G34 A;  2WKH A;  3GTC A;  1K56 A;  2RL3 A;  3A3D A;  1ES3 A;  4QY6 A;  1YMX A;  4KZ5 A;  3SH7 A;  4B4Z A;  1FCO A;  4M3K A;  3BFD A;  1DJB A;  1K6S A;  4HBU A;  3GQZ A;  1ZG4 A;  4KZ7 A;  4E3O A;  2ZQ8 A;  5I94 A;  4R4S A;  4OVD A;  3E2L A;  3LY4 A;  2WK0 A;  1MWU A;  3Q7V A;  4CPK A;  5FAQ A;  5M18 A;  5FI2 A;  5FQM A;  1ERO A;  4WYY A;  1RCJ A;  4MBK A;  5GLA A;  4FH4 A;  3VP2 A;  1YLT A;  2V1Z A;  4WZ5 A;  5A91 A;  2E8I A;  3G2Y A;  3HUM A;  2OLU A;  2ZC7 A;  4C3Q A;  3SS5 A;  4OQ0 A;  5HAR A;  1ONH A;  2V2F F;  4KZ3 A;  3Q07 A;  2EX2 A;  1JTD A;  1CK3 A;  3N8L A;  4H8R A;  3NC8 A;  4LV2 A;  3GMW A;  3ZNY A;  5E2G A;  1ESI A;  2HDR A;  4LV3 A;  4S2L A;  1WE4 A;  3JYI A;  5CEB A;  1H5X A;  3M2J A;  4LCM A;  2ZC6 B;  1JWZ A;  3LO7 A;  3MBZ A;  5DTK A;  3UDI A;  2BG1 A;  2X02 A;  4EBN A;  1K55 A;  4DKI A;  2WGV A;  3QNB A;  2Y2P A;  3A3E A;  3CZD A;  2J8Y A;  2P74 A;  3O87 A;  1WYB A;  1ALQ A;  4HEF A;  1XGI A;  2WGI A;  4DDY A;  3GVB A;  3IWO A;  5GHZ A;  1DJA A;  3O86 A;  2R9X A;  4OPZ A;  3PBQ A;  1E3U A;  3LEZ A;  3OPP A;  5CGX A;  1ES2 A;  1K25 A;  1E3U D;  3UE0 A;  1OME A;  3HRE A;  4IBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...