1G68A

Pse-4 carbenicillinase, wild type
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
266
structure length
266
Chain Sequence
SKFQQVEQDVKAIEVSLSARIGVSVLDTQNGEYWDYNGNQRFPLTSTFKTIACAKLLYDAEQGKVNPNSTVEIKKADLVTYSPVIEKQVGQAITLDDACFATMTTSDNTAANIILSAVGGPKGVTDFLRQIGDKETRLDRIEPDLNEGKLGDLRDTTTPKAIASTLNKFLFGSALSEMNQKKLESWMVNNQVTGNLLRSVLPAGWNIADRSGAGGFGARSITAVVWSEHQAPIIVSIYLAQTQASMEERNDAIVKIGHSIFDVYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the molecular basis for the carbenicillinase activity of PSE-4 beta-lactamase from crystallographic and kinetic studies.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE PSE-4
total genus 98
structure length 266
sequence length 266
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1g68A00
1N4OA 1HD8A 2Q9NA 1L2SA 3GTCA 3NBLA 4Y7PA 4ZJ2A 4IVIA 4UA9A 4GDNA 1IYOA 1BLSA 1XXMA 4RA7A 5CEDA 3O86A 1YLTA 1PWGA 2ZD8A 3HLFA 5KZHA 3N8RA 4GNUA 5IHVA 1MPLA 3MFDA 5M18A 1NYMA 2HP5A 1MWUA 4OPQA 4JF6A 3IF6C 1FCMA 4ZTKA 1ES4A 1W7FA 2P74A 3A3FA 3HBRA 4P6BA 1KGGA 3W4PA 3WWXA 1PZPA 1W5DA 3Q7ZA 5HAPA 3S22A 3Q82A 3OCNA 1JWVA 3ZG5A 1S0WA 1ONGA 3UDFA 1KGFA 4X69A 2RCXA 4RYEA 5A92A 4JBFA 4JXSA 2QZ6A 4OOLA 3Q81A 3BFFA 1U60A 3PAEA 4GOGA 2WGWB 4E6XA 5FA7A 3G35A 3HUMA 3ZG7B 1LL9A 1HVBA 3UPPA 5I94A 5CHMA 4GD6A 5AQ9A 4KQOA 4FSFA 4YFMA 3IF6A 1RP5A 3IWIA 4N92A 1M40A 3G32A 4OQIA 3GV9A 1NYYA 1WE4A 3UNWA 3BM6A 5EVID 2J9OA 4KZBA 1K25A 1PW1A 3UE3A 3ZVTA 5EECA 4KZ7A 4K0XA 1L0EA 3IQAA 2EXBA 2JCHA 1KGEA 2X71A 4QD4A 3VP3A 1O07A 1ES3A 3FKWA 3N6IA 3QNCA 4DDYA 4HESA 1C3BA 3N8LA 5CXWA 2ZM8A 2HPBA 3LEZA 3VSLA 1GCEA 5AQAA 3SS4A 1S6RA 4QJGA 2C6WB 1BTLA 3AGFA 1NRFA 2OLVA 2X02A 5FAQA 5F82A 4X56A 2OSUA 3PBOA 4OPRA 3O3VA 2P9VA 2Y2NA 5HL1A 5HAQA 4KQRA 1FSYA 4OOYA 1QMEA 3CJMA 2Z2MB 3LY3A 2WZZA 4WMCA 4Z9QA 3MZDA 3VFHA 1TVFA 1KDWA 1Z6FA 4JLFA 4MEZA 1GA9A 5DTSA 4JXWA 4E6WA 3IWOA 5G18A 3SH7A 1I5QA 1VQQA 4ID4A 5J8XA 3LCEA 4PM7A 4KZ6A 4UA6A 5GHXA 1IKGA 4C3QA 4DXCA 3C4PA 4KZAA 1KDSA 5GLAA 3GR2A 1MXOA 3PTEA 1Q2PA 1KE0A 3PBQA 3IHAA 1FQGA 1ZG6A 2ZM2A 3IXBA 4OQGA 4LV0A 4CJNA 5U47A 3N4IA 3V5MA 5FDHA 5E2HA 3W4QA 2UWXA 4HBTA 1BLCA 1ESUA 1SDEA 1YM1A 3ZG0A 2Y2PA 3G30A 3RXWA 3NC8A 3AGEA 4LCMA 3Q7VB 4WEKA 4DDSA 5HX9A 3BEBA 2P9VB 4S2KA 4S2MA 3UN7A 1IYQA 1BT5A 2EFXA 3PBRA 3TG9A 2Y2JA 4BD0A 5KMWA 1PZOA 4CPKA 4JF5A 2HDQA 3A3EA 3GVBA 4XXRA 5TGFA 5CEBA 5GLCA 2Y2HA 1FR6A 3BYDA 1FSWA 1DJCA 4BLMA 3DWKA 3VOZA 4R0QA 4LCLA 1SCWA 5HAIA 5FI6A 3IWQA 5FQIA 2ZQDA 2H5SA 4BD1A 5L2FA 2WGWA 5F1FA 3NI9A 4IBRA 3IH8A 2XD5A 3Q7VA 2DRWA 5FAOA 3D4FA 1J9MA 3M6BA 1XGIA 5GL9A 3SH8A 4BJPA 3EQVA 1H5XA 2J8YA 1K4EA 2WADA 3B3XA 1CI8A 3C7VA 2C5WB 3IXHA 1TDGA 2XFSA 4MBKA 1IKIA 2R9XA 2HDUA 1HZOA 1LL5A 2VGKA 2V1ZA 4M3KA 1CK3A 4BL2A 3HLGA 4F94A 4OONA 4OQ0A 5TR7A 3OZHA 4LV2A 4GKUA 2EFUA 2Y55A 1BUEA 3NY4A 2Y59A 2WYXA 2A49A 4LENA 1QMFA 3PBSA 2V20A 3WS0A 3MZEA 3V3RA 4R4RA 2DCFA 2I72A 1PI4A 3ZNTA 5D3OA 4WMCD 2XDMA 1HTZA 1NJ4A 1PIOA 1YLPA 4D2OA 2ZQCA 3BFDA 1LI0A 1IEMA 5FATA 3BFEA 3CMZA 4WEJA 5GLDA 1K54A 2XQZA 3VSKA 2JE5A 5EVIC 3WS4A 3HLBA 4N9KA 5EUAA 1SDNA 1DJAA 1DY6A 2H0TA 1BLHA 4S2OA 4S2IA 5FQ9A 5KSCA 2EX8A 4FH4A 3ZFZA 4E3OA 2ZC6B 2HP9A 3PAGA 1NZUA 4OOMA 5CHUA 4OP5A 1BSGA 4WM9A 2FFYA 1ZG4A 1L0DA 4R3JA 2V2FF 3HVFA 5E2GA 5FQQA 2G2WA 3BRMA 2Y2QA 4PM8A 4KQQA 2WKHA 2X01A 3GMWA 4MBFA 1CI9A 1NZOA 1RGZA 2XD1A 3GSGA 3S4XA 4H8RA 3VOYA 3MZFA 4B4ZA 3NCKA 1MY8A 4U0TA 3VP0A 2XH9A 4DXBA 4R4SA 4PPRA 1YLZA 2RL3A 3HLEA 3P98A 4MLLA 3OPRA 2Y2MA 4KZ5A 4OLDA 1KE4A 5FI7A 4Y0OA 1K54C 1MBLA 5CGXA 3VFFA 2QPNA 4E3IA 3ZGAB 3HUNA 4GZBA 3UE0A 3PBTA 4PM5A 4KG2A 5F1GA 1CEFA 1NXYA 2ZC5B 5DTTA 5FSRA 3ITAA 2XK1A 4RX2A 3UO9A 1YQSA 1BZAA 1E3UD 2XFTA 3M2JA 1MKIA 1E25A 4N1HA 1IELA 3M2KA 2WUQA 4JXVA 3WS1A 3VP2A 5GHZA 4KENB 3VP1A 2Y2OA 3ZDJA 3IF6B 2ZJ9A 2PU2A 3OPPA 4GD8A 3UPOA 1JWPA 4MBHA 4X55A 3IXGA 1LHYA 1K56D 4FD8A 5CHJA 1E4DA 1JVJA 4QB8A 1BULA 5E43A 4S2JA 3MKFA 4FH2A 3WRZA 1JTGA 4OPZA 3NDGA 3A3DA 1EROA 1CEGA 4RVAA 2WAEA 3WS2A 4DF6A 2BG1A 4S2LA 2VGJA 5CERA 1XPBA 1K57C 1W8YA 1K38A 3WRTA 1PWCA 3ZHHA 4WZ5A 1GHIA 4BENA 2ZM0A 1ES2A 1KE3A 1FOFA 3S1YA 1JWZA 2WKIA 4GB7A 2XF3A 3I7JA 4WBGA 4E3KA 1WYCA 3CZDA 1LI9A 1WYBA 1KVMA 3BLMA 5E2FA 2PBYA 3ITBA 4KZ4A 4EQIA 1K6SA 3LO7A 4P85A 2XEPA 2WGVA 4QY6A 1PWDA 1DJBA 2WK0A 2EXAA 4WYYA 3G2YA 5EVIA 4WZ5C 5DF8A 4U3TA 4BQMA 4DE2A 1PI5A 4KG5A 3RXXA 1XP4A 1ZC2A 1K57A 1ALQA 2OLUA 1YT4A 2J9PA 4N1XA 2E8IA 3G34A 4OP8A 5E2EA 3ZG8B 3UE1A 3LY4A 4PM6A 4QY5A 1PYYA 3MBZA 4E3JA 2ZLYA 5AQBA 4EBPA 2DNSA 2XGNA 1O7EA 4QU3A 3IF5A 3HL9A 1KVLA 3SOIA 4OQHA 1L0FA 4R23A 3NIAA 5F83A 4DKIA 1GHPA 4EV4A 1W79A 2Y4AA 5HFOA 3RJUA 1SHVA 4EBLA 4E3NA 2G2UA 1GHMA 5M19A 4K0WA 4NETA 5CECA 4FCFA 3OPHA 1ESIA 2OV5A 5DF7A 5CRFA 4ZAMA 3HREA 4OLGA 5FAPA 1ERMA 3AGDA 3CG5A 1I2WA 3BFGA 3VMAA 1VM1A 5EOEA 3V50A 1ONHA 4JKTA 3UDIA 4S2PA 5FQMA 4ZJ3A 3JYIA 3A3IA 2J7VA 2QMIA 2BLSA 4X68A 1E3UA 4LV1A 2IWCA 3C4OA 3PBNA 3FWLA 1G6AA 3ISGA 5DVAA 2GDNA 1JTDA 1XA1A 5TFQA 3W4OA 4R3BA 5GHYA 2IWBA 1YMXA 4UHUA 3W8KA 3ZCZA 3BECA 4UAAA 5EVIB 1Q2QA 1YLJA 2EX2A 2ZQ8A 5A93A 5AQ7A 1AXBA 3V3SA 3ZNYA 5JYOA 3HUOA 5CGWA 4EBNA 2WAFA 1YLWA 4MNRA 2H0YA 4Y0UA 4Y0TA 1ZKJA 4BL3A 2A3UA 3O87A 1GA0A 2WZXA 3P09A 3DW0A 3E2KA 2ZC3B 1K4FA 1ERQA 4EWFA 3ZG9B 4GN2A 4E3LA 4B88A 1H8YA 3HLCA 3HLDA 2Y2KA 2IWDA 5CGSA 5A90A 3NDEA 2JBFA 3GRJA 3FYZA 2Q9MA 1EI5A 2Z2LB 1K6RA 5FQKA 4LV3A 1MWTA 4PM9A 3IH9A 4KZ8A 4QHCA 1NY0A 1ES5A 2HDSA 4IBXA 2Y2GA 2WKEA 1G68A 4IEDA 4U0XA 1RGYA 1MWSA 1RCJA 2ZMAA 2EX6A 3E2LA 1TEMA 2ZQ9A 1OMEA 5DF9A 1IYPA 2R9WA 3OC2A 4JPMA 1K56A 1K55C 3G31A 4S2NC 3MXSA 4DE1A 2WGIA 2HDRA 3MXRA 3IHBA 5DTKA 3SS5A 4EUZA 4DE0A 4OVDA 4DRTA 5CTNA 3Q07A 1XX2A 5HW3A 3N7WA 3BFCA 2B5RA 1N9BA 3FV7A 4GDBA 3GQZA 4N9LA 3EQUA 3UDXA 4KG6A 1H8ZA 3WS5A 4K91A 2ZC7A 1W8QA 2ZQAA 3DWZA 3UPNA 5JYPA 4XUXA 2HP6A 3C5AA 1BLPA 1Y54A 5GLBA 5BOHA 4YINA 3MKEA 4OH0A 4JXGA 4XUZA 4Q8IA 1K55A 4S2NA 3OPLA 5HARA 2ZC4B 1XKZA 4OKPA 4UA7A 4C6YA 4NK3A 5EE8A 5EVLA 2JC7A 4C75A 1PW8A 5M1AA 3Q1FA 4L0LA 5FASA 3A3JA 4DE3A 3O88A 5A91A 1I2SA 3IT9A 2ZQ7A 2XR0A 3IXDA 1FCOA 3C7UA 4X53A 1L0GA 4HBUA 4ZJ1A 1SKFA 1MWRA 4O7DA 5FQJA 2Y2IA 1YMSA 4B4XA 1TDLA 3M6HA 1IYSA 1EWZA 4PMAA 4ZBEA 2FFFB 4OPYA 2XLNA 3G4PA 1XGJA 4E3MA 4IVKA 4ZDXA 1FR1A 1FCNA 1YLYA 2H10A 3SH9A 2Y91A 4HEFA 4JF4A 5KSHA 2PU4A 4X6TA 3TSGA 3FZCA 3UY6A 1LLBA 3QHYA 4KZ3A 3N8SA 4KZ9A 3BLSA 4P0MA 3SS3A 2CC1A 3OCLA 5CTMA 4A5RA 3ZVWA 1M6KA 2EX9A 3TOIA 1XA7A 5FI2A 5EPHA 3V39A 4WELA 4RX3A 5EOOA 3FKVA 3G2ZA 4WZ4A 3DTMA 3QNBA 4P87A 3VP4A 4R1GA 3HLWA 2Y2LA
chains in the Genus database with same CATH superfamily
2W0NA 2Q9NA 3NBLA 4IVIA 1BLSA 4RA7A 4LLOB 1F2KA 4GNUA 3T4TA 5IHVA 3MFDA 5M18A 1NYMA 4Z1WA 3WWXA 1PZPA 1JWVA 2V8FA 1S0WA 3UDFA 3Q81A 2VKSA 5FA7A 3HUMA 5AQ9A 4KQOA 2VJWA 1RP5A 4N92A 1M40A 3K2NA 3RFBA 3GV9A 3BM6A 3ULFA 4KZBA 3ZVTA 3UE3A 2X71A 3B33A 4PAUA 1ES3A 3QNCA 3P01A 3LEZA 3E4QA 4EEUA 1NRFA 2OLVA 5F82A 2P9VA 2M7UA 5HAQA 1ZTUA 2Z2MB 4Z9QA 3MZDA 3VFHA 1TVFA 1Z6FA 4JLFA 1GA9A 5G18A 1I5QA 1VQQA 4ID4A 4PM7A 1OTEA 1PFLA 3G6OA 1LSVA 3IHAA 2ZM2A 4LV0A 4P6ZM 4CJNA 5U47A 3N4IA 3NC8A 3AGEA 4LCMA 2K7SA 2PRFA 3UN7A 3TRCA 5EVEA 1FSWA 4NXBA 4BLMA 1W63M 5FQIA 5L2FA 3UB5P 4Q0IA 4IBRA 3IH8A 4DMZA 1G6OA 2J3WA 4JGRA 2WADA 4XXRA 4HJ3A 2HDUA 2V1ZA 2VGKA 1Z09A 5HDSA 5TR7A 3OZHA 4GKUA 2HJEA 2AVXA 3CAXA 1BUEA 5AVFA 2WYXA 4LENA 1QMFA 3LIAA 3MZEA 1UGUA 5EM0A 2DCFA 1PI4A 2QWSA 1HTZA 4II7A 2ZQCA 1LI0A 3L7HA 4B9OA 1T1BA 1K54A 4N9KA 4GHIA 5EUAA 3MJQA 1BLHA 4S2IA 3CI6A 5CHUA 1F9IA 4OP5A 2FFYA 2MJ6A 4R3JA 5C5KA 3HVFA 3H7WA 3CITA 4UEYA 5MC7A 4MBFA 2PYRA 3MZFA 2XH9A 4R4SA 3OPRA 4OLDA 4D60A 4HJ4A 1KE4A 4Y0OA 1K54C 5CGXA 3VFFA 4E3IA 2QPNA 2W1RA 3T4SA 4GZBA 5L07A 5DTTA 1TS8A 2XK1A 2I9VA 5DJTA 3M2JA 3S7PA 1IELA 2OOLA 3WS1A 4JXVA 3LUQA 1YAXA 3C30A 5GHZA 2JKTI 1D7EA 3VP1A 1SKOB 3T1SA 2Y2OA 2ZJ9A 3O5YA 1JWPA 3LI8A 4Y2FA 3K3CA 4FD8A 1DP9A 1MC0A 2L1MA 3JPUA 4S2JA 4FH2A 3NDGA 3LICA 4QPRA 3A3DA 1EROA 4XT2B 2W27A 4LRYC 1XPBA 3ZHHA 2ZM0A 3IBRA 1CJFA 1WYBA 3SZTA 1KVMA 2CMNA 3E4OA 3LO7A 2WGVA 2VLGA 4WZ5C 5DF8A 3K3DA 1ZC2A 2V0UA 4OP8A 5E2EA 3UE1A 1PYYA 3MBZA 4EBPA 4NXEA 1O7EA 5F83A 2HZ5A 2VEAA 1Y28A 4DKIA 5HFOA 4EBLA 3KSHA 5DJUA 4ZAMA 3HREA 4OLGA 5FAPA 1V9ZA 5HDCA 3DBAA 5AJGA 3VMAA 1VM1A 1ONHA 3UDIA 5AVEA 3JYIA 1OJ5A 3MSHA 4G3WA 2J7VA 2BLSA 2VV6A 2VV7A 2P04A 4Q0JA 2XA7M 1W63Q 4AFIA 3CHWP 4GCZA 1S1YA 3FC7A 1VEUB 3ZCZA 3CUEA 3UB8A 1Q2QA 5AQ7A 2HJ9C 3ZNYA 1Y4OA 1YKDA 5JYOA 5CGWA 4JGPA 2H0YA 3O87A 1H3QA 3KYQA 2B95A 3HLDA 1K0KA 2IWDA 5EM1A 5A90A 3NDEA 1K6RA 5FQKA 4PM9A 5HD5A 1NY0A 1ES5A 4IBXA 3E0YA 4HJ6A 4Y13A 4U0XA 2ZMAA 2PYPA 3LR3A 3S7NA 1IYPA 2R9WA 3OC2A 3G31A 4I39A 1OPXA 2HDRA 3IHBA 3Q07A 3C8CA 1S66L 2B5RA 3FG8A 4LGWA 4KG6A 1H8ZA 4BWIA 1NLYA 2BASA 4XUXA 2HP6A 5HD3A 1P9WA 4R3AA 3MKEA 4OH0A 1K55A 4S2NA 1P97A 4UA7A 1MKMA 3T50A 3VOLA 4UQIM 3T4LA 2A24B 4LRXC 1SKOA 4NXGA 4O7DA 4NEED 2DMWA 3L9KA 1JNUA 2FFFB 4KUKA 3G4PA 3VE4A 4P6ZS 4IVKA 1FR1A 1YLYA 2H10A 3IS2A 4P0MA 3QHYA 3KSFA 1S67L 3ZVWA 3KYZA 2O9BA 3MMHA 1STZA 2W1TB 3CPTA 2ZOIA 3UMEA 2E8JA 1L2SA 4ZJ2A 4UA9A 4GDNA 5FDSA 5EFWA 2GX5A 3BJNA 2HP5A 1MWUA 2FH5A 1A0KA 1F98A 1W7FA 2P74A 3HBRA 1KGGA 1W5DA 4E04A 1ONGA 5A92A 4JBFA 4JXSA 4MN6A 1L3LA 1U60A 1YSPA 1LT0A 3UPPA 4YFMA 2VK3A 3A0SA 3IWIA 1WE4A 5EVID 1K25A 2M1CA 3CLOA 1L0EA 1T19A 3IQAA 2XROA 3D72A 1KGEA 4QD4A 3VP3A 4EW7A 4DDYA 2BTFP 3N8LA 5CXWA 2KLIA 2ZM8A 3VSLA 1GCEA 2XSSA 5FAQA 4X56A 2OSUA 3PBOA 1G5UA 2Y2NA 3CWFA 3QP6A 5HL1A 1P0ZA 2Z6CA 3R7WA 4E6WA 4JXWA 3IWOA 3SH7A 1V9YA 3LCEA 4KZ6A 4UA6A 5GHXA 1IKGA 4C3QA 3IX8A 1Q2PA 3V5MA 5FDHA 3W4QA 1ESUA 3ZG0A 5IT5A 5HX9A 3BEBA 2VGLM 2P9VB 4S2KA 4S2MA 3LR5A 1ODVA 3LIDA 1IOUA 3A3EA 1XJ2A 3GVBA 5CEBA 5GLCA 1FR6A 3C38A 3DWKA 4LCLA 3EEAA 1SCWA 2ZQDA 4UQIS 2XD5A 3Q7VA 2DRWA 5FAOA 4X1LA 4BJPA 3EQVA 1UWNX 4MBKA 4ARZB 1CK3A 3T4KA 4F94A 4OQ0A 2V9AA 2EFUA 3V67A 4EEPA 3NY4A 3T1QB 3DTEA 3WS0A 2V1AA 2I72A 1NJ4A 1YLPA 4D2OA 2HF6A 1IEMA 1OTAA 5FATA 3CMZA 5GLDA 4I38A 2JE5A 3LIEA 3HLBA 4S2OA 5KSCA 2EX8A 2ZC6B 2HP9A 3PAGA 4Q0HA 4HI4A 4OOMA 5J4EA 1BSGA 4WM9A 2V2FF 5E2GA 5FQQA 2G2WA 2W3DA 3F1PB 1PRQA 4R38A 4I5SA 2XD1A 3GSGA 4EERA 3VOYA 2L0WA 4B4ZA 2IA2A 3VP0A 3LIFA 4DXBA 4PPRA 2RL3A 3HLEA 5FI7A 3ZGAB 3HUNA 3NOTC 2KDKA 1CEFA 2ZC5B 5FSRA 3ITAA 3OOVA 4RX2A 3UO9A 1YQSA 1OJGA 1BZAA 1E3UD 2XFTA 3IX4A 5TBMB 2XA7S 3VP2A 4KENB 3UMDA 3OPPA 1T1CA 5CHJA 4QB8A 5E43A 3MKFA 2P7JA 5FEFA 2W3FA 4G3VA 2W3HA 2WAEA 4DF6A 2VGJA 5CERA 4QWOA 1W8YA 1K38A 3T12B 3UB7A 2WKIA 5HWWA 4GB7A 2XF3A 4WBGA 4E3KA 4EETB 2PBYA 3VV4A 4KZ4A 4EQIA 4IHQA 1K6SA 4QY6A 4YWZA 3GECA 1ACFA 3NECA 3NOPC 4BQMA 1PI5A 1XFNA 3LI9A 3LY4A 4QY5A 3IX3A 4E3JA 5AQBA 2DNSA 4QU3A 3IF5A 2W1TA 1KVLA 3MQQA 2G2UA 1OTBA 1GHMA 4K0WA 4NETA 4F3LB 4FCFA 1ESIA 5DF7A 5CRFA 1TD5A 3BQ8A 1SZVA 2JHEA 5FQMA 4ZJ3A 3A3IA 2QMIA 2ZMVA 4X68A 5HPIA 1E3UA 3DTKA 4LV1A 2JKGA 5HPFA 3C4OA 3ISGA 1JTDA 3A0RA 3W4OA 5GHYA 2IWBA 1YMXA 3HJKA 2D01A 1AXBA 3T4OA 3BWLA 5L10A 4MNRA 4Y0UA 2WKPA 4BL3A 2A3UA 3QP1A 3MR0A 3BW6A 2VV8A 3ZG9B 4GN2A 1H8YA 1FIKA 5CGSA 4FOFA 2PD8A 3FYZA 1EI5A 2Z2LB 3QP4A 4CQHA 2R78A 1MWTA 4LPZA 3P7NA 4KZ8A 2HDSA 2H28A 1G68A 1MWSA 2EX6A 3E2LA 1OMEA 1TS0A 5DF9A 4JPMA 5HWVA 3EOIA 3S7OA 3SS5A 2QYBA 4BBUA 4DRTA 4BBTA 1N9BA 3FV7A 2Y79A 3UDXA 4O8GA 4K91A 2ZC7A 4HP9A 5JYPA 1Y54A 4JXGA 4Q8IA 3NHQA 3OPLA 5M1AA 1VEUA 4L0LA 5FASA 3A3JA 3O88A 3U2AA 2ZQ7A 4ESPA 3C7UA 4X53A 1L0GA 4B4XA 1TDLA 3M6HA 1IYSA 4CLCB 1TF1A 1XGJA 2OAQ1 3UE6A 2PU4A 4X6TA 3EEHA 3EWKA 3FZCA 3UY6A 4IUHA 4KZ9A 3UB9A 4X25A 3F1NA 4DN0A 2HGVA 5CTMA 4A5RA 1OT6A 1KOUA 3TOIA 1XA7A 3H9WA 4WZ4A 1OTDA 2EA9A 3DTMA 3OLOA 4R1GA 4Y3IA 1HD8A 3CPTB 3T4JA 1IYOA 1XXMA 5CEDA 4GS9B 3HLFA 5KZHA 3N8RA 5LBRA 1MPLA 4OPQA 3IF6C 1FCMA 4B93A 1ES4A 3A3FA 4P6BA 5HAPA 2NUPC 3S22A 3Q82A 1F5MA 2VZWA 5F69A 1KGFA 2RCXA 4RYEA 3F1NB 4NXFA 4L9FA 4WUJA 2O0YA 4OOLA 3BFFA 3PAEA 4GOGA 3G35A 1LL9A 1HVBA 5I94A 4GD6A 3QP8A 4FSFA 4JGOA 2J3TD 3G32A 1NYYA 2KOIA 1PW1A 5EECA 4F3LA 2EXBA 3H82B 1O07A 3FKWA 4GLQA 4HESA 2VA0A 5AQAA 2C6WB 1BTLA 3VE3A 2JKRM 4OPRA 4X1MA 4KQRA 1FSYA 4OOYA 1QMEA 3CJMA 4WMCA 4I3AA 4LFUA 2WKRA 3QP2A 1KDWA 4R6LA 5J3WA 1H8MA 5J8XA 4K08A 3C4PA 2ZL1B 3GR2A 3PTEA 5HSQA 4HNBA 4Y5FA 3IXBA 4OQGA 3LIBA 1VHMA 3D3OA 5E2HA 2UWXA 4HBTA 1BLCA 1SDEA 1YM1A 3LR0A 3G30A 3RXWA 1TS6A 3Q7VB 1IYQA 1BT5A 2EFXA 2O9AA 3PBRA 2Y2JA 4BD0A 4CLCE 2HDQA 5TGFA 5F5YA 2Y2HA 3R4KA 1DJCA 3VOZA 4R0QA 3RTYA 2V8CA 5HAIA 5FI6A 2HV1A 1FILA 4Y17A 3MFXA 3NI9A 4MN5A 1J9MA 1XGIA 2O9CA 3MF0A 3JVVA 4HHDA 2W3GA 1CI8A 4KQDA 2C5WB 2V0WA 1IKIA 1HZOA 2M7VA 4M3KA 2JN7A 3HJIA 5TBMA 2Y55A 2Y59A 5EV0A 3PBSA 2V20A 4ZRRA 3DAVA 4R4RA 3ZNTA 1XJ3A 5D3OA 3PHYA 4WMCD 4MDZA 3BFEA 2PR6A 1DJAA 2H0TA 4FH4A 4E3OA 2ZBBA 1ZG4A 3BRMA 2WKHA 4FTXA 4NG2A 1CI9A 3R7WB 1RGZA 3S4XA 2LB9A 3NCKA 1MY8A 4U0TA 1YLZA 2VX8A 1MBLA 3BQAA 1YPRA 4PM5A 5F1GA 1NXYA 2QHKA 1E25A 2JKFA 3M2KA 4NKPA 4HP4A 3ZDJA 3IF6B 2K2NA 3GDIA 4GD8A 3UPOA 4I3JA 3FPVA 4MBHA 3LEQA 4X55A 3IXGA 1K56D 1E4DA 1JVJA 3WRZA 1JTGA 1NLZA 3LFVA 4G3KA 1CEGA 1GSWA 2Y8HA 1DP8A 4S2LA 1K57C 5IU1A 3WRTA 4BENA 1KE3A 3S1YA 4WLAA 3KSIA 4WL9A 3I7JA 1WYCA 3CZDA 3BLMA 3B47A 3LYXA 1VETA 4WF0A 4EUVA 1PWDA 1DJBA 2WK0A 2EXAA 4WYYA 2YKFA 2A24A 4U3TA 1VB6A 4DE2A 4KG5A 4KUOA 3RXXA 1XP4A 1CQAA 1K57A 2OLUA 1YT4A 2J9PA 4N1XA 2E8IA 2GJ3A 3SOIA 4ME4A 4OQHA 2G7UA 1GHPA 4EV4A 1W79A 2Y4AA 2QJ7A 4E3NA 2B18A 5M19A 5CECA 3OPHA 2OV5A 4ETZA 5EOEA 4JKTA 1S4RA 5HWTA 2PHYA 4EQ1A 3FPWA 3PR6A 5DVAA 2QJ5A 1XA1A 5TFQA 4R3BA 4UAAA 1OT9A 2FZ0A 3EGDC 2EX2A 5FEGA 2ZQ8A 5A93A 5TJJA 4HIAA 4MCWA 4I3IA 4EBNA 4Y0TA 1ZKJA 1GA0A 1P9RA 1N9LA 3P09A 2ZC3B 3S7QA 4EWFA 4E3LA 1IFQA 4B88A 2Y2KA 4MN7A 4EU0A 2Q0OA 2Q9MA 3E4PA 3T1XA 2WKQA 4QHCA 2Y2GA 2WKEA 2ZL1A 1RGYA 1RCJA 4LRZE 4ETXA 3MXSA 4DE1A 2WGIA 3MXRA 4EXOA 4EUZA 5CTNA 1XX2A 2J3TC 3N7WA 3TW8A 1X0OA 4N9LA 4YNRA 2ZQAA 1W8QA 3DWZA 3C5AA 1BLPA 3LR4A 5GLBA 5BOHA 4XUZA 2LB5A 5A8BA 5HARA 2PR5A 2ZC4B 4C6YA 4NK3A 5EE8A 5EVLA 2JC7A 3U4LP 3Q1FA 2ACGA 3EGXC 5A91A 3IT9A 3TJZC 4HBUA 1MWRA 5FQJA 2Y2IA 4HY8A 4PMAA 1EWZA 4CLCD 4OPYA 2XLNA 4E3MA 1FCNA 5DKKA 3SH9A 1LL8A 2Y91A 4JF4A 5KSHA 3TSGA 3SS3A 4KZ3A 1LLBA 3IBJA 3N8SA 5HDDA 2CC1A 3F1OA 3UB6A 1NWZA 1M6KA 2EX9A 4MMNA 5FI2A 5EPHA 3V39A 4WELA 4RX3A 3FKVA 3G2ZA 2EWVA 5K5BA 4JGQA 3VP4A 4P87A 3HLWA 2Y2LA 5G4YA 1N4OA 4GJ4A 3GTCA 4Y7PA 2P08A 3O86A 1YLTA 1S4SA 1PWGA 2ZD8A 2YKHA 5G4ZA 5L8MA 4JF6A 3ZQ5A 4ZTKA 5FL3A 3W4PA 3Q7ZA 3KO6A 3OCNA 3ZG5A 4X69A 2QZ6A 3IS2B 4E6XA 2WGWB 3ZG7B 1DP6A 4IUKA 5CHMA 4YOFA 3IF6A 3NJAA 4OQIA 3UNWA 2J9OA 4KZ7A 4K0XA 2JCHA 3N6IA 2O99A 1C3BA 1CF0A 3KYEA 3DTIA 2HPBA 3MQOA 4IJGA 2NUTC 4WN5A 3SS4A 1S6RA 4QJGA 1XJ4A 3AGFA 2X02A 2A2LA 3O3VA 3LY3A 5CX7A 2WZZA 1HLUP 4HQAA 4MEZA 5DTSA 4M4XA 3H7WB 5DKLA 4DXCA 4KZAA 1KDSA 5GLAA 1MXOA 1KE0A 3PBQA 1FQGA 1ZG6A 1J3WA 4HOIA 1N9OA 4O01A 2Y2PA 4WEKA 4DDSA 1LSWA 3TG9A 5KMWA 1PZOA 4CPKA 4JF5A 3PYPA 3BYDA 3IWQA 4BD1A 2H5SA 2WGWA 2UV0E 5F1FA 1EW0A 3SW1A 3D4FA 3M6BA 5GL9A 3SH8A 1ZHHB 1H5XA 2J8YA 3BY8A 1K4EA 4GS9A 3B3XA 3C7VA 3IXHA 1TDGA 2XFSA 2PT7A 2R9XA 1LL5A 4BL2A 2JKTM 3HLGA 4OONA 1LSXA 4LV2A 2A49A 5HL6A 2ZMFA 3NOUC 3V3RA 2Z6DA 3LGOA 2XDMA 1PIOA 3BFDA 2K31A 4O0PA 4WEJA 2XQZA 3VSKA 3WS4A 5EVIC 1SDNA 1DY6A 3KX0X 5FQ9A 3ZFZA 1NZUA 4CLCA 3H82A 3F1OB 5L09A 1L0DA 2Y2QA 4PM8A 4KQQA 2X01A 3GMWA 4RQ9A 1NZOA 4H8RA 3RH8B 2PBDP 2B02A 1T18A 3P98A 4MLLA 2Y2MA 4KZ5A 1NRJA 3ZYTA 3E98A 3UE0A 4XT2A 5F68A 3PBTA 4KG2A 5I5LA 4PHTA 1MKIA 1VETB 3OBFA 4N1HA 2WUQA 3QP5A 3T4QA 3MQ0A 2PU2A 5J7EA 1LHYA 2EWWA 1BULA 2L4RA 3T1RA 4OPZA 1N9NA 2W3EA 2D02A 4RVAA 3WS2A 2BG1A 5DFYA 4L9GA 1PWCA 1OTIA 4WZ5A 1GHIA 3W2ZA 2KX6A 3B42A 4EESA 1ES2A 1FOFA 4HH2A 1JWZA 1UWPX 3D9YA 4FUWA 1LI9A 5E2FA 3ITBA 4BBVA 4P85A 2OWHA 2XEPA 2PDRA 5EVIA 3G2YA 3F1PA 1T1AA 1ALQA 4BMWA 3G34A 3ZG8B 1YSQA 4PM6A 1H0MA 2OWJA 1G28A 2ZLYA 2XGNA 2ZOHA 3HL9A 1PNEA 1L0FA 4R23A 3NIAA 3RJUA 1SHVA 4Y15A 1ERMA 3AGDA 3CG5A 1I2WA 3BFGA 4GHIB 2QKPA 2PAVP 4PKYA 3V50A 4S2PA 4CLCC 3NULA 1D06A 2JKRI 3ICYA 2IWCA 3PBNA 3FWLA 1G6AA 3C2WA 2GDNA 3PXPA 2INWA 4UHUA 3W8KA 1GSXA 3BECA 5EVIB 1XJ6A 1YLJA 3V3SA 5KIZA 3HUOA 5F6AA 2WAFA 1YLWA 4HH3A 4PKYG 2WZXA 3DW0A 3E2KA 1K4FA 1ERQA 1MZUA 3JVUA 4H6JB 1WA9A 3MS6A 3HLCA 1DRMA 4R70A 2JBFA 3GRJA 4GW9A 1AWIA 4LV3A 3BY9A 3IH9A 3CUEC 4IEDA 4H6JA 4DJ2A 5IS1A 1TEMA 2ZQ9A 3MXQA 2VGLS 1BYWA 1K56A 1K55C 4S2NC 1XFQA 5DTKA 2PD7A 4DE0A 4OVDA 1GSVA 5HW3A 3BFCA 3HCYA 4GDBA 3GQZA 3EQUA 3WS5A 3UPNA 4YINA 1S1ZA 2J80A 2XRNA 3KSGA 4ARZA 1TS7A 1XKZA 4OKPA 5DFXA 4C75A 1PW8A 2OAP1 4DE3A 1I2SA 2XR0A 3IXDA 1FCOA 4ZJ1A 1SKFA 1YMSA 4ZBEA 3TE8A 4ZDXA 3A0VA 4L9EA 4HEFA 2GNXA 3BLSA 3OCLA 2GZAA 2V1BA 5HZHA 1D1JA 4DJ3A 5EOOA 3QNBA
chains in the Genus database with same CATH topology
1N4OA 1HD8A 2Q9NA 1L2SA 3GTCA 3NBLA 4Y7PA 4ZJ2A 4IVIA 4UA9A 4GDNA 1IYOA 1BLSA 1XXMA 4RA7A 5CEDA 3O86A 1YLTA 1PWGA 2ZD8A 3HLFA 5KZHA 3N8RA 4GNUA 5IHVA 1MPLA 3MFDA 5M18A 1NYMA 2HP5A 1MWUA 4OPQA 4JF6A 3IF6C 1FCMA 4ZTKA 1ES4A 1W7FA 2P74A 3A3FA 3HBRA 4P6BA 1KGGA 3W4PA 3WWXA 1PZPA 1W5DA 3Q7ZA 5HAPA 3S22A 3Q82A 3OCNA 1JWVA 3ZG5A 1S0WA 1ONGA 3UDFA 1KGFA 4X69A 2RCXA 4RYEA 5A92A 4JBFA 4JXSA 2QZ6A 4OOLA 3Q81A 3BFFA 1U60A 3PAEA 4GOGA 2WGWB 4E6XA 5FA7A 3G35A 3HUMA 3ZG7B 1LL9A 1HVBA 3UPPA 5I94A 5CHMA 4GD6A 5AQ9A 4KQOA 4FSFA 4YFMA 3IF6A 1RP5A 3IWIA 4N92A 1M40A 3G32A 4OQIA 3GV9A 1NYYA 1WE4A 3UNWA 3BM6A 5EVID 2J9OA 4KZBA 1K25A 1PW1A 3UE3A 3ZVTA 5EECA 4KZ7A 4K0XA 1L0EA 3IQAA 2EXBA 2JCHA 1KGEA 2X71A 4QD4A 3VP3A 1O07A 1ES3A 3FKWA 3N6IA 3QNCA 4DDYA 4HESA 1C3BA 3N8LA 5CXWA 2ZM8A 2HPBA 3LEZA 3VSLA 1GCEA 5AQAA 3SS4A 1S6RA 4QJGA 2C6WB 1BTLA 3AGFA 1NRFA 2OLVA 2X02A 5FAQA 5F82A 4X56A 2OSUA 3PBOA 4OPRA 3O3VA 2P9VA 2Y2NA 5HL1A 5HAQA 4KQRA 1FSYA 4OOYA 1QMEA 3CJMA 2Z2MB 3LY3A 2WZZA 4WMCA 4Z9QA 3MZDA 3VFHA 1TVFA 1KDWA 1Z6FA 4JLFA 4MEZA 1GA9A 5DTSA 4JXWA 4E6WA 3IWOA 5G18A 3SH7A 1I5QA 1VQQA 4ID4A 5J8XA 3LCEA 4PM7A 4KZ6A 4UA6A 5GHXA 1IKGA 4C3QA 4DXCA 3C4PA 4KZAA 1KDSA 5GLAA 3GR2A 1MXOA 3PTEA 1Q2PA 1KE0A 3PBQA 3IHAA 1FQGA 1ZG6A 2ZM2A 3IXBA 4OQGA 4LV0A 4CJNA 5U47A 3N4IA 3V5MA 5FDHA 5E2HA 3W4QA 2UWXA 4HBTA 1BLCA 1ESUA 1SDEA 1YM1A 3ZG0A 2Y2PA 3G30A 3RXWA 3NC8A 3AGEA 4LCMA 3Q7VB 4WEKA 4DDSA 5HX9A 3BEBA 2P9VB 4S2KA 4S2MA 3UN7A 1IYQA 1BT5A 2EFXA 3PBRA 3TG9A 2Y2JA 4BD0A 5KMWA 1PZOA 4CPKA 4JF5A 2HDQA 3A3EA 3GVBA 4XXRA 5TGFA 5CEBA 5GLCA 2Y2HA 1FR6A 3BYDA 1FSWA 1DJCA 4BLMA 3DWKA 3VOZA 4R0QA 4LCLA 1SCWA 5HAIA 5FI6A 3IWQA 5FQIA 2ZQDA 2H5SA 4BD1A 5L2FA 2WGWA 5F1FA 3NI9A 4IBRA 3IH8A 2XD5A 3Q7VA 2DRWA 5FAOA 3D4FA 1J9MA 3M6BA 1XGIA 5GL9A 3SH8A 4BJPA 3EQVA 1H5XA 2J8YA 1K4EA 2WADA 3B3XA 1CI8A 3C7VA 2C5WB 3IXHA 1TDGA 2XFSA 4MBKA 1IKIA 2R9XA 2HDUA 1HZOA 1LL5A 2VGKA 2V1ZA 4M3KA 1CK3A 4BL2A 3HLGA 4F94A 4OONA 4OQ0A 5TR7A 3OZHA 4LV2A 4GKUA 2EFUA 2Y55A 1BUEA 3NY4A 2Y59A 2WYXA 2A49A 4LENA 1QMFA 3PBSA 2V20A 3WS0A 3MZEA 3V3RA 4R4RA 2DCFA 2I72A 1PI4A 3ZNTA 5D3OA 4WMCD 2XDMA 1HTZA 1NJ4A 1PIOA 1YLPA 4D2OA 2ZQCA 3BFDA 1LI0A 1IEMA 5FATA 3BFEA 3CMZA 4WEJA 5GLDA 1K54A 2XQZA 3VSKA 2JE5A 5EVIC 3WS4A 3HLBA 4N9KA 5EUAA 1SDNA 1DJAA 1DY6A 2H0TA 1BLHA 4S2OA 4S2IA 5FQ9A 5KSCA 2EX8A 4FH4A 3ZFZA 4E3OA 2ZC6B 2HP9A 3PAGA 1NZUA 4OOMA 5CHUA 4OP5A 1BSGA 4WM9A 2FFYA 1ZG4A 1L0DA 4R3JA 2V2FF 3HVFA 5E2GA 5FQQA 2G2WA 3BRMA 2Y2QA 4PM8A 4KQQA 2WKHA 2X01A 3GMWA 4MBFA 1CI9A 1NZOA 1RGZA 2XD1A 3GSGA 3S4XA 4H8RA 3VOYA 3MZFA 4B4ZA 3NCKA 1MY8A 4U0TA 3VP0A 2XH9A 4DXBA 4R4SA 4PPRA 1YLZA 2RL3A 3HLEA 3P98A 4MLLA 3OPRA 2Y2MA 4KZ5A 4OLDA 1KE4A 5FI7A 4Y0OA 1K54C 1MBLA 5CGXA 3VFFA 2QPNA 4E3IA 3ZGAB 3HUNA 4GZBA 3UE0A 3PBTA 4PM5A 4KG2A 5F1GA 1CEFA 1NXYA 2ZC5B 5DTTA 5FSRA 3ITAA 2XK1A 4RX2A 3UO9A 1YQSA 1BZAA 1E3UD 2XFTA 3M2JA 1MKIA 1E25A 4N1HA 1IELA 3M2KA 2WUQA 4JXVA 3WS1A 3VP2A 5GHZA 4KENB 3VP1A 2Y2OA 3ZDJA 3IF6B 2ZJ9A 2PU2A 3OPPA 4GD8A 3UPOA 1JWPA 4MBHA 4X55A 3IXGA 1LHYA 1K56D 4FD8A 5CHJA 1E4DA 1JVJA 4QB8A 1BULA 5E43A 4S2JA 3MKFA 4FH2A 3WRZA 1JTGA 4OPZA 3NDGA 3A3DA 1EROA 1CEGA 4RVAA 2WAEA 3WS2A 4DF6A 2BG1A 4S2LA 2VGJA 5CERA 1XPBA 1K57C 1W8YA 1K38A 3WRTA 1PWCA 3ZHHA 4WZ5A 1GHIA 4BENA 2ZM0A 1ES2A 1KE3A 1FOFA 3S1YA 1JWZA 2WKIA 4GB7A 2XF3A 3I7JA 4WBGA 4E3KA 1WYCA 3CZDA 1LI9A 1WYBA 1KVMA 3BLMA 5E2FA 2PBYA 3ITBA 4KZ4A 4EQIA 1K6SA 3LO7A 4P85A 2XEPA 2WGVA 4QY6A 1PWDA 1DJBA 2WK0A 2EXAA 4WYYA 3G2YA 5EVIA 4WZ5C 5DF8A 4U3TA 4BQMA 4DE2A 1PI5A 4KG5A 3RXXA 1XP4A 1ZC2A 1K57A 1ALQA 2OLUA 1YT4A 2J9PA 4N1XA 2E8IA 3G34A 4OP8A 5E2EA 3ZG8B 3UE1A 3LY4A 4PM6A 4QY5A 1PYYA 3MBZA 4E3JA 2ZLYA 5AQBA 4EBPA 2DNSA 2XGNA 1O7EA 4QU3A 3IF5A 3HL9A 1KVLA 3SOIA 4OQHA 1L0FA 4R23A 3NIAA 5F83A 4DKIA 1GHPA 4EV4A 1W79A 2Y4AA 5HFOA 3RJUA 1SHVA 4EBLA 4E3NA 2G2UA 1GHMA 5M19A 4K0WA 4NETA 5CECA 4FCFA 3OPHA 1ESIA 2OV5A 5DF7A 5CRFA 4ZAMA 3HREA 4OLGA 5FAPA 1ERMA 3AGDA 3CG5A 1I2WA 3BFGA 3VMAA 1VM1A 5EOEA 3V50A 1ONHA 4JKTA 3UDIA 4S2PA 5FQMA 4ZJ3A 3JYIA 3A3IA 2J7VA 2QMIA 2BLSA 4X68A 1E3UA 4LV1A 2IWCA 3C4OA 3PBNA 3FWLA 1G6AA 3ISGA 5DVAA 2GDNA 1JTDA 1XA1A 5TFQA 3W4OA 4R3BA 5GHYA 2IWBA 1YMXA 4UHUA 3W8KA 3ZCZA 3BECA 4UAAA 5EVIB 1Q2QA 1YLJA 2EX2A 2ZQ8A 5A93A 5AQ7A 1AXBA 3V3SA 3ZNYA 5JYOA 3HUOA 5CGWA 4EBNA 2WAFA 1YLWA 4MNRA 2H0YA 4Y0UA 4Y0TA 1ZKJA 4BL3A 2A3UA 3O87A 1GA0A 2WZXA 3P09A 3DW0A 3E2KA 2ZC3B 1K4FA 1ERQA 4EWFA 3ZG9B 4GN2A 4E3LA 4B88A 1H8YA 3HLCA 3HLDA 2Y2KA 2IWDA 5CGSA 5A90A 3NDEA 2JBFA 3GRJA 3FYZA 2Q9MA 1EI5A 2Z2LB 1K6RA 5FQKA 4LV3A 1MWTA 4PM9A 3IH9A 4KZ8A 4QHCA 1NY0A 1ES5A 2HDSA 4IBXA 2Y2GA 2WKEA 1G68A 4IEDA 4U0XA 1RGYA 1MWSA 1RCJA 2ZMAA 2EX6A 3E2LA 1TEMA 2ZQ9A 1OMEA 5DF9A 1IYPA 2R9WA 3OC2A 4JPMA 1K56A 1K55C 3G31A 4S2NC 3MXSA 4DE1A 2WGIA 2HDRA 3MXRA 3IHBA 5DTKA 3SS5A 4EUZA 4DE0A 4OVDA 4DRTA 5CTNA 3Q07A 1XX2A 5HW3A 3N7WA 3BFCA 2B5RA 1N9BA 3FV7A 4GDBA 3GQZA 4N9LA 3EQUA 3UDXA 4KG6A 1H8ZA 3WS5A 4K91A 2ZC7A 1W8QA 2ZQAA 3DWZA 3UPNA 5JYPA 4XUXA 2HP6A 3C5AA 1BLPA 1Y54A 5GLBA 5BOHA 4YINA 3MKEA 4OH0A 4JXGA 4XUZA 4Q8IA 1K55A 4S2NA 3OPLA 5HARA 2ZC4B 1XKZA 4OKPA 4UA7A 4C6YA 4NK3A 5EE8A 5EVLA 2JC7A 4C75A 1PW8A 5M1AA 3Q1FA 4L0LA 5FASA 3A3JA 4DE3A 3O88A 5A91A 1I2SA 3IT9A 2ZQ7A 2XR0A 3IXDA 1FCOA 3C7UA 4X53A 1L0GA 4HBUA 4ZJ1A 1SKFA 1MWRA 4O7DA 5FQJA 2Y2IA 1YMSA 4B4XA 1TDLA 3M6HA 1IYSA 1EWZA 4PMAA 4ZBEA 2FFFB 4OPYA 2XLNA 3G4PA 1XGJA 4E3MA 4IVKA 4ZDXA 1FR1A 1FCNA 1YLYA 2H10A 3SH9A 2Y91A 4HEFA 4JF4A 5KSHA 2PU4A 4X6TA 3TSGA 3FZCA 3UY6A 1LLBA 3QHYA 4KZ3A 3N8SA 4KZ9A 3BLSA 4P0MA 3SS3A 2CC1A 3OCLA 5CTMA 4A5RA 3ZVWA 1M6KA 2EX9A 3TOIA 1XA7A 5FI2A 5EPHA 3V39A 4WELA 4RX3A 5EOOA 3FKVA 3G2ZA 4WZ4A 3DTMA 3QNBA 4P87A 3VP4A 4R1GA 3HLWA 2Y2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N4O A;  1HD8 A;  2Q9N A;  1L2S A;  3GTC A;  3NBL A;  4Y7P A;  4ZJ2 A;  4IVI A;  4UA9 A;  4GDN A;  1IYO A;  1BLS A;  1XXM A;  4RA7 A;  5CED A;  3O86 A;  1YLT A;  1PWG A;  2ZD8 A;  3HLF A;  5KZH A;  3N8R A;  4GNU A;  5IHV A;  1MPL A;  3MFD A;  5M18 A;  1NYM A;  2HP5 A;  1MWU A;  4OPQ A;  4JF6 A;  3IF6 C;  1FCM A;  4ZTK A;  1ES4 A;  1W7F A;  2P74 A;  3A3F A;  3HBR A;  4P6B A;  1KGG A;  3W4P A;  3WWX A;  1PZP A;  1W5D A;  3Q7Z A;  5HAP A;  3S22 A;  3Q82 A;  3OCN A;  1JWV A;  3ZG5 A;  1S0W A;  1ONG A;  3UDF A;  1KGF A;  4X69 A;  2RCX A;  4RYE A;  5A92 A;  4JBF A;  4JXS A;  2QZ6 A;  4OOL A;  3Q81 A;  3BFF A;  1U60 A;  3PAE A;  4GOG A;  2WGW B;  4E6X A;  5FA7 A;  3G35 A;  3HUM A;  3ZG7 B;  1LL9 A;  1HVB A;  3UPP A;  5I94 A;  5CHM A;  4GD6 A;  5AQ9 A;  4KQO A;  4FSF A;  4YFM A;  3IF6 A;  1RP5 A;  3IWI A;  4N92 A;  1M40 A;  3G32 A;  4OQI A;  3GV9 A;  1NYY A;  1WE4 A;  3UNW A;  3BM6 A;  5EVI D;  2J9O A;  4KZB A;  1K25 A;  1PW1 A;  3UE3 A;  3ZVT A;  5EEC A;  4KZ7 A;  4K0X A;  1L0E A;  3IQA A;  2EXB A;  2JCH A;  1KGE A;  2X71 A;  4QD4 A;  3VP3 A;  1O07 A;  1ES3 A;  3FKW A;  3N6I A;  3QNC A;  4DDY A;  4HES A;  1C3B A;  3N8L A;  5CXW A;  2ZM8 A;  2HPB A;  3LEZ A;  3VSL A;  1GCE A;  5AQA A;  3SS4 A;  1S6R A;  4QJG A;  2C6W B;  1BTL A;  3AGF A;  1NRF A;  2OLV A;  2X02 A;  5FAQ A;  5F82 A;  4X56 A;  2OSU A;  3PBO A;  4OPR A;  3O3V A;  2P9V A;  2Y2N A;  5HL1 A;  5HAQ A;  4KQR A;  1FSY A;  4OOY A;  1QME A;  3CJM A;  2Z2M B;  3LY3 A;  2WZZ A;  4WMC A;  4Z9Q A;  3MZD A;  3VFH A;  1TVF A;  1KDW A;  1Z6F A;  4JLF A;  4MEZ A;  1GA9 A;  5DTS A;  4JXW A;  4E6W A;  3IWO A;  5G18 A;  3SH7 A;  1I5Q A;  1VQQ A;  4ID4 A;  5J8X A;  3LCE A;  4PM7 A;  4KZ6 A;  4UA6 A;  5GHX A;  1IKG A;  4C3Q A;  4DXC A;  3C4P A;  4KZA A;  1KDS A;  5GLA A;  3GR2 A;  1MXO A;  3PTE A;  1Q2P A;  1KE0 A;  3PBQ A;  3IHA A;  1FQG A;  1ZG6 A;  2ZM2 A;  3IXB A;  4OQG A;  4LV0 A;  4CJN A;  5U47 A;  3N4I A;  3V5M A;  5FDH A;  5E2H A;  3W4Q A;  2UWX A;  4HBT A;  1BLC A;  1ESU A;  1SDE A;  1YM1 A;  3ZG0 A;  2Y2P A;  3G30 A;  3RXW A;  3NC8 A;  3AGE A;  4LCM A;  3Q7V B;  4WEK A;  4DDS A;  5HX9 A;  3BEB A;  2P9V B;  4S2K A;  4S2M A;  3UN7 A;  1IYQ A;  1BT5 A;  2EFX A;  3PBR A;  3TG9 A;  2Y2J A;  4BD0 A;  5KMW A;  1PZO A;  4CPK A;  4JF5 A;  2HDQ A;  3A3E A;  3GVB A;  4XXR A;  5TGF A;  5CEB A;  5GLC A;  2Y2H A;  1FR6 A;  3BYD A;  1FSW A;  1DJC A;  4BLM A;  3DWK A;  3VOZ A;  4R0Q A;  4LCL A;  1SCW A;  5HAI A;  5FI6 A;  3IWQ A;  5FQI A;  2ZQD A;  2H5S A;  4BD1 A;  5L2F A;  2WGW A;  5F1F A;  3NI9 A;  4IBR A;  3IH8 A;  2XD5 A;  3Q7V A;  2DRW A;  5FAO A;  3D4F A;  1J9M A;  3M6B A;  1XGI A;  5GL9 A;  3SH8 A;  4BJP A;  3EQV A;  1H5X A;  2J8Y A;  1K4E A;  2WAD A;  3B3X A;  1CI8 A;  3C7V A;  2C5W B;  3IXH A;  1TDG A;  2XFS A;  4MBK A;  1IKI A;  2R9X A;  2HDU A;  1HZO A;  1LL5 A;  2VGK A;  2V1Z A;  4M3K A;  1CK3 A;  4BL2 A;  3HLG A;  4F94 A;  4OON A;  4OQ0 A;  5TR7 A;  3OZH A;  4LV2 A;  4GKU A;  2EFU A;  2Y55 A;  1BUE A;  3NY4 A;  2Y59 A;  2WYX A;  2A49 A;  4LEN A;  1QMF A;  3PBS A;  2V20 A;  3WS0 A;  3MZE A;  3V3R A;  4R4R A;  2DCF A;  2I72 A;  1PI4 A;  3ZNT A;  5D3O A;  4WMC D;  2XDM A;  1HTZ A;  1NJ4 A;  1PIO A;  1YLP A;  4D2O A;  2ZQC A;  3BFD A;  1LI0 A;  1IEM A;  5FAT A;  3BFE A;  3CMZ A;  4WEJ A;  5GLD A;  1K54 A;  2XQZ A;  3VSK A;  2JE5 A;  5EVI C;  3WS4 A;  3HLB A;  4N9K A;  5EUA A;  1SDN A;  1DJA A;  1DY6 A;  2H0T A;  1BLH A;  4S2O A;  4S2I A;  5FQ9 A;  5KSC A;  2EX8 A;  4FH4 A;  3ZFZ A;  4E3O A;  2ZC6 B;  2HP9 A;  3PAG A;  1NZU A;  4OOM A;  5CHU A;  4OP5 A;  1BSG A;  4WM9 A;  2FFY A;  1ZG4 A;  1L0D A;  4R3J A;  2V2F F;  3HVF A;  5E2G A;  5FQQ A;  2G2W A;  3BRM A;  2Y2Q A;  4PM8 A;  4KQQ A;  2WKH A;  2X01 A;  3GMW A;  4MBF A;  1CI9 A;  1NZO A;  1RGZ A;  2XD1 A;  3GSG A;  3S4X A;  4H8R A;  3VOY A;  3MZF A;  4B4Z A;  3NCK A;  1MY8 A;  4U0T A;  3VP0 A;  2XH9 A;  4DXB A;  4R4S A;  4PPR A;  1YLZ A;  2RL3 A;  3HLE A;  3P98 A;  4MLL A;  3OPR A;  2Y2M A;  4KZ5 A;  4OLD A;  1KE4 A;  5FI7 A;  4Y0O A;  1K54 C;  1MBL A;  5CGX A;  3VFF A;  2QPN A;  4E3I A;  3ZGA B;  3HUN A;  4GZB A;  3UE0 A;  3PBT A;  4PM5 A;  4KG2 A;  5F1G A;  1CEF A;  1NXY A;  2ZC5 B;  5DTT A;  5FSR A;  3ITA A;  2XK1 A;  4RX2 A;  3UO9 A;  1YQS A;  1BZA A;  1E3U D;  2XFT A;  3M2J A;  1MKI A;  1E25 A;  4N1H A;  1IEL A;  3M2K A;  2WUQ A;  4JXV A;  3WS1 A;  3VP2 A;  5GHZ A;  4KEN B;  3VP1 A;  2Y2O A;  3ZDJ A;  3IF6 B;  2ZJ9 A;  2PU2 A;  3OPP A;  4GD8 A;  3UPO A;  1JWP A;  4MBH A;  4X55 A;  3IXG A;  1LHY A;  1K56 D;  4FD8 A;  5CHJ A;  1E4D A;  1JVJ A;  4QB8 A;  1BUL A;  5E43 A;  4S2J A;  3MKF A;  4FH2 A;  3WRZ A;  1JTG A;  4OPZ A;  3NDG A;  3A3D A;  1ERO A;  1CEG A;  4RVA A;  2WAE A;  3WS2 A;  4DF6 A;  2BG1 A;  4S2L A;  2VGJ A;  5CER A;  1XPB A;  1K57 C;  1W8Y A;  1K38 A;  3WRT A;  1PWC A;  3ZHH A;  4WZ5 A;  1GHI A;  4BEN A;  2ZM0 A;  1ES2 A;  1KE3 A;  1FOF A;  3S1Y A;  1JWZ A;  2WKI A;  4GB7 A;  2XF3 A;  3I7J A;  4WBG A;  4E3K A;  1WYC A;  3CZD A;  1LI9 A;  1WYB A;  1KVM A;  3BLM A;  5E2F A;  2PBY A;  3ITB A;  4KZ4 A;  4EQI A;  1K6S A;  3LO7 A;  4P85 A;  2XEP A;  2WGV A;  4QY6 A;  1PWD A;  1DJB A;  2WK0 A;  2EXA A;  4WYY A;  3G2Y A;  5EVI A;  4WZ5 C;  5DF8 A;  4U3T A;  4BQM A;  4DE2 A;  1PI5 A;  4KG5 A;  3RXX A;  1XP4 A;  1ZC2 A;  1K57 A;  1ALQ A;  2OLU A;  1YT4 A;  2J9P A;  4N1X A;  2E8I A;  3G34 A;  4OP8 A;  5E2E A;  3ZG8 B;  3UE1 A;  3LY4 A;  4PM6 A;  4QY5 A;  1PYY A;  3MBZ A;  4E3J A;  2ZLY A;  5AQB A;  4EBP A;  2DNS A;  2XGN A;  1O7E A;  4QU3 A;  3IF5 A;  3HL9 A;  1KVL A;  3SOI A;  4OQH A;  1L0F A;  4R23 A;  3NIA A;  5F83 A;  4DKI A;  1GHP A;  4EV4 A;  1W79 A;  2Y4A A;  5HFO A;  3RJU A;  1SHV A;  4EBL A;  4E3N A;  2G2U A;  1GHM A;  5M19 A;  4K0W A;  4NET A;  5CEC A;  4FCF A;  3OPH A;  1ESI A;  2OV5 A;  5DF7 A;  5CRF A;  4ZAM A;  3HRE A;  4OLG A;  5FAP A;  1ERM A;  3AGD A;  3CG5 A;  1I2W A;  3BFG A;  3VMA A;  1VM1 A;  5EOE A;  3V50 A;  1ONH A;  4JKT A;  3UDI A;  4S2P A;  5FQM A;  4ZJ3 A;  3JYI A;  3A3I A;  2J7V A;  2QMI A;  2BLS A;  4X68 A;  1E3U A;  4LV1 A;  2IWC A;  3C4O A;  3PBN A;  3FWL A;  1G6A A;  3ISG A;  5DVA A;  2GDN A;  1JTD A;  1XA1 A;  5TFQ A;  3W4O A;  4R3B A;  5GHY A;  2IWB A;  1YMX A;  4UHU A;  3W8K A;  3ZCZ A;  3BEC A;  4UAA A;  5EVI B;  1Q2Q A;  1YLJ A;  2EX2 A;  2ZQ8 A;  5A93 A;  5AQ7 A;  1AXB A;  3V3S A;  3ZNY A;  5JYO A;  3HUO A;  5CGW A;  4EBN A;  2WAF A;  1YLW A;  4MNR A;  2H0Y A;  4Y0U A;  4Y0T A;  1ZKJ A;  4BL3 A;  2A3U A;  3O87 A;  1GA0 A;  2WZX A;  3P09 A;  3DW0 A;  3E2K A;  2ZC3 B;  1K4F A;  1ERQ A;  4EWF A;  3ZG9 B;  4GN2 A;  4E3L A;  4B88 A;  1H8Y A;  3HLC A;  3HLD A;  2Y2K A;  2IWD A;  5CGS A;  5A90 A;  3NDE A;  2JBF A;  3GRJ A;  3FYZ A;  2Q9M A;  1EI5 A;  2Z2L B;  1K6R A;  5FQK A;  4LV3 A;  1MWT A;  4PM9 A;  3IH9 A;  4KZ8 A;  4QHC A;  1NY0 A;  1ES5 A;  2HDS A;  4IBX A;  2Y2G A;  2WKE A;  1G68 A;  4IED A;  4U0X A;  1RGY A;  1MWS A;  1RCJ A;  2ZMA A;  2EX6 A;  3E2L A;  1TEM A;  2ZQ9 A;  1OME A;  5DF9 A;  1IYP A;  2R9W A;  3OC2 A;  4JPM A;  1K56 A;  1K55 C;  3G31 A;  4S2N C;  3MXS A;  4DE1 A;  2WGI A;  2HDR A;  3MXR A;  3IHB A;  5DTK A;  3SS5 A;  4EUZ A;  4DE0 A;  4OVD A;  4DRT A;  5CTN A;  3Q07 A;  1XX2 A;  5HW3 A;  3N7W A;  3BFC A;  2B5R A;  1N9B A;  3FV7 A;  4GDB A;  3GQZ A;  4N9L A;  3EQU A;  3UDX A;  4KG6 A;  1H8Z A;  3WS5 A;  4K91 A;  2ZC7 A;  1W8Q A;  2ZQA A;  3DWZ A;  3UPN A;  5JYP A;  4XUX A;  2HP6 A;  3C5A A;  1BLP A;  1Y54 A;  5GLB A;  5BOH A;  4YIN A;  3MKE A;  4OH0 A;  4JXG A;  4XUZ A;  4Q8I A;  1K55 A;  4S2N A;  3OPL A;  5HAR A;  2ZC4 B;  1XKZ A;  4OKP A;  4UA7 A;  4C6Y A;  4NK3 A;  5EE8 A;  5EVL A;  2JC7 A;  4C75 A;  1PW8 A;  5M1A A;  3Q1F A;  4L0L A;  5FAS A;  3A3J A;  4DE3 A;  3O88 A;  5A91 A;  1I2S A;  3IT9 A;  2ZQ7 A;  2XR0 A;  3IXD A;  1FCO A;  3C7U A;  4X53 A;  1L0G A;  4HBU A;  4ZJ1 A;  1SKF A;  1MWR A;  4O7D A;  5FQJ A;  2Y2I A;  1YMS A;  4B4X A;  1TDL A;  3M6H A;  1IYS A;  1EWZ A;  4PMA A;  4ZBE A;  2FFF B;  4OPY A;  2XLN A;  3G4P A;  1XGJ A;  4E3M A;  4IVK A;  4ZDX A;  1FR1 A;  1FCN A;  1YLY A;  2H10 A;  3SH9 A;  2Y91 A;  4HEF A;  4JF4 A;  5KSH A;  2PU4 A;  4X6T A;  3TSG A;  3FZC A;  3UY6 A;  1LLB A;  3QHY A;  4KZ3 A;  3N8S A;  4KZ9 A;  3BLS A;  4P0M A;  3SS3 A;  2CC1 A;  3OCL A;  5CTM A;  4A5R A;  3ZVW A;  1M6K A;  2EX9 A;  3TOI A;  1XA7 A;  5FI2 A;  5EPH A;  3V39 A;  4WEL A;  4RX3 A;  5EOO A;  3FKV A;  3G2Z A;  4WZ4 A;  3DTM A;  3QNB A;  4P87 A;  3VP4 A;  4R1G A;  3HLW A;  2Y2L A; 
#chains in the Genus database with same CATH topology
 2W0N A;  2Q9N A;  3NBL A;  4IVI A;  1BLS A;  4RA7 A;  4LLO B;  1F2K A;  4GNU A;  3T4T A;  5IHV A;  3MFD A;  5M18 A;  1NYM A;  4Z1W A;  3WWX A;  1PZP A;  1JWV A;  2V8F A;  1S0W A;  3UDF A;  3Q81 A;  2VKS A;  5FA7 A;  3HUM A;  5AQ9 A;  4KQO A;  2VJW A;  1RP5 A;  4N92 A;  1M40 A;  3K2N A;  3RFB A;  3GV9 A;  3BM6 A;  3ULF A;  4KZB A;  3ZVT A;  3UE3 A;  2X71 A;  3B33 A;  4PAU A;  1ES3 A;  3QNC A;  3P01 A;  3LEZ A;  3E4Q A;  4EEU A;  1NRF A;  2OLV A;  5F82 A;  2P9V A;  2M7U A;  5HAQ A;  1ZTU A;  2Z2M B;  4Z9Q A;  3MZD A;  3VFH A;  1TVF A;  1Z6F A;  4JLF A;  1GA9 A;  5G18 A;  1I5Q A;  1VQQ A;  4ID4 A;  4PM7 A;  1OTE A;  1PFL A;  3G6O A;  1LSV A;  3IHA A;  2ZM2 A;  4LV0 A;  4P6Z M;  4CJN A;  5U47 A;  3N4I A;  3NC8 A;  3AGE A;  4LCM A;  2K7S A;  2PRF A;  3UN7 A;  3TRC A;  5EVE A;  1FSW A;  4NXB A;  4BLM A;  1W63 M;  5FQI A;  5L2F A;  3UB5 P;  4Q0I A;  4IBR A;  3IH8 A;  4DMZ A;  1G6O A;  2J3W A;  4JGR A;  2WAD A;  4XXR A;  4HJ3 A;  2HDU A;  2V1Z A;  2VGK A;  1Z09 A;  5HDS A;  5TR7 A;  3OZH A;  4GKU A;  2HJE A;  2AVX A;  3CAX A;  1BUE A;  5AVF A;  2WYX A;  4LEN A;  1QMF A;  3LIA A;  3MZE A;  1UGU A;  5EM0 A;  2DCF A;  1PI4 A;  2QWS A;  1HTZ A;  4II7 A;  2ZQC A;  1LI0 A;  3L7H A;  4B9O A;  1T1B A;  1K54 A;  4N9K A;  4GHI A;  5EUA A;  3MJQ A;  1BLH A;  4S2I A;  3CI6 A;  5CHU A;  1F9I A;  4OP5 A;  2FFY A;  2MJ6 A;  4R3J A;  5C5K A;  3HVF A;  3H7W A;  3CIT A;  4UEY A;  5MC7 A;  4MBF A;  2PYR A;  3MZF A;  2XH9 A;  4R4S A;  3OPR A;  4OLD A;  4D60 A;  4HJ4 A;  1KE4 A;  4Y0O A;  1K54 C;  5CGX A;  3VFF A;  4E3I A;  2QPN A;  2W1R A;  3T4S A;  4GZB A;  5L07 A;  5DTT A;  1TS8 A;  2XK1 A;  2I9V A;  5DJT A;  3M2J A;  3S7P A;  1IEL A;  2OOL A;  3WS1 A;  4JXV A;  3LUQ A;  1YAX A;  3C30 A;  5GHZ A;  2JKT I;  1D7E A;  3VP1 A;  1SKO B;  3T1S A;  2Y2O A;  2ZJ9 A;  3O5Y A;  1JWP A;  3LI8 A;  4Y2F A;  3K3C A;  4FD8 A;  1DP9 A;  1MC0 A;  2L1M A;  3JPU A;  4S2J A;  4FH2 A;  3NDG A;  3LIC A;  4QPR A;  3A3D A;  1ERO A;  4XT2 B;  2W27 A;  4LRY C;  1XPB A;  3ZHH A;  2ZM0 A;  3IBR A;  1CJF A;  1WYB A;  3SZT A;  1KVM A;  2CMN A;  3E4O A;  3LO7 A;  2WGV A;  2VLG A;  4WZ5 C;  5DF8 A;  3K3D A;  1ZC2 A;  2V0U A;  4OP8 A;  5E2E A;  3UE1 A;  1PYY A;  3MBZ A;  4EBP A;  4NXE A;  1O7E A;  5F83 A;  2HZ5 A;  2VEA A;  1Y28 A;  4DKI A;  5HFO A;  4EBL A;  3KSH A;  5DJU A;  4ZAM A;  3HRE A;  4OLG A;  5FAP A;  1V9Z A;  5HDC A;  3DBA A;  5AJG A;  3VMA A;  1VM1 A;  1ONH A;  3UDI A;  5AVE A;  3JYI A;  1OJ5 A;  3MSH A;  4G3W A;  2J7V A;  2BLS A;  2VV6 A;  2VV7 A;  2P04 A;  4Q0J A;  2XA7 M;  1W63 Q;  4AFI A;  3CHW P;  4GCZ A;  1S1Y A;  3FC7 A;  1VEU B;  3ZCZ A;  3CUE A;  3UB8 A;  1Q2Q A;  5AQ7 A;  2HJ9 C;  3ZNY A;  1Y4O A;  1YKD A;  5JYO A;  5CGW A;  4JGP A;  2H0Y A;  3O87 A;  1H3Q A;  3KYQ A;  2B95 A;  3HLD A;  1K0K A;  2IWD A;  5EM1 A;  5A90 A;  3NDE A;  1K6R A;  5FQK A;  4PM9 A;  5HD5 A;  1NY0 A;  1ES5 A;  4IBX A;  3E0Y A;  4HJ6 A;  4Y13 A;  4U0X A;  2ZMA A;  2PYP A;  3LR3 A;  3S7N A;  1IYP A;  2R9W A;  3OC2 A;  3G31 A;  4I39 A;  1OPX A;  2HDR A;  3IHB A;  3Q07 A;  3C8C A;  1S66 L;  2B5R A;  3FG8 A;  4LGW A;  4KG6 A;  1H8Z A;  4BWI A;  1NLY A;  2BAS A;  4XUX A;  2HP6 A;  5HD3 A;  1P9W A;  4R3A A;  3MKE A;  4OH0 A;  1K55 A;  4S2N A;  1P97 A;  4UA7 A;  1MKM A;  3T50 A;  3VOL A;  4UQI M;  3T4L A;  2A24 B;  4LRX C;  1SKO A;  4NXG A;  4O7D A;  4NEE D;  2DMW A;  3L9K A;  1JNU A;  2FFF B;  4KUK A;  3G4P A;  3VE4 A;  4P6Z S;  4IVK A;  1FR1 A;  1YLY A;  2H10 A;  3IS2 A;  4P0M A;  3QHY A;  3KSF A;  1S67 L;  3ZVW A;  3KYZ A;  2O9B A;  3MMH A;  1STZ A;  2W1T B;  3CPT A;  2ZOI A;  3UME A;  2E8J A;  1L2S A;  4ZJ2 A;  4UA9 A;  4GDN A;  5FDS A;  5EFW A;  2GX5 A;  3BJN A;  2HP5 A;  1MWU A;  2FH5 A;  1A0K A;  1F98 A;  1W7F A;  2P74 A;  3HBR A;  1KGG A;  1W5D A;  4E04 A;  1ONG A;  5A92 A;  4JBF A;  4JXS A;  4MN6 A;  1L3L A;  1U60 A;  1YSP A;  1LT0 A;  3UPP A;  4YFM A;  2VK3 A;  3A0S A;  3IWI A;  1WE4 A;  5EVI D;  1K25 A;  2M1C A;  3CLO A;  1L0E A;  1T19 A;  3IQA A;  2XRO A;  3D72 A;  1KGE A;  4QD4 A;  3VP3 A;  4EW7 A;  4DDY A;  2BTF P;  3N8L A;  5CXW A;  2KLI A;  2ZM8 A;  3VSL A;  1GCE A;  2XSS A;  5FAQ A;  4X56 A;  2OSU A;  3PBO A;  1G5U A;  2Y2N A;  3CWF A;  3QP6 A;  5HL1 A;  1P0Z A;  2Z6C A;  3R7W A;  4E6W A;  4JXW A;  3IWO A;  3SH7 A;  1V9Y A;  3LCE A;  4KZ6 A;  4UA6 A;  5GHX A;  1IKG A;  4C3Q A;  3IX8 A;  1Q2P A;  3V5M A;  5FDH A;  3W4Q A;  1ESU A;  3ZG0 A;  5IT5 A;  5HX9 A;  3BEB A;  2VGL M;  2P9V B;  4S2K A;  4S2M A;  3LR5 A;  1ODV A;  3LID A;  1IOU A;  3A3E A;  1XJ2 A;  3GVB A;  5CEB A;  5GLC A;  1FR6 A;  3C38 A;  3DWK A;  4LCL A;  3EEA A;  1SCW A;  2ZQD A;  4UQI S;  2XD5 A;  3Q7V A;  2DRW A;  5FAO A;  4X1L A;  4BJP A;  3EQV A;  1UWN X;  4MBK A;  4ARZ B;  1CK3 A;  3T4K A;  4F94 A;  4OQ0 A;  2V9A A;  2EFU A;  3V67 A;  4EEP A;  3NY4 A;  3T1Q B;  3DTE A;  3WS0 A;  2V1A A;  2I72 A;  1NJ4 A;  1YLP A;  4D2O A;  2HF6 A;  1IEM A;  1OTA A;  5FAT A;  3CMZ A;  5GLD A;  4I38 A;  2JE5 A;  3LIE A;  3HLB A;  4S2O A;  5KSC A;  2EX8 A;  2ZC6 B;  2HP9 A;  3PAG A;  4Q0H A;  4HI4 A;  4OOM A;  5J4E A;  1BSG A;  4WM9 A;  2V2F F;  5E2G A;  5FQQ A;  2G2W A;  2W3D A;  3F1P B;  1PRQ A;  4R38 A;  4I5S A;  2XD1 A;  3GSG A;  4EER A;  3VOY A;  2L0W A;  4B4Z A;  2IA2 A;  3VP0 A;  3LIF A;  4DXB A;  4PPR A;  2RL3 A;  3HLE A;  5FI7 A;  3ZGA B;  3HUN A;  3NOT C;  2KDK A;  1CEF A;  2ZC5 B;  5FSR A;  3ITA A;  3OOV A;  4RX2 A;  3UO9 A;  1YQS A;  1OJG A;  1BZA A;  1E3U D;  2XFT A;  3IX4 A;  5TBM B;  2XA7 S;  3VP2 A;  4KEN B;  3UMD A;  3OPP A;  1T1C A;  5CHJ A;  4QB8 A;  5E43 A;  3MKF A;  2P7J A;  5FEF A;  2W3F A;  4G3V A;  2W3H A;  2WAE A;  4DF6 A;  2VGJ A;  5CER A;  4QWO A;  1W8Y A;  1K38 A;  3T12 B;  3UB7 A;  2WKI A;  5HWW A;  4GB7 A;  2XF3 A;  4WBG A;  4E3K A;  4EET B;  2PBY A;  3VV4 A;  4KZ4 A;  4EQI A;  4IHQ A;  1K6S A;  4QY6 A;  4YWZ A;  3GEC A;  1ACF A;  3NEC A;  3NOP C;  4BQM A;  1PI5 A;  1XFN A;  3LI9 A;  3LY4 A;  4QY5 A;  3IX3 A;  4E3J A;  5AQB A;  2DNS A;  4QU3 A;  3IF5 A;  2W1T A;  1KVL A;  3MQQ A;  2G2U A;  1OTB A;  1GHM A;  4K0W A;  4NET A;  4F3L B;  4FCF A;  1ESI A;  5DF7 A;  5CRF A;  1TD5 A;  3BQ8 A;  1SZV A;  2JHE A;  5FQM A;  4ZJ3 A;  3A3I A;  2QMI A;  2ZMV A;  4X68 A;  5HPI A;  1E3U A;  3DTK A;  4LV1 A;  2JKG A;  5HPF A;  3C4O A;  3ISG A;  1JTD A;  3A0R A;  3W4O A;  5GHY A;  2IWB A;  1YMX A;  3HJK A;  2D01 A;  1AXB A;  3T4O A;  3BWL A;  5L10 A;  4MNR A;  4Y0U A;  2WKP A;  4BL3 A;  2A3U A;  3QP1 A;  3MR0 A;  3BW6 A;  2VV8 A;  3ZG9 B;  4GN2 A;  1H8Y A;  1FIK A;  5CGS A;  4FOF A;  2PD8 A;  3FYZ A;  1EI5 A;  2Z2L B;  3QP4 A;  4CQH A;  2R78 A;  1MWT A;  4LPZ A;  3P7N A;  4KZ8 A;  2HDS A;  2H28 A;  1G68 A;  1MWS A;  2EX6 A;  3E2L A;  1OME A;  1TS0 A;  5DF9 A;  4JPM A;  5HWV A;  3EOI A;  3S7O A;  3SS5 A;  2QYB A;  4BBU A;  4DRT A;  4BBT A;  1N9B A;  3FV7 A;  2Y79 A;  3UDX A;  4O8G A;  4K91 A;  2ZC7 A;  4HP9 A;  5JYP A;  1Y54 A;  4JXG A;  4Q8I A;  3NHQ A;  3OPL A;  5M1A A;  1VEU A;  4L0L A;  5FAS A;  3A3J A;  3O88 A;  3U2A A;  2ZQ7 A;  4ESP A;  3C7U A;  4X53 A;  1L0G A;  4B4X A;  1TDL A;  3M6H A;  1IYS A;  4CLC B;  1TF1 A;  1XGJ A;  2OAQ 1;  3UE6 A;  2PU4 A;  4X6T A;  3EEH A;  3EWK A;  3FZC A;  3UY6 A;  4IUH A;  4KZ9 A;  3UB9 A;  4X25 A;  3F1N A;  4DN0 A;  2HGV A;  5CTM A;  4A5R A;  1OT6 A;  1KOU A;  3TOI A;  1XA7 A;  3H9W A;  4WZ4 A;  1OTD A;  2EA9 A;  3DTM A;  3OLO A;  4R1G A;  4Y3I A;  1HD8 A;  3CPT B;  3T4J A;  1IYO A;  1XXM A;  5CED A;  4GS9 B;  3HLF A;  5KZH A;  3N8R A;  5LBR A;  1MPL A;  4OPQ A;  3IF6 C;  1FCM A;  4B93 A;  1ES4 A;  3A3F A;  4P6B A;  5HAP A;  2NUP C;  3S22 A;  3Q82 A;  1F5M A;  2VZW A;  5F69 A;  1KGF A;  2RCX A;  4RYE A;  3F1N B;  4NXF A;  4L9F A;  4WUJ A;  2O0Y A;  4OOL A;  3BFF A;  3PAE A;  4GOG A;  3G35 A;  1LL9 A;  1HVB A;  5I94 A;  4GD6 A;  3QP8 A;  4FSF A;  4JGO A;  2J3T D;  3G32 A;  1NYY A;  2KOI A;  1PW1 A;  5EEC A;  4F3L A;  2EXB A;  3H82 B;  1O07 A;  3FKW A;  4GLQ A;  4HES A;  2VA0 A;  5AQA A;  2C6W B;  1BTL A;  3VE3 A;  2JKR M;  4OPR A;  4X1M A;  4KQR A;  1FSY A;  4OOY A;  1QME A;  3CJM A;  4WMC A;  4I3A A;  4LFU A;  2WKR A;  3QP2 A;  1KDW A;  4R6L A;  5J3W A;  1H8M A;  5J8X A;  4K08 A;  3C4P A;  2ZL1 B;  3GR2 A;  3PTE A;  5HSQ A;  4HNB A;  4Y5F A;  3IXB A;  4OQG A;  3LIB A;  1VHM A;  3D3O A;  5E2H A;  2UWX A;  4HBT A;  1BLC A;  1SDE A;  1YM1 A;  3LR0 A;  3G30 A;  3RXW A;  1TS6 A;  3Q7V B;  1IYQ A;  1BT5 A;  2EFX A;  2O9A A;  3PBR A;  2Y2J A;  4BD0 A;  4CLC E;  2HDQ A;  5TGF A;  5F5Y A;  2Y2H A;  3R4K A;  1DJC A;  3VOZ A;  4R0Q A;  3RTY A;  2V8C A;  5HAI A;  5FI6 A;  2HV1 A;  1FIL A;  4Y17 A;  3MFX A;  3NI9 A;  4MN5 A;  1J9M A;  1XGI A;  2O9C A;  3MF0 A;  3JVV A;  4HHD A;  2W3G A;  1CI8 A;  4KQD A;  2C5W B;  2V0W A;  1IKI A;  1HZO A;  2M7V A;  4M3K A;  2JN7 A;  3HJI A;  5TBM A;  2Y55 A;  2Y59 A;  5EV0 A;  3PBS A;  2V20 A;  4ZRR A;  3DAV A;  4R4R A;  3ZNT A;  1XJ3 A;  5D3O A;  3PHY A;  4WMC D;  4MDZ A;  3BFE A;  2PR6 A;  1DJA A;  2H0T A;  4FH4 A;  4E3O A;  2ZBB A;  1ZG4 A;  3BRM A;  2WKH A;  4FTX A;  4NG2 A;  1CI9 A;  3R7W B;  1RGZ A;  3S4X A;  2LB9 A;  3NCK A;  1MY8 A;  4U0T A;  1YLZ A;  2VX8 A;  1MBL A;  3BQA A;  1YPR A;  4PM5 A;  5F1G A;  1NXY A;  2QHK A;  1E25 A;  2JKF A;  3M2K A;  4NKP A;  4HP4 A;  3ZDJ A;  3IF6 B;  2K2N A;  3GDI A;  4GD8 A;  3UPO A;  4I3J A;  3FPV A;  4MBH A;  3LEQ A;  4X55 A;  3IXG A;  1K56 D;  1E4D A;  1JVJ A;  3WRZ A;  1JTG A;  1NLZ A;  3LFV A;  4G3K A;  1CEG A;  1GSW A;  2Y8H A;  1DP8 A;  4S2L A;  1K57 C;  5IU1 A;  3WRT A;  4BEN A;  1KE3 A;  3S1Y A;  4WLA A;  3KSI A;  4WL9 A;  3I7J A;  1WYC A;  3CZD A;  3BLM A;  3B47 A;  3LYX A;  1VET A;  4WF0 A;  4EUV A;  1PWD A;  1DJB A;  2WK0 A;  2EXA A;  4WYY A;  2YKF A;  2A24 A;  4U3T A;  1VB6 A;  4DE2 A;  4KG5 A;  4KUO A;  3RXX A;  1XP4 A;  1CQA A;  1K57 A;  2OLU A;  1YT4 A;  2J9P A;  4N1X A;  2E8I A;  2GJ3 A;  3SOI A;  4ME4 A;  4OQH A;  2G7U A;  1GHP A;  4EV4 A;  1W79 A;  2Y4A A;  2QJ7 A;  4E3N A;  2B18 A;  5M19 A;  5CEC A;  3OPH A;  2OV5 A;  4ETZ A;  5EOE A;  4JKT A;  1S4R A;  5HWT A;  2PHY A;  4EQ1 A;  3FPW A;  3PR6 A;  5DVA A;  2QJ5 A;  1XA1 A;  5TFQ A;  4R3B A;  4UAA A;  1OT9 A;  2FZ0 A;  3EGD C;  2EX2 A;  5FEG A;  2ZQ8 A;  5A93 A;  5TJJ A;  4HIA A;  4MCW A;  4I3I A;  4EBN A;  4Y0T A;  1ZKJ A;  1GA0 A;  1P9R A;  1N9L A;  3P09 A;  2ZC3 B;  3S7Q A;  4EWF A;  4E3L A;  1IFQ A;  4B88 A;  2Y2K A;  4MN7 A;  4EU0 A;  2Q0O A;  2Q9M A;  3E4P A;  3T1X A;  2WKQ A;  4QHC A;  2Y2G A;  2WKE A;  2ZL1 A;  1RGY A;  1RCJ A;  4LRZ E;  4ETX A;  3MXS A;  4DE1 A;  2WGI A;  3MXR A;  4EXO A;  4EUZ A;  5CTN A;  1XX2 A;  2J3T C;  3N7W A;  3TW8 A;  1X0O A;  4N9L A;  4YNR A;  2ZQA A;  1W8Q A;  3DWZ A;  3C5A A;  1BLP A;  3LR4 A;  5GLB A;  5BOH A;  4XUZ A;  2LB5 A;  5A8B A;  5HAR A;  2PR5 A;  2ZC4 B;  4C6Y A;  4NK3 A;  5EE8 A;  5EVL A;  2JC7 A;  3U4L P;  3Q1F A;  2ACG A;  3EGX C;  5A91 A;  3IT9 A;  3TJZ C;  4HBU A;  1MWR A;  5FQJ A;  2Y2I A;  4HY8 A;  4PMA A;  1EWZ A;  4CLC D;  4OPY A;  2XLN A;  4E3M A;  1FCN A;  5DKK A;  3SH9 A;  1LL8 A;  2Y91 A;  4JF4 A;  5KSH A;  3TSG A;  3SS3 A;  4KZ3 A;  1LLB A;  3IBJ A;  3N8S A;  5HDD A;  2CC1 A;  3F1O A;  3UB6 A;  1NWZ A;  1M6K A;  2EX9 A;  4MMN A;  5FI2 A;  5EPH A;  3V39 A;  4WEL A;  4RX3 A;  3FKV A;  3G2Z A;  2EWV A;  5K5B A;  4JGQ A;  3VP4 A;  4P87 A;  3HLW A;  2Y2L A;  5G4Y A;  1N4O A;  4GJ4 A;  3GTC A;  4Y7P A;  2P08 A;  3O86 A;  1YLT A;  1S4S A;  1PWG A;  2ZD8 A;  2YKH A;  5G4Z A;  5L8M A;  4JF6 A;  3ZQ5 A;  4ZTK A;  5FL3 A;  3W4P A;  3Q7Z A;  3KO6 A;  3OCN A;  3ZG5 A;  4X69 A;  2QZ6 A;  3IS2 B;  4E6X A;  2WGW B;  3ZG7 B;  1DP6 A;  4IUK A;  5CHM A;  4YOF A;  3IF6 A;  3NJA A;  4OQI A;  3UNW A;  2J9O A;  4KZ7 A;  4K0X A;  2JCH A;  3N6I A;  2O99 A;  1C3B A;  1CF0 A;  3KYE A;  3DTI A;  2HPB A;  3MQO A;  4IJG A;  2NUT C;  4WN5 A;  3SS4 A;  1S6R A;  4QJG A;  1XJ4 A;  3AGF A;  2X02 A;  2A2L A;  3O3V A;  3LY3 A;  5CX7 A;  2WZZ A;  1HLU P;  4HQA A;  4MEZ A;  5DTS A;  4M4X A;  3H7W B;  5DKL A;  4DXC A;  4KZA A;  1KDS A;  5GLA A;  1MXO A;  1KE0 A;  3PBQ A;  1FQG A;  1ZG6 A;  1J3W A;  4HOI A;  1N9O A;  4O01 A;  2Y2P A;  4WEK A;  4DDS A;  1LSW A;  3TG9 A;  5KMW A;  1PZO A;  4CPK A;  4JF5 A;  3PYP A;  3BYD A;  3IWQ A;  4BD1 A;  2H5S A;  2WGW A;  2UV0 E;  5F1F A;  1EW0 A;  3SW1 A;  3D4F A;  3M6B A;  5GL9 A;  3SH8 A;  1ZHH B;  1H5X A;  2J8Y A;  3BY8 A;  1K4E A;  4GS9 A;  3B3X A;  3C7V A;  3IXH A;  1TDG A;  2XFS A;  2PT7 A;  2R9X A;  1LL5 A;  4BL2 A;  2JKT M;  3HLG A;  4OON A;  1LSX A;  4LV2 A;  2A49 A;  5HL6 A;  2ZMF A;  3NOU C;  3V3R A;  2Z6D A;  3LGO A;  2XDM A;  1PIO A;  3BFD A;  2K31 A;  4O0P A;  4WEJ A;  2XQZ A;  3VSK A;  3WS4 A;  5EVI C;  1SDN A;  1DY6 A;  3KX0 X;  5FQ9 A;  3ZFZ A;  1NZU A;  4CLC A;  3H82 A;  3F1O B;  5L09 A;  1L0D A;  2Y2Q A;  4PM8 A;  4KQQ A;  2X01 A;  3GMW A;  4RQ9 A;  1NZO A;  4H8R A;  3RH8 B;  2PBD P;  2B02 A;  1T18 A;  3P98 A;  4MLL A;  2Y2M A;  4KZ5 A;  1NRJ A;  3ZYT A;  3E98 A;  3UE0 A;  4XT2 A;  5F68 A;  3PBT A;  4KG2 A;  5I5L A;  4PHT A;  1MKI A;  1VET B;  3OBF A;  4N1H A;  2WUQ A;  3QP5 A;  3T4Q A;  3MQ0 A;  2PU2 A;  5J7E A;  1LHY A;  2EWW A;  1BUL A;  2L4R A;  3T1R A;  4OPZ A;  1N9N A;  2W3E A;  2D02 A;  4RVA A;  3WS2 A;  2BG1 A;  5DFY A;  4L9G A;  1PWC A;  1OTI A;  4WZ5 A;  1GHI A;  3W2Z A;  2KX6 A;  3B42 A;  4EES A;  1ES2 A;  1FOF A;  4HH2 A;  1JWZ A;  1UWP X;  3D9Y A;  4FUW A;  1LI9 A;  5E2F A;  3ITB A;  4BBV A;  4P85 A;  2OWH A;  2XEP A;  2PDR A;  5EVI A;  3G2Y A;  3F1P A;  1T1A A;  1ALQ A;  4BMW A;  3G34 A;  3ZG8 B;  1YSQ A;  4PM6 A;  1H0M A;  2OWJ A;  1G28 A;  2ZLY A;  2XGN A;  2ZOH A;  3HL9 A;  1PNE A;  1L0F A;  4R23 A;  3NIA A;  3RJU A;  1SHV A;  4Y15 A;  1ERM A;  3AGD A;  3CG5 A;  1I2W A;  3BFG A;  4GHI B;  2QKP A;  2PAV P;  4PKY A;  3V50 A;  4S2P A;  4CLC C;  3NUL A;  1D06 A;  2JKR I;  3ICY A;  2IWC A;  3PBN A;  3FWL A;  1G6A A;  3C2W A;  2GDN A;  3PXP A;  2INW A;  4UHU A;  3W8K A;  1GSX A;  3BEC A;  5EVI B;  1XJ6 A;  1YLJ A;  3V3S A;  5KIZ A;  3HUO A;  5F6A A;  2WAF A;  1YLW A;  4HH3 A;  4PKY G;  2WZX A;  3DW0 A;  3E2K A;  1K4F A;  1ERQ A;  1MZU A;  3JVU A;  4H6J B;  1WA9 A;  3MS6 A;  3HLC A;  1DRM A;  4R70 A;  2JBF A;  3GRJ A;  4GW9 A;  1AWI A;  4LV3 A;  3BY9 A;  3IH9 A;  3CUE C;  4IED A;  4H6J A;  4DJ2 A;  5IS1 A;  1TEM A;  2ZQ9 A;  3MXQ A;  2VGL S;  1BYW A;  1K56 A;  1K55 C;  4S2N C;  1XFQ A;  5DTK A;  2PD7 A;  4DE0 A;  4OVD A;  1GSV A;  5HW3 A;  3BFC A;  3HCY A;  4GDB A;  3GQZ A;  3EQU A;  3WS5 A;  3UPN A;  4YIN A;  1S1Z A;  2J80 A;  2XRN A;  3KSG A;  4ARZ A;  1TS7 A;  1XKZ A;  4OKP A;  5DFX A;  4C75 A;  1PW8 A;  2OAP 1;  4DE3 A;  1I2S A;  2XR0 A;  3IXD A;  1FCO A;  4ZJ1 A;  1SKF A;  1YMS A;  4ZBE A;  3TE8 A;  4ZDX A;  3A0V A;  4L9E A;  4HEF A;  2GNX A;  3BLS A;  3OCL A;  2GZA A;  2V1B A;  5HZH A;  1D1J A;  4DJ3 A;  5EOO A;  3QNB A; 
#chains in the Genus database with same CATH homology
 1N4O A;  1HD8 A;  2Q9N A;  1L2S A;  3GTC A;  3NBL A;  4Y7P A;  4ZJ2 A;  4IVI A;  4UA9 A;  4GDN A;  1IYO A;  1BLS A;  1XXM A;  4RA7 A;  5CED A;  3O86 A;  1YLT A;  1PWG A;  2ZD8 A;  3HLF A;  5KZH A;  3N8R A;  4GNU A;  5IHV A;  1MPL A;  3MFD A;  5M18 A;  1NYM A;  2HP5 A;  1MWU A;  4OPQ A;  4JF6 A;  3IF6 C;  1FCM A;  4ZTK A;  1ES4 A;  1W7F A;  2P74 A;  3A3F A;  3HBR A;  4P6B A;  1KGG A;  3W4P A;  3WWX A;  1PZP A;  1W5D A;  3Q7Z A;  5HAP A;  3S22 A;  3Q82 A;  3OCN A;  1JWV A;  3ZG5 A;  1S0W A;  1ONG A;  3UDF A;  1KGF A;  4X69 A;  2RCX A;  4RYE A;  5A92 A;  4JBF A;  4JXS A;  2QZ6 A;  4OOL A;  3Q81 A;  3BFF A;  1U60 A;  3PAE A;  4GOG A;  2WGW B;  4E6X A;  5FA7 A;  3G35 A;  3HUM A;  3ZG7 B;  1LL9 A;  1HVB A;  3UPP A;  5I94 A;  5CHM A;  4GD6 A;  5AQ9 A;  4KQO A;  4FSF A;  4YFM A;  3IF6 A;  1RP5 A;  3IWI A;  4N92 A;  1M40 A;  3G32 A;  4OQI A;  3GV9 A;  1NYY A;  1WE4 A;  3UNW A;  3BM6 A;  5EVI D;  2J9O A;  4KZB A;  1K25 A;  1PW1 A;  3UE3 A;  3ZVT A;  5EEC A;  4KZ7 A;  4K0X A;  1L0E A;  3IQA A;  2EXB A;  2JCH A;  1KGE A;  2X71 A;  4QD4 A;  3VP3 A;  1O07 A;  1ES3 A;  3FKW A;  3N6I A;  3QNC A;  4DDY A;  4HES A;  1C3B A;  3N8L A;  5CXW A;  2ZM8 A;  2HPB A;  3LEZ A;  3VSL A;  1GCE A;  5AQA A;  3SS4 A;  1S6R A;  4QJG A;  2C6W B;  1BTL A;  3AGF A;  1NRF A;  2OLV A;  2X02 A;  5FAQ A;  5F82 A;  4X56 A;  2OSU A;  3PBO A;  4OPR A;  3O3V A;  2P9V A;  2Y2N A;  5HL1 A;  5HAQ A;  4KQR A;  1FSY A;  4OOY A;  1QME A;  3CJM A;  2Z2M B;  3LY3 A;  2WZZ A;  4WMC A;  4Z9Q A;  3MZD A;  3VFH A;  1TVF A;  1KDW A;  1Z6F A;  4JLF A;  4MEZ A;  1GA9 A;  5DTS A;  4JXW A;  4E6W A;  3IWO A;  5G18 A;  3SH7 A;  1I5Q A;  1VQQ A;  4ID4 A;  5J8X A;  3LCE A;  4PM7 A;  4KZ6 A;  4UA6 A;  5GHX A;  1IKG A;  4C3Q A;  4DXC A;  3C4P A;  4KZA A;  1KDS A;  5GLA A;  3GR2 A;  1MXO A;  3PTE A;  1Q2P A;  1KE0 A;  3PBQ A;  3IHA A;  1FQG A;  1ZG6 A;  2ZM2 A;  3IXB A;  4OQG A;  4LV0 A;  4CJN A;  5U47 A;  3N4I A;  3V5M A;  5FDH A;  5E2H A;  3W4Q A;  2UWX A;  4HBT A;  1BLC A;  1ESU A;  1SDE A;  1YM1 A;  3ZG0 A;  2Y2P A;  3G30 A;  3RXW A;  3NC8 A;  3AGE A;  4LCM A;  3Q7V B;  4WEK A;  4DDS A;  5HX9 A;  3BEB A;  2P9V B;  4S2K A;  4S2M A;  3UN7 A;  1IYQ A;  1BT5 A;  2EFX A;  3PBR A;  3TG9 A;  2Y2J A;  4BD0 A;  5KMW A;  1PZO A;  4CPK A;  4JF5 A;  2HDQ A;  3A3E A;  3GVB A;  4XXR A;  5TGF A;  5CEB A;  5GLC A;  2Y2H A;  1FR6 A;  3BYD A;  1FSW A;  1DJC A;  4BLM A;  3DWK A;  3VOZ A;  4R0Q A;  4LCL A;  1SCW A;  5HAI A;  5FI6 A;  3IWQ A;  5FQI A;  2ZQD A;  2H5S A;  4BD1 A;  5L2F A;  2WGW A;  5F1F A;  3NI9 A;  4IBR A;  3IH8 A;  2XD5 A;  3Q7V A;  2DRW A;  5FAO A;  3D4F A;  1J9M A;  3M6B A;  1XGI A;  5GL9 A;  3SH8 A;  4BJP A;  3EQV A;  1H5X A;  2J8Y A;  1K4E A;  2WAD A;  3B3X A;  1CI8 A;  3C7V A;  2C5W B;  3IXH A;  1TDG A;  2XFS A;  4MBK A;  1IKI A;  2R9X A;  2HDU A;  1HZO A;  1LL5 A;  2VGK A;  2V1Z A;  4M3K A;  1CK3 A;  4BL2 A;  3HLG A;  4F94 A;  4OON A;  4OQ0 A;  5TR7 A;  3OZH A;  4LV2 A;  4GKU A;  2EFU A;  2Y55 A;  1BUE A;  3NY4 A;  2Y59 A;  2WYX A;  2A49 A;  4LEN A;  1QMF A;  3PBS A;  2V20 A;  3WS0 A;  3MZE A;  3V3R A;  4R4R A;  2DCF A;  2I72 A;  1PI4 A;  3ZNT A;  5D3O A;  4WMC D;  2XDM A;  1HTZ A;  1NJ4 A;  1PIO A;  1YLP A;  4D2O A;  2ZQC A;  3BFD A;  1LI0 A;  1IEM A;  5FAT A;  3BFE A;  3CMZ A;  4WEJ A;  5GLD A;  1K54 A;  2XQZ A;  3VSK A;  2JE5 A;  5EVI C;  3WS4 A;  3HLB A;  4N9K A;  5EUA A;  1SDN A;  1DJA A;  1DY6 A;  2H0T A;  1BLH A;  4S2O A;  4S2I A;  5FQ9 A;  5KSC A;  2EX8 A;  4FH4 A;  3ZFZ A;  4E3O A;  2ZC6 B;  2HP9 A;  3PAG A;  1NZU A;  4OOM A;  5CHU A;  4OP5 A;  1BSG A;  4WM9 A;  2FFY A;  1ZG4 A;  1L0D A;  4R3J A;  2V2F F;  3HVF A;  5E2G A;  5FQQ A;  2G2W A;  3BRM A;  2Y2Q A;  4PM8 A;  4KQQ A;  2WKH A;  2X01 A;  3GMW A;  4MBF A;  1CI9 A;  1NZO A;  1RGZ A;  2XD1 A;  3GSG A;  3S4X A;  4H8R A;  3VOY A;  3MZF A;  4B4Z A;  3NCK A;  1MY8 A;  4U0T A;  3VP0 A;  2XH9 A;  4DXB A;  4R4S A;  4PPR A;  1YLZ A;  2RL3 A;  3HLE A;  3P98 A;  4MLL A;  3OPR A;  2Y2M A;  4KZ5 A;  4OLD A;  1KE4 A;  5FI7 A;  4Y0O A;  1K54 C;  1MBL A;  5CGX A;  3VFF A;  2QPN A;  4E3I A;  3ZGA B;  3HUN A;  4GZB A;  3UE0 A;  3PBT A;  4PM5 A;  4KG2 A;  5F1G A;  1CEF A;  1NXY A;  2ZC5 B;  5DTT A;  5FSR A;  3ITA A;  2XK1 A;  4RX2 A;  3UO9 A;  1YQS A;  1BZA A;  1E3U D;  2XFT A;  3M2J A;  1MKI A;  1E25 A;  4N1H A;  1IEL A;  3M2K A;  2WUQ A;  4JXV A;  3WS1 A;  3VP2 A;  5GHZ A;  4KEN B;  3VP1 A;  2Y2O A;  3ZDJ A;  3IF6 B;  2ZJ9 A;  2PU2 A;  3OPP A;  4GD8 A;  3UPO A;  1JWP A;  4MBH A;  4X55 A;  3IXG A;  1LHY A;  1K56 D;  4FD8 A;  5CHJ A;  1E4D A;  1JVJ A;  4QB8 A;  1BUL A;  5E43 A;  4S2J A;  3MKF A;  4FH2 A;  3WRZ A;  1JTG A;  4OPZ A;  3NDG A;  3A3D A;  1ERO A;  1CEG A;  4RVA A;  2WAE A;  3WS2 A;  4DF6 A;  2BG1 A;  4S2L A;  2VGJ A;  5CER A;  1XPB A;  1K57 C;  1W8Y A;  1K38 A;  3WRT A;  1PWC A;  3ZHH A;  4WZ5 A;  1GHI A;  4BEN A;  2ZM0 A;  1ES2 A;  1KE3 A;  1FOF A;  3S1Y A;  1JWZ A;  2WKI A;  4GB7 A;  2XF3 A;  3I7J A;  4WBG A;  4E3K A;  1WYC A;  3CZD A;  1LI9 A;  1WYB A;  1KVM A;  3BLM A;  5E2F A;  2PBY A;  3ITB A;  4KZ4 A;  4EQI A;  1K6S A;  3LO7 A;  4P85 A;  2XEP A;  2WGV A;  4QY6 A;  1PWD A;  1DJB A;  2WK0 A;  2EXA A;  4WYY A;  3G2Y A;  5EVI A;  4WZ5 C;  5DF8 A;  4U3T A;  4BQM A;  4DE2 A;  1PI5 A;  4KG5 A;  3RXX A;  1XP4 A;  1ZC2 A;  1K57 A;  1ALQ A;  2OLU A;  1YT4 A;  2J9P A;  4N1X A;  2E8I A;  3G34 A;  4OP8 A;  5E2E A;  3ZG8 B;  3UE1 A;  3LY4 A;  4PM6 A;  4QY5 A;  1PYY A;  3MBZ A;  4E3J A;  2ZLY A;  5AQB A;  4EBP A;  2DNS A;  2XGN A;  1O7E A;  4QU3 A;  3IF5 A;  3HL9 A;  1KVL A;  3SOI A;  4OQH A;  1L0F A;  4R23 A;  3NIA A;  5F83 A;  4DKI A;  1GHP A;  4EV4 A;  1W79 A;  2Y4A A;  5HFO A;  3RJU A;  1SHV A;  4EBL A;  4E3N A;  2G2U A;  1GHM A;  5M19 A;  4K0W A;  4NET A;  5CEC A;  4FCF A;  3OPH A;  1ESI A;  2OV5 A;  5DF7 A;  5CRF A;  4ZAM A;  3HRE A;  4OLG A;  5FAP A;  1ERM A;  3AGD A;  3CG5 A;  1I2W A;  3BFG A;  3VMA A;  1VM1 A;  5EOE A;  3V50 A;  1ONH A;  4JKT A;  3UDI A;  4S2P A;  5FQM A;  4ZJ3 A;  3JYI A;  3A3I A;  2J7V A;  2QMI A;  2BLS A;  4X68 A;  1E3U A;  4LV1 A;  2IWC A;  3C4O A;  3PBN A;  3FWL A;  1G6A A;  3ISG A;  5DVA A;  2GDN A;  1JTD A;  1XA1 A;  5TFQ A;  3W4O A;  4R3B A;  5GHY A;  2IWB A;  1YMX A;  4UHU A;  3W8K A;  3ZCZ A;  3BEC A;  4UAA A;  5EVI B;  1Q2Q A;  1YLJ A;  2EX2 A;  2ZQ8 A;  5A93 A;  5AQ7 A;  1AXB A;  3V3S A;  3ZNY A;  5JYO A;  3HUO A;  5CGW A;  4EBN A;  2WAF A;  1YLW A;  4MNR A;  2H0Y A;  4Y0U A;  4Y0T A;  1ZKJ A;  4BL3 A;  2A3U A;  3O87 A;  1GA0 A;  2WZX A;  3P09 A;  3DW0 A;  3E2K A;  2ZC3 B;  1K4F A;  1ERQ A;  4EWF A;  3ZG9 B;  4GN2 A;  4E3L A;  4B88 A;  1H8Y A;  3HLC A;  3HLD A;  2Y2K A;  2IWD A;  5CGS A;  5A90 A;  3NDE A;  2JBF A;  3GRJ A;  3FYZ A;  2Q9M A;  1EI5 A;  2Z2L B;  1K6R A;  5FQK A;  4LV3 A;  1MWT A;  4PM9 A;  3IH9 A;  4KZ8 A;  4QHC A;  1NY0 A;  1ES5 A;  2HDS A;  4IBX A;  2Y2G A;  2WKE A;  1G68 A;  4IED A;  4U0X A;  1RGY A;  1MWS A;  1RCJ A;  2ZMA A;  2EX6 A;  3E2L A;  1TEM A;  2ZQ9 A;  1OME A;  5DF9 A;  1IYP A;  2R9W A;  3OC2 A;  4JPM A;  1K56 A;  1K55 C;  3G31 A;  4S2N C;  3MXS A;  4DE1 A;  2WGI A;  2HDR A;  3MXR A;  3IHB A;  5DTK A;  3SS5 A;  4EUZ A;  4DE0 A;  4OVD A;  4DRT A;  5CTN A;  3Q07 A;  1XX2 A;  5HW3 A;  3N7W A;  3BFC A;  2B5R A;  1N9B A;  3FV7 A;  4GDB A;  3GQZ A;  4N9L A;  3EQU A;  3UDX A;  4KG6 A;  1H8Z A;  3WS5 A;  4K91 A;  2ZC7 A;  1W8Q A;  2ZQA A;  3DWZ A;  3UPN A;  5JYP A;  4XUX A;  2HP6 A;  3C5A A;  1BLP A;  1Y54 A;  5GLB A;  5BOH A;  4YIN A;  3MKE A;  4OH0 A;  4JXG A;  4XUZ A;  4Q8I A;  1K55 A;  4S2N A;  3OPL A;  5HAR A;  2ZC4 B;  1XKZ A;  4OKP A;  4UA7 A;  4C6Y A;  4NK3 A;  5EE8 A;  5EVL A;  2JC7 A;  4C75 A;  1PW8 A;  5M1A A;  3Q1F A;  4L0L A;  5FAS A;  3A3J A;  4DE3 A;  3O88 A;  5A91 A;  1I2S A;  3IT9 A;  2ZQ7 A;  2XR0 A;  3IXD A;  1FCO A;  3C7U A;  4X53 A;  1L0G A;  4HBU A;  4ZJ1 A;  1SKF A;  1MWR A;  4O7D A;  5FQJ A;  2Y2I A;  1YMS A;  4B4X A;  1TDL A;  3M6H A;  1IYS A;  1EWZ A;  4PMA A;  4ZBE A;  2FFF B;  4OPY A;  2XLN A;  3G4P A;  1XGJ A;  4E3M A;  4IVK A;  4ZDX A;  1FR1 A;  1FCN A;  1YLY A;  2H10 A;  3SH9 A;  2Y91 A;  4HEF A;  4JF4 A;  5KSH A;  2PU4 A;  4X6T A;  3TSG A;  3FZC A;  3UY6 A;  1LLB A;  3QHY A;  4KZ3 A;  3N8S A;  4KZ9 A;  3BLS A;  4P0M A;  3SS3 A;  2CC1 A;  3OCL A;  5CTM A;  4A5R A;  3ZVW A;  1M6K A;  2EX9 A;  3TOI A;  1XA7 A;  5FI2 A;  5EPH A;  3V39 A;  4WEL A;  4RX3 A;  5EOO A;  3FKV A;  3G2Z A;  4WZ4 A;  3DTM A;  3QNB A;  4P87 A;  3VP4 A;  4R1G A;  3HLW A;  2Y2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...