1G6MA

Nmr solution structure of cbt2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
62
structure length
62
Chain Sequence
LECHNQQSSQTPTTTGCSGGENNCYKKEWRDNRGYRTERGCGCPSVKKGIGINCCTTDRCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHORT NEUROTOXIN 1
publication title NMR Solution structure of CBT2
rcsb
molecule tags Toxin
total genus 7
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2000-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1g6mA00
1HAAA 1F94A 1M9ZA 2QJBC 4EY8B 2MUPA 1TXBA 2H5FA 2MFAA 4BIKB 4FAOE 1BTEA 1FASA 1KBSA 1LXGA 3ERAA 3EBXA 3NEQA 2H62C 1KBAA 1IDIA 1I02A 1CTXA 3PLCA 1G6MA 2N99A 3U73U 1IDHA 1NTXA 1ZADA 3NDSA 2H7ZA 2UWRA 1L4WA 1KFHA 5DZ5A 2LCRA 4DO8A 1ERGA 1XT3A 5IMTD 1RGJA 3EVSC 2L03A 1ONJA 1FSSB 1KXIA 3NH7A 1HAJA 3QB4B 1COEA 1NORA 1V6PA 5IMYC 4OM5A 2ABXA 1CDTA 2NBTA 3FEVA 1KU6B 2BHIA 3KFDE 1KC4A 1S4YA 1IK8A 2J8BA 1NTNA 4HQPF 6EBXA 1CRFA 1NEAA 1LJZA 2I9BE 2H64C 4BDTB 1IQ9A 4RUDA 1ERAA 1HC9A 5DO6A 2JQPA 1FFJA 1MR6A 5EBXA 1ES7B 1NYUA 2QJAC 1RL5A 2VLWA 1VB0A 2PJYB 1CXOA 2FD6U 1CB9A 1DRSA 1TGXA 2OFSA 4AEAA 2H7ZB 2MHYA 3KFDI 2CDXA 1CDRA 2L5SA 1IKCA 4UY2C 1UG4A 2CRTA 2MJ0A 1QKEA 1FF4A 2CRSA 3BT2U 1MAHF 4OM4A 1KS6A 1TXAA 1QKDA 1CDSA 3U74U 2MJ4A 2H62D 1JGKA 2JVEA 2H8UA 3LAQU 2CCXA 4FAOC 4P7UA 1KL8A 3BT1U 4IYEA 5DU1A 1CDQA 1REWC 1FSCA 1NXBA 2HLQA 1HC9B 1YWHA 1ABTA 1PLOA 1LSIA 2X8BB 2QC1A 2GOOB 3HH7A 1JE9A 1NYSA 4QTIU 1LXHA 1QM7A 1B41B 1TFSA 1FRAA 1HOYA 1KTZB 1BXPA 1CCQA 4LFTA 1IJCA 2LA1A 2PJYC 4XJJA 1CREA 2MUOA 1CVOA 2K3GA 2HLRA 2QJ9C 1IDGA 2GOOC 2CTXA 2MJYA 1H0JA 1KBTA 1IDLA 3VTSA 1CXNA 1CHVS 2BTXA 4ZQYA 2ERAA 1F8UB 1LX5B 1JBDA 2H64B 1W6BA 1CODA 2UX2A
chains in the Genus database with same CATH superfamily
1HAAA 1F94A 1M9ZA 2QJBC 4EY8B 2MUPA 1TXBA 2H5FA 2MFAA 4BIKB 4FAOE 1BTEA 1FASA 1KBSA 1LXGA 3ERAA 3EBXA 3NEQA 2H62C 1KBAA 1IDIA 1I02A 1CTXA 3PLCA 1G6MA 2N99A 3U73U 1IDHA 1NTXA 1ZADA 3NDSA 2H7ZA 2UWRA 1L4WA 1KFHA 5DZ5A 2LCRA 4DO8A 1ERGA 1XT3A 5IMTD 1RGJA 3EVSC 2L03A 1ONJA 1FSSB 1KXIA 3NH7A 1HAJA 3QB4B 1COEA 1NORA 1V6PA 5IMYC 4OM5A 2ABXA 1CDTA 2NBTA 3FEVA 1KU6B 2BHIA 3KFDE 1KC4A 1S4YA 1IK8A 2J8BA 1NTNA 4HQPF 6EBXA 1CRFA 1NEAA 1LJZA 2I9BE 2H64C 4BDTB 1IQ9A 4RUDA 1ERAA 1HC9A 5DO6A 2JQPA 1FFJA 1MR6A 5EBXA 1ES7B 1NYUA 2QJAC 1RL5A 2VLWA 1VB0A 2PJYB 1CXOA 2FD6U 1CB9A 1DRSA 1TGXA 2OFSA 4AEAA 2H7ZB 2MHYA 3KFDI 2CDXA 1CDRA 2L5SA 1IKCA 4UY2C 1UG4A 2CRTA 2MJ0A 1QKEA 1FF4A 2CRSA 3BT2U 1MAHF 4OM4A 1KS6A 1TXAA 1QKDA 1CDSA 3U74U 2MJ4A 2H62D 1JGKA 2JVEA 2H8UA 3LAQU 2CCXA 4FAOC 4P7UA 1KL8A 3BT1U 4IYEA 5DU1A 1CDQA 1REWC 1FSCA 1NXBA 2HLQA 1HC9B 1YWHA 1ABTA 1PLOA 1LSIA 2X8BB 2QC1A 2GOOB 3HH7A 1JE9A 1NYSA 4QTIU 1LXHA 1QM7A 1B41B 1TFSA 1FRAA 1HOYA 1KTZB 1BXPA 1CCQA 4LFTA 1IJCA 2LA1A 2PJYC 4XJJA 1CREA 2MUOA 1CVOA 2K3GA 2HLRA 2QJ9C 1IDGA 2GOOC 2CTXA 2MJYA 1H0JA 1KBTA 1IDLA 3VTSA 1CXNA 1CHVS 2BTXA 4ZQYA 2ERAA 1F8UB 1LX5B 1JBDA 2H64B 1W6BA 4KSNA 1CODA 2UX2A
chains in the Genus database with same CATH topology
1HAAA 1F94A 1M9ZA 2QJBC 4EY8B 2MUPA 1TXBA 2H5FA 2MFAA 4BIKB 4FAOE 1BTEA 1FASA 1KBSA 1LXGA 3ERAA 3EBXA 3NEQA 2H62C 1KBAA 1IDIA 1I02A 1CTXA 3PLCA 1G6MA 2N99A 3U73U 1IDHA 1NTXA 1ZADA 3NDSA 2H7ZA 2UWRA 1L4WA 1KFHA 5DZ5A 2LCRA 4DO8A 1ERGA 1XT3A 5IMTD 1RGJA 3EVSC 2L03A 1ONJA 1FSSB 1KXIA 3NH7A 1HAJA 3QB4B 1COEA 1NORA 1V6PA 5IMYC 4OM5A 2ABXA 1CDTA 2NBTA 3FEVA 1KU6B 2BHIA 3KFDE 1KC4A 1S4YA 1IK8A 2J8BA 1NTNA 4HQPF 6EBXA 1CRFA 1NEAA 1LJZA 2I9BE 2H64C 4BDTB 1IQ9A 4RUDA 1ERAA 1HC9A 5DO6A 2JQPA 1FFJA 1MR6A 5EBXA 1ES7B 1NYUA 2QJAC 1RL5A 2VLWA 1VB0A 2PJYB 1CXOA 2FD6U 1CB9A 1DRSA 1TGXA 2OFSA 4AEAA 2H7ZB 2MHYA 3KFDI 2CDXA 1CDRA 2L5SA 1IKCA 4UY2C 1UG4A 2CRTA 2MJ0A 1QKEA 1FF4A 2CRSA 3BT2U 1MAHF 4OM4A 1KS6A 1TXAA 1QKDA 1CDSA 3U74U 2MJ4A 2H62D 1JGKA 2JVEA 2H8UA 3LAQU 2CCXA 4FAOC 4P7UA 1KL8A 3BT1U 4IYEA 5DU1A 1CDQA 1REWC 1FSCA 1NXBA 2HLQA 1HC9B 1YWHA 1ABTA 1PLOA 1LSIA 2X8BB 2QC1A 2GOOB 3HH7A 1JE9A 1NYSA 4QTIU 1LXHA 1QM7A 1B41B 1TFSA 1FRAA 1HOYA 1KTZB 1BXPA 1CCQA 4LFTA 1IJCA 2LA1A 2PJYC 4XJJA 1CREA 2MUOA 1CVOA 2K3GA 2HLRA 2QJ9C 1IDGA 2GOOC 2CTXA 2MJYA 1H0JA 1KBTA 1IDLA 3VTSA 1CXNA 1CHVS 2BTXA 4ZQYA 2ERAA 1F8UB 1LX5B 1JBDA 2H64B 1W6BA 4KSNA 1CODA 2UX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HAA A;  1F94 A;  1M9Z A;  2QJB C;  4EY8 B;  2MUP A;  1TXB A;  2H5F A;  2MFA A;  4BIK B;  4FAO E;  1BTE A;  1FAS A;  1KBS A;  1LXG A;  3ERA A;  3EBX A;  3NEQ A;  2H62 C;  1KBA A;  1IDI A;  1I02 A;  1CTX A;  3PLC A;  1G6M A;  2N99 A;  3U73 U;  1IDH A;  1NTX A;  1ZAD A;  3NDS A;  2H7Z A;  2UWR A;  1L4W A;  1KFH A;  5DZ5 A;  2LCR A;  4DO8 A;  1ERG A;  1XT3 A;  5IMT D;  1RGJ A;  3EVS C;  2L03 A;  1ONJ A;  1FSS B;  1KXI A;  3NH7 A;  1HAJ A;  3QB4 B;  1COE A;  1NOR A;  1V6P A;  5IMY C;  4OM5 A;  2ABX A;  1CDT A;  2NBT A;  3FEV A;  1KU6 B;  2BHI A;  3KFD E;  1KC4 A;  1S4Y A;  1IK8 A;  2J8B A;  1NTN A;  4HQP F;  6EBX A;  1CRF A;  1NEA A;  1LJZ A;  2I9B E;  2H64 C;  4BDT B;  1IQ9 A;  4RUD A;  1ERA A;  1HC9 A;  5DO6 A;  2JQP A;  1FFJ A;  1MR6 A;  5EBX A;  1ES7 B;  1NYU A;  2QJA C;  1RL5 A;  2VLW A;  1VB0 A;  2PJY B;  1CXO A;  2FD6 U;  1CB9 A;  1DRS A;  1TGX A;  2OFS A;  4AEA A;  2H7Z B;  2MHY A;  3KFD I;  2CDX A;  1CDR A;  2L5S A;  1IKC A;  4UY2 C;  1UG4 A;  2CRT A;  2MJ0 A;  1QKE A;  1FF4 A;  2CRS A;  3BT2 U;  1MAH F;  4OM4 A;  1KS6 A;  1TXA A;  1QKD A;  1CDS A;  3U74 U;  2MJ4 A;  2H62 D;  1JGK A;  2JVE A;  2H8U A;  3LAQ U;  2CCX A;  4FAO C;  4P7U A;  1KL8 A;  3BT1 U;  4IYE A;  5DU1 A;  1CDQ A;  1REW C;  1FSC A;  1NXB A;  2HLQ A;  1HC9 B;  1YWH A;  1ABT A;  1PLO A;  1LSI A;  2X8B B;  2QC1 A;  2GOO B;  3HH7 A;  1JE9 A;  1NYS A;  4QTI U;  1LXH A;  1QM7 A;  1B41 B;  1TFS A;  1FRA A;  1HOY A;  1KTZ B;  1BXP A;  1CCQ A;  4LFT A;  1IJC A;  2LA1 A;  2PJY C;  4XJJ A;  1CRE A;  2MUO A;  1CVO A;  2K3G A;  2HLR A;  2QJ9 C;  1IDG A;  2GOO C;  2CTX A;  2MJY A;  1H0J A;  1KBT A;  1IDL A;  3VTS A;  1CXN A;  1CHV S;  2BTX A;  4ZQY A;  2ERA A;  1F8U B;  1LX5 B;  1JBD A;  2H64 B;  1W6B A;  1COD A;  2UX2 A; 
#chains in the Genus database with same CATH topology
 1HAA A;  1F94 A;  1M9Z A;  2QJB C;  4EY8 B;  2MUP A;  1TXB A;  2H5F A;  2MFA A;  4BIK B;  4FAO E;  1BTE A;  1FAS A;  1KBS A;  1LXG A;  3ERA A;  3EBX A;  3NEQ A;  2H62 C;  1KBA A;  1IDI A;  1I02 A;  1CTX A;  3PLC A;  1G6M A;  2N99 A;  3U73 U;  1IDH A;  1NTX A;  1ZAD A;  3NDS A;  2H7Z A;  2UWR A;  1L4W A;  1KFH A;  5DZ5 A;  2LCR A;  4DO8 A;  1ERG A;  1XT3 A;  5IMT D;  1RGJ A;  3EVS C;  2L03 A;  1ONJ A;  1FSS B;  1KXI A;  3NH7 A;  1HAJ A;  3QB4 B;  1COE A;  1NOR A;  1V6P A;  5IMY C;  4OM5 A;  2ABX A;  1CDT A;  2NBT A;  3FEV A;  1KU6 B;  2BHI A;  3KFD E;  1KC4 A;  1S4Y A;  1IK8 A;  2J8B A;  1NTN A;  4HQP F;  6EBX A;  1CRF A;  1NEA A;  1LJZ A;  2I9B E;  2H64 C;  4BDT B;  1IQ9 A;  4RUD A;  1ERA A;  1HC9 A;  5DO6 A;  2JQP A;  1FFJ A;  1MR6 A;  5EBX A;  1ES7 B;  1NYU A;  2QJA C;  1RL5 A;  2VLW A;  1VB0 A;  2PJY B;  1CXO A;  2FD6 U;  1CB9 A;  1DRS A;  1TGX A;  2OFS A;  4AEA A;  2H7Z B;  2MHY A;  3KFD I;  2CDX A;  1CDR A;  2L5S A;  1IKC A;  4UY2 C;  1UG4 A;  2CRT A;  2MJ0 A;  1QKE A;  1FF4 A;  2CRS A;  3BT2 U;  1MAH F;  4OM4 A;  1KS6 A;  1TXA A;  1QKD A;  1CDS A;  3U74 U;  2MJ4 A;  2H62 D;  1JGK A;  2JVE A;  2H8U A;  3LAQ U;  2CCX A;  4FAO C;  4P7U A;  1KL8 A;  3BT1 U;  4IYE A;  5DU1 A;  1CDQ A;  1REW C;  1FSC A;  1NXB A;  2HLQ A;  1HC9 B;  1YWH A;  1ABT A;  1PLO A;  1LSI A;  2X8B B;  2QC1 A;  2GOO B;  3HH7 A;  1JE9 A;  1NYS A;  4QTI U;  1LXH A;  1QM7 A;  1B41 B;  1TFS A;  1FRA A;  1HOY A;  1KTZ B;  1BXP A;  1CCQ A;  4LFT A;  1IJC A;  2LA1 A;  2PJY C;  4XJJ A;  1CRE A;  2MUO A;  1CVO A;  2K3G A;  2HLR A;  2QJ9 C;  1IDG A;  2GOO C;  2CTX A;  2MJY A;  1H0J A;  1KBT A;  1IDL A;  3VTS A;  1CXN A;  1CHV S;  2BTX A;  4ZQY A;  2ERA A;  1F8U B;  1LX5 B;  1JBD A;  2H64 B;  1W6B A;  4KSN A;  1COD A;  2UX2 A; 
#chains in the Genus database with same CATH homology
 1HAA A;  1F94 A;  1M9Z A;  2QJB C;  4EY8 B;  2MUP A;  1TXB A;  2H5F A;  2MFA A;  4BIK B;  4FAO E;  1BTE A;  1FAS A;  1KBS A;  1LXG A;  3ERA A;  3EBX A;  3NEQ A;  2H62 C;  1KBA A;  1IDI A;  1I02 A;  1CTX A;  3PLC A;  1G6M A;  2N99 A;  3U73 U;  1IDH A;  1NTX A;  1ZAD A;  3NDS A;  2H7Z A;  2UWR A;  1L4W A;  1KFH A;  5DZ5 A;  2LCR A;  4DO8 A;  1ERG A;  1XT3 A;  5IMT D;  1RGJ A;  3EVS C;  2L03 A;  1ONJ A;  1FSS B;  1KXI A;  3NH7 A;  1HAJ A;  3QB4 B;  1COE A;  1NOR A;  1V6P A;  5IMY C;  4OM5 A;  2ABX A;  1CDT A;  2NBT A;  3FEV A;  1KU6 B;  2BHI A;  3KFD E;  1KC4 A;  1S4Y A;  1IK8 A;  2J8B A;  1NTN A;  4HQP F;  6EBX A;  1CRF A;  1NEA A;  1LJZ A;  2I9B E;  2H64 C;  4BDT B;  1IQ9 A;  4RUD A;  1ERA A;  1HC9 A;  5DO6 A;  2JQP A;  1FFJ A;  1MR6 A;  5EBX A;  1ES7 B;  1NYU A;  2QJA C;  1RL5 A;  2VLW A;  1VB0 A;  2PJY B;  1CXO A;  2FD6 U;  1CB9 A;  1DRS A;  1TGX A;  2OFS A;  4AEA A;  2H7Z B;  2MHY A;  3KFD I;  2CDX A;  1CDR A;  2L5S A;  1IKC A;  4UY2 C;  1UG4 A;  2CRT A;  2MJ0 A;  1QKE A;  1FF4 A;  2CRS A;  3BT2 U;  1MAH F;  4OM4 A;  1KS6 A;  1TXA A;  1QKD A;  1CDS A;  3U74 U;  2MJ4 A;  2H62 D;  1JGK A;  2JVE A;  2H8U A;  3LAQ U;  2CCX A;  4FAO C;  4P7U A;  1KL8 A;  3BT1 U;  4IYE A;  5DU1 A;  1CDQ A;  1REW C;  1FSC A;  1NXB A;  2HLQ A;  1HC9 B;  1YWH A;  1ABT A;  1PLO A;  1LSI A;  2X8B B;  2QC1 A;  2GOO B;  3HH7 A;  1JE9 A;  1NYS A;  4QTI U;  1LXH A;  1QM7 A;  1B41 B;  1TFS A;  1FRA A;  1HOY A;  1KTZ B;  1BXP A;  1CCQ A;  4LFT A;  1IJC A;  2LA1 A;  2PJY C;  4XJJ A;  1CRE A;  2MUO A;  1CVO A;  2K3G A;  2HLR A;  2QJ9 C;  1IDG A;  2GOO C;  2CTX A;  2MJY A;  1H0J A;  1KBT A;  1IDL A;  3VTS A;  1CXN A;  1CHV S;  2BTX A;  4ZQY A;  2ERA A;  1F8U B;  1LX5 B;  1JBD A;  2H64 B;  1W6B A;  4KSN A;  1COD A;  2UX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...