1G68A

Pse-4 carbenicillinase, wild type
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
266
structure length
266
Chain Sequence
b'SKFQQVEQDVKAIEVSLSARIGVSVLDTQNGEYWDYNGNQRFPLTSTFKTIACAKLLYDAEQGKVNPNSTVEIKKADLVTYSPVIEKQVGQAITLDDACFATMTTSDNTAANIILSAVGGPKGVTDFLRQIGDKETRLDRIEPDLNEGKLGDLRDTTTPKAIASTLNKFLFGSALSEMNQKKLESWMVNNQVTGNLLRSVLPAGWNIADRSGAGGFGARSITAVVWSEHQAPIIVSIYLAQTQASMEERNDAIVKIGHSIFDVYTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE PSE-4
publication title Insights into the molecular basis for the carbenicillinase activity of PSE-4 beta-lactamase from crystallographic and kinetic studies.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 98
structure length 266
sequence length 266
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1g68A00
1XA1A 1NZUA 3GQZA 4JF5A 2ZLYA 2HDUA 4KG6A 4S2OA 3NDGA 1NZOA 1K6RA 3UNWA 3Q7ZA 2Y59A 2CC1A 5CGSA 4DE1A 3PAEA 1BLCA 2ZC5B 1L0EA 4L0LA 1K4FA 2I72A 4EUZA 1RGZA 2Y2IA 3C7VA 1JTGA 3WS0A 2EX2A 2EX8A 5U47A 2EX9A 5I94A 3MZFA 4JXVA 1YLWA 4KQQA 1KGEA 3WRTA 4WMCD 3IT9A 5EE8A 1PW1A 1MWSA 2Z2MB 4DRTA 3IWQA 3PAGA 5HAIA 4XUXA 3P09A 4NK3A 1ZG4A 3PBOA 2XEPA 1KDWA 2R9WA 5E2GA 2H10A 4OOMA 1KVMA 1OMEA 1PI5A 3WS2A 1BULA 1LLBA 4PPRA 5FAPA 4E6XA 3FYZA 3ITAA 4ZTKA 4R3JA 3ZHHA 4N1HA 3ZDJA 1Q2PA 3HUOA 1NRFA 4IBXA 4RA7A 5AQ9A 1XP4A 4IBRA 4PMAA 4S2PA 3BM6A 4HBUA 5EUAA 2WKIA 3GTCA 5FQMA 1WYCA 1PZPA 2IWDA 3OC2A 4P0MA 2V1ZA 3PTEA 1SDNA 3M6BA 4RX2A 3LY3A 3NY4A 4ZAMA 1K25A 4IVIA 4S2NC 5GLDA 4LV3A 3LEZA 1W8QA 2Y4AA 2JBFA 1K54C 1BUEA 4LV0A 2P9VB 3UDFA 1GA0A 1ZC2A 3Q81A 4WMCA 3NI9A 3C4PA 1ERQA 5GLBA 1MWRA 1Q2QA 4X56A 4OOLA 2ZQAA 5HAPA 1K6SA 5DF7A 3VSLA 3DWZA 1K56A 3BFDA 3N8LA 1JVJA 3A3IA 3MXRA 3O88A 3VSKA 4FSFA 3HLBA 4QU3A 3UPNA 1JWVA 1M40A 4EWFA 1TDLA 5DTSA 5F82A 4UAAA 1W7FA 2R9XA 2DNSA 3UPOA 5CRFA 3ZG8B 1BLPA 4ZJ3A 3P98A 4HEFA 4N1XA 5EVLA 3V39A 2WGWA 3IF6C 4BL3A 1PZOA 1MPLA 1W5DA 4PM7A 5G18A 4MNRA 4GDNA 2J9PA 5CHMA 4BJPA 4KQOA 4DXCA 3UE1A 5JYPA 4R23A 4S2JA 5JYOA 2C6WB 3IWIA 3OCLA 4E3MA 2XFTA 5CTNA 2P9VA 2XR0A 4MBFA 1E25A 2QZ6A 1KGGA 1U60A 3UN7A 1CEFA 3NIAA 3IF6B 5HARA 3ZNTA 4C3QA 3PBNA 1H8YA 1G68A 4K91A 3VMAA 1JTDA 1MY8A 4OOYA 5D3OA 3VFHA 2P74A 3DWKA 5CERA 2RCXA 1ES4A 1MXOA 5FQKA 1YLJA 5HFOA 3E2LA 5EOOA 2Y2QA 5TR7A 5J8XA 3E2KA 4FCFA 5F1GA 2GDNA 5M1AA 3Q1FA 4OP5A 2H5SA 3Q7VB 5FAQA 4RX3A 1MWUA 1O07A 5KZHA 1K57C 3IHBA 5FQ9A 5GLCA 3IXBA 2WZXA 1S0WA 4MBKA 5EECA 4DE3A 5KSCA 4KZ6A 3N8SA 3SH9A 3MZEA 4E6WA 3BEBA 1NY0A 2XFSA 4E3OA 2XQZA 3N4IA 4E3JA 2JE5A 4GNUA 4N92A 1XXMA 1XGJA 5FATA 5AQ7A 3NBLA 2HDSA 3RXWA 4OPYA 5DTKA 4D2OA 5EVIA 1CEGA 1L0FA 1MKIA 1TDGA 4JLFA 4KZBA 3IF5A 3W4QA 2B5RA 2C5WB 4EQIA 1GHMA 4PM9A 3AGDA 3VP4A 4GKUA 4IVKA 1C3BA 3CJMA 1I2SA 1EI5A 4LV1A 4U0XA 4X6TA 4OQIA 1FQGA 1E3UD 3SH8A 1YMXA 5GL9A 5A92A 3HVFA 3QNBA 3ZG9B 3IQAA 3GVBA 4LV2A 4PM6A 4B88A 2QMIA 1FR1A 4KQRA 5CEDA 4DF6A 4KZ4A 3B3XA 1BSGA 1K55C 4JBFA 1NYMA 4KZ9A 4EBNA 1IYSA 4LCLA 4WZ4A 2ZQ9A 1BLSA 3IH9A 3UDXA 3WS4A 4S2LA 5GHZA 1GHIA 1YT4A 2ZC7A 2HP5A 2ZM8A 2ZM0A 5CHJA 4BD0A 1GCEA 1SDEA 2Y2OA 1WE4A 2HPBA 3I7JA 4GD6A 4UA9A 4UA7A 4X68A 2Z2LB 3WS5A 3RXXA 2J8YA 2XF3A 5GHXA 3OPLA 1FCOA 3MKEA 1KE4A 3BLSA 3CG5A 4IEDA 1KDSA 3M2KA 2A3UA 4QY5A 4P87A 2J7VA 3LO7A 2QPNA 3IXGA 3UPPA 4GDBA 5BOHA 4ZJ1A 3C4OA 3PBTA 3QNCA 4P85A 5CGXA 5FSRA 3RJUA 3BFGA 3Q07A 1PWCA 3G2YA 3PBRA 1HD8A 4Y0UA 1E3UA 4HESA 2WAEA 3N7WA 3UDIA 1YLZA 2WZZA 3PBSA 2WADA 4BLMA 4WELA 4GD8A 4GN2A 3OPRA 3SS5A 2X01A 4GB7A 3IXDA 3VP2A 1ONGA 3FV7A 4E3KA 4QY6A 3G2ZA 1SCWA 3VOYA 1MBLA 3A3JA 5E43A 1KVLA 4ZDXA 3M2JA 3W8KA 4WYYA 3HUMA 3HLCA 3V50A 3AGFA 5FI6A 4DDYA 1ERMA 3O3VA 2VGKA 4FD8A 3HLFA 1IYPA 3ZNYA 3DTMA 3WWXA 5EVIC 5DF8A 4YFMA 4YINA 4EBPA 1XGIA 1M6KA 4JF6A 3W4PA 1N4OA 1GHPA 1Y54A 3GV9A 3IH8A 1K4EA 2FFYA 4R4RA 5IHVA 3SH7A 2OSUA 3CMZA 4H8RA 4OKPA 5HL1A 1AXBA 3IHAA 4U3TA 3V3RA 4OH0A 2BLSA 2FFFB 2HP9A 3EQVA 3OPHA 3HBRA 1KGFA 4OPZA 4BQMA 5DF9A 2WKEA 2H0YA 2Y91A 3VFFA 4E3LA 2DRWA 2XD5A 5FA7A 5DTTA 3UO9A 1S6RA 3BFFA 3BFCA 1IEMA 3FWLA 5KSHA 3HLDA 3S22A 3WS1A 4C75A 3HLWA 2V2FF 4X53A 2XGNA 2EXBA 1ESIA 2WAFA 4Y0TA 3Q82A 5A93A 3V5MA 5FQJA 3BYDA 3S1YA 4Q8IA 1E4DA 3TOIA 4WEJA 5TFQA 4GOGA 3SS3A 1JWPA 1LL9A 4WEKA 4WZ5A 4PM8A 4EBLA 1FSYA 3G4PA 3PBQA 4S2NA 5AQAA 4CJNA 2DCFA 1DJBA 4GZBA 4OP8A 1I5QA 2XDMA 3TG9A 2OV5A 1K54A 4HBTA 4LENA 5HW3A 3ZVTA 1PI4A 1YMSA 5E2FA 1EWZA 1ALQA 3GSGA 4JXGA 3IXHA 1CI9A 4OPRA 2WUQA 1PWDA 1SKFA 4LCMA 2Y2GA 1BT5A 2J9OA 2HDQA 4P6BA 3V3SA 3MBZA 3GRJA 2Y2LA 2IWCA 3GMWA 2WGIA 3NC8A 4N9LA 4NETA 1PW8A 4X55A 4JF4A 5EPHA 3WRZA 5EOEA 3VP0A 4E3NA 3MZDA 1I2WA 2X02A 3EQUA 4BENA 1Z6FA 1W79A 2RL3A 1L0GA 1BTLA 1VM1A 4R4SA 5L2FA 4R1GA 1PYYA 2HP6A 3IF6A 2A49A 3N8RA 1L0DA 2X71A 1G6AA 4EV4A 3ZGAB 4OQ0A 4F94A 5A91A 1IKIA 3DW0A 1ZG6A 3G35A 3G34A 3HLGA 4JKTA 2ZM2A 1ES5A 2G2WA 2XH9A 4BL2A 5FASA 4ZBEA 4B4ZA 1SHVA 2G2UA 4FH2A 3NDEA 4A5RA 2ZC6B 1IYOA 2Y2KA 3FZCA 3Q7VA 5FQQA 1WYBA 2Y2NA 3VOZA 5KMWA 1HTZA 2ZD8A 3BLMA 4PM5A 2Y2JA 1K56D 1QMEA 2EXAA 1XA7A 4M3KA 4MLLA 4RVAA 5FQIA 1RP5A 4C6YA 5FAOA 1DJAA 4KG2A 4K0WA 4OQGA 5F83A 3UY6A 1BLHA 1IYQA 1JWZA 3AGEA 2IWBA 3G31A 1ES2A 4S2KA 2EFUA 2ZJ9A 4QJGA 2WGWB 2JCHA 2ZQ8A 5E2EA 2Y55A 5TGFA 4OLGA 5AQBA 4K0XA 5M18A 3OCNA 2ZQDA 3TSGA 3ZG0A 1ESUA 1KE3A 2VGJA 3HLEA 4QB8A 5FI2A 1XPBA 2E8IA 1FSWA 1CK3A 3VP1A 1DJCA 4E3IA 1XKZA 3M6HA 3D4FA 4UHUA 4WM9A 3S4XA 1L2SA 2ZQCA 4WZ5C 1ONHA 1PWGA 4QD4A 3BECA 1K57A 4N9KA 5E2HA 1FCNA 4DE2A 3SOIA 3QHYA 2ZQ7A 2OLVA 2PU2A 4JPMA 5FI7A 3ZG5A 2WGVA 4FH4A 5HX9A 3A3FA 4S2IA 4RYEA 3C7UA 5CXWA 3OZHA 2Y2PA 4KZ7A 4WBGA 5CEBA 4CPKA 1FCMA 1CI8A 1YLTA 4KG5A 2Q9MA 4X69A 4R0QA 1FOFA 3NCKA 4OONA 5A90A 5CECA 2XD1A 3MFDA 2PBYA 4DKIA 1LHYA 5HAQA 5CTMA 4Y0OA 1J9MA 1H5XA 1YLPA 1DY6A 3O86A 1TVFA 1IKGA 2PU4A 1H8ZA 1TEMA 2Q9NA 1KE0A 3G30A 2XK1A 4Y7PA 5CGWA 5M19A 4JXWA 3ZCZA 4DDSA 1LI0A 4OLDA 4XXRA 1RCJA 3ZFZA 3ZG7B 1LI9A 1O7EA 3SS4A 2V20A 4OVDA 4QHCA 1LL5A 3GR2A 4MEZA 1MWTA 4BD1A 3O87A 2WYXA 4OPQA 2Y2HA 3MXSA 2XLNA 3FKWA 3G32A 3HL9A 2EFXA 5DVAA 1HZOA 2HDRA 1K55A 1EROA 4R3BA 1QMFA 3ZVWA 4JXSA 2ZC3B 1GA9A 2EX6A 1IELA 2WK0A 4ID4A 4KZAA 5EVIB 1YM1A 2H0TA 1FR6A 1W8YA 5EVID 3OPPA 1YLYA 4UA6A 1VQQA 4XUZA 3HUNA 4B4XA 3CZDA 1YQSA 2ZMAA 3MKFA 4U0TA 3ITBA 1XX2A 5FDHA 4DE0A 5GHYA 2ZC4B 1K38A 3IWOA 1BZAA 3LCEA 3W4OA 3A3DA 1ZKJA 5CHUA 1NXYA 4O7DA 3BRMA 3UE3A 1NYYA 1PIOA 3A3EA 3FKVA 5GLAA 4S2MA 3C5AA 2WKHA 3BFEA 4ZJ2A 5F1FA 3N6IA 1ES3A 3UE0A 2JC7A 4KZ5A 4OQHA 4KZ8A 4MBHA 3JYIA 4Z9QA 2Y2MA 4KZ3A 2BG1A 3VP3A 1HVBA 2OLUA 1NJ4A 2UWXA 1RGYA 3HREA 4KENB 3ISGA 1N9BA 3LY4A 4DXBA
chains in the Genus database with same CATH superfamily
4Q0IA 4LPZA 4S2OA 1NZOA 4Y5FA 2Y59A 4DE1A 1K4FA 4NXBA 2Y2IA 5TBMA 2G7UA 2EX2A 3MZFA 4JXVA 2Z6DA 5EE8A 3LUQA 4I3JA 3KSIA 4XUXA 4QPRA 2H10A 3WS2A 1PI5A 4E6XA 3ITAA 3ZHHA 4R3JA 4X1LA 4IBXA 3OBFA 1XFQA 1Z09A 2GJ3A 4PMAA 3BM6A 5EUAA 1PZPA 2IWDA 3OC2A 4P0MA 4HHDA 1SDNA 3NHQA 4RX2A 3NY4A 4LV3A 1G5UA 2JBFA 1GA0A 3H9WA 3C4PA 5GLBA 3LIFA 2PD7A 2P7JA 5AVEA 4FSFA 5HWVA 3UPNA 1TDLA 4UAAA 4HJ3A 2R9XA 2DNSA 1MZUA 5CRFA 3ZG8B 3P98A 5EVLA 4YWZA 1OTEA 1W5DA 1V9YA 5G18A 3DTIA 4X25A 2A2LA 2JKGA 4BJPA 4KQOA 4DXCA 4UQIM 4UQIS 3S7OA 3CAXA 4S2JA 5EM0A 3OCLA 5CTNA 2P9VA 4LFUA 2GZAA 2PR5A 1E25A 2QZ6A 1KGGA 1U60A 3KO6A 3NIAA 5HARA 5TJJA 1H8YA 4OOYA 4HJ6A 2P74A 3PHYA 5EOOA 3MQ0A 2LB5A 4RX3A 1MWUA 5GLCA 5KSCA 4KZ6A 3SH9A 3RH8B 2XQZA 3N4IA 2JE5A 4GNUA 5FATA 4GCZA 3QP2A 4OPYA 4R38A 3D72A 3W4QA 4JLFA 3VV4A 4EQIA 1GHMA 5HL6A 3CUEA 1OTIA 2XA7M 4IVKA 2XA7S 2W0NA 4U0XA 4OQIA 3LFVA 5HPFA 2J80A 3HVFA 3ZG9B 2PYRA 1FR1A 3MSHA 4KQRA 4NG2A 3K3DA 1UWPX 2O9CA 1K55C 4BBVA 2D02A 4LCLA 4WZ4A 2ZQ9A 4EU0A 1BLSA 4CLCA 2CMNA 2HP5A 2ZM8A 4K08A 1XJ2A 4HH3A 4LRXC 4UA9A 4UA7A 4EETB 3RXXA 4R6LA 3P01A 3E4PA 1KE4A 3CG5A 3DTEA 1MKMA 4IEDA 2A3UA 2EWVA 4R70A 1DP8A 4P87A 2QPNA 4NXGA 4Y3IA 3IXGA 3T4KA 3A0SA 3W2ZA 4ZJ1A 1LL8A 4P85A 3BFGA 1PWCA 4MN6A 4GHIB 1DP9A 3KYEA 4X1MA 3SS5A 3FV7A 2VLGA 4ZDXA 3W8KA 1CJFA 3HLCA 3V50A 3O3VA 2VGKA 3LI8A 4JGRA 2L0WA 4FD8A 3ZNYA 3DTMA 4P6ZS 2KOIA 4YFMA 2UV0E 3CI6A 1XGIA 1M6KA 1OPXA 4EEPA 2VJWA 3W4PA 4ARZA 3SH7A 2ZL1A 3OPHA 1ODVA 4E3LA 2DRWA 3UO9A 2K7SA 3FWLA 3HLDA 4CLCE 3WS1A 3V5MA 4RQ9A 4Q8IA 4GOGA 1V9ZA 4WZ5A 2DCFA 4GZBA 3TG9A 1I5QA 2OV5A 3EGDC 1EWZA 1ALQA 3GSGA 5FEFA 2J9OA 4P6BA 1LSXA 4I5SA 2INWA 4JF4A 1YSPA 3C30A 4GS9B 3S7PA 1I2WA 3EQUA 1Z6FA 1W79A 4HY8A 5HWTA 1PYYA 3N8RA 2X71A 4I3IA 1G6AA 3ZGAB 4BBTA 4JKTA 4NEED 2ZM2A 4BL2A 4ZBEA 4FH2A 4A5RA 1IYOA 2Y2NA 3KSFA 3F1OA 2V0WA 2EXAA 4M3KA 4WUJA 4G3WA 3AGEA 4S2KA 2EFUA 5DKKA 2VX8A 5TGFA 3HJKA 2ZQDA 3ZG0A 4QB8A 5FI2A 1T1BA 2D01A 1JNUA 5IU1A 3LICA 3VP1A 4BBUA 3OLOA 3D4FA 3LIDA 3VE4A 1TS7A 2E8JA 4EUVA 4QD4A 1PWGA 4N9KA 2VGLM 4FTXA 2VGLS 4DE2A 3SOIA 2HV1A 2V8FA 2OLVA 4S2IA 5CXWA 2PRFA 4CPKA 3T1XA 1YLTA 4KG5A 4R0QA 2XD1A 1G6OA 2NUPC 3KX0X 1YLPA 4Y7PA 2XK1A 5L09A 4G3KA 1RCJA 3ZG7B 1LI9A 4PKYA 4OVDA 1SZVA 1MWTA 1VHMA 4BD1A 2HJEA 2Y2HA 3FKWA 3HL9A 2EFXA 2HDRA 1K55A 4R3BA 2ZC3B 4KZAA 3E0YA 4HQAA 1VQQA 3HUNA 4B4XA 4MCWA 1YQSA 4YOFA 1XX2A 3EGXC 3MJQA 2V9AA 3PXPA 1NLZA 1TS6A 2J3TD 3UE3A 3BQAA 1NYYA 3CWFA 5GLAA 1W63Q 4S2MA 1ES3A 4OQHA 4KZ3A 3VP3A 2OLUA 5J4EA 2UWXA 3HREA 4HH2A 3ISGA 1XA1A 2W1TB 1DRMA 3ICYA 4WL9A 2HGVA 1A0KA 3UNWA 3Q7ZA 2W3HA 1OTAA 2OWHA 5U47A 5I94A 1KGEA 5FL3A 3WRTA 3IT9A 2V1BA 1PW1A 2ZBBA 3T1QB 5HAIA 4H6JB 2P08A 4NK3A 1KDWA 2R9WA 5KIZA 1UWNX 1OMEA 1LLBA 4PPRA 5FAPA 4EXOA 4DN0A 4ZTKA 4RA7A 1NRFA 3LGOA 3F1PB 3T4OA 4S2PA 1ZTUA 4DJ2A 2WKIA 1WYCA 2Y8HA 2V1ZA 3T12B 3LY3A 4IVIA 3LEZA 2VKSA 1W8QA 3LEQA 3TRCA 1K54C 4Q0HA 4LV0A 1S67L 3UB5P 3UDFA 4QWOA 3Q81A 4WMCA 3NULA 4F3LB 1MWRA 3JPUA 3V67A 3DWZA 1K56A 3LR5A 3N8LA 1MC0A 1JVJA 3A3IA 3DTKA 3NECA 4PHTA 1JWVA 1OTDA 2QJ5A 3ZQ5A 3UPOA 2VEAA 1BLPA 1D06A 4HEFA 4N1XA 3V39A 2WGWA 4BL3A 4WLAA 1K0KA 5HDDA 2W1RA 1CQAA 4EESA 4HP4A 5JYPA 5LBRA 1D7EA 3RTYA 2PYPA 1BYWA 2C6WB 4E3MA 2XR0A 3B42A 3UN7A 1CEFA 3IF6B 2I9VA 1YKDA 2O99A 1MY8A 3VFHA 1MXOA 3OOVA 5HFOA 3E2LA 3IX4A 2Y2QA 3E98A 3E2KA 2GDNA 5M1AA 4OP5A 2H5SA 3Q7VB 5FAQA 1H3QA 1K57C 3IHBA 3IXBA 4MBKA 4WN5A 3N8SA 1NY0A 4E3OA 4E3JA 5AQ7A 4EW7A 1N9OA 2HDSA 3RXWA 3F1NB 3RFBA 5DTKA 4D2OA 5EVIA 4NXEA 1L0FA 1I2SA 1EI5A 1GSWA 4LV1A 4X6TA 1E3UD 3SH8A 5GL9A 4LV2A 4PM6A 3JVUA 4DF6A 3MQQA 3BWLA 3D9YA 4MN5A 3S7QA 3WS4A 1YT4A 2ZC7A 3E4QA 2ZM0A 5CHJA 1WE4A 3UB7A 4GD6A 4L9FA 2J8YA 2XF3A 1FCOA 4ETZA 3M2KA 2PBDP 5J3WA 3NOTC 3D3OA 1N9BA 3Q07A 4Y0UA 1HD8A 4XT2B 3N7WA 3UB9A 2WZZA 3PBSA 4I39A 4WELA 1T1CA 4JGPA 2X01A 1HLUP 4QY6A 3VOYA 1MBLA 3A3JA 5E43A 2ZOIA 3IX3A 4WYYA 4O8GA 4DDYA 4O01A 1F5MA 5DF8A 3IX8A 2O0YA 2MJ6A 4LRZE 3KYQA 3IH8A 3H82A 5HWWA 5HL1A 1AXBA 3V3RA 4U3TA 4OH0A 2VK3A 3HBRA 2QYBA 1KGFA 4BQMA 5DF9A 2WKEA 3VFFA 2XD5A 5FA7A 3BFFA 1IEMA 2ZMFA 5KSHA 5TBMB 2VV8A 3HLWA 2V2FF 3Q82A 5A93A 3BYDA 3CPTA 4WEKA 4DXBA 3PBQA 2VZWA 1K54A 4HBTA 5HW3A 3ZVTA 4JXGA 2WUQA 1PWDA 1SKFA 3V3SA 1P9RA 4N9LA 3PR6A 1PW8A 4X55A 3LYXA 4E04A 1TD5A 5HSQA 4E3NA 2JKRI 3MZDA 3U4LP 1UGUA 1BTLA 4R4SA 4EV4A 4F94A 5A91A 1IKIA 1P97A 3G35A 3G34A 2R78A 3T50A 2G2WA 2KLIA 4B4ZA 1SHVA 5DJTA 1WYBA 3VOZA 5KMWA 1HTZA 1K56D 4L9GA 4MLLA 1XA7A 3DBAA 5FAOA 4KG2A 5F83A 2OWJA 1IYQA 1H8MA 2IWBA 1ES2A 1VETA 2K2NA 2JCHA 2ZQ8A 5DJUA 5M18A 3A0VA 1S66L 1FSWA 1DJCA 3DAVA 3UE6A 3S4XA 1VEUB 5G4YA 3H7WA 2PD8A 3BECA 2J3WA 1K57A 4UEYA 5E2HA 2HF6A 3QHYA 4Q0JA 2PU2A 5FI7A 2WGVA 4FH4A 5HX9A 2B95A 2Y2PA 1EW0A 2Q9MA 5A90A 3IS2A 1FOFA 3NCKA 5CECA 5HAQA 5CTMA 1LSVA 2Q0OA 4P6ZM 1DY6A 3O86A 2O9AA 1IKGA 1H8ZA 1TEMA 1KE0A 5CGWA 4L9EA 4JXWA 2BTFP 4GJ4A 3T1SA 3ZFZA 1LL5A 2WYXA 2JHEA 3G32A 5DVAA 1EROA 3ZVWA 4JXSA 1SKOA 1GA9A 2EX6A 5A8BA 5L10A 1FR6A 5EVID 3OPPA 3BW6A 1XJ4A 4UA6A 4XUZA 4G3VA 2OAP1 2B02A 5HPIA 5FDHA 2ZC4B 1K38A 4LLOB 1BZAA 1GSVA 3W4OA 4O7DA 1PIOA 3VE3A 4ZJ2A 5F1FA 3UE0A 4KZ5A 3NOUC 4KZ8A 4MBHA 3JYIA 4PAUA 1NJ4A 4CLCB 1RGYA 3PYPA 5HD5A 3LY4A 5EOEA 4HIAA 2HDUA 4Y17A 3UMDA 2CC1A 2ZC5B 1L0EA 2M1CA 4L0LA 4EUZA 1JTGA 1YLWA 4KQQA 2W3GA 3LI9A 1MWSA 2Z2MB 4GLQA 1KOUA 3PAGA 3P09A 3LIAA 3PBOA 1PFLA 3FYZA 1Q2PA 3HUOA 2O9BA 4B9OA 3HCYA 1XP4A 5AQ9A 4IBRA 4HBUA 3B33A 3PTEA 1XJ3A 4ARZB 1K25A 5GLDA 3R7WA 3EWKA 1XJ6A 2ZL1B 2Y4AA 1BUEA 3NI9A 2A24A 1ERQA 4X56A 4OOLA 2ZQAA 5HAPA 3VSLA 5EFWA 1XFNA 1P0ZA 3K2NA 4Y15A 3EEAA 3VSKA 2XRNA 3LR3A 1OT9A 3HLBA 3B47A 3HJIA 3IBJA 4EWFA 5DTSA 3L7HA 3IBRA 1W7FA 3GECA 4ZJ3A 1FILA 4FOFA 3T4LA 1PZOA 3EEHA 2Y79A 3QP4A 4JGOA 2J9PA 3UE1A 5J7EA 2ZMVA 4R23A 3BQ8A 1J3WA 3IWIA 2KX6A 2XFTA 4NXFA 1LT0A 2ZOHA 2FH5A 4PKYG 3CITA 1G68A 2BASA 1JTDA 5D3OA 1OTBA 2P04A 3DWKA 1ES4A 5FQKA 4DJ3A 5TR7A 5J8XA 5F1GA 3VOLA 3F1OB 1L3LA 5KZHA 2WZXA 4CLCD 1S0WA 4DE3A 4E6WA 3MZEA 3BEBA 2ACGA 4Y2FA 3U2AA 4N92A 1S4SA 3NBLA 4FUWA 3T4SA 4D60A 4KZBA 1LSWA 2B5RA 1F9IA 4MDZA 1GSXA 5DFYA 3CJMA 5A92A 3QNBA 4B88A 3QP6A 5CEDA 4KZ4A 3B3XA 1BSGA 3FG8A 1NYMA 4KZ9A 4EBNA 3UDXA 4S2LA 5GHZA 1GHIA 1F98A 2H28A 2WKPA 1SDEA 2Y2OA 2JKFA 2HPBA 4AFIA 2Z2LB 3WS5A 3MKEA 3BLSA 1KDSA 2J7VA 3LO7A 5K5BA 2YKFA 5BOHA 3QNCA 2HJ9C 1OJGA 4EEUA 5IT5A 2WAEA 3UDIA 4BLMA 2WADA 3MMHA 3OPRA 3IXDA 5HDSA 3G2ZA 1SCWA 2QWSA 3HUMA 3AGFA 5FI6A 1ERMA 1IYPA 4DMZA 2B18A 2L4RA 1N4OA 1GHPA 4R4RA 5IHVA 2JN7A 3CUEC 2WKRA 3IHAA 2J3TC 2BLSA 5FEGA 2HP9A 3EQVA 3K3CA 2M7UA 2H0YA 5F68A 5DTTA 1S6RA 3BFCA 3S22A 2XROA 4C75A 1OJ5A 4X53A 2EXBA 1S1YA 1ESIA 4Y0TA 5FQJA 1E4DA 4CLCC 3TOIA 4WEJA 1JWPA 4PM8A 3G4PA 5AQAA 4BMWA 2DMWA 1PI4A 1YMSA 3LIBA 1CI9A 4OPRA 2Y2GA 1BT5A 2HDQA 3MBZA 3GMWA 3P7NA 5EPHA 1NWZA 2HP6A 2A49A 1L0DA 5F5YA 2NUTC 1ES5A 1S1ZA 3NDEA 1S4RA 3FC7A 4Y13A 2ZC6B 3FZCA 2Y2KA 1H0MA 4LGWA 2ZD8A 3BLMA 1T1AA 2Y2JA 4ETXA 1QMEA 5FQIA 4RVAA 4C6YA 1RP5A 1DJAA 3UY6A 2HZ5A 1BLHA 1JWZA 2ZJ9A 2WGWB 4HOIA 5AQBA 1YPRA 3NJAA 3HLEA 1XPBA 2E8IA 4I3AA 3M6HA 4UHUA 1YSQA 1L2SA 4WZ5C 1FCNA 4JPMA 1CF0A 2WKQA 4RYEA 3C7UA 4YNRA 3OZHA 4KZ7A 5DFXA 1FCMA 1CI8A 4X69A 2VV7A 1Y28A 2PBYA 4Y0OA 1H5XA 2PU4A 3T4TA 2GNXA 2VA0A 5M19A 3ZCZA 4B93A 4DDSA 3QP5A 1LI0A 5L8MA 1O7EA 3SS4A 2V20A 2XSSA 4MEZA 1NRJA 3LR0A 3O87A 3MF0A 3MXSA 2XLNA 1IFQA 1HZOA 2WK0A 1IELA 4ID4A 1VEUA 5EVIB 1YM1A 3KSHA 4GHIA 4CQHA 1NLYA 2EWWA 1YLYA 4U0TA 3ITBA 4DE0A 3C8CA 5F6AA 5HD3A 1NXYA 1T19A 3BRMA 3A3EA 2KDKA 3BFEA 2JC7A 1HVBA 5DKLA 2PDRA 4KENB 4HNBA 3GQZA 1NZUA 4JF5A 2ZLYA 4KG6A 2V1AA 3NDGA 1K6RA 5CGSA 3PAEA 1BLCA 2I72A 1RGZA 3C7VA 3WS0A 2EX8A 3UMEA 2EX9A 5MC7A 4WMCD 3TJZC 4DRTA 3IWQA 5HZHA 1N9LA 1ZG4A 2FZ0A 2XEPA 5E2GA 4OOMA 1KVMA 1AWIA 1BULA 2W3FA 4IUKA 4Z1WA 4N1HA 3ZDJA 2OOLA 4EQ1A 4KQDA 4WF0A 5FQMA 3GTCA 4NKPA 4GS9A 3M6BA 4ZAMA 3H82B 4S2NC 4IJGA 5AJGA 2P9VB 3T4JA 1ZC2A 3C2WA 4EERA 4ME4A 1Q2QA 1K6SA 5DF7A 3BFDA 1PNEA 2VV6A 3MXRA 3O88A 3CPTB 3A0RA 4QU3A 5I5LA 1M40A 5F82A 2PT7A 4JGQA 3T1RA 3LIEA 1OT6A 4ZRRA 3IF6C 1MPLA 4PM7A 3T4QA 4MNRA 3EOIA 4GDNA 4LRYC 3TW8A 5CHMA 1TS8A 1F2KA 2M7VA 5JYOA 3G6OA 4MBFA 3SZTA 3JVVA 3ZNTA 4C3QA 3PBNA 4K91A 3VMAA 3TE8A 5CERA 2RCXA 1YLJA 4FCFA 3Q1FA 3QP1A 2PAVP 1O07A 5FQ9A 4GW9A 5EECA 2XFSA 1VETB 1XXMA 1XGJA 1TF1A 5HDCA 1CEGA 1MKIA 1TDGA 4II7A 3IF5A 2C5WB 1STZA 4PM9A 3AGDA 3VP4A 4GKUA 1C3BA 3H7WB 1Y4OA 1FQGA 1WA9A 1YMXA 5EVEA 3IQAA 3GVBA 4HP9A 3BY8A 2QMIA 3IS2B 4JBFA 1FIKA 1IYSA 1IOUA 3IH9A 3KSGA 2W1TA 5EM1A 4BD0A 1G28A 1GCEA 3I7JA 4X68A 2EA9A 3GDIA 5GHXA 3OPLA 2V8CA 2JKTM 4QY5A 3UPPA 4GDBA 5EV0A 3RJUA 1SKOB 3C4OA 3PBTA 5CGXA 5FSRA 3G2YA 3PBRA 1E3UA 4HESA 1DP6A 4H6JA 1YLZA 4GD8A 4HI4A 4GN2A 4HJ4A 3L9KA 1ACFA 4GB7A 3VP2A 1ONGA 4E3KA 1KVLA 3M2JA 1N9NA 3F1PA 3HLFA 2K31A 3WWXA 5C5KA 5EVIC 4YINA 1TS0A 4EBPA 4JF6A 3GV9A 1Y54A 1K4EA 2FFYA 2OSUA 3CMZA 4H8RA 4OKPA 2FFFB 3ZYTA 4MMNA 1ZHHB 4OPZA 2Y91A 4F3LA 3BJNA 5F69A 3FPVA 2XGNA 2WAFA 3QP8A 3C38A 3S1YA 5TFQA 3SS3A 1LL9A 2LB9A 4EBLA 1FSYA 4S2NA 4O0PA 4CJNA 3CHWP 1DJBA 2W3EA 4OP8A 2PHYA 2XDMA 4LENA 2V0UA 2Z6CA 5E2FA 3IXHA 3NOPC 4LCMA 3R4KA 5AVFA 3GRJA 2Y2LA 3S7NA 2IWCA 3NC8A 2WGIA 4NETA 3WRZA 1W63M 3VP0A 3ULFA 2X02A 3O5YA 4BENA 2PR6A 2RL3A 1L0GA 1VM1A 3R7WB 5L2FA 3FPWA 4R1GA 3MQOA 3IF6A 4BWIA 4OQ0A 3DW0A 1ZG6A 3HLGA 2A24B 2XH9A 5FASA 2G2UA 1VB6A 3Q7VA 5FQQA 4I38A 1D1JA 4PM5A 4OQGA 4K0WA 3MXQA 3LR4A 3G31A 4QJGA 5E2EA 3MFXA 2Y55A 4OLGA 3F1NA 2IA2A 4K0XA 3OCNA 3TSGA 4IUHA 1ESUA 1KE3A 2QKPA 2VGJA 3UB6A 4MN7A 1CK3A 2GX5A 3E4OA 4E3IA 1XKZA 3KYZA 4WM9A 4M4XA 2ZQCA 1ONHA 3CLOA 2ZQ7A 3ZG5A 3A3FA 1P9WA 3SW1A 5CEBA 4WBGA 2W27A 2OAQ1 4OONA 3MFDA 4DKIA 1LHYA 2AVXA 2QJ7A 4ESPA 1J9MA 1PRQA 1TVFA 2QHKA 2JKTI 1YAXA 2Q9NA 3G30A 3BY9A 5IS1A 4OLDA 4XXRA 4QHCA 3GR2A 5L07A 4R3AA 1X0OA 2W3DA 4OPQA 2L1MA 1QMFA 5FDSA 4KUOA 4XT2A 1T18A 2H0TA 1W8YA 2YKHA 3CZDA 4IHQA 3MR0A 2ZMAA 3MKFA 5GHYA 3IWOA 3LCEA 3UB8A 3A3DA 1ZKJA 5CHUA 2JKRM 3FKVA 3MS6A 3C5AA 2WKHA 5G4ZA 3N6IA 4KUKA 4Z9QA 2BG1A 2Y2MA 5CX7A
chains in the Genus database with same CATH topology
1XA1A 1NZUA 3GQZA 4JF5A 2ZLYA 2HDUA 4KG6A 4S2OA 3NDGA 1NZOA 1K6RA 3UNWA 3Q7ZA 2Y59A 2CC1A 5CGSA 4DE1A 3PAEA 1BLCA 2ZC5B 1L0EA 4L0LA 1K4FA 2I72A 4EUZA 1RGZA 2Y2IA 3C7VA 1JTGA 3WS0A 2EX2A 2EX8A 5U47A 2EX9A 5I94A 3MZFA 4JXVA 1YLWA 4KQQA 1KGEA 3WRTA 4WMCD 3IT9A 5EE8A 1PW1A 1MWSA 2Z2MB 4DRTA 3IWQA 3PAGA 5HAIA 4XUXA 3P09A 4NK3A 1ZG4A 3PBOA 2XEPA 1KDWA 2R9WA 5E2GA 2H10A 4OOMA 1KVMA 1OMEA 1PI5A 3WS2A 1BULA 1LLBA 4PPRA 5FAPA 4E6XA 3FYZA 3ITAA 4ZTKA 4R3JA 3ZHHA 4N1HA 3ZDJA 1Q2PA 3HUOA 1NRFA 4IBXA 4RA7A 5AQ9A 1XP4A 4IBRA 4PMAA 4S2PA 3BM6A 4HBUA 5EUAA 2WKIA 3GTCA 5FQMA 1WYCA 1PZPA 2IWDA 3OC2A 4P0MA 2V1ZA 3PTEA 1SDNA 3M6BA 4RX2A 3LY3A 3NY4A 4ZAMA 1K25A 4IVIA 4S2NC 5GLDA 4LV3A 3LEZA 1W8QA 2Y4AA 2JBFA 1K54C 1BUEA 4LV0A 2P9VB 3UDFA 1GA0A 1ZC2A 3Q81A 4WMCA 3NI9A 3C4PA 1ERQA 5GLBA 1MWRA 1Q2QA 4X56A 4OOLA 2ZQAA 5HAPA 1K6SA 5DF7A 3VSLA 3DWZA 1K56A 3BFDA 3N8LA 1JVJA 3A3IA 3MXRA 3O88A 3VSKA 4FSFA 3HLBA 4QU3A 3UPNA 1JWVA 1M40A 4EWFA 1TDLA 5DTSA 5F82A 4UAAA 1W7FA 2R9XA 2DNSA 3UPOA 5CRFA 3ZG8B 1BLPA 4ZJ3A 3P98A 4HEFA 4N1XA 5EVLA 3V39A 2WGWA 3IF6C 4BL3A 1PZOA 1MPLA 1W5DA 4PM7A 5G18A 4MNRA 4GDNA 2J9PA 5CHMA 4BJPA 4KQOA 4DXCA 3UE1A 5JYPA 4R23A 4S2JA 5JYOA 2C6WB 3IWIA 3OCLA 4E3MA 2XFTA 5CTNA 2P9VA 2XR0A 4MBFA 1E25A 2QZ6A 1KGGA 1U60A 3UN7A 1CEFA 3NIAA 3IF6B 5HARA 3ZNTA 4C3QA 3PBNA 1H8YA 1G68A 4K91A 3VMAA 1JTDA 1MY8A 4OOYA 5D3OA 3VFHA 2P74A 3DWKA 5CERA 2RCXA 1ES4A 1MXOA 5FQKA 1YLJA 5HFOA 3E2LA 5EOOA 2Y2QA 5TR7A 5J8XA 3E2KA 4FCFA 5F1GA 2GDNA 5M1AA 3Q1FA 4OP5A 2H5SA 3Q7VB 5FAQA 4RX3A 1MWUA 1O07A 5KZHA 1K57C 3IHBA 5FQ9A 5GLCA 3IXBA 2WZXA 1S0WA 4MBKA 5EECA 4DE3A 5KSCA 4KZ6A 3N8SA 3SH9A 3MZEA 4E6WA 3BEBA 1NY0A 2XFSA 4E3OA 2XQZA 3N4IA 4E3JA 2JE5A 4GNUA 4N92A 1XXMA 1XGJA 5FATA 5AQ7A 3NBLA 2HDSA 3RXWA 4OPYA 5DTKA 4D2OA 5EVIA 1CEGA 1L0FA 1MKIA 1TDGA 4JLFA 4KZBA 3IF5A 3W4QA 2B5RA 2C5WB 4EQIA 1GHMA 4PM9A 3AGDA 3VP4A 4GKUA 4IVKA 1C3BA 3CJMA 1I2SA 1EI5A 4LV1A 4U0XA 4X6TA 4OQIA 1FQGA 1E3UD 3SH8A 1YMXA 5GL9A 5A92A 3HVFA 3QNBA 3ZG9B 3IQAA 3GVBA 4LV2A 4PM6A 4B88A 2QMIA 1FR1A 4KQRA 5CEDA 4DF6A 4KZ4A 3B3XA 1BSGA 1K55C 4JBFA 1NYMA 4KZ9A 4EBNA 1IYSA 4LCLA 4WZ4A 2ZQ9A 1BLSA 3IH9A 3UDXA 3WS4A 4S2LA 5GHZA 1GHIA 1YT4A 2ZC7A 2HP5A 2ZM8A 2ZM0A 5CHJA 4BD0A 1GCEA 1SDEA 2Y2OA 1WE4A 2HPBA 3I7JA 4GD6A 4UA9A 4UA7A 4X68A 2Z2LB 3WS5A 3RXXA 2J8YA 2XF3A 5GHXA 3OPLA 1FCOA 3MKEA 1KE4A 3BLSA 3CG5A 4IEDA 1KDSA 3M2KA 2A3UA 4QY5A 4P87A 2J7VA 3LO7A 2QPNA 3IXGA 3UPPA 4GDBA 5BOHA 4ZJ1A 3C4OA 3PBTA 3QNCA 4P85A 5CGXA 5FSRA 3RJUA 3BFGA 3Q07A 1PWCA 3G2YA 3PBRA 1HD8A 4Y0UA 1E3UA 4HESA 2WAEA 3N7WA 3UDIA 1YLZA 2WZZA 3PBSA 2WADA 4BLMA 4WELA 4GD8A 4GN2A 3OPRA 3SS5A 2X01A 4GB7A 3IXDA 3VP2A 1ONGA 3FV7A 4E3KA 4QY6A 3G2ZA 1SCWA 3VOYA 1MBLA 3A3JA 5E43A 1KVLA 4ZDXA 3M2JA 3W8KA 4WYYA 3HUMA 3HLCA 3V50A 3AGFA 5FI6A 4DDYA 1ERMA 3O3VA 2VGKA 4FD8A 3HLFA 1IYPA 3ZNYA 3DTMA 3WWXA 5EVIC 5DF8A 4YFMA 4YINA 4EBPA 1XGIA 1M6KA 4JF6A 3W4PA 1N4OA 1GHPA 1Y54A 3GV9A 3IH8A 1K4EA 2FFYA 4R4RA 5IHVA 3SH7A 2OSUA 3CMZA 4H8RA 4OKPA 5HL1A 1AXBA 3IHAA 4U3TA 3V3RA 4OH0A 2BLSA 2FFFB 2HP9A 3EQVA 3OPHA 3HBRA 1KGFA 4OPZA 4BQMA 5DF9A 2WKEA 2H0YA 2Y91A 3VFFA 4E3LA 2DRWA 2XD5A 5FA7A 5DTTA 3UO9A 1S6RA 3BFFA 3BFCA 1IEMA 3FWLA 5KSHA 3HLDA 3S22A 3WS1A 4C75A 3HLWA 2V2FF 4X53A 2XGNA 2EXBA 1ESIA 2WAFA 4Y0TA 3Q82A 5A93A 3V5MA 5FQJA 3BYDA 3S1YA 4Q8IA 1E4DA 3TOIA 4WEJA 5TFQA 4GOGA 3SS3A 1JWPA 1LL9A 4WEKA 4WZ5A 4PM8A 4EBLA 1FSYA 3G4PA 3PBQA 4S2NA 5AQAA 4CJNA 2DCFA 1DJBA 4GZBA 4OP8A 1I5QA 2XDMA 3TG9A 2OV5A 1K54A 4HBTA 4LENA 5HW3A 3ZVTA 1PI4A 1YMSA 5E2FA 1EWZA 1ALQA 3GSGA 4JXGA 3IXHA 1CI9A 4OPRA 2WUQA 1PWDA 1SKFA 4LCMA 2Y2GA 1BT5A 2J9OA 2HDQA 4P6BA 3V3SA 3MBZA 3GRJA 2Y2LA 2IWCA 3GMWA 2WGIA 3NC8A 4N9LA 4NETA 1PW8A 4X55A 4JF4A 5EPHA 3WRZA 5EOEA 3VP0A 4E3NA 3MZDA 1I2WA 2X02A 3EQUA 4BENA 1Z6FA 1W79A 2RL3A 1L0GA 1BTLA 1VM1A 4R4SA 5L2FA 4R1GA 1PYYA 2HP6A 3IF6A 2A49A 3N8RA 1L0DA 2X71A 1G6AA 4EV4A 3ZGAB 4OQ0A 4F94A 5A91A 1IKIA 3DW0A 1ZG6A 3G35A 3G34A 3HLGA 4JKTA 2ZM2A 1ES5A 2G2WA 2XH9A 4BL2A 5FASA 4ZBEA 4B4ZA 1SHVA 2G2UA 4FH2A 3NDEA 4A5RA 2ZC6B 1IYOA 2Y2KA 3FZCA 3Q7VA 5FQQA 1WYBA 2Y2NA 3VOZA 5KMWA 1HTZA 2ZD8A 3BLMA 4PM5A 2Y2JA 1K56D 1QMEA 2EXAA 1XA7A 4M3KA 4MLLA 4RVAA 5FQIA 1RP5A 4C6YA 5FAOA 1DJAA 4KG2A 4K0WA 4OQGA 5F83A 3UY6A 1BLHA 1IYQA 1JWZA 3AGEA 2IWBA 3G31A 1ES2A 4S2KA 2EFUA 2ZJ9A 4QJGA 2WGWB 2JCHA 2ZQ8A 5E2EA 2Y55A 5TGFA 4OLGA 5AQBA 4K0XA 5M18A 3OCNA 2ZQDA 3TSGA 3ZG0A 1ESUA 1KE3A 2VGJA 3HLEA 4QB8A 5FI2A 1XPBA 2E8IA 1FSWA 1CK3A 3VP1A 1DJCA 4E3IA 1XKZA 3M6HA 3D4FA 4UHUA 4WM9A 3S4XA 1L2SA 2ZQCA 4WZ5C 1ONHA 1PWGA 4QD4A 3BECA 1K57A 4N9KA 5E2HA 1FCNA 4DE2A 3SOIA 3QHYA 2ZQ7A 2OLVA 2PU2A 4JPMA 5FI7A 3ZG5A 2WGVA 4FH4A 5HX9A 3A3FA 4S2IA 4RYEA 3C7UA 5CXWA 3OZHA 2Y2PA 4KZ7A 4WBGA 5CEBA 4CPKA 1FCMA 1CI8A 1YLTA 4KG5A 2Q9MA 4X69A 4R0QA 1FOFA 3NCKA 4OONA 5A90A 5CECA 2XD1A 3MFDA 2PBYA 4DKIA 1LHYA 5HAQA 5CTMA 4Y0OA 1J9MA 1H5XA 1YLPA 1DY6A 3O86A 1TVFA 1IKGA 2PU4A 1H8ZA 1TEMA 2Q9NA 1KE0A 3G30A 2XK1A 4Y7PA 5CGWA 5M19A 4JXWA 3ZCZA 4DDSA 1LI0A 4OLDA 4XXRA 1RCJA 3ZFZA 3ZG7B 1LI9A 1O7EA 3SS4A 2V20A 4OVDA 4QHCA 1LL5A 3GR2A 4MEZA 1MWTA 4BD1A 3O87A 2WYXA 4OPQA 2Y2HA 3MXSA 2XLNA 3FKWA 3G32A 3HL9A 2EFXA 5DVAA 1HZOA 2HDRA 1K55A 1EROA 4R3BA 1QMFA 3ZVWA 4JXSA 2ZC3B 1GA9A 2EX6A 1IELA 2WK0A 4ID4A 4KZAA 5EVIB 1YM1A 2H0TA 1FR6A 1W8YA 5EVID 3OPPA 1YLYA 4UA6A 1VQQA 4XUZA 3HUNA 4B4XA 3CZDA 1YQSA 2ZMAA 3MKFA 4U0TA 3ITBA 1XX2A 5FDHA 4DE0A 5GHYA 2ZC4B 1K38A 3IWOA 1BZAA 3LCEA 3W4OA 3A3DA 1ZKJA 5CHUA 1NXYA 4O7DA 3BRMA 3UE3A 1NYYA 1PIOA 3A3EA 3FKVA 5GLAA 4S2MA 3C5AA 2WKHA 3BFEA 4ZJ2A 5F1FA 3N6IA 1ES3A 3UE0A 2JC7A 4KZ5A 4OQHA 4KZ8A 4MBHA 3JYIA 4Z9QA 2Y2MA 4KZ3A 2BG1A 3VP3A 1HVBA 2OLUA 1NJ4A 2UWXA 1RGYA 3HREA 4KENB 3ISGA 1N9BA 3LY4A 4DXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XA1 A;  1NZU A;  3GQZ A;  4JF5 A;  2ZLY A;  2HDU A;  4KG6 A;  4S2O A;  3NDG A;  1NZO A;  1K6R A;  3UNW A;  3Q7Z A;  2Y59 A;  2CC1 A;  5CGS A;  4DE1 A;  3PAE A;  1BLC A;  2ZC5 B;  1L0E A;  4L0L A;  1K4F A;  2I72 A;  4EUZ A;  1RGZ A;  2Y2I A;  3C7V A;  1JTG A;  3WS0 A;  2EX2 A;  2EX8 A;  5U47 A;  2EX9 A;  5I94 A;  3MZF A;  4JXV A;  1YLW A;  4KQQ A;  1KGE A;  3WRT A;  4WMC D;  3IT9 A;  5EE8 A;  1PW1 A;  1MWS A;  2Z2M B;  4DRT A;  3IWQ A;  3PAG A;  5HAI A;  4XUX A;  3P09 A;  4NK3 A;  1ZG4 A;  3PBO A;  2XEP A;  1KDW A;  2R9W A;  5E2G A;  2H10 A;  4OOM A;  1KVM A;  1OME A;  1PI5 A;  3WS2 A;  1BUL A;  1LLB A;  4PPR A;  5FAP A;  4E6X A;  3FYZ A;  3ITA A;  4ZTK A;  4R3J A;  3ZHH A;  4N1H A;  3ZDJ A;  1Q2P A;  3HUO A;  1NRF A;  4IBX A;  4RA7 A;  5AQ9 A;  1XP4 A;  4IBR A;  4PMA A;  4S2P A;  3BM6 A;  4HBU A;  5EUA A;  2WKI A;  3GTC A;  5FQM A;  1WYC A;  1PZP A;  2IWD A;  3OC2 A;  4P0M A;  2V1Z A;  3PTE A;  1SDN A;  3M6B A;  4RX2 A;  3LY3 A;  3NY4 A;  4ZAM A;  1K25 A;  4IVI A;  4S2N C;  5GLD A;  4LV3 A;  3LEZ A;  1W8Q A;  2Y4A A;  2JBF A;  1K54 C;  1BUE A;  4LV0 A;  2P9V B;  3UDF A;  1GA0 A;  1ZC2 A;  3Q81 A;  4WMC A;  3NI9 A;  3C4P A;  1ERQ A;  5GLB A;  1MWR A;  1Q2Q A;  4X56 A;  4OOL A;  2ZQA A;  5HAP A;  1K6S A;  5DF7 A;  3VSL A;  3DWZ A;  1K56 A;  3BFD A;  3N8L A;  1JVJ A;  3A3I A;  3MXR A;  3O88 A;  3VSK A;  4FSF A;  3HLB A;  4QU3 A;  3UPN A;  1JWV A;  1M40 A;  4EWF A;  1TDL A;  5DTS A;  5F82 A;  4UAA A;  1W7F A;  2R9X A;  2DNS A;  3UPO A;  5CRF A;  3ZG8 B;  1BLP A;  4ZJ3 A;  3P98 A;  4HEF A;  4N1X A;  5EVL A;  3V39 A;  2WGW A;  3IF6 C;  4BL3 A;  1PZO A;  1MPL A;  1W5D A;  4PM7 A;  5G18 A;  4MNR A;  4GDN A;  2J9P A;  5CHM A;  4BJP A;  4KQO A;  4DXC A;  3UE1 A;  5JYP A;  4R23 A;  4S2J A;  5JYO A;  2C6W B;  3IWI A;  3OCL A;  4E3M A;  2XFT A;  5CTN A;  2P9V A;  2XR0 A;  4MBF A;  1E25 A;  2QZ6 A;  1KGG A;  1U60 A;  3UN7 A;  1CEF A;  3NIA A;  3IF6 B;  5HAR A;  3ZNT A;  4C3Q A;  3PBN A;  1H8Y A;  1G68 A;  4K91 A;  3VMA A;  1JTD A;  1MY8 A;  4OOY A;  5D3O A;  3VFH A;  2P74 A;  3DWK A;  5CER A;  2RCX A;  1ES4 A;  1MXO A;  5FQK A;  1YLJ A;  5HFO A;  3E2L A;  5EOO A;  2Y2Q A;  5TR7 A;  5J8X A;  3E2K A;  4FCF A;  5F1G A;  2GDN A;  5M1A A;  3Q1F A;  4OP5 A;  2H5S A;  3Q7V B;  5FAQ A;  4RX3 A;  1MWU A;  1O07 A;  5KZH A;  1K57 C;  3IHB A;  5FQ9 A;  5GLC A;  3IXB A;  2WZX A;  1S0W A;  4MBK A;  5EEC A;  4DE3 A;  5KSC A;  4KZ6 A;  3N8S A;  3SH9 A;  3MZE A;  4E6W A;  3BEB A;  1NY0 A;  2XFS A;  4E3O A;  2XQZ A;  3N4I A;  4E3J A;  2JE5 A;  4GNU A;  4N92 A;  1XXM A;  1XGJ A;  5FAT A;  5AQ7 A;  3NBL A;  2HDS A;  3RXW A;  4OPY A;  5DTK A;  4D2O A;  5EVI A;  1CEG A;  1L0F A;  1MKI A;  1TDG A;  4JLF A;  4KZB A;  3IF5 A;  3W4Q A;  2B5R A;  2C5W B;  4EQI A;  1GHM A;  4PM9 A;  3AGD A;  3VP4 A;  4GKU A;  4IVK A;  1C3B A;  3CJM A;  1I2S A;  1EI5 A;  4LV1 A;  4U0X A;  4X6T A;  4OQI A;  1FQG A;  1E3U D;  3SH8 A;  1YMX A;  5GL9 A;  5A92 A;  3HVF A;  3QNB A;  3ZG9 B;  3IQA A;  3GVB A;  4LV2 A;  4PM6 A;  4B88 A;  2QMI A;  1FR1 A;  4KQR A;  5CED A;  4DF6 A;  4KZ4 A;  3B3X A;  1BSG A;  1K55 C;  4JBF A;  1NYM A;  4KZ9 A;  4EBN A;  1IYS A;  4LCL A;  4WZ4 A;  2ZQ9 A;  1BLS A;  3IH9 A;  3UDX A;  3WS4 A;  4S2L A;  5GHZ A;  1GHI A;  1YT4 A;  2ZC7 A;  2HP5 A;  2ZM8 A;  2ZM0 A;  5CHJ A;  4BD0 A;  1GCE A;  1SDE A;  2Y2O A;  1WE4 A;  2HPB A;  3I7J A;  4GD6 A;  4UA9 A;  4UA7 A;  4X68 A;  2Z2L B;  3WS5 A;  3RXX A;  2J8Y A;  2XF3 A;  5GHX A;  3OPL A;  1FCO A;  3MKE A;  1KE4 A;  3BLS A;  3CG5 A;  4IED A;  1KDS A;  3M2K A;  2A3U A;  4QY5 A;  4P87 A;  2J7V A;  3LO7 A;  2QPN A;  3IXG A;  3UPP A;  4GDB A;  5BOH A;  4ZJ1 A;  3C4O A;  3PBT A;  3QNC A;  4P85 A;  5CGX A;  5FSR A;  3RJU A;  3BFG A;  3Q07 A;  1PWC A;  3G2Y A;  3PBR A;  1HD8 A;  4Y0U A;  1E3U A;  4HES A;  2WAE A;  3N7W A;  3UDI A;  1YLZ A;  2WZZ A;  3PBS A;  2WAD A;  4BLM A;  4WEL A;  4GD8 A;  4GN2 A;  3OPR A;  3SS5 A;  2X01 A;  4GB7 A;  3IXD A;  3VP2 A;  1ONG A;  3FV7 A;  4E3K A;  4QY6 A;  3G2Z A;  1SCW A;  3VOY A;  1MBL A;  3A3J A;  5E43 A;  1KVL A;  4ZDX A;  3M2J A;  3W8K A;  4WYY A;  3HUM A;  3HLC A;  3V50 A;  3AGF A;  5FI6 A;  4DDY A;  1ERM A;  3O3V A;  2VGK A;  4FD8 A;  3HLF A;  1IYP A;  3ZNY A;  3DTM A;  3WWX A;  5EVI C;  5DF8 A;  4YFM A;  4YIN A;  4EBP A;  1XGI A;  1M6K A;  4JF6 A;  3W4P A;  1N4O A;  1GHP A;  1Y54 A;  3GV9 A;  3IH8 A;  1K4E A;  2FFY A;  4R4R A;  5IHV A;  3SH7 A;  2OSU A;  3CMZ A;  4H8R A;  4OKP A;  5HL1 A;  1AXB A;  3IHA A;  4U3T A;  3V3R A;  4OH0 A;  2BLS A;  2FFF B;  2HP9 A;  3EQV A;  3OPH A;  3HBR A;  1KGF A;  4OPZ A;  4BQM A;  5DF9 A;  2WKE A;  2H0Y A;  2Y91 A;  3VFF A;  4E3L A;  2DRW A;  2XD5 A;  5FA7 A;  5DTT A;  3UO9 A;  1S6R A;  3BFF A;  3BFC A;  1IEM A;  3FWL A;  5KSH A;  3HLD A;  3S22 A;  3WS1 A;  4C75 A;  3HLW A;  2V2F F;  4X53 A;  2XGN A;  2EXB A;  1ESI A;  2WAF A;  4Y0T A;  3Q82 A;  5A93 A;  3V5M A;  5FQJ A;  3BYD A;  3S1Y A;  4Q8I A;  1E4D A;  3TOI A;  4WEJ A;  5TFQ A;  4GOG A;  3SS3 A;  1JWP A;  1LL9 A;  4WEK A;  4WZ5 A;  4PM8 A;  4EBL A;  1FSY A;  3G4P A;  3PBQ A;  4S2N A;  5AQA A;  4CJN A;  2DCF A;  1DJB A;  4GZB A;  4OP8 A;  1I5Q A;  2XDM A;  3TG9 A;  2OV5 A;  1K54 A;  4HBT A;  4LEN A;  5HW3 A;  3ZVT A;  1PI4 A;  1YMS A;  5E2F A;  1EWZ A;  1ALQ A;  3GSG A;  4JXG A;  3IXH A;  1CI9 A;  4OPR A;  2WUQ A;  1PWD A;  1SKF A;  4LCM A;  2Y2G A;  1BT5 A;  2J9O A;  2HDQ A;  4P6B A;  3V3S A;  3MBZ A;  3GRJ A;  2Y2L A;  2IWC A;  3GMW A;  2WGI A;  3NC8 A;  4N9L A;  4NET A;  1PW8 A;  4X55 A;  4JF4 A;  5EPH A;  3WRZ A;  5EOE A;  3VP0 A;  4E3N A;  3MZD A;  1I2W A;  2X02 A;  3EQU A;  4BEN A;  1Z6F A;  1W79 A;  2RL3 A;  1L0G A;  1BTL A;  1VM1 A;  4R4S A;  5L2F A;  4R1G A;  1PYY A;  2HP6 A;  3IF6 A;  2A49 A;  3N8R A;  1L0D A;  2X71 A;  1G6A A;  4EV4 A;  3ZGA B;  4OQ0 A;  4F94 A;  5A91 A;  1IKI A;  3DW0 A;  1ZG6 A;  3G35 A;  3G34 A;  3HLG A;  4JKT A;  2ZM2 A;  1ES5 A;  2G2W A;  2XH9 A;  4BL2 A;  5FAS A;  4ZBE A;  4B4Z A;  1SHV A;  2G2U A;  4FH2 A;  3NDE A;  4A5R A;  2ZC6 B;  1IYO A;  2Y2K A;  3FZC A;  3Q7V A;  5FQQ A;  1WYB A;  2Y2N A;  3VOZ A;  5KMW A;  1HTZ A;  2ZD8 A;  3BLM A;  4PM5 A;  2Y2J A;  1K56 D;  1QME A;  2EXA A;  1XA7 A;  4M3K A;  4MLL A;  4RVA A;  5FQI A;  1RP5 A;  4C6Y A;  5FAO A;  1DJA A;  4KG2 A;  4K0W A;  4OQG A;  5F83 A;  3UY6 A;  1BLH A;  1IYQ A;  1JWZ A;  3AGE A;  2IWB A;  3G31 A;  1ES2 A;  4S2K A;  2EFU A;  2ZJ9 A;  4QJG A;  2WGW B;  2JCH A;  2ZQ8 A;  5E2E A;  2Y55 A;  5TGF A;  4OLG A;  5AQB A;  4K0X A;  5M18 A;  3OCN A;  2ZQD A;  3TSG A;  3ZG0 A;  1ESU A;  1KE3 A;  2VGJ A;  3HLE A;  4QB8 A;  5FI2 A;  1XPB A;  2E8I A;  1FSW A;  1CK3 A;  3VP1 A;  1DJC A;  4E3I A;  1XKZ A;  3M6H A;  3D4F A;  4UHU A;  4WM9 A;  3S4X A;  1L2S A;  2ZQC A;  4WZ5 C;  1ONH A;  1PWG A;  4QD4 A;  3BEC A;  1K57 A;  4N9K A;  5E2H A;  1FCN A;  4DE2 A;  3SOI A;  3QHY A;  2ZQ7 A;  2OLV A;  2PU2 A;  4JPM A;  5FI7 A;  3ZG5 A;  2WGV A;  4FH4 A;  5HX9 A;  3A3F A;  4S2I A;  4RYE A;  3C7U A;  5CXW A;  3OZH A;  2Y2P A;  4KZ7 A;  4WBG A;  5CEB A;  4CPK A;  1FCM A;  1CI8 A;  1YLT A;  4KG5 A;  2Q9M A;  4X69 A;  4R0Q A;  1FOF A;  3NCK A;  4OON A;  5A90 A;  5CEC A;  2XD1 A;  3MFD A;  2PBY A;  4DKI A;  1LHY A;  5HAQ A;  5CTM A;  4Y0O A;  1J9M A;  1H5X A;  1YLP A;  1DY6 A;  3O86 A;  1TVF A;  1IKG A;  2PU4 A;  1H8Z A;  1TEM A;  2Q9N A;  1KE0 A;  3G30 A;  2XK1 A;  4Y7P A;  5CGW A;  5M19 A;  4JXW A;  3ZCZ A;  4DDS A;  1LI0 A;  4OLD A;  4XXR A;  1RCJ A;  3ZFZ A;  3ZG7 B;  1LI9 A;  1O7E A;  3SS4 A;  2V20 A;  4OVD A;  4QHC A;  1LL5 A;  3GR2 A;  4MEZ A;  1MWT A;  4BD1 A;  3O87 A;  2WYX A;  4OPQ A;  2Y2H A;  3MXS A;  2XLN A;  3FKW A;  3G32 A;  3HL9 A;  2EFX A;  5DVA A;  1HZO A;  2HDR A;  1K55 A;  1ERO A;  4R3B A;  1QMF A;  3ZVW A;  4JXS A;  2ZC3 B;  1GA9 A;  2EX6 A;  1IEL A;  2WK0 A;  4ID4 A;  4KZA A;  5EVI B;  1YM1 A;  2H0T A;  1FR6 A;  1W8Y A;  5EVI D;  3OPP A;  1YLY A;  4UA6 A;  1VQQ A;  4XUZ A;  3HUN A;  4B4X A;  3CZD A;  1YQS A;  2ZMA A;  3MKF A;  4U0T A;  3ITB A;  1XX2 A;  5FDH A;  4DE0 A;  5GHY A;  2ZC4 B;  1K38 A;  3IWO A;  1BZA A;  3LCE A;  3W4O A;  3A3D A;  1ZKJ A;  5CHU A;  1NXY A;  4O7D A;  3BRM A;  3UE3 A;  1NYY A;  1PIO A;  3A3E A;  3FKV A;  5GLA A;  4S2M A;  3C5A A;  2WKH A;  3BFE A;  4ZJ2 A;  5F1F A;  3N6I A;  1ES3 A;  3UE0 A;  2JC7 A;  4KZ5 A;  4OQH A;  4KZ8 A;  4MBH A;  3JYI A;  4Z9Q A;  2Y2M A;  4KZ3 A;  2BG1 A;  3VP3 A;  1HVB A;  2OLU A;  1NJ4 A;  2UWX A;  1RGY A;  3HRE A;  4KEN B;  3ISG A;  1N9B A;  3LY4 A;  4DXB A; 
#chains in the Genus database with same CATH topology
 4Q0I A;  4LPZ A;  4S2O A;  1NZO A;  4Y5F A;  2Y59 A;  4DE1 A;  1K4F A;  4NXB A;  2Y2I A;  5TBM A;  2G7U A;  2EX2 A;  3MZF A;  4JXV A;  2Z6D A;  5EE8 A;  3LUQ A;  4I3J A;  3KSI A;  4XUX A;  4QPR A;  2H10 A;  3WS2 A;  1PI5 A;  4E6X A;  3ITA A;  3ZHH A;  4R3J A;  4X1L A;  4IBX A;  3OBF A;  1XFQ A;  1Z09 A;  2GJ3 A;  4PMA A;  3BM6 A;  5EUA A;  1PZP A;  2IWD A;  3OC2 A;  4P0M A;  4HHD A;  1SDN A;  3NHQ A;  4RX2 A;  3NY4 A;  4LV3 A;  1G5U A;  2JBF A;  1GA0 A;  3H9W A;  3C4P A;  5GLB A;  3LIF A;  2PD7 A;  2P7J A;  5AVE A;  4FSF A;  5HWV A;  3UPN A;  1TDL A;  4UAA A;  4HJ3 A;  2R9X A;  2DNS A;  1MZU A;  5CRF A;  3ZG8 B;  3P98 A;  5EVL A;  4YWZ A;  1OTE A;  1W5D A;  1V9Y A;  5G18 A;  3DTI A;  4X25 A;  2A2L A;  2JKG A;  4BJP A;  4KQO A;  4DXC A;  4UQI M;  4UQI S;  3S7O A;  3CAX A;  4S2J A;  5EM0 A;  3OCL A;  5CTN A;  2P9V A;  4LFU A;  2GZA A;  2PR5 A;  1E25 A;  2QZ6 A;  1KGG A;  1U60 A;  3KO6 A;  3NIA A;  5HAR A;  5TJJ A;  1H8Y A;  4OOY A;  4HJ6 A;  2P74 A;  3PHY A;  5EOO A;  3MQ0 A;  2LB5 A;  4RX3 A;  1MWU A;  5GLC A;  5KSC A;  4KZ6 A;  3SH9 A;  3RH8 B;  2XQZ A;  3N4I A;  2JE5 A;  4GNU A;  5FAT A;  4GCZ A;  3QP2 A;  4OPY A;  4R38 A;  3D72 A;  3W4Q A;  4JLF A;  3VV4 A;  4EQI A;  1GHM A;  5HL6 A;  3CUE A;  1OTI A;  2XA7 M;  4IVK A;  2XA7 S;  2W0N A;  4U0X A;  4OQI A;  3LFV A;  5HPF A;  2J80 A;  3HVF A;  3ZG9 B;  2PYR A;  1FR1 A;  3MSH A;  4KQR A;  4NG2 A;  3K3D A;  1UWP X;  2O9C A;  1K55 C;  4BBV A;  2D02 A;  4LCL A;  4WZ4 A;  2ZQ9 A;  4EU0 A;  1BLS A;  4CLC A;  2CMN A;  2HP5 A;  2ZM8 A;  4K08 A;  1XJ2 A;  4HH3 A;  4LRX C;  4UA9 A;  4UA7 A;  4EET B;  3RXX A;  4R6L A;  3P01 A;  3E4P A;  1KE4 A;  3CG5 A;  3DTE A;  1MKM A;  4IED A;  2A3U A;  2EWV A;  4R70 A;  1DP8 A;  4P87 A;  2QPN A;  4NXG A;  4Y3I A;  3IXG A;  3T4K A;  3A0S A;  3W2Z A;  4ZJ1 A;  1LL8 A;  4P85 A;  3BFG A;  1PWC A;  4MN6 A;  4GHI B;  1DP9 A;  3KYE A;  4X1M A;  3SS5 A;  3FV7 A;  2VLG A;  4ZDX A;  3W8K A;  1CJF A;  3HLC A;  3V50 A;  3O3V A;  2VGK A;  3LI8 A;  4JGR A;  2L0W A;  4FD8 A;  3ZNY A;  3DTM A;  4P6Z S;  2KOI A;  4YFM A;  2UV0 E;  3CI6 A;  1XGI A;  1M6K A;  1OPX A;  4EEP A;  2VJW A;  3W4P A;  4ARZ A;  3SH7 A;  2ZL1 A;  3OPH A;  1ODV A;  4E3L A;  2DRW A;  3UO9 A;  2K7S A;  3FWL A;  3HLD A;  4CLC E;  3WS1 A;  3V5M A;  4RQ9 A;  4Q8I A;  4GOG A;  1V9Z A;  4WZ5 A;  2DCF A;  4GZB A;  3TG9 A;  1I5Q A;  2OV5 A;  3EGD C;  1EWZ A;  1ALQ A;  3GSG A;  5FEF A;  2J9O A;  4P6B A;  1LSX A;  4I5S A;  2INW A;  4JF4 A;  1YSP A;  3C30 A;  4GS9 B;  3S7P A;  1I2W A;  3EQU A;  1Z6F A;  1W79 A;  4HY8 A;  5HWT A;  1PYY A;  3N8R A;  2X71 A;  4I3I A;  1G6A A;  3ZGA B;  4BBT A;  4JKT A;  4NEE D;  2ZM2 A;  4BL2 A;  4ZBE A;  4FH2 A;  4A5R A;  1IYO A;  2Y2N A;  3KSF A;  3F1O A;  2V0W A;  2EXA A;  4M3K A;  4WUJ A;  4G3W A;  3AGE A;  4S2K A;  2EFU A;  5DKK A;  2VX8 A;  5TGF A;  3HJK A;  2ZQD A;  3ZG0 A;  4QB8 A;  5FI2 A;  1T1B A;  2D01 A;  1JNU A;  5IU1 A;  3LIC A;  3VP1 A;  4BBU A;  3OLO A;  3D4F A;  3LID A;  3VE4 A;  1TS7 A;  2E8J A;  4EUV A;  4QD4 A;  1PWG A;  4N9K A;  2VGL M;  4FTX A;  2VGL S;  4DE2 A;  3SOI A;  2HV1 A;  2V8F A;  2OLV A;  4S2I A;  5CXW A;  2PRF A;  4CPK A;  3T1X A;  1YLT A;  4KG5 A;  4R0Q A;  2XD1 A;  1G6O A;  2NUP C;  3KX0 X;  1YLP A;  4Y7P A;  2XK1 A;  5L09 A;  4G3K A;  1RCJ A;  3ZG7 B;  1LI9 A;  4PKY A;  4OVD A;  1SZV A;  1MWT A;  1VHM A;  4BD1 A;  2HJE A;  2Y2H A;  3FKW A;  3HL9 A;  2EFX A;  2HDR A;  1K55 A;  4R3B A;  2ZC3 B;  4KZA A;  3E0Y A;  4HQA A;  1VQQ A;  3HUN A;  4B4X A;  4MCW A;  1YQS A;  4YOF A;  1XX2 A;  3EGX C;  3MJQ A;  2V9A A;  3PXP A;  1NLZ A;  1TS6 A;  2J3T D;  3UE3 A;  3BQA A;  1NYY A;  3CWF A;  5GLA A;  1W63 Q;  4S2M A;  1ES3 A;  4OQH A;  4KZ3 A;  3VP3 A;  2OLU A;  5J4E A;  2UWX A;  3HRE A;  4HH2 A;  3ISG A;  1XA1 A;  2W1T B;  1DRM A;  3ICY A;  4WL9 A;  2HGV A;  1A0K A;  3UNW A;  3Q7Z A;  2W3H A;  1OTA A;  2OWH A;  5U47 A;  5I94 A;  1KGE A;  5FL3 A;  3WRT A;  3IT9 A;  2V1B A;  1PW1 A;  2ZBB A;  3T1Q B;  5HAI A;  4H6J B;  2P08 A;  4NK3 A;  1KDW A;  2R9W A;  5KIZ A;  1UWN X;  1OME A;  1LLB A;  4PPR A;  5FAP A;  4EXO A;  4DN0 A;  4ZTK A;  4RA7 A;  1NRF A;  3LGO A;  3F1P B;  3T4O A;  4S2P A;  1ZTU A;  4DJ2 A;  2WKI A;  1WYC A;  2Y8H A;  2V1Z A;  3T12 B;  3LY3 A;  4IVI A;  3LEZ A;  2VKS A;  1W8Q A;  3LEQ A;  3TRC A;  1K54 C;  4Q0H A;  4LV0 A;  1S67 L;  3UB5 P;  3UDF A;  4QWO A;  3Q81 A;  4WMC A;  3NUL A;  4F3L B;  1MWR A;  3JPU A;  3V67 A;  3DWZ A;  1K56 A;  3LR5 A;  3N8L A;  1MC0 A;  1JVJ A;  3A3I A;  3DTK A;  3NEC A;  4PHT A;  1JWV A;  1OTD A;  2QJ5 A;  3ZQ5 A;  3UPO A;  2VEA A;  1BLP A;  1D06 A;  4HEF A;  4N1X A;  3V39 A;  2WGW A;  4BL3 A;  4WLA A;  1K0K A;  5HDD A;  2W1R A;  1CQA A;  4EES A;  4HP4 A;  5JYP A;  5LBR A;  1D7E A;  3RTY A;  2PYP A;  1BYW A;  2C6W B;  4E3M A;  2XR0 A;  3B42 A;  3UN7 A;  1CEF A;  3IF6 B;  2I9V A;  1YKD A;  2O99 A;  1MY8 A;  3VFH A;  1MXO A;  3OOV A;  5HFO A;  3E2L A;  3IX4 A;  2Y2Q A;  3E98 A;  3E2K A;  2GDN A;  5M1A A;  4OP5 A;  2H5S A;  3Q7V B;  5FAQ A;  1H3Q A;  1K57 C;  3IHB A;  3IXB A;  4MBK A;  4WN5 A;  3N8S A;  1NY0 A;  4E3O A;  4E3J A;  5AQ7 A;  4EW7 A;  1N9O A;  2HDS A;  3RXW A;  3F1N B;  3RFB A;  5DTK A;  4D2O A;  5EVI A;  4NXE A;  1L0F A;  1I2S A;  1EI5 A;  1GSW A;  4LV1 A;  4X6T A;  1E3U D;  3SH8 A;  5GL9 A;  4LV2 A;  4PM6 A;  3JVU A;  4DF6 A;  3MQQ A;  3BWL A;  3D9Y A;  4MN5 A;  3S7Q A;  3WS4 A;  1YT4 A;  2ZC7 A;  3E4Q A;  2ZM0 A;  5CHJ A;  1WE4 A;  3UB7 A;  4GD6 A;  4L9F A;  2J8Y A;  2XF3 A;  1FCO A;  4ETZ A;  3M2K A;  2PBD P;  5J3W A;  3NOT C;  3D3O A;  1N9B A;  3Q07 A;  4Y0U A;  1HD8 A;  4XT2 B;  3N7W A;  3UB9 A;  2WZZ A;  3PBS A;  4I39 A;  4WEL A;  1T1C A;  4JGP A;  2X01 A;  1HLU P;  4QY6 A;  3VOY A;  1MBL A;  3A3J A;  5E43 A;  2ZOI A;  3IX3 A;  4WYY A;  4O8G A;  4DDY A;  4O01 A;  1F5M A;  5DF8 A;  3IX8 A;  2O0Y A;  2MJ6 A;  4LRZ E;  3KYQ A;  3IH8 A;  3H82 A;  5HWW A;  5HL1 A;  1AXB A;  3V3R A;  4U3T A;  4OH0 A;  2VK3 A;  3HBR A;  2QYB A;  1KGF A;  4BQM A;  5DF9 A;  2WKE A;  3VFF A;  2XD5 A;  5FA7 A;  3BFF A;  1IEM A;  2ZMF A;  5KSH A;  5TBM B;  2VV8 A;  3HLW A;  2V2F F;  3Q82 A;  5A93 A;  3BYD A;  3CPT A;  4WEK A;  4DXB A;  3PBQ A;  2VZW A;  1K54 A;  4HBT A;  5HW3 A;  3ZVT A;  4JXG A;  2WUQ A;  1PWD A;  1SKF A;  3V3S A;  1P9R A;  4N9L A;  3PR6 A;  1PW8 A;  4X55 A;  3LYX A;  4E04 A;  1TD5 A;  5HSQ A;  4E3N A;  2JKR I;  3MZD A;  3U4L P;  1UGU A;  1BTL A;  4R4S A;  4EV4 A;  4F94 A;  5A91 A;  1IKI A;  1P97 A;  3G35 A;  3G34 A;  2R78 A;  3T50 A;  2G2W A;  2KLI A;  4B4Z A;  1SHV A;  5DJT A;  1WYB A;  3VOZ A;  5KMW A;  1HTZ A;  1K56 D;  4L9G A;  4MLL A;  1XA7 A;  3DBA A;  5FAO A;  4KG2 A;  5F83 A;  2OWJ A;  1IYQ A;  1H8M A;  2IWB A;  1ES2 A;  1VET A;  2K2N A;  2JCH A;  2ZQ8 A;  5DJU A;  5M18 A;  3A0V A;  1S66 L;  1FSW A;  1DJC A;  3DAV A;  3UE6 A;  3S4X A;  1VEU B;  5G4Y A;  3H7W A;  2PD8 A;  3BEC A;  2J3W A;  1K57 A;  4UEY A;  5E2H A;  2HF6 A;  3QHY A;  4Q0J A;  2PU2 A;  5FI7 A;  2WGV A;  4FH4 A;  5HX9 A;  2B95 A;  2Y2P A;  1EW0 A;  2Q9M A;  5A90 A;  3IS2 A;  1FOF A;  3NCK A;  5CEC A;  5HAQ A;  5CTM A;  1LSV A;  2Q0O A;  4P6Z M;  1DY6 A;  3O86 A;  2O9A A;  1IKG A;  1H8Z A;  1TEM A;  1KE0 A;  5CGW A;  4L9E A;  4JXW A;  2BTF P;  4GJ4 A;  3T1S A;  3ZFZ A;  1LL5 A;  2WYX A;  2JHE A;  3G32 A;  5DVA A;  1ERO A;  3ZVW A;  4JXS A;  1SKO A;  1GA9 A;  2EX6 A;  5A8B A;  5L10 A;  1FR6 A;  5EVI D;  3OPP A;  3BW6 A;  1XJ4 A;  4UA6 A;  4XUZ A;  4G3V A;  2OAP 1;  2B02 A;  5HPI A;  5FDH A;  2ZC4 B;  1K38 A;  4LLO B;  1BZA A;  1GSV A;  3W4O A;  4O7D A;  1PIO A;  3VE3 A;  4ZJ2 A;  5F1F A;  3UE0 A;  4KZ5 A;  3NOU C;  4KZ8 A;  4MBH A;  3JYI A;  4PAU A;  1NJ4 A;  4CLC B;  1RGY A;  3PYP A;  5HD5 A;  3LY4 A;  5EOE A;  4HIA A;  2HDU A;  4Y17 A;  3UMD A;  2CC1 A;  2ZC5 B;  1L0E A;  2M1C A;  4L0L A;  4EUZ A;  1JTG A;  1YLW A;  4KQQ A;  2W3G A;  3LI9 A;  1MWS A;  2Z2M B;  4GLQ A;  1KOU A;  3PAG A;  3P09 A;  3LIA A;  3PBO A;  1PFL A;  3FYZ A;  1Q2P A;  3HUO A;  2O9B A;  4B9O A;  3HCY A;  1XP4 A;  5AQ9 A;  4IBR A;  4HBU A;  3B33 A;  3PTE A;  1XJ3 A;  4ARZ B;  1K25 A;  5GLD A;  3R7W A;  3EWK A;  1XJ6 A;  2ZL1 B;  2Y4A A;  1BUE A;  3NI9 A;  2A24 A;  1ERQ A;  4X56 A;  4OOL A;  2ZQA A;  5HAP A;  3VSL A;  5EFW A;  1XFN A;  1P0Z A;  3K2N A;  4Y15 A;  3EEA A;  3VSK A;  2XRN A;  3LR3 A;  1OT9 A;  3HLB A;  3B47 A;  3HJI A;  3IBJ A;  4EWF A;  5DTS A;  3L7H A;  3IBR A;  1W7F A;  3GEC A;  4ZJ3 A;  1FIL A;  4FOF A;  3T4L A;  1PZO A;  3EEH A;  2Y79 A;  3QP4 A;  4JGO A;  2J9P A;  3UE1 A;  5J7E A;  2ZMV A;  4R23 A;  3BQ8 A;  1J3W A;  3IWI A;  2KX6 A;  2XFT A;  4NXF A;  1LT0 A;  2ZOH A;  2FH5 A;  4PKY G;  3CIT A;  1G68 A;  2BAS A;  1JTD A;  5D3O A;  1OTB A;  2P04 A;  3DWK A;  1ES4 A;  5FQK A;  4DJ3 A;  5TR7 A;  5J8X A;  5F1G A;  3VOL A;  3F1O B;  1L3L A;  5KZH A;  2WZX A;  4CLC D;  1S0W A;  4DE3 A;  4E6W A;  3MZE A;  3BEB A;  2ACG A;  4Y2F A;  3U2A A;  4N92 A;  1S4S A;  3NBL A;  4FUW A;  3T4S A;  4D60 A;  4KZB A;  1LSW A;  2B5R A;  1F9I A;  4MDZ A;  1GSX A;  5DFY A;  3CJM A;  5A92 A;  3QNB A;  4B88 A;  3QP6 A;  5CED A;  4KZ4 A;  3B3X A;  1BSG A;  3FG8 A;  1NYM A;  4KZ9 A;  4EBN A;  3UDX A;  4S2L A;  5GHZ A;  1GHI A;  1F98 A;  2H28 A;  2WKP A;  1SDE A;  2Y2O A;  2JKF A;  2HPB A;  4AFI A;  2Z2L B;  3WS5 A;  3MKE A;  3BLS A;  1KDS A;  2J7V A;  3LO7 A;  5K5B A;  2YKF A;  5BOH A;  3QNC A;  2HJ9 C;  1OJG A;  4EEU A;  5IT5 A;  2WAE A;  3UDI A;  4BLM A;  2WAD A;  3MMH A;  3OPR A;  3IXD A;  5HDS A;  3G2Z A;  1SCW A;  2QWS A;  3HUM A;  3AGF A;  5FI6 A;  1ERM A;  1IYP A;  4DMZ A;  2B18 A;  2L4R A;  1N4O A;  1GHP A;  4R4R A;  5IHV A;  2JN7 A;  3CUE C;  2WKR A;  3IHA A;  2J3T C;  2BLS A;  5FEG A;  2HP9 A;  3EQV A;  3K3C A;  2M7U A;  2H0Y A;  5F68 A;  5DTT A;  1S6R A;  3BFC A;  3S22 A;  2XRO A;  4C75 A;  1OJ5 A;  4X53 A;  2EXB A;  1S1Y A;  1ESI A;  4Y0T A;  5FQJ A;  1E4D A;  4CLC C;  3TOI A;  4WEJ A;  1JWP A;  4PM8 A;  3G4P A;  5AQA A;  4BMW A;  2DMW A;  1PI4 A;  1YMS A;  3LIB A;  1CI9 A;  4OPR A;  2Y2G A;  1BT5 A;  2HDQ A;  3MBZ A;  3GMW A;  3P7N A;  5EPH A;  1NWZ A;  2HP6 A;  2A49 A;  1L0D A;  5F5Y A;  2NUT C;  1ES5 A;  1S1Z A;  3NDE A;  1S4R A;  3FC7 A;  4Y13 A;  2ZC6 B;  3FZC A;  2Y2K A;  1H0M A;  4LGW A;  2ZD8 A;  3BLM A;  1T1A A;  2Y2J A;  4ETX A;  1QME A;  5FQI A;  4RVA A;  4C6Y A;  1RP5 A;  1DJA A;  3UY6 A;  2HZ5 A;  1BLH A;  1JWZ A;  2ZJ9 A;  2WGW B;  4HOI A;  5AQB A;  1YPR A;  3NJA A;  3HLE A;  1XPB A;  2E8I A;  4I3A A;  3M6H A;  4UHU A;  1YSQ A;  1L2S A;  4WZ5 C;  1FCN A;  4JPM A;  1CF0 A;  2WKQ A;  4RYE A;  3C7U A;  4YNR A;  3OZH A;  4KZ7 A;  5DFX A;  1FCM A;  1CI8 A;  4X69 A;  2VV7 A;  1Y28 A;  2PBY A;  4Y0O A;  1H5X A;  2PU4 A;  3T4T A;  2GNX A;  2VA0 A;  5M19 A;  3ZCZ A;  4B93 A;  4DDS A;  3QP5 A;  1LI0 A;  5L8M A;  1O7E A;  3SS4 A;  2V20 A;  2XSS A;  4MEZ A;  1NRJ A;  3LR0 A;  3O87 A;  3MF0 A;  3MXS A;  2XLN A;  1IFQ A;  1HZO A;  2WK0 A;  1IEL A;  4ID4 A;  1VEU A;  5EVI B;  1YM1 A;  3KSH A;  4GHI A;  4CQH A;  1NLY A;  2EWW A;  1YLY A;  4U0T A;  3ITB A;  4DE0 A;  3C8C A;  5F6A A;  5HD3 A;  1NXY A;  1T19 A;  3BRM A;  3A3E A;  2KDK A;  3BFE A;  2JC7 A;  1HVB A;  5DKL A;  2PDR A;  4KEN B;  4HNB A;  3GQZ A;  1NZU A;  4JF5 A;  2ZLY A;  4KG6 A;  2V1A A;  3NDG A;  1K6R A;  5CGS A;  3PAE A;  1BLC A;  2I72 A;  1RGZ A;  3C7V A;  3WS0 A;  2EX8 A;  3UME A;  2EX9 A;  5MC7 A;  4WMC D;  3TJZ C;  4DRT A;  3IWQ A;  5HZH A;  1N9L A;  1ZG4 A;  2FZ0 A;  2XEP A;  5E2G A;  4OOM A;  1KVM A;  1AWI A;  1BUL A;  2W3F A;  4IUK A;  4Z1W A;  4N1H A;  3ZDJ A;  2OOL A;  4EQ1 A;  4KQD A;  4WF0 A;  5FQM A;  3GTC A;  4NKP A;  4GS9 A;  3M6B A;  4ZAM A;  3H82 B;  4S2N C;  4IJG A;  5AJG A;  2P9V B;  3T4J A;  1ZC2 A;  3C2W A;  4EER A;  4ME4 A;  1Q2Q A;  1K6S A;  5DF7 A;  3BFD A;  1PNE A;  2VV6 A;  3MXR A;  3O88 A;  3CPT B;  3A0R A;  4QU3 A;  5I5L A;  1M40 A;  5F82 A;  2PT7 A;  4JGQ A;  3T1R A;  3LIE A;  1OT6 A;  4ZRR A;  3IF6 C;  1MPL A;  4PM7 A;  3T4Q A;  4MNR A;  3EOI A;  4GDN A;  4LRY C;  3TW8 A;  5CHM A;  1TS8 A;  1F2K A;  2M7V A;  5JYO A;  3G6O A;  4MBF A;  3SZT A;  3JVV A;  3ZNT A;  4C3Q A;  3PBN A;  4K91 A;  3VMA A;  3TE8 A;  5CER A;  2RCX A;  1YLJ A;  4FCF A;  3Q1F A;  3QP1 A;  2PAV P;  1O07 A;  5FQ9 A;  4GW9 A;  5EEC A;  2XFS A;  1VET B;  1XXM A;  1XGJ A;  1TF1 A;  5HDC A;  1CEG A;  1MKI A;  1TDG A;  4II7 A;  3IF5 A;  2C5W B;  1STZ A;  4PM9 A;  3AGD A;  3VP4 A;  4GKU A;  1C3B A;  3H7W B;  1Y4O A;  1FQG A;  1WA9 A;  1YMX A;  5EVE A;  3IQA A;  3GVB A;  4HP9 A;  3BY8 A;  2QMI A;  3IS2 B;  4JBF A;  1FIK A;  1IYS A;  1IOU A;  3IH9 A;  3KSG A;  2W1T A;  5EM1 A;  4BD0 A;  1G28 A;  1GCE A;  3I7J A;  4X68 A;  2EA9 A;  3GDI A;  5GHX A;  3OPL A;  2V8C A;  2JKT M;  4QY5 A;  3UPP A;  4GDB A;  5EV0 A;  3RJU A;  1SKO B;  3C4O A;  3PBT A;  5CGX A;  5FSR A;  3G2Y A;  3PBR A;  1E3U A;  4HES A;  1DP6 A;  4H6J A;  1YLZ A;  4GD8 A;  4HI4 A;  4GN2 A;  4HJ4 A;  3L9K A;  1ACF A;  4GB7 A;  3VP2 A;  1ONG A;  4E3K A;  1KVL A;  3M2J A;  1N9N A;  3F1P A;  3HLF A;  2K31 A;  3WWX A;  5C5K A;  5EVI C;  4YIN A;  1TS0 A;  4EBP A;  4JF6 A;  3GV9 A;  1Y54 A;  1K4E A;  2FFY A;  2OSU A;  3CMZ A;  4H8R A;  4OKP A;  2FFF B;  3ZYT A;  4MMN A;  1ZHH B;  4OPZ A;  2Y91 A;  4F3L A;  3BJN A;  5F69 A;  3FPV A;  2XGN A;  2WAF A;  3QP8 A;  3C38 A;  3S1Y A;  5TFQ A;  3SS3 A;  1LL9 A;  2LB9 A;  4EBL A;  1FSY A;  4S2N A;  4O0P A;  4CJN A;  3CHW P;  1DJB A;  2W3E A;  4OP8 A;  2PHY A;  2XDM A;  4LEN A;  2V0U A;  2Z6C A;  5E2F A;  3IXH A;  3NOP C;  4LCM A;  3R4K A;  5AVF A;  3GRJ A;  2Y2L A;  3S7N A;  2IWC A;  3NC8 A;  2WGI A;  4NET A;  3WRZ A;  1W63 M;  3VP0 A;  3ULF A;  2X02 A;  3O5Y A;  4BEN A;  2PR6 A;  2RL3 A;  1L0G A;  1VM1 A;  3R7W B;  5L2F A;  3FPW A;  4R1G A;  3MQO A;  3IF6 A;  4BWI A;  4OQ0 A;  3DW0 A;  1ZG6 A;  3HLG A;  2A24 B;  2XH9 A;  5FAS A;  2G2U A;  1VB6 A;  3Q7V A;  5FQQ A;  4I38 A;  1D1J A;  4PM5 A;  4OQG A;  4K0W A;  3MXQ A;  3LR4 A;  3G31 A;  4QJG A;  5E2E A;  3MFX A;  2Y55 A;  4OLG A;  3F1N A;  2IA2 A;  4K0X A;  3OCN A;  3TSG A;  4IUH A;  1ESU A;  1KE3 A;  2QKP A;  2VGJ A;  3UB6 A;  4MN7 A;  1CK3 A;  2GX5 A;  3E4O A;  4E3I A;  1XKZ A;  3KYZ A;  4WM9 A;  4M4X A;  2ZQC A;  1ONH A;  3CLO A;  2ZQ7 A;  3ZG5 A;  3A3F A;  1P9W A;  3SW1 A;  5CEB A;  4WBG A;  2W27 A;  2OAQ 1;  4OON A;  3MFD A;  4DKI A;  1LHY A;  2AVX A;  2QJ7 A;  4ESP A;  1J9M A;  1PRQ A;  1TVF A;  2QHK A;  2JKT I;  1YAX A;  2Q9N A;  3G30 A;  3BY9 A;  5IS1 A;  4OLD A;  4XXR A;  4QHC A;  3GR2 A;  5L07 A;  4R3A A;  1X0O A;  2W3D A;  4OPQ A;  2L1M A;  1QMF A;  5FDS A;  4KUO A;  4XT2 A;  1T18 A;  2H0T A;  1W8Y A;  2YKH A;  3CZD A;  4IHQ A;  3MR0 A;  2ZMA A;  3MKF A;  5GHY A;  3IWO A;  3LCE A;  3UB8 A;  3A3D A;  1ZKJ A;  5CHU A;  2JKR M;  3FKV A;  3MS6 A;  3C5A A;  2WKH A;  5G4Z A;  3N6I A;  4KUK A;  4Z9Q A;  2BG1 A;  2Y2M A;  5CX7 A; 
#chains in the Genus database with same CATH homology
 1XA1 A;  1NZU A;  3GQZ A;  4JF5 A;  2ZLY A;  2HDU A;  4KG6 A;  4S2O A;  3NDG A;  1NZO A;  1K6R A;  3UNW A;  3Q7Z A;  2Y59 A;  2CC1 A;  5CGS A;  4DE1 A;  3PAE A;  1BLC A;  2ZC5 B;  1L0E A;  4L0L A;  1K4F A;  2I72 A;  4EUZ A;  1RGZ A;  2Y2I A;  3C7V A;  1JTG A;  3WS0 A;  2EX2 A;  2EX8 A;  5U47 A;  2EX9 A;  5I94 A;  3MZF A;  4JXV A;  1YLW A;  4KQQ A;  1KGE A;  3WRT A;  4WMC D;  3IT9 A;  5EE8 A;  1PW1 A;  1MWS A;  2Z2M B;  4DRT A;  3IWQ A;  3PAG A;  5HAI A;  4XUX A;  3P09 A;  4NK3 A;  1ZG4 A;  3PBO A;  2XEP A;  1KDW A;  2R9W A;  5E2G A;  2H10 A;  4OOM A;  1KVM A;  1OME A;  1PI5 A;  3WS2 A;  1BUL A;  1LLB A;  4PPR A;  5FAP A;  4E6X A;  3FYZ A;  3ITA A;  4ZTK A;  4R3J A;  3ZHH A;  4N1H A;  3ZDJ A;  1Q2P A;  3HUO A;  1NRF A;  4IBX A;  4RA7 A;  5AQ9 A;  1XP4 A;  4IBR A;  4PMA A;  4S2P A;  3BM6 A;  4HBU A;  5EUA A;  2WKI A;  3GTC A;  5FQM A;  1WYC A;  1PZP A;  2IWD A;  3OC2 A;  4P0M A;  2V1Z A;  3PTE A;  1SDN A;  3M6B A;  4RX2 A;  3LY3 A;  3NY4 A;  4ZAM A;  1K25 A;  4IVI A;  4S2N C;  5GLD A;  4LV3 A;  3LEZ A;  1W8Q A;  2Y4A A;  2JBF A;  1K54 C;  1BUE A;  4LV0 A;  2P9V B;  3UDF A;  1GA0 A;  1ZC2 A;  3Q81 A;  4WMC A;  3NI9 A;  3C4P A;  1ERQ A;  5GLB A;  1MWR A;  1Q2Q A;  4X56 A;  4OOL A;  2ZQA A;  5HAP A;  1K6S A;  5DF7 A;  3VSL A;  3DWZ A;  1K56 A;  3BFD A;  3N8L A;  1JVJ A;  3A3I A;  3MXR A;  3O88 A;  3VSK A;  4FSF A;  3HLB A;  4QU3 A;  3UPN A;  1JWV A;  1M40 A;  4EWF A;  1TDL A;  5DTS A;  5F82 A;  4UAA A;  1W7F A;  2R9X A;  2DNS A;  3UPO A;  5CRF A;  3ZG8 B;  1BLP A;  4ZJ3 A;  3P98 A;  4HEF A;  4N1X A;  5EVL A;  3V39 A;  2WGW A;  3IF6 C;  4BL3 A;  1PZO A;  1MPL A;  1W5D A;  4PM7 A;  5G18 A;  4MNR A;  4GDN A;  2J9P A;  5CHM A;  4BJP A;  4KQO A;  4DXC A;  3UE1 A;  5JYP A;  4R23 A;  4S2J A;  5JYO A;  2C6W B;  3IWI A;  3OCL A;  4E3M A;  2XFT A;  5CTN A;  2P9V A;  2XR0 A;  4MBF A;  1E25 A;  2QZ6 A;  1KGG A;  1U60 A;  3UN7 A;  1CEF A;  3NIA A;  3IF6 B;  5HAR A;  3ZNT A;  4C3Q A;  3PBN A;  1H8Y A;  1G68 A;  4K91 A;  3VMA A;  1JTD A;  1MY8 A;  4OOY A;  5D3O A;  3VFH A;  2P74 A;  3DWK A;  5CER A;  2RCX A;  1ES4 A;  1MXO A;  5FQK A;  1YLJ A;  5HFO A;  3E2L A;  5EOO A;  2Y2Q A;  5TR7 A;  5J8X A;  3E2K A;  4FCF A;  5F1G A;  2GDN A;  5M1A A;  3Q1F A;  4OP5 A;  2H5S A;  3Q7V B;  5FAQ A;  4RX3 A;  1MWU A;  1O07 A;  5KZH A;  1K57 C;  3IHB A;  5FQ9 A;  5GLC A;  3IXB A;  2WZX A;  1S0W A;  4MBK A;  5EEC A;  4DE3 A;  5KSC A;  4KZ6 A;  3N8S A;  3SH9 A;  3MZE A;  4E6W A;  3BEB A;  1NY0 A;  2XFS A;  4E3O A;  2XQZ A;  3N4I A;  4E3J A;  2JE5 A;  4GNU A;  4N92 A;  1XXM A;  1XGJ A;  5FAT A;  5AQ7 A;  3NBL A;  2HDS A;  3RXW A;  4OPY A;  5DTK A;  4D2O A;  5EVI A;  1CEG A;  1L0F A;  1MKI A;  1TDG A;  4JLF A;  4KZB A;  3IF5 A;  3W4Q A;  2B5R A;  2C5W B;  4EQI A;  1GHM A;  4PM9 A;  3AGD A;  3VP4 A;  4GKU A;  4IVK A;  1C3B A;  3CJM A;  1I2S A;  1EI5 A;  4LV1 A;  4U0X A;  4X6T A;  4OQI A;  1FQG A;  1E3U D;  3SH8 A;  1YMX A;  5GL9 A;  5A92 A;  3HVF A;  3QNB A;  3ZG9 B;  3IQA A;  3GVB A;  4LV2 A;  4PM6 A;  4B88 A;  2QMI A;  1FR1 A;  4KQR A;  5CED A;  4DF6 A;  4KZ4 A;  3B3X A;  1BSG A;  1K55 C;  4JBF A;  1NYM A;  4KZ9 A;  4EBN A;  1IYS A;  4LCL A;  4WZ4 A;  2ZQ9 A;  1BLS A;  3IH9 A;  3UDX A;  3WS4 A;  4S2L A;  5GHZ A;  1GHI A;  1YT4 A;  2ZC7 A;  2HP5 A;  2ZM8 A;  2ZM0 A;  5CHJ A;  4BD0 A;  1GCE A;  1SDE A;  2Y2O A;  1WE4 A;  2HPB A;  3I7J A;  4GD6 A;  4UA9 A;  4UA7 A;  4X68 A;  2Z2L B;  3WS5 A;  3RXX A;  2J8Y A;  2XF3 A;  5GHX A;  3OPL A;  1FCO A;  3MKE A;  1KE4 A;  3BLS A;  3CG5 A;  4IED A;  1KDS A;  3M2K A;  2A3U A;  4QY5 A;  4P87 A;  2J7V A;  3LO7 A;  2QPN A;  3IXG A;  3UPP A;  4GDB A;  5BOH A;  4ZJ1 A;  3C4O A;  3PBT A;  3QNC A;  4P85 A;  5CGX A;  5FSR A;  3RJU A;  3BFG A;  3Q07 A;  1PWC A;  3G2Y A;  3PBR A;  1HD8 A;  4Y0U A;  1E3U A;  4HES A;  2WAE A;  3N7W A;  3UDI A;  1YLZ A;  2WZZ A;  3PBS A;  2WAD A;  4BLM A;  4WEL A;  4GD8 A;  4GN2 A;  3OPR A;  3SS5 A;  2X01 A;  4GB7 A;  3IXD A;  3VP2 A;  1ONG A;  3FV7 A;  4E3K A;  4QY6 A;  3G2Z A;  1SCW A;  3VOY A;  1MBL A;  3A3J A;  5E43 A;  1KVL A;  4ZDX A;  3M2J A;  3W8K A;  4WYY A;  3HUM A;  3HLC A;  3V50 A;  3AGF A;  5FI6 A;  4DDY A;  1ERM A;  3O3V A;  2VGK A;  4FD8 A;  3HLF A;  1IYP A;  3ZNY A;  3DTM A;  3WWX A;  5EVI C;  5DF8 A;  4YFM A;  4YIN A;  4EBP A;  1XGI A;  1M6K A;  4JF6 A;  3W4P A;  1N4O A;  1GHP A;  1Y54 A;  3GV9 A;  3IH8 A;  1K4E A;  2FFY A;  4R4R A;  5IHV A;  3SH7 A;  2OSU A;  3CMZ A;  4H8R A;  4OKP A;  5HL1 A;  1AXB A;  3IHA A;  4U3T A;  3V3R A;  4OH0 A;  2BLS A;  2FFF B;  2HP9 A;  3EQV A;  3OPH A;  3HBR A;  1KGF A;  4OPZ A;  4BQM A;  5DF9 A;  2WKE A;  2H0Y A;  2Y91 A;  3VFF A;  4E3L A;  2DRW A;  2XD5 A;  5FA7 A;  5DTT A;  3UO9 A;  1S6R A;  3BFF A;  3BFC A;  1IEM A;  3FWL A;  5KSH A;  3HLD A;  3S22 A;  3WS1 A;  4C75 A;  3HLW A;  2V2F F;  4X53 A;  2XGN A;  2EXB A;  1ESI A;  2WAF A;  4Y0T A;  3Q82 A;  5A93 A;  3V5M A;  5FQJ A;  3BYD A;  3S1Y A;  4Q8I A;  1E4D A;  3TOI A;  4WEJ A;  5TFQ A;  4GOG A;  3SS3 A;  1JWP A;  1LL9 A;  4WEK A;  4WZ5 A;  4PM8 A;  4EBL A;  1FSY A;  3G4P A;  3PBQ A;  4S2N A;  5AQA A;  4CJN A;  2DCF A;  1DJB A;  4GZB A;  4OP8 A;  1I5Q A;  2XDM A;  3TG9 A;  2OV5 A;  1K54 A;  4HBT A;  4LEN A;  5HW3 A;  3ZVT A;  1PI4 A;  1YMS A;  5E2F A;  1EWZ A;  1ALQ A;  3GSG A;  4JXG A;  3IXH A;  1CI9 A;  4OPR A;  2WUQ A;  1PWD A;  1SKF A;  4LCM A;  2Y2G A;  1BT5 A;  2J9O A;  2HDQ A;  4P6B A;  3V3S A;  3MBZ A;  3GRJ A;  2Y2L A;  2IWC A;  3GMW A;  2WGI A;  3NC8 A;  4N9L A;  4NET A;  1PW8 A;  4X55 A;  4JF4 A;  5EPH A;  3WRZ A;  5EOE A;  3VP0 A;  4E3N A;  3MZD A;  1I2W A;  2X02 A;  3EQU A;  4BEN A;  1Z6F A;  1W79 A;  2RL3 A;  1L0G A;  1BTL A;  1VM1 A;  4R4S A;  5L2F A;  4R1G A;  1PYY A;  2HP6 A;  3IF6 A;  2A49 A;  3N8R A;  1L0D A;  2X71 A;  1G6A A;  4EV4 A;  3ZGA B;  4OQ0 A;  4F94 A;  5A91 A;  1IKI A;  3DW0 A;  1ZG6 A;  3G35 A;  3G34 A;  3HLG A;  4JKT A;  2ZM2 A;  1ES5 A;  2G2W A;  2XH9 A;  4BL2 A;  5FAS A;  4ZBE A;  4B4Z A;  1SHV A;  2G2U A;  4FH2 A;  3NDE A;  4A5R A;  2ZC6 B;  1IYO A;  2Y2K A;  3FZC A;  3Q7V A;  5FQQ A;  1WYB A;  2Y2N A;  3VOZ A;  5KMW A;  1HTZ A;  2ZD8 A;  3BLM A;  4PM5 A;  2Y2J A;  1K56 D;  1QME A;  2EXA A;  1XA7 A;  4M3K A;  4MLL A;  4RVA A;  5FQI A;  1RP5 A;  4C6Y A;  5FAO A;  1DJA A;  4KG2 A;  4K0W A;  4OQG A;  5F83 A;  3UY6 A;  1BLH A;  1IYQ A;  1JWZ A;  3AGE A;  2IWB A;  3G31 A;  1ES2 A;  4S2K A;  2EFU A;  2ZJ9 A;  4QJG A;  2WGW B;  2JCH A;  2ZQ8 A;  5E2E A;  2Y55 A;  5TGF A;  4OLG A;  5AQB A;  4K0X A;  5M18 A;  3OCN A;  2ZQD A;  3TSG A;  3ZG0 A;  1ESU A;  1KE3 A;  2VGJ A;  3HLE A;  4QB8 A;  5FI2 A;  1XPB A;  2E8I A;  1FSW A;  1CK3 A;  3VP1 A;  1DJC A;  4E3I A;  1XKZ A;  3M6H A;  3D4F A;  4UHU A;  4WM9 A;  3S4X A;  1L2S A;  2ZQC A;  4WZ5 C;  1ONH A;  1PWG A;  4QD4 A;  3BEC A;  1K57 A;  4N9K A;  5E2H A;  1FCN A;  4DE2 A;  3SOI A;  3QHY A;  2ZQ7 A;  2OLV A;  2PU2 A;  4JPM A;  5FI7 A;  3ZG5 A;  2WGV A;  4FH4 A;  5HX9 A;  3A3F A;  4S2I A;  4RYE A;  3C7U A;  5CXW A;  3OZH A;  2Y2P A;  4KZ7 A;  4WBG A;  5CEB A;  4CPK A;  1FCM A;  1CI8 A;  1YLT A;  4KG5 A;  2Q9M A;  4X69 A;  4R0Q A;  1FOF A;  3NCK A;  4OON A;  5A90 A;  5CEC A;  2XD1 A;  3MFD A;  2PBY A;  4DKI A;  1LHY A;  5HAQ A;  5CTM A;  4Y0O A;  1J9M A;  1H5X A;  1YLP A;  1DY6 A;  3O86 A;  1TVF A;  1IKG A;  2PU4 A;  1H8Z A;  1TEM A;  2Q9N A;  1KE0 A;  3G30 A;  2XK1 A;  4Y7P A;  5CGW A;  5M19 A;  4JXW A;  3ZCZ A;  4DDS A;  1LI0 A;  4OLD A;  4XXR A;  1RCJ A;  3ZFZ A;  3ZG7 B;  1LI9 A;  1O7E A;  3SS4 A;  2V20 A;  4OVD A;  4QHC A;  1LL5 A;  3GR2 A;  4MEZ A;  1MWT A;  4BD1 A;  3O87 A;  2WYX A;  4OPQ A;  2Y2H A;  3MXS A;  2XLN A;  3FKW A;  3G32 A;  3HL9 A;  2EFX A;  5DVA A;  1HZO A;  2HDR A;  1K55 A;  1ERO A;  4R3B A;  1QMF A;  3ZVW A;  4JXS A;  2ZC3 B;  1GA9 A;  2EX6 A;  1IEL A;  2WK0 A;  4ID4 A;  4KZA A;  5EVI B;  1YM1 A;  2H0T A;  1FR6 A;  1W8Y A;  5EVI D;  3OPP A;  1YLY A;  4UA6 A;  1VQQ A;  4XUZ A;  3HUN A;  4B4X A;  3CZD A;  1YQS A;  2ZMA A;  3MKF A;  4U0T A;  3ITB A;  1XX2 A;  5FDH A;  4DE0 A;  5GHY A;  2ZC4 B;  1K38 A;  3IWO A;  1BZA A;  3LCE A;  3W4O A;  3A3D A;  1ZKJ A;  5CHU A;  1NXY A;  4O7D A;  3BRM A;  3UE3 A;  1NYY A;  1PIO A;  3A3E A;  3FKV A;  5GLA A;  4S2M A;  3C5A A;  2WKH A;  3BFE A;  4ZJ2 A;  5F1F A;  3N6I A;  1ES3 A;  3UE0 A;  2JC7 A;  4KZ5 A;  4OQH A;  4KZ8 A;  4MBH A;  3JYI A;  4Z9Q A;  2Y2M A;  4KZ3 A;  2BG1 A;  3VP3 A;  1HVB A;  2OLU A;  1NJ4 A;  2UWX A;  1RGY A;  3HRE A;  4KEN B;  3ISG A;  1N9B A;  3LY4 A;  4DXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...