1G69A

Thiamin phosphate synthase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
226
structure length
226
Chain Sequence
HGIRMTRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQEDANAKEVRAAIGDMILGVAAHTMSEVKQAEEDGADYVGLGPIYPTETKKDTRAVQGVSLIEAVRRQGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKTGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the enzyme-substrate, enzyme-intermediate, and enzyme-product complexes of thiamin phosphate synthase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords THIAMIN PHOSPHATE SYNTHASE
total genus 79
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.5.1.3: Thiamine phosphate synthase.
pdb deposition date 2000-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1g69A00
3QFEA 3NM1A 4ZQNA 1X6UA 3BGJA 1W8SA 3PBWA 4PFMA 3NOEA 4PH6A 2VEMA 1QOQA 1NVMA 1SZEA 4LWWA 3S5OA 2ZDRA 1VRDA 1TTJA 1Q3NA 1TIMA 1YPIA 3B4UA 5KZEA 1OX4B 3WJXA 5CSRA 3W84A 2QCCA 5TQLA 1H50A 3LLFA 4FEZA 5AC6A 1W37A 1XDLA 3TX9A 2RDTA 3LTYA 1AL7A 2OZ0A 4PEKA 3S9YA 5HR6A 3CB8A 4XZ9A 3S1VA 3GLCA 2PE4A 1UBSA 3KVLA 3BW3A 5LZLA 4GUJA 4JTHA 3N9RA 4XBSA 4PA8A 1SR9A 3STEA 4R33A 2DJLA 2V0TA 5DY3A 3I68A 2WNNA 4RZ4A 3DFOA 3O6DA 3F03K 4O1CA 2CZEA 2V9DA 3WK3A 3W70A 4NVTA 3VE7A 2E09A 5LGZA 2QCMA 3LGEA 3QMRA 4Y96A 3T7VA 1IIHA 3RK8A 3UWWA 2WSYA 2B0MA 4FF7A 4OHQA 1OVDA 2FQIA 1JCYA 2E68A 1W3IA 2YGYA 1KV5A 4O1AA 4K39A 3PM6A 3QYQA 1OABA 1GOXA 1VR6A 3W7HA 4O53A 3QPZA 1VLWA 1OFEA 3W71A 5DELA 1ALDA 1KBJA 2YW4A 3VCRA 3TJLA 1UCWA 2CZ5A 4XUGA 2VC6A 1YXDA 2FPTA 2DU2A 2JK2A 5DBUA 5T26A 1LLWA 1VCVA 2C19A 5DBTA 2H6RA 3TSBA 1KM6A 5D2VA 3FEMA 5HMSA 3O05A 4UMAA 3NEVA 4RKAA 3S0CA 1E51A 3DI0A 4CNOA 4ZQCA 1O95A 3SECA 2Y7DA 5BNKA 3OIXA 4WQ6A 1WBHA 4U28A 2J9XA 5G1YA 3NZRA 5HUOA 3FS2A 4N9BA 3W1UA 3QZEA 3G0SA 4IPJA 2QCFA 2V81A 4O18A 3UWUA 4MYAA 2WJZA 3L67A 3H54A 2QJGA 5CSSA 3DFNA 3TXZA 4AVFA 1LOSA 2A7RA 2YSWA 4WXZA 5LHFA 3GB6A 1W1ZA 2NUYA 3ABRA 4UTMA 3TSMA 2GJLA 3LCIA 4GXMA 2YPIA 3NQ6A 2ATSA 2PC4A 3CWOX 1P1XA 4O0ZA 2H8ZA 3LHTA 2CLIA 3C3NA 3OVQA 3N14A 3TXVA 3MBFA 2ZZ2A 3CHVA 2I14A 1JRCA 4XBKA 3NQFA 1GEQA 3A23A 1B3OA 1FDZA 4JTLA 1EP1A 3TMQA 2E5DA 4HNNA 2QAFA 5HJLA 1VHNA 4R7JA 2Y7EA 4O19A 1ZAJA 3O1NA 1XUUA 4RZ5A 2WSRA 2VOMA 4Z1DA 4DF1A 2E1DA 3GDLA 1EIXA 5D2YA 4S2BA 1T96A 5SWUA 1X1OA 1OHLA 5HR7A 4CQ9A 1GG1A 1H7XA 1XBXA 3OA3A 3TROA 2V2HA 4N2YA 3W1TA 4NZFA 4JR5A 5KTLA 3LTSA 4JD4A 1Z44A 3UY8A 3G8RA 1JCNA 3FLUA 4P2VA 2ZRXA 1H5YA 2ISVA 1K8YA 4IMCA 2V2CA 4ADSA 5IBXC 1TPWA 4HIBA 4JTKA 2DZVA 5G2WA 5CPMA 1F73A 3M0ZA 1KLYA 2TSYA 4JX6A 1TV7A 1UB3A 1TRDA 4FHAA 5KINA 3ZWTA 1WOAA 4O11A 4NX5A 3V1PA 3MW7A 3M7WA 5EY5A 3DAQA 3P62A 4MIMA 1TPB1 2ZTJA 1ZFJA 4MOZA 4OV4A 4O10A 3SGUA 2C6QA 3EWWA 2NV1A 4CCDA 3C2VA 3LTPA 3R8RA 3G24A 3IV3A 1LBFA 4MFEA 1CI1A 1OFBA 1JUKA 4EVZA 3P82A 1KFJA 2A4AA 3SW6A 3P5YA 4AF0B 5F2MA 4RXGA 2ZZ4A 4IX2A 3HBLA 3G1SA 4GUHA 2ZA1A 3HGJA 4E0CA 2YYTA 3NL3A 2GVLA 1YLVA 3B05A 3RLUA 2TRSA 3MP3A 3FJ6A 1W31A 4AMAA 1KM2A 3CWNA 2J6XA 1TRIA 3W1LA 1AW5A 2FFCA 3NXFA 1UJPA 3EWUA 3IIZA 5FF0A 4JTJA 1EPXA 3IIPA 2BLEA 3TQVA 2Q3OA 1RZMA 1LROA 3PWAA 5C2XA 3DU0A 1QPQA 2DORA 2DZUA 3ABSA 4IJBA 1F2JA 4ORMA 1PCKA 3LCHA 4LUIA 3GX9A 3KVJA 4UFHA 1OFPA 3U8GA 3GDRA 3DZ1A 1S5WA 3HGRA 3ZFHA 1PL9A 1Y0EA 5EL1A 3TU9A 1IXNA 1SO3A 3MMTA 1SFJA 4TU1A 4UMCA 2AAMA 4NJGA 4I7UA 2F7FA 4FO4A 4EOUA 2V2DA 4QQ3A 4KWVA 1PCWA 2GOUA 3EXSA 4UXDA 4MUZA 1JR1A 2YDAA 5F4XA 1KFCA 1SSGA 3L21A 4DF0A 1R47A 1NFBA 1Z42A 5EA9A 2C0AA 1PIIA 2A6LA 3P74A 1YPFA 1YDOA 3NQAA 3QSTA 3A9IA 1U5JA 4UR8A 1B9BA 4O50A 3C0JA 3HGOA 2VKZG 5K3VA 3W7OA 5K4ZA 1D3HA 1H1ZA 4LY8A 3N73A 4MLRA 4JY8A 3STCA 3P8JA 5ABTA 2R91A 1WYIA 4AHQA 4JX5A 1A5CA 2DZWA 2H3DA 3USBA 2TPSA 3H55A 3N3MA 3KX6A 4QITA 3SY5A 2OT1A 3NAVA 1PV8A 3DBPA 2I9EA 4MY9A 1KFEA 3QPYA 5J5DA 1FWRA 3QEZA 2CFFA 5FF4A 3LM7A 3MP4A 1C8VA 3QQ0A 4E2BA 3BG9A 2Y6ZA 2BXVA 1D9EA 2NUWA 2A1YA 4LS2A 3A24A 3S1UA 4Q4KA 4FIRA 5FEZA 2QDHA 2QCGA 1S5VA 4X2RA 4NJHA 3W7IA 2DZTA 3HB9A 1AW2A 3BGGA 1EUAA 2CWNA 2O7SA 1DQXA 1S3HA 1K02A 3W1XA 3P5ZA 2E6AA 3UY7A 1G4TA 1GWJA 2JGYA 1I2OA 1XKYA 2Z1BA 1V5XA 3R89A 4JTIA 4UR7A 4Z1CA 4WOZA 3HMJG 4LT9A 4GUFA 1EEPA 1Q6LA 4UTWC 3G8EA 3LCWA 4MLJA 3NM3A 1RD5A 3G1FA 3TAKA 3W7CA 3TFXA 1T0OA 4HNTA 3W07A 2E6DA 2WKJA 4Z08A 1WX0A 4LTSA 4UTTA 4JTFA 1L9WA 3UPBA 5AHNA 3P81A 1TCDA 5F4WA 2G95A 1FUYA 2A0NA 2GQ8A 4ADTA 2WSQA 5AFDA 4GJ1A 4MY8A 2NV2A 5KMYA 4GC4A 1AW1A 1JULA 3QMSA 3UYCA 2FPYA 3C2EA 2FPVA 2V30A 2NXHA 4Y6GA 3O16A 1JCMP 4YLWA 4IPIA 1KTCA 1J2WA 1U83A 2RHGA 3DFPA 3S1WA 1W5MA 3PG9A 1OX4A 3ATYA 2H3BA 2P0OA 3IVTA 4FNPA 1TTQA 2DJXA 1BWLA 3W72A 1GVSA 1SW0A 1TJPA 3M41A 4XQ6A 3QJAA 3S5NA 4GWEA 1K8XA 1G67A 4I7VA 3DGRA 4IQLA 3LRKA 3NA8A 2GUUA 1PE1A 5HINA 5AOUA 3HG5A 1O4UA 2DZSA 3CEUA 1KTBA 4KFNA 2H90A 4FX7A 1H63A 1I2RA 5TBOA 1SO6A 4AWTA 2E5BA 3L0KA 3R2GA 3G1DA 3GKFA 4UFKA 3T78A 4CNPA 1KBIA 2X16A 3EX6A 1RQBA 4NU7A 3EKZA 3C52A 3NQ2A 1WAUA 5D33A 4CQ8A 3E12A 2Y7FA 5I3KA 2ZZ3A 4RK8A 4JDYA 1NAL1 1P0NA 4MJMA 2YW3A 4WY0B 2HMCA 2RDUA 4LRTA 1QOPA 4NJJA 2JGQA 4FNUA 1OFDA 3E9AA 1SZNA 1G4EA 3W22A 1TPFA 1H7OA 5H2ZA 1G7VA 3DKLA 3NPUA 1XBVA 4UFMA 3QM3A 5LNVA 1Z41A 1LZOA 2QCDA 2W6RA 1A5SA 1G4PA 2QJIA 5A5WA 5J5RA 4AHOA 5L9FA 4UIOA 4ZQRA 3QQ1A 1KM3A 1QPRA 1DORA 5K7JA 3V75A 5BW6A 5D2TA 1EP2A 4HN4A 4UC5A 5HQEA 1OFOA 1SW3A 1UASA 1FCUA 1YTKA 2HS6A 2PRHA 4XTDA 3MHUA 1VYSX 1ZALA 2ZZ6A 3RMJA 2QF7A 5G1TA 1ZCOA 5AN7A 1OYAA 3IGXA 2GJNA 3MBDA 3W88A 3NPVA 3PAJA 2J24A 4K36A 2CLOA 1R46A 3RFAA 5LKYA 4JIPA 3GR7A 2C18A 3WJZA 3O15A 1IGSA 1XFBA 4FNQA 1C29A 4N9CA 3ANYA 5I3JA 1O5XA 1C9DA 5FF2A 1KFKA 4JTGA 3C2OA 3W2JA 4MJZA 2ZCGA 4NNCA 1VCFA 1SFLA 5HULA 2EPHA 1L6YA 1VPXA 1QPNA 3GDKA 3G22A 4C1LA 4JS3A 4ZMGA 2FB2A 5LNRA 5K9XA 4YCPA 5DY2A 5FI8A 3FKRA 1FWSA 3PC0A 1I2QA 4AWUA 4FX6M 4YL2A 5EMUA 3LRLA 4MZ8A 1YDVA 2E6FA 3G1XA 4DEFA 4E38A 3WK2A 1M7OA 5D02A 3OVPA 1OF6A 3CLMA 1F05A 1GG0A 3N34A 3C56A 4ZVJA 5LHEA 4WUIA 1LOQA 3A21A 3SIZA 3LHWA 3PB0A 4WOQA 5DXXA 3BPWA 4Z0SA 3W9ZA 3AO0A 4WXYA 4AXKA 3GZ3A 3UWVA 3QH2A 2ZRUA 2OJPA 1DHPA 1CX9A 3CC1A 3ELFA 4HT3A 3FIGA 3GDMA 4N9DA 4UTLA 4RZ6A 4O15A 2GPTA 1OYCA 3TE9A 2ATMA 3JRKA 4OBTA 1X8FA 3SI9A 4XWUA 3EX1A 2GVGA 2NZLA 3UQNA 1H7RA 5TIMA 1LM1A 4MY1A 3CT7A 2FJKA 1WV2A 3AJXA 5D30A 3HG2A 5G4EA 1B57A 3HG3A 3W76A 3NQGA 5F2IA 3W7RA 1H62A 1WBJA 4QNWA 1XL9A 3E49A 4O16A 3B0UX 4O54A 5BMWA 1KLZA 5HUPA 1TPC1 3G0XA 4JTTA 2HTMA 5EPDA 2PCQA 1FWNA 1AK5A 2Z6JA 4PL2A 1Q6OA 4DO4A 3HG4A 3E0IA 2Y85A 2Y89A 1AL8A 1FXQA 1K03A 1TTIA 4JTUA 2CLLA 3LERA 5AHIA 3W83A 2RFGA 3U6WA 2FDSA 1GVFA 1I2NA 3G0UA 2R14A 1JCJA 4ZQMA 1HTIA 3EXRA 3SFKA 4MPQA 5DCEA 2TYSA 1H60A 1R2TA 3MI6A 3IVSA 3W87A 4HPXA 2J9ZA 2QCLA 4HNVA 3TDFA 3YPIA 2C3ZA 3NG3A 3TMLA 2ABBA 3A22A 1VCGA 4EF8A 3ZWSA 5K9CA 2YZRA 3KFTA 1TREA 3A5FA 3LHUA 2WQPA 1DJNA 1HUVA 5AHEA 4FXSA 3RNDA 5AYXA 3S5ZA 1L2UA 1RQEA 4BI6A 3W7KA 3M1ZA 4ZZ9A 4UUIA 1H7NA 3P80A 1EWEA 3Q94A 3SGZA 1Q45A 1DQWA 1H7WA 3MO7A 4AHPA 5CPOA 5FF3A 2ISWA 3F4NA 3JS3A 5FEWA 5FF7A 3TJXA 2PURA 4Z1BA 5E93A 3LXCA 3R13A 1LYXA 3E02A 4UTTC 4GE8A 3TSDA 3WK0A 5HWNA 1F74A 3DI1A 1NF0A 4DBDA 4DELA 3IEBA 1WOBA 4J9JA 2ZZ7A 2Y63A 3CQ0A 3T40A 3W1QA 5D03A 3MYOA 2BX7A 2EHHA 4M6VA 1B4KA 4POCA 2CZFA 2Q8ZA 2B7PA 1CW2A 3Q37A 3PUEA 3DH7A 4WJEA 3IGUA 4NJKA 1RVGA 3HQ1A 2XN1A 2CZDA 2RH9A 1TV5A 4ALDA 2DZXA 3KOFA 2FIQA 4X22A 4O1BA 3N2XA 3GAYA 3M5VA 4Q32A 3ZR4A 2YFNA 3UWQA 3MHFA 3NYZA 1LCOA 3W7MA 3BVJA 1XBYA 1MZHA 3EX2A 3IVUA 4L4MA 4G1KA 4QNEA 3TFCA 2B7OA 1VQTA 4QM1A 5LNUA 3PSWA 3W1AA 2ZRYA 3GKAA 1GYLA 1XI3A 1P0KA 2G5WA 1XBZA 2AQWA 5D09A 2W0UA 1OG0A 1VS1A 2NX9A 3PBUA 2E77A 1EWDA 3NPWA 5HNRA 4M6PA 3INPA 1ML1A 5I3HA 3S5YA 2LLEA 3F4WA 3W2NA 3PVFA 2DP3A 1YDNA 4YXGA 1VJIA 3EKLA 3QSRA 1W54A 3LBMA 2CLEA 5C6MA 4TIMA 4EIVA 3OG3A 4BFAA 2ZQ0A 4YWIA 3EX4A 1ICSA 4H3DA 4LVGA 1BTMA 5D37A 2Y88A 3EWYA 3UWYA 1FCBA 4S1FA 4HHPA 4LC8A 5I3FA 5CPNA 3P84A 2CLHA 1ZENA 5I3GA 3BARA 5K9DA 1OFRA 6TIMA 4PC8A 3LHVA 1PHQA 2JBMA 2ZRVA 1D3GA 2A5HA 3G18A 5BRBA 4UNKA 3FFSA 2QEZA 5CKSA 3TH6A 1I4NA 1M7PA 2ISSA 4PTNA 5AHMA 1GVRA 2VFDA 3C2RA 3LX9A 3UXAA 2YYUA 1P5BA 4UCGA 3WJWA 3TNOA 1N8FA 3O06A 5BOOA 1VGAA 1GPWA 4O28A 4RV8A 2WNQA 3W2KA 1SQ7A 4BWLC 2C16A 4JGDA 3C4UA 3WJYA 1A5AA 3G3MA 5K4XA 3KVKA 3LRMA 3LCLA 4HNUA 2QJHA 1XCFA 3C6CA 3W7QA 1SZFA 3M6YA 4R53A 1QNVA 2ABAA 4Y90A 2JKAA 4W9TA 2EAWA 4MZ1A 1TPH1 3TC6A 2D73A 3QC3A 3BG5A 3A5VA 3MWAA 3TW7A 2XFWA 1JVNA 1G7UA 1KV8A 1SZGA 3KHJA 4ORIA 3GVGA 3TC7A 2WPBA 4LVAA 3MHGA 2V8ZA 3B03A 1KFBA 5HWJA 1X1ZA 4JY9A 3O6CA 2Q3RA 3EWXA 4U4MA 4TR9A 4CCEA 4M6QA 4LW7A 4N02A 3P7YA 3VFLA 3TQKA 1LDCA 2C13A 3STFA 1OYBA 3EXTA 3LOTA 1UUOA 2FLIA 4N9EA 1HL2A 2A7PA 2VXNA 3IIOA 3DFTA 1WA3A 2PRMA 3DKJA 2WO5A 2QR6A 5CZJA 4RX0A 5D2WA 5AB3A 4LRSA 3BLIA 1LTDA 4XKYA 1GJPA 3NZ1A 1I2PA 3BW2A 1TPUA 2V5LA 5DXYA 1K8ZA 2E6YA 1JRBA 3KRZA 3OVRA 1IXQA 1QPOA 3O07A 1PS9A 1FBAA 4UTHA 2VENA 3LCFA 4NNAA 3HGSA 3M5ZA 3M43A 1ZY9A 1KM4A 1EUNA 1O60A 3G3DA 3I65A 4NX0A 1VYRA 3BLEA 3L5AA 1K7XA 1EB3A 4RXFA 1JJKA 2YR1A 1Q6RA 1ZJIA 3GXTA 4AWSA 1FY6A 2ZYFA 3SJ3A 4NT0A 2UV8G 2QCNA 1XDMA 1LBLA 1N55A 1BEUA 3W73A 1LOLA 1R2SA 3C8FA 2QCHA 2VFFA 4HKPA 1DL3A 1ADOA 1IIGA 1TO3A 4A21A 2PRLA 2ZZ5A 3TQ0A 3HIJA 1SUXA 3M9YA 1KTNA 1BKSA 2JKEA 3B0PA 2ZZ1A 4RCXA 3CM4A 2J9YA 5IM51 1OK4A 2VFIA 3KAOA 3I6RA 1RPXA 4D2JA 1OFAA 3PULA 5C5YA 1XM3A 3QMTA 3LCGA 5CG7A 4UTUA 4FB7A 4O14A 3G1YA 3Q58A 4O8RA 2O7QA 2B7QA 1YXCA 4MKNA 1GQNA 4X3ZA 1F76A 2ZA2A 2NXGA 2RDWA 5CPLA 4OGZA 4WZHA 1J4EA 4OQVA 1WDWA 1YADA 2Y70A 5F4SA 3W2UA 3HPSA 3MUXA 4AH7A 3IIVA 2I1OA 3NQ7A 1T8XA 2G97A 2R94A 2ZRWA 3UXDA 3W75A 1TB3A 1VC4A 3W7LA 4K8HA 1W3TA 2VFHA 1J5TA 3N9SA 1UUMA 1ONRA 4IWWA 1FXPA 5L6UA 3QW4B 3L65A 4UNLA 1QFEA 3BG3A 1M5WA 2Q8LA 3W7EA 3CIWA 2WNZA 4FNSA 3PSVA 3KXQA 1EA0A 4JYEA 1LBMA 1GZGA 3L5LA 4TMCA 5F1VA 1W5PA 4M5PA 5CZ0A 3RF9A 4IMGA 1KM1A 3TCEA 4X9SA 2EF9A 1DBTA 3DENA 3NL6A 5CGQA 1YTEA 1I45A 4ADUA 3I7SA 1JCXA 4Z1AA 3HPXA 3WFAA 5FEPA 1F6PA 1TJRA 4O13A 2Z0IA 1FWWA 4ML9A 4MVAA 5G2IA 2V82A 2VELA 2ZRZA 4JTEA 1F7BA 4WX2A 1AMKA 2ZBTA 4UTKA 3OEXA 4I7WA 1TV8A 4MFDA 5KITA 3Q2DA 3LV5A 4UTWA 2X2GA 3C61A 3W1MA 2NWRA 1ICPA 1MEHA 2VEPA 1YTDA 4P61A 4IMEA 1W5NA 2QCDB 4FNTA 5G2HA 1TMHA 3W2MA 3IRDA 2VEIA 1LRNA 1K7EA 2QUVA 3U2OA 5AHLA 1W3NA 1G6CA 2ALDA 3GYEA 4DQWA 3DHDA 2B4GA 4UFJA 3LB0A 2JKPA 1TQXA 3MP5A 4UTJA 1B4EA 3CPRA 4TO8A 2Y7GA 3PR2A 1EX5A 3FJLA 1YXYA 2OT0A 1MSSA 5EBUA 2DZPA 2B7NA 4TMBA 4R34A 4CCCA 3GAKA 1ZNNA 1TSIA 4IXXA 1YYAA 1H61A 5F1UA 2HS8A 3F1QA 3KVMA 2QKFA 1NEYA 3OBKA 3MI3A 4O0KA 1ME8A 1VLIA 3SR7A 1QDSA 4ICNA 2A21A 3DXIA 1QAPA 3PBVA 3T55A 3PG8A 3KRUA 3L2IA 4O4VA 3LXBA 4DXVA 3P67A 4K37A 2X1TA 3LHYA 5DCDA 3GNDA 3QF0A 4LV9A 3S8HA 1XUZA 1FDYA 3L9CA 3FYOA 4GUGA 4RR4A 2OCZA 1P4CA 1ME7A 5LGXA 4IXHA 5AHFA 1FQ0A 4Q33A 4IUOA 4LS1A 1KM5A 2Y61A 4NJIA 2GQ9A 4ZQPA 4RLIA 3KRSA 3NGJA 4ONVA 2Z2UA 2QCEA 4JICA 2C15A 3DFQA 2CU0A 3S6DA 2G96A 3FA5A 3W85A 4JDBA 1BWKA 5D2XA 4IMFA 4A2SA 4PL1A 2FB3A 4N4QA 4LVFA 5IBXA 3O63A 1THFD 4N6FA 4A2RA 1EP3A 2AGKA 3T4CA 2TMDA 5D04C 2EKCA 5DN1A 3FKKA 1TPDA 3VNDA 3UZ5A 1TTPA 3TK7A 1O94A 3EWZA 3LI0A 3EEGA 1W0MA 1T99A 3GDTA 3HOJA 3M5XA 4LVDA 2XN0A 4CQAA 2QAPA 3LLDA 2BSLA 4JYFA 2FTPA 4N4PA 3L0GA 3TUUA 4DF2A 1VZWA 5FEXA 3LCXA 3P8IA 1OFQA 3I7QA 4BK9A 1IXPA 2X1RA 3R12A 3NQ8A 2QDGA 4Y9AA 1AG1O 3W1RA 4K7VA 3HJZA 2RKXA 4UTIA 1TYGA 3B04A 1JUBA 2EGZA 1HG3A 3B06A 2NUXA 3TV8A 3W74A 3M44A 4YCOA 3ZS4A 1GVOA 3N2MA 4OT7A 1HO1A 2H8XA 3P61A 2C14A 1XXXA 2CLMA 4O52A 3CEPA 1L6SA 5F2GA 3GIYA 3MI2A 2IQTA 1N7KA 3N19B 3EB2A 3FYPA 2ZA3A 4RJEA 4DBEA 4K8EA 5K2ZA 3PUOA 1NSJA 3W6YA 3G1AA 1R2RA 1DJQA 3S42A 1TPVA 4HSNA 1MEWA 2J88A 3NVTA 4EWND 4JNMA 1O5KA 4IGHA 3LDVA 2A6NA 5I3IA 4GFSA 4M7TA 4IMDA 4JX4A 4BR1A 1R30A 5CZTA 4A3UA 4S2CA 4BI7A 5G5IA 5D32A 1QMLA 4HSOA 3TAOA 4JIQA 3P60A 4DO6A 1FX6A 4XTIA 2GVJA 3NPXA 3R5EA 1L6WA 4TX9A 3UZJA 3K30A 4PODA 3M47A 3NL5A 1VYPX 5EKYA 1ICQA 3TKFA 5D05A 4LOCA 3IIXA 4FNRA 2F84A 2YXGA 1KM0A 3NR0A 3LI1A 3LV6A 4NXSA 7TIMA 3STGA 2XN2A 4OV9A 4O4WA 2CLFA 3C2FA 3GK0A 4A29A 1PHWA 1IXOA 2YX0A 4MYXA 1FDJA 2YFOA 3VKJA 4MZYA 3THQA 2A2IA 3UD6A 1A5BA 1RQHA 1JQVA 3T44A 1DKWA 4AAJA 1LRTA 4CNNA 3TA6A 4BWLA 3RU6A 5AC7A 4QSHA 3VI2A 4JXCA 1DVJA 3TIMA 2BTMA 4JN6A 2YCEA 3IGSA 3H53A 1ME9A 1K7FA 4WY0A 2KZHA 4L4LA 1HFBA 4B5NA 2Z6IA 3GR8A 3W7GA 1QO5A 5D38A 4JYDA 1HO4A 2X1SA 2QUUA 2W79A 2CLKA 1LLZA 1M6JA 2GQAA 5BMXA 1TQJA 4GUIA 1VH7A 2Y62A 4LUJA 4PCFA 2A85A 4LS0A 1QR7A 4YMZA 1DOSA 1GVQA 2C1HA 4KFPA 4OWGA 3L66A 4O17A 1VHCA 3WJSA 3TW6A 4E2DA 3NQEA 3NNTA 1WQ5A 3PF3A 1A53A 1LP6A 1Z48A 4GNJA 3LHZA 3BO9A 1SW7A 3NO5A 3PB2A 4QIUA 3HO8A 1H51A 3SSJA 2OX1A 3OHIA 4UFLA 3M5YA 4ZQOA 1X7FA 2R8WA 1PVNA 3NQCA 4M19A 5DLCA 4DPQA 5LNWA 4DPPA 1RV8A 3O6YX 1OX6A 1NF7A 1I8JA 1OK6A 3BV4A 4LU0A 2VFGA 2QUTA 4I9AA 3BK0A 4XKYB 3LXAA 3CU2A 4K38A 8TIMA 4KKXA 4AB4A 4BI5A 1LORA 4NZJA 5H91A 1JCLA 5A8GA 2OMAA 1ZAHA 2V5BA 4GRSA 4M7SA 1H1YA 5MHBA 3W7DA 3W7JA 5LSMA 1WXJA 1FWTA 3TR2A 2NX1A 4HPJA 5KSWA 3NQVA 3PY2A 1KFLA 3L68A 3GXNA 4LC6A 3VE9A 4IOTA 2BWGA 3L0NA 1MXSA 3DFSA 5U7SA 5GVJA 2P10A 4LNYA 1SSDA 6ALDA 3E96A 3W1NA 4EF9A 2CW6A 1IF2A 4H4IA 5C55A 4JEQA 2X1UA 3O8AA 4LV4A 3HPZA 3ABOA 4FX8A 4JTSA 1SU5A 1H7PA 4UFIA 1W56A 3NDOA 2WV8A 4QISA 1QO2A 4WD0A 3UPWA 1MEIA 1TPEA 4UMBA 2ZTKA 1QWGA 3SZ8A 4OE7A 3THAA 3W7NA 4FIQA 1G4SA 3W1PA 3CIXA 4AEOA 1FCQA 1GT8A 4QAIA 3ABQA 1F6KA 3GXPA 1ZAIA 3M16A 4WY0F 4DO5A 1ZHAA 3W7PA 5U4NA 5AYZA 4GBUA 1A50A 1FCVA 1Q6QA 3W2LA 1SPQA 1K3UA 4KWWA 3G1HA 3NQDA 3NQMA 3MYPA 5AC8A 5LNSA 1GTEA 3BLFA 3CTLA 4LVBA 1JQXA 1JUEA 5KZDA 5C54A 1KA9F 2NXIA 3JR2A 3UWZA 4O57A 4NUWA 1OX5A 4KFOA 5CZSA 1F5ZA 4A22A 4CLMA 2HSAA 5E1QA 2E5CA 5KZMA 3QRHA 1XC4A 4AF0A 3EX3A 3UNDA 4NNBA 1SO4A 3W86A 1OF8A 2ZFAA 3MJYA 4BF9A 4K7YA 1OJXA 4ZL1A 3NL2A 2VFEA 5AYYA 5DCBA 3G1VA 3RLVA 3DHFA 3HF3A 2BZNA 1W5OA 3EWBX 1RR2A 1KW1A 3I7RA 4Z0JA 4NXKA 1DV7A 3B8DA 4FXRA 2A7NA 3PUDA 1G69A 3L5MA 1LRQA 2J27A 3S1XA 4OU1A 4IX0A 4QJ1A 4O12A 5E0KA 5EYWA 2X30A 5FESA 2WOQA 3W3OA 5F2LA 5G4WA 3ATZA 3GNNA 4C1KA 3D0CA 1V7YA 4K6AA 2NLIA 4N6EA 5HWMA 4O1DA 4Y8FA 3W23A 2NWSA 3PBYA 3B0VC 3BW4A 2VEKA 1GYNA 1GTHA 1MO0A 2NX3A 3WK1A 1S5TA 3LBCA 3QW3A 2P1FA 3PS7A 4NQ1A 1QCWA 1W5QA 4H6KA 3FOKA 1SO5A
chains in the Genus database with same CATH superfamily
1DJGA 1WZMA 4ZQNA 4QXIA 3NOEA 3XIMA 4PH6A 2VEMA 1HF6A 1SZEA 3GBEA 4KW2A 2FH6A 1TIMA 1Q6DA 2WLYA 1E5JA 2Z25A 1UR1A 4JOMA 5A6AA 5KZEA 4D8LA 3V3WA 4EAYA 5CSRA 3GHUA 3W84A 5TQLA 3PHAA 4KRUA 3LLFA 4FEZA 3BLKA 3KZPA 4EPDC 1G0CA 3S9YA 3LN3A 3WSUA 1E6SM 3CB8A 4H6EA 5HOSA 3S1VA 2RGLA 2PE4A 1UBSA 3KVLA 1QI0A 2CYGA 4JTHA 4WEVX 4E4UA 2DJLA 2V0TA 2WCSA 4MJ2A 4NF7A 3I68A 2QV5A 3L12A 6REQA 3O6DA 4PMYA 4O1CA 3OZMA 4Z17A 2V9DA 3W70A 3TOPA 2E09A 3ITTA 3LGEA 1L6FA 3F5JA 1IIHA 2WSYA 3B8TA 4FF7A 1KV5A 3B9EA 3GVWA 1K4GA 3WLRA 4K39A 1YNQA 5EB8A 1FWFC 1X38A 1GOXA 4QAWA 3W7HA 4R9XA 5FJRA 1ALDA 3GSMA 2E3ZA 3MQTA 4DZ5A 3PFRA 3FAWA 3VCRA 4AZGA 2J7BA 3TJLA 1UCWA 4MB3A 2CZ5A 5IHSA 3RPDA 2VD9A 3LUTA 3VDHA 1L8PA 2JK2A 5DBUA 4WJ8A 2Q02A 4AIEA 1XF0A 2BOEX 3TSBA 3KLLA 3O05A 4UMAA 2A3HA 3S0CA 4CNOA 1O95A 5D4YA 3GTNA 2Y7DA 1A47A 5G1YA 4A3QA 4AD1A 4IPJA 4P7OA 3AC0A 3TTYA 1MQRA 4MYAA 1SMAA 1XLJA 1C8QA 5CSSA 3TXZA 3QQWA 3ZT7A 4NYYA 2E67A 1LOSA 5LHFA 1R9XA 2XGZA 1QK2A 3CH9A 3TSMA 3V35A 1MDRA 2YPIA 1VFMA 4NZ4A 1B3WA 3OW1A 1IR2A 2H8ZA 3LHTA 2CLIA 2KX9A 3AYRA 1GK8A 2YL9A 4DB7A 3RX3A 5HQLA 3NQFA 1B3OA 1FDZA 2VZSA 3AS1A 1OG6A 2GYIA 3TMQA 2QAFA 5BXTA 5HJLA 4O19A 1ZAJA 3SUVA 2BY1A 1XUUA 3K8LA 4Z1DA 3UG8A 4PULA 4C6FA 2QF8A 5I5RA 3GDLA 1Q6GA 3ZVIA 1T96A 5SWUA 4XAZA 1A80A 4CQ9A 3LSCA 1GG1A 1H7XA 1GHSA 1XCWA 1VFHA 2QZRA 3W1TA 1VPYA 1YX1A 1UD8A 3GR4A 1Z44A 1M7JA 2BHZA 4P2VA 5E0CA 1CEOA 1H5YA 1FHUA 3VXGA 3VYLA 3RUBL 2DZVA 3RR4A 1FTXA 1LF1A 3GG7A 1TRDA 1X6NA 4NX5A 1HKVA 4O10A 2PP3A 4CVWA 5A6MA 2CITA 4EPKA 3GM8A 3WFLA 3G24A 3NTYA 1OFBA 2NVCA 3K1DA 1KC7A 4EVZA 4C6OA 3DHUA 3SW6A 2DW7A 4PB3A 5EMMA 3SQLA 2ZUUA 2J62A 4GUHA 4GXWA 3AJ7A 1W2PA 4F8XA 2DQXA 3CWNA 2J6XA 1TRIA 5D9NA 3W1LA 4IM4A 4HN8A 3WD1A 5FF0A 3IIPA 2PLKA 3AS3A 2A79A 2Q3OA 1KGUA 4AYGA 3LGGA 4QFUA 5C2XA 4AC7C 2YXOA 3WLHA 1GKQA 3COTA 3OQ8A 3LCHA 3QV6A 4U2YA 4GI4A 3U8GA 3DZ1A 3OU8A 5DF0A 1KR0A 1J93A 2F61A 1SFJA 2GGGA 2VQUA 2QYGA 1KRMA 3AXXA 2BG5A 3F7JA 3E1F1 2GGEA 1SSGA 3DFHA 1V7AA 3ARVA 1RLDA 3P74A 2E4TA 4HOZA 1YDOA 1JFXA 1U5JA 2AGTA 5H1WA 1TJ1A 2YCKX 4I8YA 1TV3A 4V27A 5K3VA 5K4ZA 1R87A 2G8ZA 4KWSA 8A3HA 3ARQA 2NVDA 3VABA 2FTWA 5ABTA 1TJ0A 1A5CA 2DZWA 1DJZA 3USBA 4HBKA 1SFSA 2DEPA 3AISA 4XG1A 3BLPX 3VDGA 2OKOA 3LA4A 3OJGA 2OT1A 1PV8A 3DBPA 5HMDA 4ZTXA 3AMGA 4GH3A 6TAAA 1FWRA 2ZX9A 1HGWA 3LM7A 2PWFA 1NWRA 1C8VA 2D3NA 3GTFA 1E9YB 1WXYA 3WF4A 2IKJA 1D9EA 4K1WA 4LJ3A 4NRRA 4LS2A 3EOOA 2VR4A 1S38A 2DFAA 3A24A 2A3LA 2QCGA 3RJXA 3VVGA 5I2UA 3VGDA 3W7IA 3IAPA 5HMFA 1BXNA 3FJNA 1UR2A 1VAHA 1JZ7A 3A9BA 4TVUA 4HA4A 3P5ZA 1CNVA 1CXKA 1G4TA 1IZKA 3A12A 1OD8A 2Z1BA 1AH3A 1MXGA 1FHDA 1V5XA 4UR7A 4IGNA 2J7GA 3BE7A 4L1WA 3QKEA 4MLJA 1DPMA 2ONEA 5GJPA 1RD5A 1NWTA 5AECA 2QNEA 4HNTA 3DC0A 2OQLA 3GFZA 1XH0A 4M51A 3WQPA 4UTTA 4Q4OA 2QXWA 4JTFA 4S23A 3P81A 4PSRA 5HNTA 2X05A 2OEKA 4KCTA 2GQ8A 3PTMA 3GNPA 4LBSA 1R5YA 4GC4A 1JULA 2C79A 4NAFB 3QMSA 2FPYA 3C2EA 1Q7ZA 2DPEA 1LWHA 4Y6GA 1QT1A 4RNHA 4IPIA 1KTCA 1TV2A 1U83A 2RHGA 3W0KA 5AYBA 4GQBA 1SJDA 1G5AA 3Q67A 3GU9A 4LUYA 2P0OA 3BLLA 1TTQA 2DJXA 4RDVA 3EBVA 1BWLA 4WGXA 3BLDA 3WEOA 1GVSA 1P7TB 1TJPA 4JIIX 1IT8A 3QJAA 2QVNA 1K8XA 1UG6A 1JYWA 2VEFA 5J8LA 1BYDA 2POZA 5HPCA 3HG5A 5ENLA 2DZSA 3CEUA 3AXIA 2J7HA 1JG9A 4AZIA 1H63A 1Y5VA 5TBOA 2PZNA 4UFKA 3GKFA 4CNPA 3T78A 3MV01 5A3HA 1A3HA 2X16A 3DYMA 3QXBA 4QG8A 3JZUA 3EKZA 3C52A 3QR0A 4B90A 1E72M 1WAUA 3E5BA 5JQ9A 3EZ4A 3NUKA 2P53A 4NZ1A 4MJMA 2YW3A 4GMEA 2QLYA 2RDUA 1QOPA 1WAWA 4LF1A 3UETA 2QMKA 3ENLA 3WD2A 3I4KA 4DJDC 5H2ZA 3NPUA 4UFMA 1E0WA 4HMNA 3ITOA 2QCDA 1A5SA 1G4PA 5A5WA 3V5FA 5H8PA 1PIFA 4B3ZA 2V69A 4J28A 2WMFA 1XYCA 5K7JA 1YEYA 3V75A 4JIEA 2CCRA 1UASA 2F38A 4YTQA 1UH3A 3TN4A 1QI2A 2EO7A 5M5DA 1BPLB 4XTDA 3DIPA 1VYSX 1JGIA 2QF7A 5G1TA 2FFIA 5CPQA 1DXIA 1OYAA 1XLCA 1OCJA 4TTUA 4B5XA 2J24A 4K36A 1R46A 1C7SA 3RFAA 3RLHA 5LKYA 3VC5A 2C18A 5CQ1A 2QGYA 2EBNA 1XFBA 4WJXA 4PRTA 2Y5SA 4GIYA 1R9YA 1QOXA 1SFLA 4J3WA 3TZNA 2X09A 2EPHA 2OLHA 1L6YA 1ZRQA 4AG0A 4JS3A 5BXSA 4NG3A 1RBLA 2FB2A 3KOXA 1NWUA 3SB0A 1J0YA 1H2JA 4DLFA 2BXZA 4AWUA 5T91A 4JIRA 1JZ4A 3IV8A 2E6FA 1F05A 3TQPA 5DMMA 3URNA 2ZVIA 4IFKA 3SIZA 3W9ZA 3QVQA 4DLMA 3F4DA 2HROA 4AXKA 2X0YA 3GZ3A 1E71M 1DHPA 3ELFA 3FIGA 3GDMA 4LEQA 4UTLA 1KD0A 4Z2JA 2GPTA 1J12A 3KWSA 1QNQA 4HTYA 3SCTA 4F0SA 4DJDA 2PU1A 2XZ9A 2Z26A 3E2RA 5IFTA 1X8FA 4JTCA 2CERA 4L61A 5TIMA 4GZ7A 4KEZA 1XKJA 2FJKA 1WV2A 3AJXA 4P7LA 1J01A 3HG2A 3QLLA 4QCFA 4IH3A 1XRSA 3ITXA 3BJTA 1B57A 4YYCA 1CENA 1EOMA 5EMJA 5HUPA 1W1PA 3G0XA 4B3LA 2HTMA 3FVMA 2Z6JA 3UVAA 1MZRA 3KBVA 4C6CA 2HK0A 4JTUA 1KRAC 2OYKA 3AROA 4GYKA 4LPCA 4ZFCA 7A3HA 2J77A 2FDSA 1GVFA 3G0UA 1Q4NX 3ALFA 1ECEA 2FZ8A 1KWGA 3BAJA 4BQ5A 1H60A 3P3BA 4Z2LA 1QW7A 3MI6A 5DMYA 4HPXA 2QCLA 3TDFA 3YPIA 3KL3A 4GVIA 2HQAA 1O5QA 1VCGA 1XIHA 4XD4A 2PCEA 3A5FA 4AD2A 1DJNA 2IXVA 4JFVA 1RQEA 4BI6A 4RL3A 3Q94A 1HQTA 3ITCA 4QCEA 3K2GA 2DIEA 3VZZA 3MKVA 3F4NA 5GJNA 4LCRA 1XG3A 3TJXA 2PURA 4Z1BA 5E93A 1FVPA 3TSDA 1B0IA 4DELA 3APYA 1WOBA 4HCHA 1US3A 5D03A 2BX7A 2EHHA 2CZFA 3DGBA 2Q8ZA 2B7PA 5I23A 3Q37A 3PUEA 4NJKA 1VIZA 4AVOA 3WMBA 4WHBA 2FIQA 3L4VA 4X22A 2OSXA 3P0XA 3N2XA 3GAYA 4P8WA 2YFNA 1NELA 3GUWA 3U7BA 3O9NA 5A6LA 2J25A 3NYZA 4ATDA 3BVJA 3A4JA 1MZHA 5RUBA 1GZJA 4G1KA 4NI8A 3HZ3A 4ZTYA 1DJHA 2ZRYA 2BVWA 3H2CA 1P0KA 2G5WA 2AQWA 1OG0A 1JYNA 5C2CA 2NX9A 4MPKA 5CJ5A 3MJMA 1QJWA 3NPWA 5HNRA 3INPA 2LLEA 2ZX5A 4QS6A 4RV3A 1V02A 3ABXA 3PVFA 2DP3A 4AISA 1VJIA 4LAKA 2ANUA 3LBMA 4JHZA 1DIKA 1JYVA 1BWVA 4CD8A 2EG7A 2C71A 2CXEA 4LVGA 4E4FA 1R7AA 3MCMA 4ZXLA 3EWYA 4PYSA 4ZOCA 2PDWA 1FCBA 1W17A 4WLCA 5CPNA 1Q13A 1EZWA 4NRSA 3SCUA 4BF7A 3LPPA 2WVTA 3PBGA 4HZ8A 4I9TA 2HPMA 4XSLA 1EYEA 3ZT6A 4PC8A 4DXKA 3G18A 5BYWA 2QEZA 1HT6A 3WUGA 3WLLA 3C2RA 1T7LA 2I56A 1E9IA 3E0VA 3TYUA 1RAKA 3FDKA 1KR1A 4UCGA 2WMHA 4AEEA 3CO8A 1QI3A 4FOUA 1PWMA 2ZX6A 1GHRA 3CAWA 4O28A 2HISA 1QVBA 2E8ZA 1A5AA 3G3MA 5BZAA 3LRMA 4AFYA 3LCLA 2QJHA 1P48A 3POCA 1SZRA 2CXGA 1SZFA 1MYRA 2VP8A 3AI0A 4EX4A 4Y90A 2JKAA 1UD5A 3HURA 1TPH1 2UY2A 3WH9A 1G7UA 1SZGA 3KHJA 3B03A 2QPSA 3BXWA 3WLOA 3WBXA 4FZIA 2Y1HA 4CCEA 4HP5A 1GQKA 4GHRA 1WPCA 3VFLA 1OBAA 4ZGYA 1LDCA 1VD6A 3WL1A 2FZNA 3GVRA 1HL2A 2A7PA 2YXXA 1GKPA 3IIOA 1TZ9A 1WA3A 3CMGA 2WVVB 4LRSA 4ZSUA 1VEPA 2GVEA 3MO4A 3MUZ1 1BVNP 1GJPA 1I2PA 1BYCA 2XSAA 1JRBA 2YA0A 1IXQA 1QPOA 4HZ7A 2PWGA 1OWQA 5C70A 2GVYA 4UOQA 4NNAA 3TTOA 3HGSA 3M43A 1ZY9A 1KM4A 4ATLA 1B2YA 2CBJA 3L5AA 2JEQA 4R88A 3BJSA 2J4GA 2ISDA 2E7FA 3BMXA 2PF8A 2HVNA 3WBYA 1JPIA 1LBLA 5FL0A 4JIHA 4J7RA 2YDSA 1Q2RA 5E0FA 4YS1A 1QWKA 1TUFA 2ZZ5A 3UNTA 3QKZA 2OSWA 1T8QA 3M9YA 4MDOA 3KP0A 2RAGA 3GNRA 2PA6A 3SFWA 3II1A 3KAOA 4D2JA 1TE1A 3UG4A 4IIDA 5ABEA 2NV9A 4O8RA 3U57A 4X3ZA 2ZA2A 2NXGA 2H9AB 1Q7QA 1REQA 1WDWA 1YADA 5F4SA 3W2UA 3HPSA 4DM2A 3RRXA 2YL5A 1AZ1A 3IIVA 3A3HA 4OUEA 3MS8A 1FH7A 2ZRWA 4P8UA 1A5UA 1JDFA 3WH8A 1XLDA 3W7LA 2W3ZA 5ABHA 1J5TA 4GPNA 2VR2A 3N4FA 1FXPA 3GXFA 5D8WA 4K8GA 1GGOA 3BWWA 4LANA 3R8GA 3CAKA 3V0SA 1QFEA 3BAIA 3NDYA 2WNZA 3PSVA 3GRIA 3GD6A 3KXQA 3L4UA 3T08A 4JYEA 3VIHA 1X7IA 4C7GA 5F1VA 4LUTA 5CZ0A 4X9SA 4DYJA 4GI8A 4Q7IA 2ZX7A 4HPHA 3HPXA 2PEVA 1TJRA 1B1YA 1UKQA 2Y2WA 4XVEA 3A3WA 2VELA 5G2IA 1OIFA 2G37A 4JTEA 1F7BA 3HQNA 2XIQA 4HNOA 2ZBTA 3ZLFA 3KBSA 4LEFA 1Z69A 1PEZA 3OEXA 3OBAA 1ZPTA 6REQB 5PTDA 2IUZA 3Q2DA 3W02A 5LXXA 4C6MA 3B97A 4IJRA 2PWVA 4X0VA 3AIEA 4GYFA 3QPEA 5HPOA 5XIAA 2R82A 3W2MA 4XO6A 2NSOA 3LB0A 1UA7A 2JKPA 1IEWA 5A8NA 1EOKA 3FJLA 2YBUA 3UCDA 1KBKA 4TMBA 4WRHA 3ITLA 4R5EA 4CCCA 2D0HA 3GAKA 3KWXA 1O1HA 2UY5A 3H4GA 1H61A 5F1UA 1XG4A 1QW9A 2WZIA 1W3KA 3SR7A 1S5NA 1QDSA 3VNJA 4ICNA 1UWUA 2A21A 1QAPA 4PBEA 3PBVA 3T55A 2CPUA 3DX5A 3O0FA 3LXBA 4MTVA 4AZ6A 2E1WA 4Q8TA 3JUGA 1XIDA 2V38A 3WF2A 2BOFX 1XYZA 3L9CA 2OCZA 1B90A 3AZSA 5AHFA 3SO7A 2QJJA 3KEHA 4ZA0A 2GQ9A 4PB4A 3VD4A 4RLIA 1CLKA 3VK5A 3LS9A 4B4FA 2Q8XA 1H41A 1SJAA 9CGTA 1I1WA 4H41A 3S6DA 2G96A 4U5KA 4JDBA 1JPDX 3VM5A 3FSTA 1PAMA 2FB3A 4V33A 3ZLGA 3O63A 4L64A 4N6FA 3EMCA 1UYQA 4F2TA 5D04C 1NY1A 4MWAD 3FKKA 2J8FA 3UZ5A 2PTDA 4P7QA 1PTGA 1UZ4A 1IEXA 1O94A 3EWZA 3PK7A 4BQ3A 1G9HA 3LI0A 3CB3A 3EEGA 1W0MA 1NU5A 1A3XA 4GXPA 3G5EA 3WDPP 4ZB5A 4CQAA 2FTPA 3SQMA 4DF2A 1R85A 4Q8OA 1VZWA 3CJPA 3P8IA 4UQDA 3XISA 3WENA 4QJ4B 3GS6A 3R12A 4EKJA 4INFA 4Y9AA 1CXEA 4Z42C 3VNZA 3AYTA 4AD0A 3D3FA 1TYGA 4CEXC 1JUBA 1KCLA 1EXBA 2Q71A 3FJ4A 4H9VA 1EF3A 3ZS4A 2BMBA 4PUUA 5A6KA 3MB9A 4O52A 3WCZA 3B9NA 2AKZA 1UWAA 1M03A 1QNOA 4N0RA 2DV0A 4RJEA 5K2ZA 3L23A 1NSJA 3G1AA 3U0HA 3KS5A 2J88A 3UJRA 2I16A 1HL9A 1O66A 4JKLA 5JMUA 4JQAA 4EXQA 4H83A 4M7TA 4IMDA 1HL8A 4E2VA 3PNUA 2Z1SA 1D3CA 2ACQA 4S2CA 5G5IA 4UR9A 3N11A 5HNUA 5I6SA 4LAOA 1DTNA 1S3TC 1B3ZA 2XINA 2WMIB 4DO6A 1FX6A 4L9YA 3AIWA 5LIKX 4J2PA 2FMOA 1E0TA 4PRWA 3FCPA 4TX9A 4AVNA 2AMGA 4LOCA 2Y4SA 2OX4A 1V6WA 3UT0A 2Z1KA 4NXSA 7TIMA 4X63A 3STGA 2GJXA 5C7VA 1UW9A 2X7VA 3U7VA 2CLFA 1O1ZA 2R1MA 4DY1A 4MYXA 3BCJA 3GVQA 3VKJA 1GCYA 4J3TA 2WC4A 2MANA 1POKA 3K5XA 1JQVA 2YL6A 1DKWA 4AAJA 2YDRA 2IKGA 2JEPA 1CLXA 1LWJA 2RJHA 2EPLX 5EMKA 2WC7A 1YQ2A 3VOGA 3UJFA 4AY7A 2BTMA 4JN6A 4F0KA 4CCZA 1K7FA 4L4LA 4Y9OA 1XW8A 1PO9A 1JIBA 2Z6IA 4B5NA 1V6VA 4JYDA 2BHYA 4G6CA 1XYBA 4DBWA 3VO0A 4QSFA 1B54A 4ERGA 1A0EA 1ONEA 3L4TA 1VH7A 4PCFA 4S3DA 4D6HA 2G3JA 2WCGA 4PMJA 4J3SA 1WKDA 3S4TA 1GVQA 3EPNA 4KFPA 4OWGA 3L66A 2VRQA 3GH7A 4E2DA 3NNTA 4MHBA 1PZ2A 3VIJA 3LHZA 2G3IA 4PMVA 4M56A 5KZ6A 4Z2GA 4B91A 4W85A 4MMWA 3NQCA 4M19A 5DLCA 3WQ8A 3O6YX 1OX6A 4GABA 2OLAA 3QZ6A 2P50A 2VFGA 4W93A 2QUTA 3CQKA 2QPUA 4I9AA 5HDRA 1TCMA 3MZ2A 4NZ5A 8TIMA 4KKXA 4BI5A 3WG6A 3SRDA 3L7RA 2OQYA 1DWHM 4M7SA 3VCCA 1C8YA 5MHBA 1ONWA 5DANA 1WXJA 3EA2A 2HWGA 3W82A 4HPJA 2VEGA 3S2JA 4V15A 4TXEA 2BWGA 1W91A 1RP9A 2B31A 5GVJA 5GJMA 3UXIA 4LNYA 1U1JA 1SSDA 3E96A 1O12A 2V5JA 4EF9A 1IF2A 1EQCA 5C55A 4LV4A 2X1UA 2JFEX 3EPMA 4HU3A 1W56A 1JZ8A 4WDXA 2MNRA 4WD0A 4FOJA 1TPEA 2ADAA 3J7HA 4OE7A 3W7NA 3LMYA 4FIQA 2CHRA 3CIXA 5CAKA 2O9OA 4ECLA 4RW5A 1V3LA 1YPXA 1F6KA 2FJUB 1ZAIA 3F2DA 4DWSB 1E0XA 1XYLA 1K9EA 4JPGA 2YIHA 4GBUA 5A6BD 3KTSA 3W2LA 1SPQA 4H6RA 1K3UA 3NQMA 1KBLA 5JUVA 1E6PA 1UWIA 3BLFA 4LVBA 1JQXA 1UMYA 3NZQA 2JF6A 2WVUA 3BH4A 1KA9F 3T42A 2NXIA 2XHYA 4NUWA 1HIZA 1HP4A 1OX5A 4ICMA 1TZ7A 2DW6A 5HXMA 4MNLA 1B5TA 2HSAA 1TX2A 3QRHA 3EX3A 1ESWA 4LYKA 4NNBA 1SO4A 3W86A 3OLIA 3MJYA 1OJXA 4D1JA 2EJ1A 3VM7A 3SRKA 3RRAA 4W7VA 2XUCA 2Z29A 1G69A 1DYSA 3H2AA 3WF0A 1GW1A 2BS9A 6CGTA 3BMWA 4HHHA 3S9IA 4C1KA 2OGJA 3ZQ9A 2NLIA 3VDBA 5HWMA 4F2UA 2J66A 4H04A 2NWSA 3B0VC 2VEKA 1GTHA 1MO0A 4C1NA 4C6PA 2NX3A 3WK1A 1S5TA 1OD0A 3LBCA 1U5VA 3PS7A 4JKKA 2W91A 2Y5JA 1ELSA 2D20A 3NM1A 1X6UA 1W8SA 2EJAA 4PFMA 3ITYA 2BP1A 3WZ0E 3SN4A 1NVMA 1H4PA 4LWWA 3ARWA 4W7UA 2ZDRA 4IPLA 3TP4A 3W27A 4FS9A 3ZVHA 3VINA 4ZODA 3AHYA 4QLJA 3B4UA 4DJED 2IKIA 2P88A 4LUSB 3WJXA 3SCPA 3H7VA 1H50A 3OTRA 4DWSA 5AC6A 4GBDA 3WLTA 4FA3A 1FH9A 3TR9A 3FA3A 1R6WA 4W84A 5HR6A 3VPLA 1Q4WA 5LIUX 4PFHA 1JXKA 4OECA 2VZTA 1UQYA 4QE5A 5AC4A 5LZLA 4XBSA 1SR9A 4L5ZA 2Z28A 1XLHA 2WNNA 4RZ4A 1XD0A 1TG7A 1NIUA 3VZYA 1GOMA 4NVTA 1NARA 2QCMA 4B2DD 1MW2A 2WWCA 3U2EA 2I7GA 2VZOA 4ZOAA 1JCYA 5FSDC 3QFWA 2AMXA 3QYQA 1A49A 5I77A 4KH2A 4PTMA 3W38A 2PWEA 4O53A 1GJWA 1VLWA 1PDZA 3W71A 3UR7A 5GNYA 1YHTA 2NQHA 7ENLA 2BODX 3S1GA 3WQWA 4YTRA 4OTKA 2CZVA 3K13A 1VCVA 2C19A 1XX1A 2JQXA 1PX3A 2H6RA 2QUNA 5D2VA 3SUSA 4MG4A 3NEVA 1DXFA 3IJ9A 1BRLB 4ZQCA 3TYCA 3SECA 1D8WA 3HM7A 3ZM8A 3WD3A 4U28A 1JNDA 2PDYA 1R9ZA 3FS2A 3W1UA 5C9WA 2V81A 2BVTA 2ACUA 3PZGA 3UWUA 3WKZA 2QJGA 3I6EA 2PP1A 2WJDA 3DFNA 3A6OA 1QHPA 5CC3A 2YSWA 4WXZA 1XP3A 4DIAA 3ZJ7A 1J0HA 1W1ZA 3ABRA 2GJLA 4GXMA 3NQ6A 3I4EA 1EX1A 3RO6A 1P1XA 2PTXA 5TF0A 3VD5A 3KDOA 2CHOA 3MBFA 2GDQA 1KKOA 4WK9A 1JRCA 4YWSA 4JTLA 4DUXA 1EP1A 4H7VA 4LUSA 5EGRA 2WSRA 1PKNA 1CLVA 3L4WA 1VPQA 4TX8A 1EIXA 1CIUA 5D2YA 4S2BA 3G77A 1NOUA 1X1OA 5HR7A 1TWWA 3IJLA 3UESA 2V2HA 1CB7B 3GC5A 3KZSA 3VA8A 1FFQA 1QBBA 3BMVA 1M01A 3UY8A 3FLUA 4AZ5A 1Q6EA 5BXRA 4HA0A 3TNBA 1K8YA 2V2CA 4ML4A 1EJSC 4HIBA 3ONCA 1AD4A 3CV7A 1XRVA 4EACA 1JCTA 5HMEA 5G2WA 1V0KA 5CPMA 3M0ZA 1E0VA 1CGUA 3NSNA 4JX6A 3LEPA 1TV7A 4M1RA 2O0TA 5IHRA 3ZWTA 4O11A 2WMJA 2OWCA 3MW7A 4G7FA 4GVFA 1Y8BA 3P62A 1ITQA 5ECVA 3EA3A 1ZFJA 3DC8A 4OV4A 4LH8A 1P6BA 2QPXA 1J0IA 1JXJA 4KF1A 2CWXA 1W9BM 1EH9A 3TWAA 1XPYA 3E0LA 4QRNA 1KFJA 1K9TA 3P5YA 3UWEA 2SFPA 2PI6A 4JQ1A 4XD3A 1V93A 2RUSA 3HBLA 2IQ0A 2O9RA 1RBOB 3LQGA 2HPIA 3HGJA 4E0CA 4JHOA 3NL3A 3W4RA 1YLVA 2HBXA 1JF5A 3RLUA 2DT0A 1ZU8A 3QOMA 3UGVA 4AMAA 2UZ9A 4C6QA 4M29A 4UZSA 1UJPA 4HYRA 3IIZA 4MDPA 3NGFA 3LMZA 4BS0A 4M81A 3TQVA 3ZT5A 4Q7BA 1RLCL 3MV11 3W01A 1R3QA 3EDFA 2DORA 2DZUA 4IJBA 2DUAA 1OB0A 1QUMA 1JPMA 4UFHA 1OFPA 2V63A 1YDYA 4YHGA 3HGRA 3N04A 4I8DA 1PL9A 1IXNA 1SO3A 3MMTA 4TU1A 4I5UA 4FO4A 4RDZA 1NP0A 2XJ7A 4DUOA 5C71A 4CVUA 4DF0A 1R47A 1Z42A 2FHBA 4O1EA 4P7RA 1YPFA 2PB1A 3MC5A 4UR8A 2F6UA 3ARRA 3CHEA 4UZUA 3O3RA 3C0JA 4A3YA 3W7OA 3HV8A 1H1ZA 2AOSA 3IS4A 3N73A 4JNZA 4JY8A 9RUBA 2R91A 3AUJA 2PLCA 4GD0A 3KS6A 3GVVA 3SCVA 2TPSA 3H55A 3M0XA 3N3MA 4JCMA 4MY9A 2FZ9A 3QPYA 4Q4MA 3R79A 5FF4A 1HKMA 2OB3A 3KCOA 1ZGDA 5GPRA 3BG9A 2Y6ZA 3QV7A 1NOWA 2NUWA 1EIBA 4A8LA 2A1YA 3PJWA 3UVIA 3HQOA 4Q4KA 4FIRA 3K4DA 3S5SA 4X2RA 4KQNA 2DZTA 1AW2A 1EUAA 3CO4A 4JQ4A 3K1GA 2O7SA 1DQXA 5I78A 3CMJA 3EDKA 4TV6A 3UY7A 1GWJA 1GJUA 4M8UA 5E9XA 2JGYA 3FVDA 4JTIA 4Z1CA 4C60A 4WOZA 4LT9A 1Q6LA 4Y9NA 4BCEA 4UTWC 3LCWA 3SSZA 4J40A 1I60A 4ZOEA 3TAKA 1JPKA 3W07A 2WKJA 4Z08A 2XVNA 3CV2A 3ZVHB 2E9BA 1F8IA 2EQDA 3IACA 2A0NA 2WXDM 5AFDA 4GJ1A 4BY3A 3UP8A 3KUMA 3VFCA 5KMYA 2X8RA 3NVDA 1AW1A 1KCXA 3CIVA 5D8ZA 2FPVA 2XH7A 4LCQA 1JCMP 8CGTA 1DIDA 5I02A 3SCQA 1J2WA 2R1PA 1CPUA 3KE0A 1BF6A 4JQ2A 4QE1A 3PG9A 1S46A 1E4NA 4PCPA 4H8HA 3ISIX 4X9YA 1HKWA 3UZWA 5CGMA 3CASA 3W72A 3NZGA 3WLSA 2WHLA 1V3JA 5FAJA 4MB5A 1O68A 2UY3A 4XQ6A 4I7VA 1G67A 1P1MA 3E2SA 1R7OA 4M1BA 4QP0A 3NA8A 3RGTA 2GUUA 1PE1A 5HINA 1O4UA 2PSNA 4H01A 6XIAA 4JTRA 4Q7NA 4FX7A 5XIMA 4HZMA 1SO6A 3H2OA 3EMZA 3QHMA 3EOEA 4AWTA 3L0KA 3EX6A 4A05A 2IXUA 3VGBA 5D33A 4CQ8A 3E12A 2DH3A 3A4AA 4OVXA 4JDYA 1NAL1 2J78A 4WY0B 2Z24A 3RLGA 2ZUMA 1OFDA 1SZNA 2X0SA 2IMRA 4B16A 2HVOA 1H7OA 3DKLA 5FCZA 3M0IA 1DE6A 2WZEA 4MKSA 1PYFA 4LAUA 5LNVA 1Z41A 3LD5A 5JBFA 3GXMA 1P7TA 4AHOA 3IWPA 3BANA 1FKXA 1KM3A 4PMQA 1EGMA 2DSKA 1Q7MA 2VX7A 4GJIA 5A2AA 2YCLA 1FCUA 2PRHA 4YJ5A 1A5OC 3RMJA 2JF7A 4GZEA 1ZCOA 2JE8A 5AN7A 1AA1B 3MDUA 2PGRA 2GJNA 4C6IA 1PXGA 3LG3A 1XCXA 4H1ZA 2W62A 3F4VA 3IJIA 3H6OA 2Y24A 5IXEA 3TYEA 3RXZA 3H8AA 3S3GA 1PDYA 1EF2A 3D46A 5H8MA 1C29A 4N9CA 1J8VA 3ANYA 5I3JA 2TODA 1C9DA 1WKFA 1KFKA 4JTGA 3W2JA 1BF2A 4MJZA 2QIIA 4NNCA 2OR2A 1VBJA 3EWDA 4PTVA 3ES8A 1VPXA 1QPNA 4ZMGA 3TC3A 5LNRA 5K9XA 2VO5A 2IPWA 3PUGA 4RNJA 3V5OA 3PZUA 2WNWA 1FWSA 3PC0A 1I2QA 2WANA 4OUIA 4YL2A 5EMUA 5HK4A 2WBGA 3H2FA 4MZ8A 4KWOA 1E6XM 3G1XA 4DEFA 4US6A 4OBRA 2J7DA 3CLMA 2WQDA 2WZTA 1V77A 1GG0A 3WO8A 4LFYA 4ZVJA 2XG9A 4WUIA 1PPIA 3A21A 3OLEA 3UJEA 1S2AA 3PB0A 5DXXA 1R0MA 3BPWA 2HCVA 3MT1A 4WXYA 4DZHA 2EXOA 2VI0A 3UWVA 3NO3A 4HT3A 3WX7A 3QGVA 1V0NA 1OYCA 3TE9A 5ABGA 2ODOA 4OBTA 3LNMA 4CQCA 4U2ZA 3WDIA 1UMLA 3T2PA 3EX1A 3DBNA 1H7RA 3CQIA 4MY1A 2QW5A 1UP2A 3S6OA 1M53A 3HG3A 3DECA 3W76A 3KBMA 3NQGA 1HJQA 4QNWA 1XL9A 2Z1VA 2XFFA 4DI8A 3B0UX 4IICA 5BMWA 4XZIA 2PCQA 1AK5A 3PNZA 3HG4A 2Y89A 4WSHA 1AL8A 1S2WA 2Z4GA 5DEZA 4FLQA 4AIOA 2VVNA 2CLLA 3AYVA 4FALA 4U10A 4I5XA 3USZA 3RR1A 1I2NA 2GK1A 2R14A 4H8NA 1S1RA 1XGEA 1W1YA 4AD5A 4NKCA 1YNYA 3TW9A 5A6TC 2ZXDA 4WDUA 3ARZA 3IVSA 3UPMA 3AFBA 4JFTA 3VAVA 2C3ZA 1OCBA 2BNJA 3T2QA 2WQPA 1HUVA 5REQB 3RNDA 4LUTB 5AYXA 1C8XA 2VGIA 4AYSA 4ZZ9A 3VOCA 1VBHA 4YTUA 4AHPA 2OLSA 1UIOA 5FF3A 4C5YA 1QRQA 5BRQA 4J3VA 5AVNA 1E70M 4G5DA 3WK0A 1Q85A 1F74A 3F5LA 4HVXA 1UQZA 4J9JA 4EE9A 4R7OA 4BQ4A 3T40A 1V02E 3MYOA 1K70A 4M6VA 4IGMA 1B4KA 3DG3A 4POCA 3WLNA 1CW2A 4Q3MA 3H21A 4WJEA 1RVGA 2XN1A 2CZDA 2RH9A 1TV5A 4W8AA 3VIMA 4ALDA 1QW8A 2GJPA 3MSDA 3ID7A 5JBEA 3TJ4A 4WKFA 3B9OA 3FXYA 1KFWA 2XH2A 4ZB2A 3MHFA 4AD3A 3N29A 1XBYA 3IVUA 4QNEA 2B7OA 1A4MA 1VQTA 2WSKA 3E74A 2FVKA 3BJFA 2EEXA 1EWDA 2XIJA 1CTNA 3F4WA 4JQ3A 5ABFB 3W2NA 2I5IA 1W9XA 3AHVA 3CUIA 1W54A 1CBGA 1VBUA 2J75A 5C6MA 4C6JA 3WLKX 4CQBA 1OZQA 1ICSA 4C5ZA 3UJ2A 1BTMA 3I10A 3QV8A 1AJ2A 1T6MA 3P84A 2CLHA 1OT1A 3S6TA 4D6FA 4A3HA 1PHQA 5CLWA 5A8QA 2G0WA 4XZMX 1RK5A 3THDA 2VHLA 4UNKA 1CYGA 4D6EA 5HANA 4OOZA 5CKSA 2DT1A 4F48A 3TH6A 1M7PA 6PTDA 2VFDA 4XZBA 3WF3A 2X0HA 1SMDA 4C1NB 1EDQA 1QK0A 3UXAA 4ZO6A 1P5BA 3WJWA 3TNOA 1Q66A 1SFTA 3T0AA 1N8FA 5LA2A 1LG1A 1VGAA 3W2KA 3DHPA 1V0MA 2XIMA 3CUHA 2C16A 1R3VA 1CCWB 1HJVA 4HTBA 2ZX8A 3MTWA 5K4XA 4DAIA 2HNEA 4I6VA 1TMLA 1XCFA 7CGTA 1AMYA 3M6YA 2ABAA 4W9TA 2ZVRA 2GZXA 3BG5A 3LYEA 1MFUA 1W9VA 1KB3A 3SBFA 4M80A 1A5KC 1WE5A 2XFWA 3GVGA 1R3SA 2V8ZA 3N4EA 1ODUA 5HBFA 4JY9A 3O6CA 1E73M 2V68A 1HKIA 3H12A 2P3ZA 1F3XA 2PDJA 4HZ6A 4E5TA 2VGFA 1S1PA 4HGXA 5HAOA 2FHFA 3P7YA 3TQKA 4KERA 2CKSA 1JZ5A 1C91A 3WL0A 3PJUA 1OINA 3EXTA 1AQHA 2PDLA 3DFTA 3S2CA 3DKJA 4H7ZA 2WO5A 2QR6A 5D2WA 1LQAA 5AB3A 2GSHA 1XRFA 3BLIA 6A3HA 2G50A 2W9MA 4I9JA 1TPUA 5DXYA 3RPMA 2E6YA 4CU6A 4TOQA 3GFXA 1R86A 3LCFA 3UG5A 1LL4A 3M5ZA 4HMEA 3N1AA 3I65A 4NX0A 1VYRA 2BGNE 4RXFA 1EB3A 1XYAA 1B3YA 3GFYA 2YR1A 1F61A 2O92A 3T81A 4AWSA 2V3EA 4GQRA 2UV8G 3A64A 2QCNA 2GL5A 2OFJA 1N55A 1BEUA 1LOLA 3MSRA 4NASA 3QR1A 3TCSA 3WQOA 3MUCA 1DL3A 1TVNA 1ADOA 1IIGA 4A21A 3HIJA 2VM8A 1KTNA 3B0PA 3WNNA 3CM4A 1AODA 2J9YA 1Q6FA 1OK4A 2VFIA 3I6RA 3PULA 5C5YA 5A95A 3LCGA 4O14A 1XIFA 3Q58A 1E6RA 1XLIA 4P7NA 1TVLA 4DJEA 3OYZA 1KXHA 1H1NA 4OGZA 4RE4A 4WZHA 3RPTA 1J4EA 4OQVA 4FK9A 2Y70A 3MUXA 3H7UA 3KBWA 4L4OA 2I1OA 1Z8AA 3MZNA 1Y7VA 2PDBA 1KXVA 1GEHA 2PDIA 3UXDA 5BROA 3W75A 3GG1A 1TELA 1VC4A 2PPGA 2XPKA 4GI6A 1L6GA 5L6UA 3QW4B 4UNLA 2NQ9A 3W7EA 3W00A 1HZYA 5AKQA 3LGDA 2ZUWA 4B5WA 1PJ9A 3CAVA 3L5LA 2YOCA 4Y9MA 1EJVC 4HCDA 1RALA 1EL3A 1JNEA 1GW9A 3A47A 4B5SA 3BSHA 4Q6JA 1W2VA 3VNYA 1YTEA 4ADUA 1JCXA 4RE2A 1LLOA 3NQBA 3VUSA 2NQJA 4XO7A 1K1DA 3MKKA 4IIHA 3CYVA 4PCTA 4BEUA 1AMKA 3UU0A 2FGZA 4H9MA 4RUBA 1UR9A 4GQQA 1TV8A 4BQ2A 3E6EA 1I9CB 4J3XA 1X98A 4HK5A 1ICPA 3TYDA 1GKRA 2VEPA 4QTGA 2FZMA 5ECUA 2CKRA 2VWTA 3VOJA 1S39A 4DI9A 1KCKA 1TMHA 3IRDA 1VJZA 2VEIA 1LRNA 2INEA 1K7EA 3U2OA 3ZO9A 3GYEA 4DQWA 2B4GA 3MP5A 1B4EA 3OZOA 4TO8A 2O4MA 3QY8A 4E6MA 4AWEA 3R4IA 2PGWA 2OT0A 2DZPA 4DJEC 2B7NA 1EBGA 1AQ0A 3KOWA 3OGSA 3R94A 4YPJA 4H9TA 3IANA 3QTGA 4V2XA 2HS8A 2QKFA 1NEYA 2IW0A 3WQ5A 3QYSA 4JTDA 3DXIA 3D3AA 3PJTA 3PG8A 1DJYA 4HMCA 4AZCA 3KRUA 1HP5A 3V18A 5DCDA 2VDGA 4MAVA 2GGIA 3W53A 1XUZA 4C65A 4AD4A 4RR4A 4IFKB 3FW6A 3OZPA 5E9AA 2Y61A 4G8TA 4I9MA 2CU0A 4F79A 3ECQA 1PZ3A 3OVGA 3PWGA 1KBBA 2Y0FA 4A2SA 4D6JA 4PL1A 4ZEPA 4Y2WA 1EKOA 3RJYA 1NDZA 2YB1A 2D24A 4W7WA 2IPJA 1TPDA 3T0DA 3LENA 1E43A 3QGAC 4KCUA 3TK7A 1BGAA 3RU8X 2W67A 4KEUA 3WLQA 4N4PA 3LCXA 2REQB 2UY4A 4KS0A 3AMLA 4GFIA 5EBAA 3LSBA 4CN4A 1IEIA 2QDGA 3WELA 1XFCA 2C8NA 3UW6A 4DN1A 2ZXAA 2RKXA 4UTIA 3H2NA 4HHLA 4AW7A 2EGZA 2NUXA 1J79A 3TTSA 1UIPA 3N2MA 1HO1A 3ARSA 1XXXA 4M82A 5CC5A 2QJMA 4DWDA 2HJPA 2EPMX 2OYMA 1N7KA 4DNMA 4K8EA 3PUOA 3DEQA 2GGJA 1DJQA 5MKGB 1MEWA 3NVTA 1IT0A 4WR3A 4IGHA 3WDJA 1Z89A 1X39A 1J9YA 2A6NA 5I3IA 3EMQA 1R30A 4M6UA 2QS8A 4DVOA 4PN2A 4F40A 1V08A 5D32A 2DUXA 3TAOA 3OYXA 2VDIA 2F2HA 3MMWA 3P60A 1V6UA 1JZ3A 4XTIA 1O5RA 3R5EA 3BV7A 1UP3A 3UZJA 1ICQA 3TKFA 5D05A 3OOQA 1R3TA 2Y5EA 3LI1A 2XN2A 1DWIM 3C2FA 3TONA 4A29A 2G4FA 1CXFA 4MZYA 3THQA 4L7ZA 3MKCA 1A5BA 1RQHA 2OTDA 2ZE0A 3UBPC 1KNWA 5JIPA 4MNJA 4MUPA 2J47A 4K2SA 1W3JA 4QDWA 4JXCA 2R1LA 3C0LA 1UP0A 1XH1A 1ZSXA 2YCEA 4WY0A 4DHGA 1PZ0A 3KDNA 4D9PA 4XZLX 1HO4A 2X1SA 4MWAC 3CL7A 2W79A 3AIUA 1MRQA 1LLZA 3JZEA 5BMXA 4GUIA 4LUJA 4QS5A 2A85A 1EO7A 3SURA 1YRRA 2Q01A 1XS2A 1DOSA 4YNGA 1UZDA 1VHCA 2PZ0A 3TW6A 4A6GA 5T9BG 1A53A 1WDRA 1LP6A 3W6MA 1ECQA 3MPGA 1N8WA 2E9LA 3APTA 2WZMA 3PB2A 3UA4A 3HO8A 4PZVA 1H51A 3OHIA 4S3FA 1ZS2A 4QLLA 4KESA 1PVNA 1VJSA 5LNWA 4UQBA 1J0ZA 3N17A 3ZR6A 1NF7A 1OK6A 3BV4A 3CQJA 4LU0A 3P93A 2OG9A 4S3GA 3GH5A 1EHNA 4XAFA 3CU2A 3C3UA 3WD4A 5I00A 5H91A 5A8GA 2OMAA 1A4LA 1H1YA 4RNIA 5REQA 3U2CA 1H11A 3CPUA 3W7JA 5LSMA 4PUWA 4B92A 5KSWA 4A8NA 3GXNA 4LC6A 3ONBA 3VE9A 4W87A 1MXSA 2HXUA 2VUYA 3GH4A 3DFSA 5U7SA 1UWRA 3SY8A 3DERA 2E28A 5CSYA 3IAQA 3W1NA 3SY1A 3ZR5A 2FZBA 2VX6A 5JBDA 2VYOA 4H4IA 1JGMA 4FX8A 4A35A 1N2VA 1SU5A 1IZCA 1H7PA 4DWSD 1BXCA 1Z6KA 4GNVA 3THCA 3OP2A 3FHQA 1QO2A 2CBIA 4UMBA 1MI3A 4GYPA 3GG8A 2J13A 5H8UA 1MQQA 3FNDA 4ILSA 4AEOA 1GT8A 3AIQA 4GI9A 1XSIA 1NDYA 5I07A 1E3ZA 1PTAA 4PTDA 3ABQA 1TR1A 1XH2A 2DZBA 4DO5A 4YTTA 1A5NC 2GOKA 2PDFA 1ZHAA 4AQLA 3MSYA 5U4NA 3T1GA 4J27A 5AYZA 3VMPA 2F8QA 1FCVA 1Q6QA 3SRFA 2BB0A 4NL1A 1UA3A 4D1IA 4GQGA 2GDUA 3G1HA 4QQUA 2VGGA 2VNCA 3D6NA 1JUEA 1S2VA 2OKTA 5KZDA 5C54A 1XLGA 3AYSA 5G4HC 2JIEA 4KFOA 5CZSA 1F5ZA 4FAMA 1IR1A 4L1GA 1LL6A 4W89A 4IL2A 1DE5A 2E5CA 3RM9A 2GK1B 1XC4A 1F3WA 2ZFAA 4K7YA 3HQPA 3NL2A 3U4AA 5AYYA 2CC0A 1W5OA 3EWBX 1RR2A 3I7RA 2NQZA 3G6LA 2TAAA 2IQDA 1DV7A 1EQPA 3ARPA 1ISWA 4FXRA 3W29A 2VDHA 2J27A 4CD5A 4OU1A 4QJ1A 5E0KA 2X30A 2QT3A 4CN6A 2WOQA 3W3OA 2OSYA 2D0FA 3WNOA 3D0CA 2PDQA 4YVPA 5CCZA 4JFUA 4DUVA 3QGKC 3BW4A 1GYNA 3AUOA 3QW3A 1OGSA 1QCWA 1E4MM 3VMNA 2YA1A 2FDMA 1UR0A 1EXPA 5EU9A 3QFEA 1I0DA 3FX4A 1QOQA 1HJWA 1VRDA 1TTJA 4WSJA 4URIA 4U33A 4ZO7A 3TJIA 3HV9A 3VOHA 1Q3NA 4GYJA 4GQ0A 2GSJA 4CGTA 1OX4B 5TD4A 2XGBA 3PBMA 2QCCA 2GJRA 1VBRA 2WKLA 1W37A 3RG6A 1R3YA 1WUEA 3NZPA 3TYAA 2RDTA 1AL7A 2R6OA 1O7AA 4PEKA 1V8EA 1H09A 4XZ9A 5DX7A 5CG0A 2ZKMX 4S3BA 1SR0A 4GUJA 3N9RA 4PA8A 9XIAA 4PUNA 1RA5A 1T41A 4MWAB 5DY3A 3UXLA 1IHIA 4XX6A 5IDIA 3BZJA 3DFOA 3MUY1 1VBGA 4Q8QA 1U22A 2CZEA 3WK3A 4YHEA 4H2CA 3VE7A 3S83A 2D3LA 5LGZA 3AHTA 1XHGA 3QMRA 4NIRA 4Y96A 3EA1A 1ZUAX 2B0MA 4JN8A 2WVSA 2E68A 4G56A 1W3IA 4O1AA 1NFPA 2OELA 1ZBVA 3PM6A 1OABA 2J8TA 2W5FA 2ZUVA 4BJHA 3CNYA 3GG0A 4TVCA 3EKGA 1E4LA 3A4XA 3W37A 1ISVA 3OLGA 4ICCX 4XUGA 1YXDA 2X7WA 1M3UA 2DU2A 5T26A 1LLWA 4KPLA 3PZ9A 1KM6A 3FY1A 1XRTA 5HMSA 4JL1A 4RKAA 5CAHA 1E51A 4B15A 3N2CA 3D5HA 3CL8A 4UQAA 2FVMA 4WQ6A 1WBHA 3N18A 2J9XA 3IARA 5HUOA 4Z2IA 4AZHA 3QZEA 1VKFA 4W88A 1NTHA 3G0SA 1DIOA 1DJXA 4O18A 3GDBA 2DH2A 3H54A 3VGHA 3SGGA 4OZOA 3AWNA 2A7RA 3FGCB 3T9PA 5IRPA 2VD8A 3HPAA 3GB6A 1W1TA 3CMFA 4J4KA 1UD6A 2POTA 4F3HA 4UTMA 1AFSA 3LCIA 4ZE5A 4LBRA 2ATSA 2PC4A 5FJTA 4XAPA 3JW7A 3CBWA 4O0ZA 3FK4A 3C3NA 3R43A 4GX9A 3G2GA 1YMYA 4TX6A 4WKAA 2ZZ2A 2I14A 4W86A 5I79A 4E8CA 3C0QA 3PZIA 2E5DA 4HNNA 4D6GA 4GIEA 2Y7EA 4XAGA 5IOBA 3O1NA 4GIRA 4Y9PA 2G3NA 4DF1A 4I6KA 1CXLA 2E40A 2J6VA 2XH0A 1XWYA 3JU2A 1MWOA 3VIPA 1Z32X 1XBXA 2WJFA 1V3HA 4JFWA 1UZHA 3WLJA 1CB2A 2O55A 3DOPA 1CXHA 4RNFA 4JR5A 5KTLA 4GC3A 1JDAA 2E0PA 6XIMA 3SDOA 1W3HA 3URQA 4JD4A 4F66A 1A0CA 1ZB5A 2C1GA 2ISVA 4IMCA 2YBVA 1EBHA 5IBXC 1TPWA 4XD5A 4JTKA 3QHNA 4YU1A 5A6JA 3UR2A 2TSYA 1UWSA 3N4AA 3A3XA 1UB3A 3S2MA 3U2ZA 4FHAA 3I3EA 5CPSA 1GQIA 3DAQA 1RHCA 4MIMA 1WB0A 4LX4A 1TPB1 4MOZA 3MUAA 3SGUA 3IUDA 3EWWA 1RPKA 3C2VA 4CD7A 3R8RA 2D2HA 5I24A 1LBFA 2XDFA 1F6YA 3K8MA 1JL8A 1RJRA 4HB7A 5BU6A 4QDPA 3P82A 2A4AA 4H9ZA 2OOGA 3EB3A 5F2MA 3IJ6A 2ZZ4A 1YIXA 5MKGA 3G1SA 2NLYA 4H2HA 2W61A 2Y8UA 3B05A 2TRSA 3MP3A 3VNLA 4XBJA 4H9YA 1W31A 5FJPA 1XR2A 1AW5A 2FFCA 2Z1WA 3B3DA 3EWUA 4US5D 4JTJA 3E5PA 1PWLA 1AH0A 2BLEA 5FACA 1RXOB 3KL5A 1LROA 1ITCA 3QY7A 3V36A 2VJXA 2ZOXA 2XU2A 2D2OA 4LUIA 5CBBA 2GWGA 2GJXB 1S5WA 4ZO9A 3T6CA 2XWDA 4JTQA 4UMCA 2AAMA 4NJGA 1LQ2A 1EJUC 4A3RA 3IK2A 2HXTA 4I7UA 1IEQA 5CPTA 2V2DA 1RY0A 3O2LA 4KWVA 3PAOA 4UXDA 3SJNA 4MUZA 2DVXA 3EOUA 3CUFA 1NFBA 4IIBA 1J0KA 3B9DA 2C0AA 2XVKA 1KGWA 2DVTA 3NQAA 4LSBA 3QSTA 3L4YA 4A8RA 1B9BA 2XVLA 3FGCA 3HGOA 2VKZG 4JAWA 3PFMA 4LY8A 2WHJA 1J10A 5CXPA 5DFAA 3ZSTA 1WYIA 1ZBCA 4AHQA 1HVQA 4JX5A 3TA9A 6ENLA 4Q4QA 1DWAM 2PWHA 4QLKA 4Z2HA 1J0JA 4QITA 3QBUA 3NAVA 1AQMA 2I9EA 1KFEA 5J5DA 2DSUA 2CFFA 3KTXA 3UGRA 4MB4A 3QQ0A 3PP7A 2BXVA 5CSUA 1ZZMA 1X8CA 3U5YA 4GCXA 1A5LC 4TVDA 3VDCA 4UTFA 4C6LA 3WQVA 3PN8A 2PDPA 4NJHA 4S3CA 3HB9A 3BUVA 3GIPA 4HK6A 1S3HA 1JD7A 2F6KA 3W1XA 1VF8A 2E6AA 1I2OA 1XKYA 3GIQA 3AIRA 4NAFA 3R89A 4V28A 1R3RA 3WQ4A 4NAEA 2F2KA 4UWMA 3AZRA 3G8EA 3NM3A 3WNLA 1M1BA 3G1FA 3GNOA 3WNKA 3W7CA 4FI4A 1OT2A 3TFXA 1W6TA 1WX0A 4NHVA 5AHNA 2BY0A 4JL2A 1ODZA 4RW3A 1FWAC 3U3HA 1GVEA 1UPPA 2WSQA 1IZJA 2NV2A 2YA2A 3GE7A 1TZZA 3AAMA 4YIWA 3RDKA 4FPSA 2V30A 2NXHA 3AU6A 4ZOBA 3O16A 3H2MA 4EXBA 3M0VA 3VOFA 5HJYA 4Q6XA 2EKGA 5HJXA 3WLMA 3DFPA 1OX4A 4CNTA 2H3BA 4FNPA 5BOFA 3OBEA 3IK4A 4Q4SA 3M41A 1LT7A 3DGRA 3UG3A 3FSUA 4IQLA 1HN1A 1A5MC 3B8IA 3SAZA 4CQDA 1ZCCA 5ABFA 2FMNA 1U1HA 4KFNA 1AJZA 2NQ5A 2BDQA 3REQA 3R1ZA 3VUPA 2E5BA 3R2GA 5FAGA 1SGJA 1UKSA 1RQBA 4NU7A 3CUGA 2WM1A 2Y7FA 5I3KA 2ZZ3A 1D2KA 1UZ1A 1AVAA 1OCQA 4IIFA 1P0NA 3VTRA 2HMCA 3BURA 2VZVA 2JGQA 3BCFA 3GW3A 3E9AA 1DQUA 4ZFMA 2G3FA 1G4EA 3W22A 1TPFA 1XBVA 3QM3A 1JZ2A 4IGSA 3TTQA 2NSXA 5J5RA 3H26A 5L9FA 4UIOA 3R7MA 5M03A 4ZQRA 4P8XA 4E8GA 4GVHA 3QQ1A 4KGLA 4CD4A 4FSAA 1BFNA 5BW6A 1EP2A 4HN4A 4UC5A 4YTSA 3GY1A 3NSXA 3MHUA 3PTQA 3T0BA 4US5A 2OWWA 3MBDA 5EMYA 3PAJA 4D71A 2ZUTA 2CLOA 2R9RA 1A3WA 3U48A 1IWBA 2W92A 1FWEC 4JIPA 3WJZA 1CGXA 4PMDA 3O15A 4GK8A 1BQGA 4FNQA 4NILA 4QR6A 1DJWA 3IRSA 1FWIC 2I9UA 1O5XA 4LXFA 4QEEA 5FF2A 1I6NA 3XINA 2ZCGA 5A6BA 1XICA 3WNMA 4Q8VA 5C9XA 3KM8A 3G22A 1WKEA 4H8UA 1E40A 4YCPA 3QZAA 5DY2A 4KCVA 5FI8A 5D9MA 7REQB 4F0HA 4M0XA 1LWIA 3CYJA 4LYRA 4REQB 4FX6M 3N2BA 2BY3A 3WQGA 1SJCA 1YDVA 1FWBC 4E8DA 3WK2A 1M7OA 5D02A 3TN5A 1OF6A 1B3VA 3N34A 3C56A 1FRBA 4ZXOA 5C9ZA 1P0EA 4UBPC 1QI5A 4WOQA 3P14A 4PUMA 2VL4A 3AO0A 4UNIA 4L80A 2ZRUA 2OJPA 4N9DA 3GHTA 2YJQA 2OEMA 4KEMA 4RE3A 4RZ6A 4AC1X 4O15A 1E1FA 2ATMA 3VKKA 3JRKA 4U5IA 1RCXB 1UWTA 1LUCB 1ZJAA 4K68A 4J1OA 2XISA 3P6LA 2WZHA 4XWUA 2GVGA 2NZLA 4PGLA 4QHRA 3N12A 1EDTA 1LM1A 3CT7A 4TTGA 5D30A 5FKYA 4CNUA 4CUCA 1TIWA 3V7PA 5F2IA 1H62A 1WBJA 3E49A 4O16A 4WDWA 4O54A 3SCNA 1TPC1 4JTTA 5EPDA 2OGYA 1FWNA 4PUDA 2XYLA 1Q6OA 5J04A 1KWKA 4PRRA 1K03A 3W83A 5AZ0A 2CNCA 4I5RA 2RFGA 3U6WA 3THUA 1L2QA 1JCJA 4ZQMA 3CS2A 4F9JA 5LA1A 4UB9A 3E3HA 3C8NA 5FIPA 3F2CA 3DFYA 3EXRA 4AUBA 3SFKA 4MPQA 2YLLA 2WMKA 3BC9A 3SUTA 4GY0A 4JN7A 2J9ZA 4L4PA 4WDTA 4HNVA 4LYPA 5I06A 1QHOA 2WM0A 5CC6A 5LIYX 2ABBA 3TWBA 7XIMA 5A69A 3ZWSA 3SQSA 2YZRA 1V79A 3KFTA 1TREA 1TX0A 3ZZ1A 3LHUA 1C90A 3CH0A 3Q4DA 1RD6A 3LK6A 3S5ZA 1L2UA 3W7KA 3M1ZA 1H7NA 1EWEA 1QU4A 2I17A 1DQWA 1H7WA 3URBA 2OZ8A 3JS3A 5FEWA 4HYWA 4ZENA 5FF7A 4G9PA 3HMCA 1EA9C 3LXCA 3MVIA 2C91A 1LYXA 3E02A 4UTTC 4GE8A 1NH6A 2QGHA 4HOWA 4DBDA 2QV4A 4DJFC 1KGXA 3M7SA 1PX4A 1WDDA 2YDQA 1QXLA 2V3FA 3GXDA 2PDUA 4D6IA 1UH4A 1AQFA 2OXNA 4ZCWA 2WBKA 1PZ1A