1G69A

Thiamin phosphate synthase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
226
structure length
226
Chain Sequence
HGIRMTRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQEDANAKEVRAAIGDMILGVAAHTMSEVKQAEEDGADYVGLGPIYPTETKKDTRAVQGVSLIEAVRRQGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKTGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIAMIN PHOSPHATE SYNTHASE
publication title Structural characterization of the enzyme-substrate, enzyme-intermediate, and enzyme-product complexes of thiamin phosphate synthase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 79
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.5.1.3: Thiamine phosphate synthase.
pdb deposition date 2000-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1g69A00
2V81A 3G22A 3LBMA 2R8WA 4MZ1A 5AOUA 2B7OA 1VYRA 2CLMA 3LHYA 1EPXA 4CQ9A 3TW6A 3C6CA 1TPC1 2ZZ5A 4UTTC 3TQVA 1W1ZA 3NPVA 4BFAA 1NAL1 2CLEA 1TPUA 5KSWA 4IPJA 3LHVA 4DBEA 1G4PA 1FCVA 4O1AA 3P8JA 4HN4A 4OE7A 5I3JA 3FFSA 2A85A 2PURA 3S5ZA 4N4PA 5FEXA 2R14A 1KM6A 4H4IA 2QCEA 4M5PA 3P81A 2C13A 3TKFA 3MI3A 3T4CA 1UB3A 5EY5A 4Z08A 2DZUA 3L21A 1FDZA 1FX6A 1FCQA 1TQJA 3FA5A 4DF1A 3EKLA 5HR6A 1LZOA 1OYAA 4NNBA 3NDOA 5DCEA 3SIZA 4ORMA 5DCDA 4UTMA 3QEZA 4X9SA 1O60A 1OFBA 2VOMA 4NJIA 2OMAA 4PCFA 1TREA 3S1WA 3HQ1A 1OFDA 5A5WA 4EF8A 1GTEA 5CZJA 1EUAA 3TC6A 4N2YA 1THFD 3RLUA 2V9DA 2C18A 3G3DA 2DP3A 2ZA1A 1OVDA 2FLIA 3WJYA 3BG3A 3FJ6A 1QNVA 3M5XA 2A6LA 4Z1DA 3NQAA 2QAPA 3LRMA 4XTDA 1Z48A 3R12A 2GPTA 3TJXA 1OFEA 4XZ9A 5FF7A 3NQFA 4LV4A 3WFAA 4ZQCA 4O11A 1H1YA 2B7NA 3CIXA 1H1ZA 3I6RA 3B06A 1SSGA 2JGYA 1S5VA 4Y8FA 3LI1A 1TRIA 1F2JA 1VYSX 1MEIA 1K8YA 3IGUA 4K8HA 3NL3A 3W7PA 1GG1A 2WOQA 2Y7GA 4ALDA 2QEZA 4U28A 1VYPX 3M5ZA 5I3IA 1OYBA 4LNYA 1ICQA 4UTIA 2LLEA 3N9RA 3O8AA 3V1PA 2Y62A 3WJWA 3IIPA 4JN6A 2QAFA 4JYEA 2ZZ1A 4LC8A 3NQ7A 4FNUA 3TC7A 1I2QA 4AHOA 1G4TA 1HL2A 4K38A 3BO9A 2Z6IA 1T96A 4NT0A 5DY3A 1RPXA 3S9YA 4E38A 1XXXA 4AHPA 2NV2A 3HPXA 1JUKA 3QW3A 3UXAA 4D2JA 1P5BA 3NQDA 4WXYA 3KOFA 1YTKA 2G95A 3W70A 3TSDA 1SZFA 2IQTA 2HSAA 2QCHA 2Z1BA 1PCKA 1W5PA 4MFDA 5CGQA 3N34A 3ZR4A 1SO6A 3VFLA 1LBFA 1XBXA 3G1SA 1N8FA 2AGKA 4EOUA 4QSHA 3W1PA 5D2TA 3NQ8A 5E93A 3W6YA 2UV8G 1ONRA 5F1VA 2ZRZA 2C1HA 3P8IA 2QDGA 3FS2A 4MJMA 3I68A 3B0PA 3LV6A 4GXMA 3LLDA 3INPA 1DBTA 2ZDRA 3TIMA 3PBUA 2YYTA 2BSLA 1LTDA 5CPOA 3TK7A 1DJNA 1G6CA 4O50A 4UCGA 5F2LA 4L4LA 4YXGA 1P1XA 2NXGA 2JKAA 3Q2DA 1RQBA 4ZQRA 5F2GA 3GIYA 4LTSA 1I2NA 3ATZA 4MY9A 2ZZ7A 1YTEA 1AMKA 4EF9A 2E09A 4JTHA 3TAKA 1OFAA 2WPBA 3L5LA 1ZHAA 2X2GA 3TA6A 3SFKA 2DZPA 1OF8A 3NA8A 3E0IA 2NWSA 3STEA 4AXKA 1XM3A 3DH7A 1K03A 4JX5A 1VH7A 3OA3A 4N6EA 1A5SA 1P0NA 3LCHA 1O5KA 1H60A 1LYXA 5I3KA 2FDSA 3LOTA 1H7XA 3L0NA 1KFLA 1U83A 2VKZG 4ZZ9A 3PUEA 3PB2A 4O4WA 3BLFA 4WX2A 4AVFA 1R46A 3W7IA 4XBKA 1JCNA 1MSSA 1I2RA 3QZEA 2FPVA 3OEXA 3W2MA 1FWSA 2PCQA 3RNDA 3GXPA 3MP3A 4OQVA 3NAVA 3VKJA 2BZNA 4FX6M 3CIWA 1R2SA 5I3FA 1QWGA 4PODA 4YMZA 1SU5A 3LHWA 3P61A 3E12A 5LNRA 4CCCA 4NX5A 3CB8A 2X1RA 2VFDA 4WY0F 3IVTA 5BRBA 4BI6A 3M41A 5DN1A 1KFJA 1SPQA 2Y63A 3UWYA 3W7GA 1TPDA 1I2OA 2OT1A 4ZQOA 1AL7A 1GTHA 4O4VA 4JX6A 4JIQA 4LY8A 1B4KA 1H7OA 3IIVA 4JTTA 4JTGA 1GVOA 5AHFA 5BMWA 1QPRA 1GVFA 5G5IA 1JRBA 4C1LA 1YXCA 4G1KA 3ABSA 1SW7A 4QISA 2H8ZA 3A23A 2C15A 1KFEA 2A1YA 1TJPA 1K02A 3UD6A 3AJXA 3B0VC 4O1CA 1OG0A 4K8EA 5D32A 3EWUA 3G1AA 1YXDA 3O05A 3YPIA 4MLJA 4BI7A 3QFEA 4JTFA 3NQ2A 4P61A 4JDYA 4IMDA 1IXPA 3NGJA 3O16A 1QAPA 4Y9AA 1O95A 1JJKA 4WUIA 3UXDA 3LCGA 1TTQA 2VFEA 3WK1A 1YXYA 1A50A 2J6XA 3ZFHA 5AC7A 2J9YA 1D3HA 1YDOA 2Y70A 1NFBA 2YSWA 4HPJA 4QIUA 5J5RA 1SO4A 5IM51 1UASA 5EBUA 5C5YA 1XI3A 4O13A 2DZSA 4WZHA 3FOKA 3ABRA 1VR6A 3RF9A 3STGA 3P60A 1Q3NA 1YDNA 2ZTJA 3NQMA 3O15A 2QCDA 3M43A 3T40A 6TIMA 3OVQA 2H6RA 1BWLA 1X7FA 3ZS4A 4DPPA 4M6VA 2Y7DA 1LRTA 5G4EA 4PEKA 3UY8A 5AYZA 4O54A 5LSMA 4OHQA 1KFCA 3DENA 1YDVA 3G1DA 3GAYA 3OHIA 5G1YA 2WSRA 1GVSA 2V2DA 4AAJA 5BMXA 3RU6A 3TFCA 2TMDA 1O94A 1WOAA 2VFGA 3NPXA 1LBLA 6ALDA 2PRHA 3EWBX 2QCLA 3R8RA 3WJSA 1M7PA 4GWEA 1HO1A 3KXQA 4FNRA 4JY8A 2CZEA 2HS8A 3PWAA 4RR4A 4MYXA 3NG3A 5AHMA 4HHPA 3STCA 3MBDA 1HTIA 4R53A 1JVNA 3NR0A 5FI8A 3NVTA 3E9AA 2X30A 2QKFA 1WXJA 3Q37A 1ZAIA 3FYPA 4AB4A 3LI0A 4UTWC 4LC6A 4W9TA 1QPOA 5D04C 2ATSA 2WV8A 3LGEA 1OFRA 4GNJA 3CPRA 3NQCA 2YCEA 4FEZA 1QCWA 5U7SA 4MZ8A 3G8RA 2C6QA 4XQ6A 4IXHA 4LRSA 3BW2A 4BI5A 4GUGA 2BTMA 2TYSA 3QQ0A 3M7WA 3MJYA 2Y7FA 4DO5A 2CWNA 2VENA 4PFMA 4JYDA 1OX4B 2XN2A 3NQ6A 3MUXA 5LNSA 1WBHA 3W23A 4HSNA 3SECA 3PUDA 4PC8A 3C56A 3TMLA 4BR1A 4Z1AA 1OYCA 5G2IA 2Y88A 2Y85A 1IIGA 4TR9A 3L9CA 3N2XA 3NL2A 3HG2A 3CQ0A 1R30A 1VHNA 1EP2A 2QR6A 3CEPA 3TROA 2DU2A 1KBIA 1AW1A 2VFFA 1FWTA 4LVGA 4ORIA 4BWLC 3S1UA 2VXNA 4AWUA 1DQXA 4Q33A 4LU0A 4TO8A 3L0GA 3C2VA 2RDWA 2WNNA 3W3OA 3DI0A 4TU1A 5FF3A 4NNCA 1O4UA 5KZMA 1UJPA 1G7VA 3QMTA 4HIBA 3TQ0A 3IV3A 1VGAA 5G2HA 1OX5A 5H91A 4JS3A 1YLVA 1VLWA 1PCWA 3H55A 3BGGA 3P7YA 3MI2A 3BG5A 4J9JA 3LV5A 1EUNA 5AHNA 3TCEA 3M9YA 4EVZA 2QJIA 4KFOA 1L9WA 2QJHA 1IXQA 1VQTA 4POCA 1M6JA 3KRUA 3PBWA 3PG8A 4BK9A 4HNNA 4I7VA 1Q45A 1B57A 2ISSA 4WJEA 4H3DA 3TUUA 4GUHA 4HNVA 4JIPA 4LOCA 3GNDA 3M47A 1TQXA 4M19A 3UYCA 5HWNA 1TPB1 2NX3A 1L6WA 1T99A 3TXVA 1JCLA 1FY6A 3PUOA 2FQIA 3T78A 1F6PA 3QC3A 1CX9A 2EGZA 2TPSA 4FHAA 1TMHA 2Q8ZA 2ATMA 4HNTA 2DORA 4KWWA 2FTPA 1B9BA 1LP6A 3LBCA 2VFHA 3D0CA 1KM5A 3BK0A 1LDCA 3NXFA 4RXFA 1KM4A 2YX0A 2X1TA 3CU2A 3HO8A 5K7JA 1W31A 2A5HA 3CLMA 1TJRA 3NOEA 4IX0A 3S1XA 3GYEA 1F74A 4MY8A 1TIMA 1OJXA 4JTIA 4HNUA 1FCUA 5DBTA 2CFFA 3IVUA 3NZRA 3C61A 4QNEA 3A24A 4IMCA 4TMCA 3W7EA 3SGZA 2OCZA 2RFGA 4JNMA 4JY9A 4WOZA 1O5XA 3DZ1A 3RLVA 3W84A 2J27A 2ZBTA 3NM1A 3NQEA 4MUZA 1F73A 4XUGA 4WY0B 2ZCGA 4UTTA 3DXIA 4IX2A 2B4GA 4PH6A 2B7PA 1FWWA 2FPYA 2E5DA 1ZAJA 4OV4A 1PV8A 3KVJA 2A21A 5DXXA 2ZQ0A 3W7MA 3W75A 4C1KA 1Z44A 2O7SA 3FKRA 4UFLA 1TYGA 2NUYA 2H3DA 1FCBA 4ZQMA 4ZL1A 1XC4A 1SW0A 4MZYA 4LVDA 1KM1A 1TV8A 5AFDA 2C19A 2H8XA 3P74A 1OFQA 3KX6A 1VZWA 3G24A 2NXHA 4TIMA 1Q6RA 3MI6A 4RLIA 3NQGA 5KINA 1NF0A 4O0ZA 3I65A 1LOLA 4FO4A 2GVLA 4QAIA 1L6SA 3BV4A 1NF7A 2GOUA 4GRSA 3TXZA 3KRZA 4AF0A 4S2BA 1LLWA 4ZMGA 3USBA 4LVAA 3G0XA 4O1BA 3W7DA 1Q6LA 4O17A 3W88A 3BARA 2YPIA 1W3IA 1TV5A 4LT9A 1KFKA 5D09A 4RXGA 3G1XA 1FXPA 4DELA 2YGYA 2YW3A 2V2CA 1E51A 3UWZA 5D02A 1GPWA 3TV8A 2NXIA 1GQNA 1VS1A 2ISVA 3RMJA 4PL2A 3TMQA 5AHIA 4TX9A 2GQ8A 3TX9A 1VHCA 4JDBA 1TPEA 3BLEA 1HUVA 1QO5A 2WQPA 4A3UA 1W37A 3STFA 1P0KA 4LUJA 1F7BA 2FPTA 4UTJA 4NUWA 1G7UA 2AQWA 3C8FA 3W2JA 1AK5A 4DF2A 4BF9A 1OX6A 4CCEA 1G67A 1S3HA 3EKZA 4OV9A 3F4WA 4N9BA 3SSJA 1JCXA 1TPFA 3FKKA 1WAUA 5T26A 3C2EA 5HR7A 3G1VA 2OJPA 3DFSA 3NYZA 4QITA 4FNPA 4JR5A 4TMBA 1XBYA 3EEGA 1CI1A 5K2ZA 1GJPA 1VC4A 4EWND 3FJLA 4YWIA 4QQ3A 5K4ZA 3W2LA 1NVMA 1T8XA 1GWJA 1QR7A 2Y6ZA 5D03A 3BPWA 1XKYA 3VE7A 1Y0EA 5C2XA 2DJXA 4R33A 4DBDA 2VEIA 3TSBA 1H51A 3B04A 2JKPA 2YZRA 2OZ0A 3EXRA 5D2XA 3HBLA 4YCOA 1JCJA 4DO4A 1Z42A 1RR2A 1SW3A 3I7QA 1N7KA 3TQKA 3WJZA 1KW1A 2WNQA 1YTDA 1PL9A 3LB0A 3MHGA 1SZNA 3W7QA 2B0MA 5C6MA 3L68A 2CLIA 1OK6A 1H5YA 3WK2A 2XN0A 5LNWA 4YCPA 4A21A 4A22A 1QFEA 2YYUA 3B0UX 3HGSA 4PA8A 5K3VA 3R5EA 3UWWA 1LM1A 3N73A 3PM6A 3N3MA 3I7RA 3L66A 1JUBA 4Z0SA 4AWTA 3T44A 1ZJIA 3IGXA 3NNTA 2QCNA 5HUOA 5K9CA 5AYXA 4Z1CA 2ZZ2A 2X1SA 4EIVA 4XWUA 2NUXA 4K36A 1DOSA 4ML9A 1IIHA 2OT0A 1ZFJA 4QJ1A 1TPH1 4N02A 3WK3A 3IIZA 3W86A 3PS7A 2CZ5A 1I8JA 2DZVA 3DBPA 4DF0A 4UNLA 5CKSA 3W85A 2I9EA 2YDAA 3L65A 4E2DA 1V7YA 3TSMA 4DO6A 4MFEA 4FNQA 4JTJA 3DHFA 4JD4A 1H63A 2VEPA 1QOQA 3MP5A 5L9FA 3TJLA 1ICPA 2FB3A 5D2WA 2F84A 1GZGA 3PBYA 4RCXA 4NZJA 7TIMA 3WK0A 2E5CA 2HS6A 3PSWA 4UTHA 1VLIA 1XDMA 1HFBA 3PVFA 5FESA 3GR8A 3P82A 4AEOA 1KBJA 2ABAA 1LORA 1F5ZA 3GKAA 1QPQA 3UZ5A 4GUJA 4ZQPA 2NV1A 3G1FA 3W1NA 1F76A 1L6YA 1XFBA 3VE9A 2WJZA 2V0TA 2HMCA 5HINA 2VEMA 3C2FA 5K9XA 4DXVA 4JEQA 2ZRYA 3GZ3A 1JUEA 2RDTA 3TNOA 3L67A 1ZNNA 1X1OA 1VJIA 5IBXC 1FUYA 1VRDA 3NEVA 2QCCA 3ABQA 3L5MA 1G4EA 3S5NA 4JTEA 1KV5A 5AN7A 1QOPA 3V75A 3LHUA 3IRDA 3KAOA 4PTNA 4LUIA 4NXKA 5G2WA 3G3MA 5HWJA 1Q6QA 3P5ZA 1Q6OA 3PB0A 2QUVA 1DJQA 3LX9A 5G4WA 1ZENA 2V8ZA 4JICA 5TIMA 5K9DA 3R13A 3UZJA 3G0UA 3S8HA 3LCXA 4CNNA 1QO2A 3C2RA 1A5BA 2PC4A 4CCDA 2A7PA 2W79A 3LTSA 3DHDA 3EWWA 4Y6GA 2V5BA 4XKYB 1SZEA 5SWUA 2A7NA 2J9XA 4NX0A 2ZRVA 5LKYA 2V2HA 1JR1A 3EXTA 1JCMP 1MEHA 1BWKA 4CLMA 1XL9A 3B4UA 4UFKA 2ZA2A 4ADUA 3P84A 3QRHA 4FF7A 5F4SA 4KWVA 4GJ1A 3UWUA 4N4QA 1W5QA 4K7YA 4AWSA 3R89A 3S5OA 3IGSA 2XFWA 3O6DA 3FEMA 1LRNA 2H3BA 1LBMA 1H7PA 2ZZ3A 5HULA 4LS0A 3T7VA 1RQEA 3TR2A 1FWNA 3MHFA 2J24A 3Q94A 1EEPA 3N9SA 2CW6A 3TU9A 4IUOA 3UWVA 3MYOA 3CWOX 4WXZA 3QH2A 3GB6A 1LCOA 5AHEA 2EF9A 2CZDA 4DPQA 3LHTA 3HG4A 5E0KA 2NZLA 4NJJA 2V5LA 5ABTA 1I45A 2CZFA 1YYAA 4Z1BA 2Z6JA 1GYNA 4ZQNA 4FXSA 3K30A 3THQA 3OIXA 4JTKA 2QDHA 3U6WA 3DFQA 3TW7A 1ZY9A 1EWDA 3PULA 3LXBA 1NSJA 2EAWA 3HPZA 4HSOA 4FIRA 2EHHA 3UPBA 2VFIA 3S6DA 3QYQA 3LXCA 3TFXA 4X3ZA 2ABBA 2NLIA 2A4AA 1QMLA 3C0JA 4L4MA 1K7FA 1OK4A 1LOQA 1X6UA 3P67A 1J2WA 3LCFA 5LZLA 2QCMA 3A5VA 5F4XA 1W0MA 4IPIA 4ICNA 1GVRA 2FIQA 5CPLA 2TSYA 4M6QA 1R47A 3GDMA 1KLYA 1KA9F 2ZRWA 4OU1A 5HMSA 3W7JA 1IGSA 2P0OA 3PC0A 4UMBA 1YPIA 1VCGA 3SR7A 3G1YA 2GQ9A 2C14A 4ADSA 3HOJA 3W87A 1V5XA 8TIMA 2P1FA 1RQHA 1SQ7A 4I7UA 3W1RA 5K4XA 3FYOA 3C3NA 1GYLA 2H90A 1KM2A 1PIIA 1Z41A 3ATYA 2YR1A 3W1QA 5KZDA 4A29A 3NPWA 1MEWA 4LRTA 3SI9A 3NO5A 3O63A 4AMAA 2QCGA 4CNPA 4CNOA 3W22A 4NJHA 1TCDA 3DU0A 4FXRA 1YADA 1F05A 3W7RA 2TRSA 3NM3A 2O7QA 5HQEA 3QSRA 4UR7A 3HPSA 5DBUA 1W54A 4O1DA 4JYFA 2WSQA 3QMSA 2J9ZA 5KTLA 5AYYA 1I4NA 3W83A 2WNZA 4RK8A 1T0OA 3LLFA 3LXAA 1EIXA 2R91A 3VCRA 1KFBA 2WO5A 3E49A 4RZ5A 2Z2UA 1SO3A 4O12A 3HGJA 1AW2A 3CEUA 3U8GA 3IVSA 1K7XA 4JGDA 5D2YA 3UNDA 2JBMA 1D9EA 5HJLA 3PAJA 5EA9A 4KFPA 3MP4A 4NZFA 4MVAA 3NL5A 1HO4A 3EX1A 4IOTA 1PHWA 3QPYA 4OBTA 1P4CA 3U2OA 4K6AA 4GUFA 3GXNA 3F1QA 1K8ZA 2ZYFA 1NEYA 1KM3A 5LHFA 2RDUA 4O19A 3B05A 5FEZA 3A5FA 4AH7A 3RFAA 5FEPA 5BOOA 3DFTA 1JCYA 5LNUA 2RHGA 4ZVJA 1TPWA 3OVRA 4JTSA 1KTCA 4P2VA 5HWMA 3E02A 4UUIA 1GT8A 5TQLA 1EA0A 3PY2A 3W1TA 3W1XA 4O53A 4O8RA 2DZWA 1ICSA 1YPFA 4R7JA 5DLCA 1TSIA 2DJLA 4U4MA 5L6UA 3W73A 1W3NA 2GJNA 4XTIA 3BVJA 1JULA 5D05A 5HUPA 5D37A 3RK8A 2V30A 1LROA 4LWWA 1WX0A 4N6FA 4UFMA 5LGXA 3O1NA 1LRQA 1XBZA 4IMEA 5G1TA 4GC4A 5C55A 3KVKA 4MOZA 3S42A 1OHLA 4O10A 3KHJA 4LS1A 4WD0A 3R2GA 5CPNA 1A5CA 3EX3A 1X8FA 2QCDB 4Z0JA 3ANYA 1HG3A 2G5WA 5D33A 4MY1A 1FDJA 5I3HA 2RKXA 5CZSA 1ZCOA 1C9DA 2Q8LA 2E6DA 5CZ0A 1TRDA 5D2VA 3E96A 3NPUA 2GQAA 4NNAA 1J4EA 3SW6A 4OT7A 1SSDA 3EX2A 3VNDA 3HG3A 5U4NA 4IXXA 1SZGA 1BKSA 3TAOA 4KKXA 3QMRA 4XKYA 4AHQA 2X16A 1TTPA 1H7WA 4IJBA 3ABOA 5TBOA 3G18A 5KZEA 1JQVA 3AO0A 4KFNA 4N9EA 1MO0A 1H7NA 3W2KA 1H62A 2I1OA 4IWWA 1WYIA 1G4SA 3L5AA 1X1ZA 1IXOA 5CSSA 3GX9A 5FF2A 1EX5A 3W71A 1MZHA 3O6CA 3Q58A 1F6KA 1H7RA 3LTPA 2C16A 4MIMA 1BEUA 1DL3A 4XBSA 5D38A 4O14A 5FF4A 3DI1A 2V82A 1WA3A 3DKJA 3EB2A 3FIGA 3NZ1A 4NVTA 1FBAA 2A7RA 5I3GA 3DAQA 2JKEA 4NJKA 1L2UA 3SZ8A 2C3ZA 4FIQA 5AHLA 1SUXA 1VPXA 1C29A 4NQ1A 2BLEA 2GVGA 2EPHA 4S1FA 2QJGA 2E6AA 5AC6A 2Y89A 3N19B 2QCFA 2ZTKA 5FEWA 3M1ZA 4E0CA 3MHUA 1KV8A 2ZRUA 1SR9A 4UC5A 3JS3A 3LCWA 1OX4A 1AL8A 5EPDA 4ONVA 3GDTA 3W1AA 3GLCA 1IF2A 2A0NA 3LTYA 3P62A 3EX6A 3HGOA 1C8VA 4I7WA 1GOXA 3BG9A 3UQNA 1K3UA 2HTMA 3W76A 1DKWA 5DCBA 2E5BA 1PVNA 3EWXA 1VCVA 1FDYA 1U5JA 3L2IA 3LHZA 3G0SA 3SY5A 3TE9A 1UCWA 1ZAHA 2QUUA 4NJGA 1DORA 3GR7A 3M5VA 1SFLA 4OWGA 4YL2A 1EP1A 1XCFA 2A2IA 5GVJA 3PR2A 3GXTA 4GFSA 3DFOA 5DELA 4Y90A 2Q3OA 3KVLA 3MMTA 2ALDA 1PE1A 1GEQA 3HJZA 3SGUA 2NX9A 3CC1A 1WQ5A 3NQVA 2YFOA 4M6PA 4UFIA 3PG9A 1ME8A 1KLZA 5LNVA 1ADOA 3PBVA 3QSTA 3H53A 3LRKA 5F1UA 3M0ZA 1RV8A 2F7FA 2AAMA 3ELFA 1S5WA 1QPNA 4LW7A 1TTIA 3WJXA 3F03K 4I9AA 3MW7A 3GDRA 4Y96A 5E1QA 3UWQA 1GG0A 1G69A 4LV9A 3CM4A 2NUWA 2VC6A 2DZTA 3A21A 3TH6A 1A53A 3LERA 5F4WA 3M44A 4UR8A 3HG5A 4Q32A 4OGZA 3CHVA 1TV7A 3GVGA 5BNKA 1R2RA 1DHPA 5KMYA 3UPWA 3HB9A 1AW5A 3GDKA 1ZALA 4N9DA 2ZFAA 1EP3A 3P80A 1M7OA 4O16A 2BXVA 2EKCA 2NX1A 1PHQA 4IMGA 4A2RA 3G8EA 3MO7A 2Y7EA 4QM1A 1W5MA 5EKYA 1KTBA 5AB3A 1K8XA 1W56A 2FFCA 3O6YX 1KM0A 1TO3A 3P5YA 3G1HA 3W72A 3IIXA 2QUTA 1K7EA 3DGRA 4RX0A 2BWGA 1FWRA 4R34A 1TPVA 2Q3RA 1J5TA 3ZWTA 5C54A 3B03A 5H2ZA 1WV2A 3HIJA 1XDLA 1LLZA 3GKFA 3OBKA 4RKAA 3OG3A 2W6RA 3C4UA 4LS2A 1H50A 2CLLA 4RJEA 5D30A 4UTUA 3KVMA 1N55A 1EWEA 2ZRXA 3IEBA 4FB7A 3N2MA 4FX8A 3HMJG 1KTNA 1VCFA 5HNRA 5DY2A 2G97A 2JK2A 3W7NA 1OFPA 4WY0A 4B5NA 4LVFA 1WOBA 2WSYA 1XUUA 3VI2A 1OABA 3W7LA 4UXDA 4MPQA 3DFPA 3QW4B 1OFOA 1I2PA 1UBSA 2GUUA 4UMAA 1RD5A 2I14A 4CQAA 2XN1A 5F2MA 3KRSA 2YXGA 1DV7A 3EX4A 5CSRA 4LVBA 3W9ZA 3LRLA 2Z0IA 4PL1A 4GUIA 3QPZA 1W5OA 1GVQA 3HF3A 4HT3A 2GVJA 2CLKA 3MWAA 4O28A 1FXQA 2ZA3A 4MLRA 3M16A 4GE8A 4AF0B 5IBXA 1WDWA 2CLOA 3C52A 3PF3A 3HGRA 2JGQA 3I7SA 4K39A 2GJLA 3S0CA 3QF0A 1A5AA 4NXSA 3W7KA 2J88A 3EWZA 3DKLA 3JR2A 1DQWA 5F2IA 1DVJA 5EL1A 2OX1A 4S2CA 3W7CA 2NWRA 5FF0A 5BW6A 3H54A 4FNTA 1QDSA 3IIOA 3S5YA 1S5TA 5LHEA 3B8DA 2YW4A 1OF6A 2R94A 2KZHA 4K37A 4H6KA 4K7VA 2E6FA 1BTMA 3QM3A 3LCLA 4O52A 3N14A 3CTLA 3EXSA 1B3OA 1UUOA 4RZ4A 3A9IA 1UUMA 4IGHA 4UTLA 3MYPA 3LDVA 2E68A 3L0KA 3W2NA 3W7OA 5CPMA 2BX7A 4JTUA 1XUZA 4YLWA 4WOQA 2PRLA 2CLHA 3W07A 1D3GA 1PS9A 1FQ0A 4UFJA 1R2TA 4X2RA 1W8SA 4FX7A 1EB3A 3W1LA 1SO5A 4UIOA 4QNWA 2A6NA 2WKJA 1SFJA 5EMUA 2RH9A 4UFHA 3TDFA 2VEKA 1JRCA 2P10A 3LM7A 3GK0A 5A8GA 3ZWSA 1AG1O 3W1UA 5AC8A 2ZZ6A 4M7SA 4X22A 4N9CA 3SJ3A 1TB3A 4JTLA 3W1MA 2QF7A 2YFNA 3OVPA 3LCIA 4JX4A 5EYWA 1IXNA 1RVGA 1XBVA 4A2SA 4MJZA 2VELA 3F4NA 1ME7A 3CT7A 4WQ6A 4UTWA 4HPXA 4M7TA 2X1UA 3MBFA 3UY7A 2ZZ4A 1JQXA 4RV8A 4UMCA 4FNSA 1B4EA 3FLUA 2ISWA 4ADTA 5MHBA 5LGZA 3DFNA 1TTJA 3T55A 2E77A 4O15A 2E1DA 3W7HA 4MKNA 4UTKA 3NL6A 3BGJA 1WBJA 4JXCA 2E6YA 3QQ1A 5CZTA 1W5NA 3PSVA 2PRMA 2D73A 2CLFA 3KFTA 3O07A 4MYAA 4O18A 4O57A 3W74A 4GBUA 1H61A 2C0AA 2G96A 4RZ6A 1ML1A 1M5WA 3CWNA 3GNNA 3M6YA 3M5YA 5J5DA 2B7QA 2W0UA 4NU7A 4CQ8A 4IQLA 3W2UA 3C2OA 3BW3A 3JRKA 4DQWA 3GAKA 3THAA 1LOSA 1W3TA 5DXYA 4E2BA 3GDLA 2CU0A 2Y61A 3EWYA 4O0KA 4UNKA 2FJKA 4DEFA 4IMFA 1RZMA 2FB2A 3A22A 1MXSA 3O06A 4HKPA 1ALDA 1CW2A 5KITA 2DZXA 2PE4A 4Q4KA 5CG7A 3BW4A 4BWLA 3QJAA 1ME9A 3S1VA 3BLIA
chains in the Genus database with same CATH superfamily
4ZO7A 4C7GA 1H49A 3TW6A 1JPIA 4UTTC 3TQVA 1W1ZA 1CGTA 4E4UA 1NAL1 5KSWA 3ANVA 4IPJA 1UP0A 4HN4A 1LWHA 3NCOA 3RCYA 3FFSA 5I3JA 3SBFA 1RHCA 4FP1A 4XVEA 1ZP4A 3BUVA 4HOZA 1IZKA 2C13A 1E9LA 5GJPA 1W9UA 4GIEA 5B80A 3E2VA 4Z08A 1N8WA 1FCQA 3EKLA 5HR6A 4XV0A 3R11A 4TVDA 3WEOA 1OYAA 2OO6A 1O60A 1TREA 1OFDA 1EUAA 3TC6A 4DZIA 4N2YA 4KGJA 4LCRA 2JF6A 2C18A 2DP3A 3URQA 2ZA1A 1OVDA 3H21A 4YVVA 3LZ5A 3M5XA 3IUHA 3E5BA 4WRHA 2DY3A 1XICA 2VQUA 4RDVA 1OFEA 3NQFA 4LV4A 1MYRA 1TZZA 1WUFA 5GJMA 1MQQA 3B06A 4GOAA 1A0CA 1YNYA 1VYSX 1MEIA 4L6OA 1OCQA 3GTNA 3HPFA 3JUGA 3NL3A 3TLQA 4AYGA 2R1NA 4LYKA 1UKSA 1Q6EA 2YA2A 4UQEA 3THDA 2V5DA 1QNOA 3GXDA 3M5ZA 4GYPC 1US0A 4Z1YA 5CPSA 4H7ZA 4CUCA 1PIGA 3PWGA 1CGWA 3P14A 1V02A 4YWSA 2DT2A 3GWQA 4LC8A 1E1CA 1I2QA 1W1B1 1GHSA 1FWIC 1HL2A 3UJEA 4CNTA 3BAIA 3V36A 3F4VA 3MZ2A 3VIIA 2IS7A 2ZUTA 2IPFA 4ES4A 4E38A 3GHRA 1RVKA 4IIFA 5IRPA 2PDIA 1JUKA 3QW3A 4W84A 4D2JA 3RLHA 1VFFA 2AOSA 1GONA 3TSDA 5ENLA 3HV8A 2IQTA 2QCHA 3V5FA 1H1NA 1W5PA 5CGQA 2R24A 3ZR4A 3VFLA 1LBFA 1N8FA 4UQ9A 4QSHA 3W1PA 5A1AA 1PX3A 4GZ7A 2VEGA 5E93A 2ZRZA 3C0QA 1EGZA 4UB9A 1D7FA 4LAMA 3P8IA 2Z4GA 3FS2A 3B0PA 3W02A 1ONEA 1C93A 3E0VA 3PBUA 1LUCA 1WDQA 1BLIA 1G6CA 4O50A 3HQPA 5F2LA 3ZT7A 4L4LA 1BRLB 4HA3A 4P7QA 3AAMA 3UBPC 3TNBA 4ZQRA 3WUBA 1IEXA 4LTSA 1ESWA 1I2NA 3P0WA 4XB3A 3ATZA 4MDPA 4BQ2A 1V3JA 1LG1A 3N1AA 3OLGA 1B1YA 4CQCA 4EF9A 3RPDA 1ZHAA 3EKGA 3N18A 1K6AA 4AXKA 3QY6A 3AIEA 1NQ6A 1B9ZA 1KRMA 2CC0A 2OTDA 2XZ7A 1E4LA 1BKHA 3LN3A 1EO5A 3GC2A 4KETA 1O5KA 1H60A 1B54A 3WH7A 9RUBA 5I3KA 3LOTA 2FFIA 4O1EA 2VKZG 4OIFA 4MPKA 4O4WA 3WD0A 3OIHA 1MSSA 1US2A 2FPVA 3POCA 2WVSA 2AL1A 4NF7A 3OEXA 1FWSA 3GTXA 3RNDA 2YBTA 3RXZA 4QEEA 4REQB 3VKJA 3CV2A 4PODA 1XGZA 1SU5A 3LHWA 3P61A 5LNRA 3MMWA 2J75A 5DMNA 2YXXA 5DN1A 1KFJA 5HMDA 4ZQOA 1KBBA 5J8LA 3VNMA 4KW2A 3IIVA 4JTTA 1E9ZB 1GVOA 1IWAA 3EZ4A 2NV9A 4AU0A 2VDIA 3D5HA 1PZ2A 4GY0A 4X2PA 5BWFA 3B0VC 1OG0A 2OVLA 3E2QA 4U33A 4J40A 1XIEA 5A2AA 3CS2A 3NQ2A 4P61A 1DIEA 4IMDA 1IXPA 3NGJA 2PDCA 5EMLA 3ZXWA 2DT1A 3R58A 1AJ0A 1QAPA 3D3AA 1R7OA 2J7DA 3LCGA 4EAYA 4R9XA 4QDPA 4KWSA 2VFEA 2F38A 3VGFA 3ZJ7A 3QC0A 1A50A 1XD0A 2Q02A 3ZFHA 5DANA 4HPJA 1SO4A 1F4HA 1XI3A 4O13A 3STGA 3H2CA 1Q3NA 1W1A1 1V3HA 1XIFA 1YDNA 3NQMA 1E71M 2H6RA 4DPPA 1K1DA 5AYZA 4O54A 1PYFA 4OHQA 3SEPA 1N8IA 4Q22A 3CNYA 5DMLA 1KFCA 3G1DA 4AC1X 4I9MA 3T0TA 2QJJA 1TCMA 2WLYA 1OGSA 3GUWA 4WJXA 1NFGA 5BMXA 3OYZA 1O94A 1LBLA 6ALDA 3EWBX 3CQIA 4GWEA 1HO1A 1AA1B 2CZEA 2HS8A 4TV6A 3VOFA 2OKTA 3MBDA 1E1EA 3CQHA 3AYSA 3AUOA 3NR0A 5FI8A 3F5KA 4QSFA 3NVDA 2X30A 1XPGA 1JZ6A 7ENLA 4GQQA 3RCNA 4XZBA 5D8WA 4UTWC 4JL1A 3BAXA 3BZGA 3MDUA 4QLKA 4GNJA 2WSKA 2YCEA 1H4PA 3GHUA 3BWWA 1Q65A 4GG9A 3N6QA 4H9VA 4ZFCA 3G8RA 4XQ6A 3LNMA 2IKIA 4O0QA 2EPLX 1UIOA 2BTMA 2PAJA 3SM0A 1DJYA 1JDAA 4C7FA 2MNRA 4PFMA 4JYDA 1OX4B 3LZ3A 4R88A 3MSRA 4JQ4A 1L6GA 4S39A 1JAKA 4ZODA 3C56A 3S2JA 3WBEA 1IWPA 2Y85A 1IIGA 4C6OA 3HG2A 3BJSA 1R30A 3T0AA 2QR6A 3AZSA 3CEPA 3TROA 4HMNA 1AW1A 3V5CA 1FWTA 4FSAA 4LVGA 3WLNA 1A80A 3TTYA 1J11A 2O55A 1KFWA 4BWLC 4LU0A 3W3OA 4ZEPA 2EQDA 7CGTA 4UCFA 1O4UA 2RAGA 1L8NA 2FHCA 2QJMA 1W1VA 2DIJA 4ZXOA 3CL8A 4QDWA 2GZXA 1G7VA 3QMTA 3MUCA 4W5UA 4B9YA 4F9DA 2VZUA 5H91A 2DQXA 1BVNP 1YLVA 1VLWA 3H55A 3MI2A 4FLSA 1V0NA 3LV5A 5AHNA 3IJ7A 4LANA 3TCEA 3M9YA 2QJIA 3CV1A 3ARVA 4QP0A 1YRRA 5LA2A 2ZXBA 4DZHA 2NVCA 2ISSA 4ERAA 4H3DA 2VRKA 1D3CA 1VBUA 4DJDA 1NELA 1S2WA 1YMYA 3PWIA 5I00A 2NX3A 1L6WA 3MZNA 5FD0A 2WMIB 3QC3A 3ALGA 4NYUA 1TMHA 2NVDA 1RBOB 4PCNA 3HN3A 3GO2A 2PDJA 2VT0A 4GH1A 4A35A 4F48A 4L6DA 5AY7A 2JALA 2VFHA 4FS9A 1NH6A 5AECA 4JFSA 2YX0A 1UR0A 1L8PA 3HO8A 1W31A 1DQUA 5PTDA 4PUDA 1TJRA 4GK8A 2Y4SA 2PWEA 2AAAA 1E6RA 3BQ5A 2TAAA 2VM8A 1FCUA 5DBTA 2J13A 3IVUA 8XIAA 5CEWA 3A4AA 1OG6A 3OP2A 5JBEA 5BRQA 1V3IA 5A6BA 4P7NA 4WOZA 2YIHA 3NQEA 3LY0A 4NSBA 5A6BD 3UETA 3DXIA 3CUGA 3IK2A 4B3KA 1D2KA 2F2KA 1ZAJA 4GXPA 4JFVA 2A21A 2DSVA 3GG7A 4CQDA 3H7VA 2CBJA 2GL5A 3CUZA 1CXHA 3WQGA 4UFLA 1QI5A 1QHZA 1HZYA 4ZL1A 4DLMA 4MZYA 2HPMA 3CIVA 5LIYX 5AFDA 2C19A 1GQIA 2H8XA 2WPGA 4QCEA 1VZWA 5LXXA 4LBRA 1Q6RA 4JHMA 4HNOA 2OQLA 4QAIA 3BV4A 4F3HA 1Q2RA 3U9IA 1E5JA 3P3BA 4US5A 2CYGA 4US6A 1F8MA 4ZMGA 4XIMA 3G0XA 5A6AA 4O17A 3N9KA 1E55A 4GA8A 1V51A 5DRCA 2VC5A 2CKSA 3VDGA 2AGTA 4DZAA 3REQB 1VPYA 3KL5A 1GQNA 1OADA 3RMJA 3LPGA 1A4LA 1G0CA 1VHCA 4JDBA 3BLEA 5C71A 1YW1A 4UTJA 3DC8A 1S3HA 4OV9A 5A94A 1T41A 2OPJA 4GH3A 1WAUA 5T26A 2OB3A 1NY1A 3G1VA 4U3AA 4WDXA 4AD5A 1MQRA 5EMJA 2X0HA 1W9BM 1AZ1A 4JR5A 4TMBA 3LSBA 1XBYA 1CI1A 2QLYA 4OBSA 4YTTA 1GJPA 3UYIA 3WLPA 3KUMA 4EWND 4YWIA 3VILA 1CEOA 1NVMA 3N6HA 4DNHA 5D03A 1K6WA 3EOLA 3HFTA 2W67A 2Y2WA 4R33A 3BLPX 1XLKA 3PANA 3SGGA 2B81A 1GQJA 3NZPA 1TV2A 3EXRA 5D2XA 3HBLA 3KWXA 7TAAA 3RO8A 3F2BA 4BF5A 1X1NA 1N7KA 3WJZA 2ZWZA 1PL9A 3ITGA 3MHGA 5AC5A 2B0MA 4C6PA 1U33A 4B90A 2INEA 5C6MA 3L4WA 1HJQA 1GZ1A 2XGIA 2XN0A 5LNWA 2VGGA 5C7VA 4Q4QA 5TAOA 3PJTA 3HGSA 4PA8A 4IFKA 3UWWA 1XIHA 3C2YA 3N3MA 3PM6A 3I7RA 4AWTA 3NNTA 2ZX9A 1GUVA 5HUOA 1H3GA 3WQ6A 3ARWA 4Z1CA 2NUXA 4K36A 1DOSA 3VM7A 4NRRA 3SDOA 3CK5A 3VAVA 2CZ5A 1HT6A 1RH9A 4UNLA 5D9PA 3W85A 2I9EA 1WNOA 1QT1A 3TSMA 1PZ1A 3BJFA 3N2TA 4FNQA 2CERA 3TTOA 3ZSSA 4V15A 2DT3A 5BXSA 4RCXA 4NZJA 4DWSC 1I1XA 4ATDA 4UTHA 1O5QA 3F2DA 2IMRA 4LF1A 3P82A 3SCPA 3CUHA 5FAJA 3RM4A 2ABAA 2UBPC 3GKAA 2JIWA 1SYTA 3S5SA 1QPQA 1UKTA 2VZOA 2WC4A 5I5RA 4GUJA 2NV1A 3BQ6A 4DX3A 2WXDM 2HMCA 4MTVA 1KRAC 2XVPA 1EJ7L 1EGVA 3BURA 1UWUA 1VJIA 1CDGA 3NEVA 3CZJA 3ABQA 2RGMA 2PWDA 1G4EA 4JTEA 4ASTA 1ADDA 4PTNA 4NXKA 2VI0A 5A2BA 2VC9A 1U5VA 3QHMA 1Q6QA 3P5ZA 1Q6OA 1BQCA 1XLGA 3N12A 3SUUA 4AZ5A 3FNDA 3DYMA 3GNXA 1PKMA 5G4WA 1RSCA 1TFVA 2V8ZA 1XH2A 5K9DA 5H6HA 3EWDA 2Z1KA 3G0UA 3VOIA 3LCXA 1HL8A 2A7PA 1T5AA 1J79A 3WD2A 4XKYB 4C65A 3I6TA 5CJNA 1UA3A 4NKCA 3B8SA 3EXTA 4ZSTA 3K2GA 4AIOA 2YDRA 1KCKA 2HXUA 1W1IE 3GY1A 1F6YA 3CWHA 4UOZA 4KWVA 3UWUA 4AWSA 3ZLGA 4DRSA 3R89A 2PDNA 4WLCA 3O6DA 4L7ZA 3KCLA 2PBGA 1LBMA 3PAOA 1EJSC 1HP5A 3T7VA 2F2HA 2FJUB 3NDYA 3Q94A 3N9SA 2JIEA 4U31A 1ITQA 3C0SA 1XLJA 4MWAC 3ES8A 2XISA 1E72M 1LCOA 3IARA 2NQ5A 3OZMA 5AHEA 4LEFA 2EF9A 1QI4A 4E8DA 2GDQA 4K68A 3H7RA 4G8TA 5E0KA 5AVNA 2VOTA 3NEHA 1I45A 4QBXA 2Z00A 1YYAA 4Z1BA 1PIFA 3TN5A 4FXSA 3WNLA 1R86A 2QDHA 2W66A 3M4HA 1HX0A 2FVLA 3AHXA 2EPKX 4YPJA 1NSJA 4GQ0A 2EHHA 3A3HA 3UPBA 1JYWA 3OW1A 3LXCA 4HCDA 1Y7VA 2ABBA 4LH8A 1V6XA 4YVPA 3T9PA 1QMLA 4MWAD 4XAGA 4L4MA 1LOQA 2PDYA 6XIMA 2GGGA 1J2WA 4QG9A 3LCFA 5I78A 5LZLA 2HNEA 4IPIA 4IGMA 2FIQA 2PDWA 4HZMA 1KGUA 3VNIA 5HQLA 4KCTA 3GDMA 1KLYA 1XLMA 1G9HA 1MRQA 3SR7A 2GQ9A 4CNUA 4ADSA 2WLZA 3AC0A 1YIXA 1Z32X 1RQHA 5CBIA 4J2PA 1KM2A 4I3GA 1PIIA 3V0UA 3M0LA 1IT0A 4AD4A 4CD6A 4A4AA 5C7HA 3WIJA 4LRTA 3O63A 2UY3A 3CYVA 4CNPA 3B4YA 4L5ZA 1V4YA 4QG8A 1YADA 2TRSA 3EOEA 3QR0A 3GVVA 4C6NA 1DP0A 4FI4A 4UR7A 4O1DA 2O4QA 3UF9A 2WSQA 4CD8A 3QMSA 3QOMA 2J9ZA 5AYYA 4PMJA 2YLLA 1V3LA 3KP0A 4IHCA 2O9PA 1E0XA 3LXAA 3VCRA 4JKMA 2WO5A 1O66A 4RZ5A 1BFNA 2NQ9A 3CEUA 1I0DA 4L9ZA 4J3XA 5D2YA 1E6PA 4AEEA 4I6KA 3ZVHA 3PAJA 4NZ1A 3AIBA 2J74A 4MVAA 4I90A 4IOTA 1A4MA 3QPYA 1P4CA 4K6AA 1NOUA 3JZUA 4KPLA 4M51A 1X7IA 3F1QA 3N4FA 2ACQA 2RDUA 3B05A 5FEPA 3MSDA 1TKKA 4YTUA 1EHNA 2QIIA 2RHGA 1CLKA 1ZLPA 5M3WA 2E9MA 5HWMA 3CJPA 3SN1A 3OBAA 1BQGA 4V27A 4G7EA 3W1TA 5IFTA 4NAEA 1EJXC 4W7WA 5E6YA 4JIIX 4YTQA 4R7JA 5CAHA 3VOGA 4DWSB 1QVBA 3O2LA 4U4MA 5L6UA 1W3NA 3DFHA 3NYDA 1JULA 1O6IA 2OEJA 5HUPA 2WAGA 1UR4A 3OTRA 4IZGA 4N6FA 3VDCA 1JNEA 3MV11 3T0DA 5JIPA 5G1TA 4GC4A 2VC7A 4PRWA 5C55A 4JZ5A 4C7DA 1S1RA 3QPEA 3ITVA 1GOOA 2GWNA 3U2CA 1UMYA 1A5CA 2FVMA 2J8GA 2OZ3A 2Q8LA 5CZ0A 1ISVA 4PB3A 3V7PA 1FP8A 3NPUA 3QHOA 1W2VA 4NNAA 1J4EA 3SW6A 4CN6A 4QRNA 2PP3A 4D6FA 4OT7A 3AU2A 4Q3MA 3CUFA 4KKXA 1CB7B 2X16A 4AHQA 3QGVA 1H7WA 3QV6A 1UH3A 5A6LA 4B9ZA 4NIRA 3ZLFA 2I1OA 1WYIA 1HXJA 1Q7ZA 4Q4PA 4S3KA 4OKDA 5CC6A 2Y0FA 3PBGA 2WCGA 1AH3A 3GX9A 5FF2A 3UFYA 1EX5A 3RGTA 4KH2A 1MZHA 4CN1A 2R6OA 3U0HA 3Q58A 1JZ7A 1F6KA 5CSUA 3WMBA 3WEZA 1PJ9A 2BVWA 2C16A 1YEYA 3I3EA 3E3HA 1JDFA 4IM4A 2JFEX 5FF4A 3DI1A 3ARSA 2V82A 1WA3A 1XKJA 3FIGA 2E9BA 5I3GA 4G5DA 5CCZA 5JQ9A 4FIQA 2PDQA 4ZTXA 4NQ1A 3OODA 1F8IA 3RPTA 2BLEA 2F61A 3WCZA 2QHAA 2QJGA 2E6AA 2E9LA 2Y89A 4MWAB 3N19B 2J8TA 1XYAA 2IPJA 1V7AA 3OB8A 5BXRA 2ZRUA 1SR9A 3JS3A 3LCWA 3JVAA 4NZCA 3W1AA 2YCKX 1IF2A 3S2NA 3BOXA 3HGOA 1UD3A 1TVNA 3FCPA 3QOKA 3PZUA 3N13A 1DKWA 5DCBA 2E5BA 1VCVA 4JNZA 1U5JA 3L2IA 3G0SA 4IQDA 3NXLA 1UCWA 1ZAHA 4JBRA 4NJGA 4X9YA 3S2MA 3M5VA 2NLYA 3SY1A 3DFYA 5BOEA 1JF6A 4LALA 4H6RA 3TYEA 3GXTA 4GFSA 1OBAA 3VK5A 3OGVA 2ZDSA 1QW7A 3MMTA 2ALDA 1PE1A 4M6PA 1QU4A 3VOCA 2Z29A 1V6VA 5F1UA 5HAOA 1IEIA 2F7FA 1PUDA 2AAMA 1WKDA 3WBWA 2ZUVA 3GXMA 5T91A 3F03K 4DUOA 3JW7A 3KHDA 1MFUA 1GG0A 3PZTA 4M81A 3AWOA 2FHBA 3T8QA 4AW7A 1A53A 2C1GA 1WZKA 3AZTA 3WBXA 2BGQA 4JPGA 5I06A 3KM8A 1R2RA 1IEQA 3UPWA 1UH4A 3I4EA 3OHMB 1O1HA 1EP3A 2REQA 3WDPP 3P80A 3ZO9A 2BXVA 3RO6A 2Y7EA 3VIPA 3ZJKA 5I24A 3R7MA 5FJIA 2IUZA 1XYMA 3SQLA 4QHRA 1K8XA 3WBAA 5HNNA 2HDJA 1TO3A 3P5YA 4Z2KA 1V8EA 3ITXA 2QIWA 3B8WA 2BWGA 3PFRA 4R34A 1RBLA 2Q3RA 2YCJA 2DW6A 2PWUA 3USZA 1XDLA 3WO8A 1AQHA 3SY8A 3KVMA 3IEBA 4KF1A 5IHRA 7PTDA 5DY2A 1BSIA 4WY0A 3FHAA 3RX4A 2WSYA 4NP7A 1W3HA 4UMAA 2I14A 2VRQA 2XN1A 1YE4A 4IP4A 1YE6A 3XIMA 3H4GA 2WJDA 5CSRA 5I6SA 4LVBA 2QGYA 2Z0IA 2ZVRA 4CVUA 3QPZA 5XINA 3OQEA 1RBAA 3HF3A 3MWAA 1TJ2A 3MPGA 1FXQA 2ZA3A 3SUVA 3G6LA 5IBXA 4HJWA 3VGDA 3V1HA 4AY7A 1FWAC 2JGQA 3I7SA 1ZTVA 4K39A 3IACA 3MCOA 1T7LA 1A5AA 4HB7A 1E1CB 1HJSA 3JR2A 1DVJA 5EL1A 3BDKA 1R9YA 2NWRA 3H54A 3UXIA 3A3WA 4HZ7A 3PFMA 2R94A 4K37A 1VIZA 3GVQA 4H6KA 2PLKA 3QM3A 3S46A 3AXHA 3VA8A 2VGFA 3KOXA 3CTLA 4CKQA 4QDMA 3QGAC 2VR5A 1UUMA 6REQA 4IGHA 4UTLA 4XZIA 3L4ZA 1P7TA 1VBGA 3KE0A 4UR9A 2CLHA 1D3GA 4UFJA 2X2YA 1RJPA 1EB3A 2E4TA 1SO5A 4QNWA 1PSCA 3CTTA 2VEKA 3WUEA 2P10A 4H7VA 3LM7A 5REQA 1LUCB 3RILA 1KR1A 2ZZ6A 3SUSA 4IQEA 1UP3A 2YFNA 3OVPA 3LCIA 3WQWA 1XBVA 4A2SA 5KZ6A 5BRPA 1OCNA 2VELA 4BHYA 1WDSA 4WQ6A 2R1MA 3QGKC 4GACA 3UR2A 2X1UA 3MBFA 1PKYA 2ZZ4A 3FGCA 3FLUA 3DHUA 3OJGA 1BD0A 1TR9A 2E77A 3TJ4A 2D2JA 2E1DA 4MKNA 1DWFM 1WBJA 3KCOA 2E6YA 1UC4A 3QQ1A 1LL6A 2FZ9A 1V02E 2PDLA 5ABFB 2V63A 2OFJA 3W74A 4GVHA 2V38A 1ML1A 1PKLA 5J5DA 1JDDA 4YHGA 4HOWA 4H41A 3JRKA 1B3ZA 4DQWA 3THAA 2GSHA 4Q8NA 2GGHA 4UNKA 2FJKA 2FGBA 5CZKA 4IMFA 2OELA 2HPIA 1CCWB 4J3UA 5EFDA 4B5VA 3NFUA 2AL2B 3A22A 2OSWA 1MXSA 3DERA 1CW2A 4M3PA 4AD1A 4IQJA 2XGZA 4RZBA 3SRHA 1XRTA 4H9ZA 4J35A 2R8WA 5AOUA 1V6UA 4JL2A 2B7OA 1VYRA 1ZSXA 3FY1A 4AISA 2CLMA 1EPXA 4CQ9A 1CWYA 2BGNE 4F40A 3C6CA 3P93A 2ZZ5A 2YL5A 4Q4OA 3MSGA 5A6JA 4BFAA 1TPUA 1D7KA 1EC7A 1VKFA 1G4PA 3S5ZA 5FEXA 4XD6A 4HYWA 1KM6A 2QCEA 3P81A 3LLXA 4HA0A 2WZTA 1OIFA 3MI3A 3L21A 5DT7A 4RE3A 5EMYA 4DF1A 2ACRA 3HU7A 1X8CA 2EJ1A 5BYWA 3NDOA 5DCDA 4UTMA 3DYOA 4X9SA 3M7SA 3H26A 4OFCA 2E8YA 2HZGA 2OMAA 3S1WA 4PFHA 4A8NA 2EBNA 4R3UA 1GTEA 5CZJA 4KRTA 1HKWA 1ZL1A 2FZBA 2V3FA 5JU6A 2V9DA 1GW1A 4W89A 3FJ6A 4XD3A 1K9EA 2PGWA 3Q67A 1NJJA 5FSDC 4XTDA 3R8GA 4FMVA 2GPTA 1Q66A 4XZ9A 1UC5A 5FF7A 1G1YA 4AD0A 3S1GA 1Z69A 4O11A 3CIXA 1VD6A 3VXGA 5C9WA 4Y8FA 1S5VA 3AI0A 3PZOA 1XHGA 5H1WA 3UJRA 5JVLA 1R3VA 3VNLA 3M0VA 1EX1A 2A3HA 2DSKA 4WHBA 4ALDA 1RY8A 4U28A 1VYPX 4AYSA 1OYBA 5I3IA 1IZJA 1IEWA 3W53A 1HF6A 4UTIA 4LYPA 3IANA 2V5JA 2VR4A 3O8AA 2Y62A 1YDYA 4ICCX 2DZAA 5EU9A 3SQMA 1OD8A 3IIPA 4IP7A 4JYEA 3R79A 3TC7A 4LB3A 1CYGA 2POTA 3LG3A 2OG9A 4NT0A 5FJJA 4TV5A 5A8QA 3GG0A 3UR7A 3WELA 4AHPA 3A12A 1OT2A 5C70A 3HPXA 4FK9A 1M7JA 2BHUA 4F0KA 1P5BA 3CHFA 3KOFA 3W70A 3MUZ1 1SZFA 5FJUA 1Z89A 2Z1BA 3EYPA 2BS9A 1IR2A 1Z9AA 1M53A 4JTAA 1Z3NA 2AGKA 2Y5JA 4AZ7A 3WENA 1QNQA 3VNKA 1M04A 4LXFA 3W6YA 5F1VA 3UR8A 1UUQA 3CT2A 3OLIA 2B31A 3I68A 3NTYA 3BXWA 1YX1A 4GXMA 3C0LA 3HA1A 3TK7A 2PSNA 1DJNA 1REQA 3OLEA 2WBGA 3CZEA 4YXGA 3U5UA 4AUBA 2JKAA 2J8FA 1ZBKA 3EMZA 1V93A 4D8ZA 4QLLA 4XIAA 1E70M 4PTXA 3S4TA 3ZQ9A 1YTEA 3TYCA 3W28A 2E09A 3WBYA 2WPBA 2DZPA 3E0IA 1FRBA 1MUCA 2VZVA 4HNCA 1XM3A 3DH7A 1ZJBA 1K03A 1V6TA 4N6EA 1EQPA 1A5SA 3VC6A 2INFA 1H09A 4EPBC 1LYXA 1A5MC 1PAMA 2FDSA 4XSMA 3L0NA 2HNHA 4ZZ9A 2OXNA 2OU4A 1R46A 5AKQA 3MS8A 1Q13A 3S6TA 4XG1A 4B91A 3WD4A 2PCQA 1NFPA 5A6SA 3SRFA 1ZP3A 5DQPA 1R2SA 3NSXA 1QWGA 4DNMA 4NX5A 1S5NA 4W8BA 1LT7A 4WY0F 3M41A 3BMXA 4GQRA 1WCGA 2VZSA 3QVQA 3AMCA 1VFOA 1E73M 1XLLA 1SPQA 2Y63A 3ZSTA 3ARQA 3UWYA 3W7GA 1TPDA 1I2OA 5E0CA 3URNA 1AL7A 4R9OA 3CB3A 4JX6A 3UR5A 1B4KA 3KOZA 1H7OA 5BMWA 1GVFA 1TG7A 5G5IA 4C1LA 5ABEA 1TA3A 2H8ZA 2HXTA 2ON3A 3MO4A 4HU3A 1K02A 3UD6A 1FWEC 4O1CA 4PUNA 3BAWA 2Z2AA 2J7BA 2H9AB 1ISWA 1DJHA 3G1AA 3O05A 3MVIA 4NG3A 2GJPA 3VIHA 2ZX8A 3A3XA 1K9DA 1ZJAA 3DC0A 2IKHA 4YNGA 2QMKA 3O16A 1FTXA 4I5UA 4Y9AA 1O95A 3NIYA 3DN5A 1JJKA 5FKYA 1RD6A 3GIQA 3U4AA 1O12A 3WK1A 4D6EA 4KRUA 2C7FA 2QULA 1E6NA 2J6XA 2G41A 1A5NC 2WSPA 2J9YA 4XD5A 1D3HA 1YDOA 2XIJA 2Y70A 4J27A 4OUEA 3EB3A 2QS8A 1KXHA 4WZHA 3TYZA 4JEJA 1EDTA 4P5UA 3THUA 2RUSA 2ZTJA 1FP9A 3M43A 3TYDA 2VDGA 2HVMA 3RR1A 4S3AA 4M6VA 1LRTA 4QQUA 2E67A 1MDLA 3IJDA 4L61A 3BSGA 3F5LA 4HK6A 1GGOA 1OIMA 3DENA 1YDVA 5G1YA 3B3DA 2Q8XA 2XFFA 2AKZA 2YJQA 4LGXA 3TYAA 3RLGA 3TFCA 2TMDA 1WOAA 3LPPA 2J78A 1M7PA 2A79A 5C9RA 3KXQA 4JY8A 4F8XA 4DYJA 3PWAA 2XIOA 4E4PA 3NG3A 2IQ0A 2GVYA 1HTIA 1AZ2A 1JVNA 2QDEA 4QROA 5BWAA 2CNCA 2QKFA 1NOWA 3Q37A 3A9BA 2PCEA 1NDYA 3EA2A 4HA1A 4D1IA 5BZAA 4MNLA 3MQTA 3URBA 3U3HA 2WCSA 2D2HA 1XIIA 3MKKA 3E1F1 3ARUA 4MZ8A 4S38A 4AZGA 1GZJA 4BI5A 4OOUA 2XH0A 4JCLA 4E3VA 1P0BA 3MJYA 2Y7FA 2CWNA 2VENA 3NQ6A 3MUXA 1WBHA 1OGBA 5MKGB 1S39A 3N17A 2I57A 4HSNA 2VGIA 3LS9A 2WANA 2QZRA 4WEVX 3SECA 3TN3A 4PC8A 4LUSA 2ZXAA 2ZUMA 4L56A 3WQVA 4TR9A 3L9CA 5DMMA 4TXEA 4IMAA 2DU2A 1KBIA 2WCAA 2WNWA 1SJDA 3EPMA 3RPMA 4AWUA 1DQXA 1BWVA 2EKGA 4Q33A 2ISDA 3L0GA 3C2VA 2WNNA 3PK7A 4IFKB 3CYJA 3DDMA 5FF3A 4NNCA 2A3BA 1UJPA 2PGEA 3VUPA 2XIIA 3KBSA 4H8HA 3VDBA 1OX5A 3C86A 1Z7AA 4PMXA 3PZMA 2D1ZA 1F3EA 5HPOA 1J9YA 3BG5A 4J9JA 2R9RA 1EUNA 1MRAA 2ZX7A 1H5VA 4F79A 1KGXA 1VQTA 7A3HA 3CZGA 1M6JA 1CGXA 5G4HC 3CXOA 4CCZA 4UQAA 4RW3A 1N2VA 4BK9A 4I7VA 3ARPA 4WJEA 3OGSA 3KS6A 4B5UA 1WZLA 3GNDA 2J7FA 3M47A 1TVPA 1A49A 1T99A 1UD5A 2G37A 2W9MA 1JCLA 1XIMA 1BGAA 3M0XA 5KEZA 3T78A 2Z1SA 5I3DA 1CX9A 4WDWA 4DJEA 1Q6DA 2DSWA 1PB0A 4U10A 2ATMA 2DORA 3W6MA 3ANUA 2FTPA 3PJXA 4GNKB 2OYKA 3LBCA 4TVCA 4RXFA 3NXFA 2WM1A 1ZUAX 1XH0A 4NAFA 1S2VA 2A5HA 3NOEA 1XCWA 1C90A 3AISA 4OVXA 4IX0A 4WCJA 5DEZA 1UZDA 1XRFA 4W85A 3SCUA 1F74A 4MY8A 1W17A 4JTIA 5AZ1A 4IL0A 8XIMA 1EZ2A 3NZRA 1XV8A 1EXBA 3SGZA 4JIRA 4JY9A 2G3NA 2FKPA 3RRAA 2HVOA 3SCNA 2OGYA 3W84A 1HJXA 3SCQA 4MUZA 2VX6A 1F73A 2X42A 4XUGA 1B0IA 2VVNA 1XQKA 4IX2A 2I9UA 4DXKA 1B3VA 4AY1A 5ECVA 1QW9A 3K8MA 3S2CA 3GVWA 1PV8A 3KVJA 2XIMA 2Z7KA 3BCJA 2PDXA 4RNFA 3VDAA 3W7MA 3W75A 4QFUA 2O7SA 4D6GA 4ZQMA 1XC4A 1SW0A 2Q09A 1LQAA 3PTMA 3ARXA 1KM1A 1TV8A 4GGHA 1OFQA 3I10A 2QUMA 1JPDX 4GMEA 4RLIA 4YYFA 5KINA 1NF0A 3I65A 4GC3A 4C6IA 4A3QA 2INZA 3TXZA 3KRZA 3SIMA 3WDRA 3KDNA 1FHUA 4RUBA 4JKKA 4G56A 3USBA 1W9DM 4O1BA 3W7DA 4JKLA 3B9NA 2CWXA 3CL6A 1C9WA 1TV5A 4LT9A 3TONA 3WH5A 3VGEA 5D09A 3G1XA 2YGYA 2YW3A 2V2CA 3II1A 3UWZA 1HVQA 4DJFA 5D02A 1GPWA 1N82A 1V3KA 2ISVA 4LY4A 1MW1A 5AHIA 2GQ8A 4MJ2A 1R9ZA 1UG6A 2QPXA 4TUFA 3STFA 2Y8VA 2F8QA 1P0KA 1F7BA 2FPTA 3PZNA 3PP7A 4BF9A 1G67A 3EKZA 1UMLA 3F4WA 3T4WA 4LCQA 1E4MM 3OO2A 3AUJA 1ZQ5A 3SCOA 4QITA 3SFWA 2KAUC 3EEGA 3GFYA 5K2ZA 3KLLA 1SJAA 3QLDA 2WZHA 4XSLA 4QQ3A 5K4ZA 3W2LA 1GWJA 2Y6ZA 3UVAA 1M7XA 2R1PA 2HE8A 5C2XA 2BODX 1VBJA 1A0EA 4GYJA 3B04A 3GIPA 2JKPA 3W00A 4EKJA 3T07A 4PMDA 1JCJA 4KEVA 1JZ4A 1Z42A 3NURA 1WKYA 2WNQA 1YTDA 1QI0A 3LB0A 5HNTA 2OQHA 2CLIA 3QFWA 1V0KA 4WVXA 3OBEA 3RAOA 4AIUA 3WK2A 3ARZA 3VMOA 4Y7EA 1QXLA 3AS2A 1QFEA 4X0NA 3W01A 4IPNB 3D6NA 1HN1A 6PTDA 5K3VA 3R5EA 1LM1A 4B4HA 3L66A 4Z0SA 3GG1A 4W87A 1FWCC 2QCNA 2BY2A 5K9CA 3A13A 3EMCA 1W9XA 4AC7C 3K8LA 1JFHA 5AYXA 2ZZ2A 2X1SA 4XWUA 2WC3A 4UZUA 4GCXA 1HP4A 1IIHA 2OT0A 1ZFJA 2DIKA 4QJ1A 6ENLA 3RMEA 3QKEA 2V67A 4N02A 4LCSA 1MVYA 1I8JA 5I2UA 3MSYA 3XINA 1GJUA 3DBPA 2D20A 4DF0A 3I3BA 4E2DA 2YDAA 3L65A 1MZRA 3ZVHB 1A3WA 4W88A 4D8AA 4JTJA 4JD4A 5L9FA 2QPSA 1UPMB 3PBMA 3F2CA 1GZGA 3VKBA 2P50A 3PN8A 7TIMA 2HS6A 4HP5A 1SGJA 2QVNA 1HFBA 1SJCA 2O0TA 3GR8A 1H41A 5LA0A 1OZQA 4AEOA 1DIOA 1KBJA 4IIDA 1HGYA 3UNTA 4GI9A 2W92A 5FJTA 1JD9A 4G7EB 2WWCA 4NAEB 2VURA 3MWCA 1PEZA 2DVUA 2WZIA 3GU2A 4DXVA 2ZRYA 2WMGA 2PC8A 3UG3A 3L2MA 3TNOA 3L67A 1ZNNA 1X1OA 3GNRA 5IBXC 3I6EA 2Z2BA 4Q8TA 2CEQA 1QUMA 5I7GA 5T9CE 4PRTA 5A8NA 5AN7A 1KQYA 3LHUA 2HISA 1J8VA 1S38A 3S83A 4QGCA 3KAOA 2C8NA 5G2WA 4K1WA 2IW0A 4M29A 5HWJA 2IXVA 2IQDA 2QUVA 1DJQA 1V6YA 5IXEA 2DUXA 3AMLA 3DBNA 2EG8A 4JICA 3R13A 3T2PA 2G4FA 5CG0A 1W1YA 4BQ5A 3G1RA 5EMKA 1A5BA 1IT8A 3LTSA 1VEPA 3DHDA 4Y6GA 3HQOA 1AODA 1SZEA 2PTXA 4NX0A 2ZRVA 5LKYA 1JR1A 3GU9A 1JCMP 3WQ8A 1XL9A 2OZ8A 2X7WA 4S3CA 5F4SA 4N4QA 3U48A 2ADAA 3FAWA 3FEMA 3QV8A 4HU4A 1XRVA 5JMUA 4XAYA 2QJNA 3TR2A 3MHFA 4F2UA 2CW6A 3TU9A 3MYOA 4G1NA 2JEPA 3GB6A 1WDRA 1FFRA 1DHKA 2XWEA 2YCLA 5IDZA 3ABZA 4BCEA 2V5LA 4PTDA 4XO7A 2OWCA 3HTWA 4GQGA 4JTKA 3WNNA 1KR0A 4IG2B 7REQB 2FYMA 5HK4A 1ZGDA 5I07A 1NM9A 2PWHA 3AWNA 4V28A 3H23A 3HPZA 4HSOA 1QK0A 3NZQA 3S6DA 3TFXA 1KD0A 5M1TA 4DLFA 5HOSA 4X3ZA 2Q71A 3A4WA 1TUXA 3O3RA 1OK4A 3QKZA 4I9JA 3P67A 5MF5A 2QCMA 1OQFA 4ICNA 1KNWA 5A8MA 3E0LA 4S3DA 5CPLA 1GHRA 4M6QA 1ZZMA 1R47A 1UD6A 2ZRWA 1BRLA 2P0OA 2G3MA 1YPIA 3TTQA 1VCGA 4HMEA 1V5XA 1BAGA 8TIMA 4I7UA 5K4XA 3BC9A 1PTAA 4HPNA 3W38A 2H90A 3UJ2A 2OZTA 5KZDA 4A29A 2CHRA 3DEQA 1E4IA 2WJEA 3NO5A 4CNOA 4KGLA 3W22A 4NJHA 4FXRA 1F05A 3W7RA 2NQZA 2PS2A 2ZVIA 3CZ8A 3CAVA 3QSRA 3HPSA 5DBUA 4JYFA 3UEQA 4IP5A 1J0YA 4E8GA 5KTLA 1JEZA 5E70A 2XGBA 4C6QA 4RK8A 3EB4A 3R8HA 3LLFA 1KFBA 1JYNA 3E49A 3Q4DA 4PUUA 1SO3A 1AW2A 3U8GA 3RM9A 1K7XA 4Q8VA 2V6AA 5HQMA 2JBMA 5EA9A 3PZGA 2AKMA 2FZMA 4TTUA 1HO4A 4ZB2A 4GUFA 3GXNA 1LT8A 4W4QA 2ZYFA 1ISXA 1A3XA 1KXTA 4KEZA 1VRXA 3WY1A 4AH7A 1JCYA 2HBVA 5LNUA 1E6ZA 4ZVJA 3WF2A 4RE4A 2PB1A 4NRSA 4P2VA 4I5XA 3TWAA 5TQLA 3CZKA 5EB8A 1EYEA 4FOUA 1W3LA 4O53A 4O8RA 2DZWA 3UA3A 5GNXA 4ZTYA 1ICSA 1YPFA 3WLHA 2OSYA 3HPAA 1TSIA 2CKRA 3PZ9A 2GJNA 4XTIA 1C8QA 3BVJA 2WKLA 6A3HA 3FVMA 4D6JA 4KERA 3AROA 2OYMA 1HNYA 4Y9PA 1LRQA 1MXGA 1XBZA 4R85A 3VCCA 4IMEA 4ZGYA 4MSSA 2W63A 2UY4A 2OLSA 1W3KA 1J10A 4J3TA 1H11A 4P7LA 5CPNA 2QCDB 4Z0JA 3CMGA 1DJXA 2G5WA 5D33A 1VEOA 3WG6A 5H8MA 2Z1VA 1XLAA 5D2VA 3E96A 3A4XA 2GQAA 4H01A 1SJBA 2J25A 5DRIA 2OWXA 3EX2A 3HG3A 1BKSA 1SZRA 4C60A 3TAOA 3WEMA 3N3TA 1JIBA 1TTPA 3KTXA 4BEQA 1XW8A 3TTSA 3ABOA 5TBOA 5KZEA 1BYAA 3IPWA 1MO0A 8A3HA 4IWWA 3V18A 1G4SA 3L5AA 2J7GA 2FH8A 4I9TA 4PB4A 4PCPA 4L65A 2BV9A 1DJIA 3W71A 3M07A 3O6CA 2XSXA 2NT0A 2NSXA 4H8UA 3F7JA 2X40A 4HPGA 3BGAA 3AICA 4GZIA 1IT7A 3ITOA 2Z7GA 3KZPA 4C6BA 5D38A 3K4AA 3DKJA 4RW5A 4MNJA 3DAQA 3U2EA 1DWAM 1IEVA 3UZYA 1C8XA 4HCHA 3SZ8A 2C3ZA 5AHLA 1C29A 2W27A 2CIPA 3K1GA 3WUGA 2EPHA 2ZTKA 5C9ZA 1KV8A 1OX4A 4ONVA 3FGCB 1EHAA 1I0BA 4N42A 2VWTA 3LTYA 3H4XA 1OZMA 4S3EA 1WDDA 5ABHA 3L4VA 1C8VA 3ALFA 1GOXA 4I7WA 3BG9A 2HTMA 3W76A 3PTQA 3H7UA 4KCWA 1PVNA 3EWXA 3VD7A 2YCIX 3MA8A 1QTWA 3LHZA 4QE4A 2JE8A 4B5TA 3N4AA 4H9UA 4AIBA 3GR7A 1DJZA 3SJNA 4GJIA 1UW9A 2A2IA 3AU6A 3PR2A 4DHGA 4DXXA 3Q65A 5DELA 1GQLA 1NDVA 1J18A 1J0JA 2VP8A 3B9AA 3CC1A 3NQVA 1K8CA 1AD1A 4UFIA 3MMUA 3H53A 3VABA 3M0ZA 3S3GA 1RV8A 4KEMA 2FGZA 2GFTA 4HCLA 4PRRA 3MJMA 3T42A 2DV0A 2XH7A 3WJXA 4MG4A 3HQNA 4L1XA 3MW7A 4PUJA 4Y96A 3UWQA 1G69A 3MVTA 4D72A 1E4NA 2BHYA 2VC6A 3IGHX 3UZZA 3VCNA 3VIGA 4UR8A 1NQKA 1B30A 4OGZA 3CHVA 2UWFA 4FAMA 5EBAA 2WKGA 1X97A 4ATWA 1AW5A 4B5XA 1ZALA 4N9DA 3ZM8A 4O16A 2WMIA 2NX1A 4Z2LA 4A2RA 4DBSA 3G8EA 1GYMA 5EKYA 3OOQA 3TP4A 3SADA 4K8GA 3QR1A 1W56A 1CGVA 2FFCA 3O6YX 1QASA 1KM0A 2NW0A 3GFXA 3EDJA 3W72A 3WLQA 3IIXA 3ZJ6A 1K7EA 1QATA 3DGRA 4JFUA 4RX0A 1QPKA 1FWRA 2O92A 3UESA 1W9VA 5H2ZA 4KESA 3ICJA 4L64A 4RKAA 4LS2A 2WVVA 1EWEA 2FH6A 4U3CA 4FB7A 1RK6A 3WQPA 4FX8A 5A6TC 5HMFA 5HNRA 4C6FA 1MFVA 3QZAA 1GOWA 3KEHA 1XYZA 1G5AA 1OFPA 4AD2A 2VJXA 3RRXA 1OABA 4MPQA 1OFOA 3IUDA 1UBSA 1BPLB 1R9XA 2GUUA 4CQAA 2NQJA 2OKOA 3KRSA 2YXGA 3EX4A 4RDZA 2BFGA 5HDRA 3W9ZA 9CGTA 3LRLA 4GKTA 3OPSA 3MKCA 1CENA 4HT3A 2GVJA 4O28A 2YL8A 4AF0B 4GE8A 3DG6A 3CZLA 5DX7A 1A5KC 3C52A 3TN4A 2PLCA 3H2FA 3N4EA 5BU6A 3GH5A 4FALA 3N29A 2BG5A 1CLVA 2MANA 1RCXB 1YBQA 3CO4A 3RCMA 1RUSA 5C9UA 3V5OA 1L6FA 2OX1A 4IUGA 4OOZA 5BW6A 4FNTA 5M5DA 4WSKA 3S5YA 1CGUA 5LHEA 4K7VA 4WDTA 1CPUA 3REQA 4PMVA 3EXSA 4DO7A 1HKIA 1UUOA 4LAZA 3F4CA 2XIQA 5JIWA 4AZ6A 2POZA 3MYPA 2BX7A 5FL0A 4C5YA 4JTRA 1XUZA 3GBEA 4PUMA 4WOQA 3SCTA 1PS9A 1DTNA 2FTYA 1W8SA 6CGTA 3KZSA 4JQ3A 2Z25A 4UIOA 1SFJA 4PN2A 2RH9A 4UFHA 4F0LA 5ECUA 5A8GA 4LEQA 1E56A 2QT3A 1REQB 2DW7A 4JTLA 3FK4A 4L9YA 3BE7A 2XH2A 1RVGA 3AS1A 5LIUX 3F4NA 1ME7A 3CT7A 4DBWA 3WQ4A 4HA4A 4JQ2A 4H00A 4UTWA 4HPXA 1POKA 3B8TA 3VZXA 4LUYA 4RV8A 4UMCA 1GKPA 1AH0A 1ZBCA 4Q4MA 4UQBA 4UTKA 1GORA 2WWDA 4JXCA 2OOGA 3H2MA 2PDGA 4BS0A 5CGMA 1W5NA 2CLFA 3KFTA 1GOQA 2R1KA 1M01A 4O57A 1H61A 4HSHA 1J12A 2G96A 4RZ6A 1R8LA 3GNNA 3M6YA 3NDZA 1RPKA 3M5YA 1XLHA 4GISA 4DJEC 2W0UA 3MCMA 4IICA 2C71A 4IQLA 1EA9C 2Y8UA 1CECA 3IV8A 1ZPTA 3G2GA 5D9OA 4Q7IA 3R0DA 4E2BA 3GDLA 2CU0A 5TD4A 3NUKA 3EWYA 3FA4A 3ZT6A 3L4YA 1V03A 4HKPA 3O06A 4WJ8A 2DZXA 3CV7A 3BW4A 4BWLA 1F4AA 3BLIA 2V81A 3LBMA 4MZ1A 4Y9MA 3R4IA 3K13A 2W62A 1EH9A 5GNYA 3SCSA 2X0YA 1ECEA 1CTNA 2YL6A 3FJNA 3I3DA 4ICMA 1CZ1A 1TPC1 2AMXA 3R10A 4LNCA 3RX3A 1UIPA 3LGDA 2CLEA 4DWDA 5HPCA 1UPPA 3LHVA 4DBEA 2BOGX 1FCVA 4OE7A 2A85A 1SMAA 4N4PA 1XSIA 4W8AA 3W81A 4M5PA 1VFHA 3RHGA 1ONWA 4XVDA 5EY5A 1EIBA 4IJRA 1FDZA 1M1BA 1FX6A 1F9CA 1TQJA 3FA5A 1UP2A 3AYVA 5DCEA 4DYKA 4ORMA 4KIRA 5FL1A 5BCAA 1MW2A 1OFBA 2VOMA 2IPGA 3POHA 2G4JA 4L1GA 4YVXA 2WQDA 4IPLA 4H9YA 3N2OA 2NQHA 2E8ZA 4W5ZA 4X63A 2FLIA 3WJYA 1EC9A 3BG3A 2A6LA 4E4FA 4Z1DA 3NQAA 2RDXA 3IJ6A 2QAPA 4H8VA 4DJFC 1Z48A 2BASA 5FAGA 1AQ0A 2ZE3A 3TJXA 1BVWA 4O8AA 3CAWA 1UZ1A 3G6MA 3FSTA 3QQWA 3O7UA 1H1YA 1H1ZA 3I6RA 3VOHA 4B2DD 4WR3A 3BMVA 8CGTA 3LI1A 1PKNA 1TRIA 3SUWA 1PBGA 1ISZA 3ZIZA 1K8YA 4GHRA 3L7RA 3W7PA 3DOPA 3GHTA 2WOQA 2Y7GA 2QEZA 2Y5SA 4FLQA 1TWDA 4LNYA 2PD9A 1ICQA 2Z27A 3FXGA 3N9RA 2ZUWA 4ZCWA 3OYXA 1A3HA 3WJWA 3VPLA 1DXEA 4JN6A 2QAFA 1NTHA 1C7SA 2ZZ1A 4XZHA 1SFTA 1J0IA 4AHOA 1JDCA 1VB9A 1R3TA 1BF2A 4CGTA 4K38A 3TEVA 4BF7A 1BSLA 1PWLA 2CZVA 1RPXA 3VMPA 1RP8A 5IDIA 3PPHA 4GX8A 3LPOA 3UXAA 1ISYA 3NQDA 2G95A 1ZS2A 1OY0A 3H6OA 1SR0A 2HSAA 1PCKA 1H0IA 3N34A 4XZWA 1XBXA 3G1SA 4E5TA 4MKSA 1R3WA 2VX4A 4AZBA 2MUCA 1TX0A 4K1GA 2ZADA 1PTDA 2I17A 3NQ8A 2UV8G 1GKQA 1ONRA 4XUYA 3WN6A 4PMUA 3B8UA 2QDGA 1J93A 1R6WA 3DESA 3LV6A 1QBBA 3INPA 5FSEC 2ZDRA 3TIMA 2YYTA 1LTDA 1J96A 4GZEA 5CPOA 3SCWA 3EMQA 4UCGA 1OWQA 3SCRA 4H8NA 3QY7A 2OX4A 1P1XA 2VR2A 1I1WA 3EPOA 3Q2DA 1RQBA 3IJQA 5IHSA 1JYXA 4FXJA 4F2TA 3UG8A 4ROPA 1UBPC 2VHLA 2PDPA 4ZSUA 1OFAA 3OVGA 2CESA 3L5LA 3SFKA 1OF8A 3NA8A 3UU0A 4J1OA 3H2NA 2NWSA 2PDBA 3O0FA 3STEA 2I7GA 2HEJA 4JX5A 1VH7A 3OA3A 1E43A 1UR9A 3WLLA 2P76A 1P0NA 4L1WA 3PZVA 1ADSA 3GXFA 1KFLA 1Q7QA 4PMOA 2HK1A 1XS2A 2AQVA 3PB2A 4DUWA 2FDMA 4XAPA 3W7IA 1JCNA 1I2RA 3N25A 3VGBA 4JN8A 5EGRA 3LUTA 4EP8C 3W2MA 2DEPA 3MP3A 4OQVA 1QI2A 3NAVA 2BZNA 4FX6M 4LQ1A 5I3FA 4UQCA 2CLPA 3IVTA 4BI6A 3OG2A 1IWBA 3JU2A 3IK4A 2GDUA 4QLJA 1OM0A 2W91A 2XYLA 1EJRC 4NAFB 1GTHA 4JIQA 3WDHA 3H4WA 4JTGA 3V0TA 5AHFA 1QPRA 2VD8A 5XIAA 2E25A 1JRBA 1NP2A 3ABSA 4QISA 3SSZA 4TQTA 2C15A 3NQBA 1KFEA 2A1YA 5AVHA 1U2YA 1HIZA 2ESCA 4K8EA 5D32A 1UOZA 3VD5A 3KBJA 3YPIA 3CHEA 2PA6A 4BI7A 4C6JA 1LWIA 3WMSA 3ABXA 1BXCA 3B9DA 1QHOA 4UNIA 3N6JA 2HQAA 5DT5A 4HK5A 4WUIA 4IJCA 3WNKA 4DWSA 4CD4A 1TIWA 1HL9A 4NL1A 3RITA 1LJYA 1TX2A 4JNYA 4DWSD 2D2OA 4FF5A 5AC7A 2X1IA 5J5RA 1NFBA 2GJXB 3PNZA 5IM51 3SURA 1BGGA 3DCPA 1VENA 1UD8A 1VR6A 4R27A 3RF9A 1EBHA 3PTDA 3LMYA 1JZ3A 1AH4A 1XISA 2ODOA 2C1IA 5A8PA 1HKJA 1X7FA 3ZS4A 1C91A 2Y7DA 4PEKA 1TUFA 3UY8A 2D24A 5LSMA 2TODA 5XIMA 3UXKA 4B4FA 4S3BA 2V2DA 3RU6A 2DZBA 2VFGA 2ZE0A 1QNRA 2PRHA 1XYLA 1AQFA 4GGBA 3R8RA 1VIWA 2PDMA 4FNRA 3QLLA 3DGBA 3CUXA 4B16A 1CB2A 4HHPA 4LUTA 4UOQA 4R53A 1EYWA 4OTKA 3E9AA 1JXJA 4LYRA 1ZAIA 3FYPA 3LI0A 3T05A 1Q6FA 4LC6A 4W9TA 2V3GA 5D04C 3XISA 2ATSA 2WV8A 3LGEA 3UCCA 3WZ0E 3CPRA 4S3FA 4PBGA 4FEZA 1JG9A 1W2PA 4BZYA 5U7SA 3VINA 3C5QA 4Q4RA 1S5MA 3CASA 1RCOB 1J6PA 4AZCA 4IXHA 3BW2A 4GUGA 2TYSA 4GBDA 4DO5A 2XN2A 3W26A 4D6IA 3W4RA 4MWAA 3DHPA 2WZEA 5E9AA 3TMLA 4Z1AA 1OYCA 2X8RA 1X39A 5H8PA 1EDGA 1EBGA 4IIHA 3URAA 3NL2A 3CQ0A 2PP0A 1VHNA 1GVEA 4HU0A 3S6OA 3ITTA 4LB4A 4WIWA 2W3ZA 1I9CB 1J01A 4J3WA 2GSJA 3RM8A 2DGAA 3O0KA 1TZ9A 3AHYA 4HYRA 4LJ3A 3S1UA 2VXNA 1FVPA 4MADA 4GIRA 3DI0A 4QTGA 5KZMA 2NVAA 3TTEA 1BTCA 4GNVA 1RA0A 2YBVA 3K5XA 3IV3A 3TQ0A 4HOXA 3IAPA 3DG7A 4M8UA 4QEHA 3RUBL 3IAQA 4JS3A 2YXOA 3OU8A 4MB5A 1PCWA 3P7YA 4AG0A 1OC6A 2I16A 2YOCA 3GW3A 3ONCA 1CNVA 3GZAA 4EVZA 2ZKMX 4POCA 1GOIA 3KRUA 4J3ZA 4EXQA 3PG8A 3QTPA 1UWRA 4G9PA 4HNNA 3CQJA 4YS1A 4M24A 4GUHA 4MNKA 4CD7A 2DT0A 4HNVA 4JIPA 4LOCA 1JXKA 4BA0A 1TQXA 2PODA 2X09A 3UYCA 1TPB1 1EO7A 3TXVA 1FY6A 2DDXA 3B0XA 4JIEA 3FAXA 2IKJA 1F6PA 2RGLA 4FR6A 4S23A 4ZXLA 2Q8ZA 2VNCA 1B9BA 1LP6A 2QGHA 3D0CA 1S1PA 3AIWA 3CU2A 4L4PA 5K7JA 4KCVA 3CUJA 3S1XA 3GYEA 2GGEA 1TIMA 4KWUA 4HNUA 2YB4A 4KMQA 2XJ7A 4YTSA 3C61A 4QNEA 2AQOA 3A24A 4IMCA 2BXZA 3A47A 4TMCA 3SRDA 2OCZA 1ZB5A 2V69A 1UR2A 4JNMA 3DZ1A 3RLVA 1W1PA 2J27A 2ZBTA 4GO9A 1UWQA 3NM1A 1F07A 1Y5VA 1WPCA 2PDKA 3WQFA 2B4GA 1KB3A 4PH6A 1V79A 1EDQA 4OV4A 2QQ6A 2ZQ0A 4C1KA 3JZEA 3FKRA 1J2BA 2L5HA 1TYGA 2FHFA 3CQKA 2NUYA 3PTKA 4GYFA 5GNZA 2H3DA 4YTRA 1FCBA 3HFYA 3MB9A 1DTUA 3P74A 3KX6A 3G24A 4LFYA 3T8LA 2C0HA 2O9TA 4HHHA 1XGEA 1LOLA 2GVLA 3WLTA 3GYCA 1NF7A 1BG9A 4GI4A 4GRSA 2QDDA 4S2BA 1LLWA 1E6SM 3EOOA 3UZWA 4LVAA 1M68A 2V5KA 2AMGA 2VDHA 3UT0A 1Q6LA 3C3UA 1Q5MA 1W3IA 3RYSA 1KFKA 1AD4A 1FXPA 4DELA 3K4DA 4IIBA 3AS3A 1KCLA 2YCLB 1E51A 3K46A 4NY2A 3VIFA 1TWZA 4G6CA 4AEFA 3TV8A 2NXIA 1VS1A 2VL4A 3TMQA 4TX9A 4AZIA 3WSUA 4PSRA 1TPEA 5HATA 1HUVA 1QO5A 4A3UA 3SO7A 5CC5A 4UBPC 1NWRA 4PUKA 4LUJA 1G7UA 3C8FA 1DIKA 4QE5A 3SSJA 1JCXA 1TPFA 2ZC8A 3C2EA 1EPVA 5I09A 1IHIA 3GVRA 2VCCA 2CITA 4FNPA 2GUYA 1R3SA 5E9XA 1FWDC 1VC4A 3QXBA 5B7YA 1GKRA 3FJLA 4PMRA 1K9FA 1T8XA 1QR7A 1R3YA 4IGSA 3BPWA 3VE7A 5JBFA 3LEPA 2DJXA 3GH4A 1IE7C 3R1ZA 4UTFA 5I77A 3W82A 3UW6A 2QV4A 4QX4A 2OZ0A 1XH1A 4HPHA 3S9IA 4DO4A 1W8GA 1IYXA 1RR2A 4EX4A 5IOBA 2D2GA 3TQKA 4PTWA 1CLXA 4XISA 3W7QA 3VIMA 1B3WA 1IZCA 1ZU8A 3FV9A 5DMYA 4KWOA 5ABFA 2HJPA 3BJTA 1LG2A 5HJYA 1JUBA 3UJSA 3T44A 1ZJIA 3IGXA 5EFFA 4J3SA 1XLCA 3R6IA 4OZOA 4IH3A 2OOFA 1RALA 3MV01 1JI1A 2BHZA