1G7JB

Crystal structure of hen egg white lysozyme (hel) complexed with the mutant anti-hel monoclonal antibody d1.3 (vlw92h)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
112
Chain Sequence
QVQLQESGPGLVSLSITCTVSGFSLTGYGVNWVRQPPGKGLEWLGMIWGDGNTDYNSALKSRLSISKDNSKSQVFLKMNSLHTDDTARYYCARERDYRLDYWGQGTTLTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3
publication title Estimation of the hydrophobic effect in an antigen-antibody protein-protein interface.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase inhibitor/hydrolase
total genus 28
structure length 112
sequence length 116
ec nomenclature
pdb deposition date 2000-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1g7jB00
1VPOH 4HXAH 1NGXA 2P8MB 4NQDD 1OVZA 3BP7A 2XTJE 3GJFK 5D1QB 1IKNC 1HYSC 2H32A 4ERSL 2X4TA 1NFIA 5FDYA 1U3HB 1ETZB 3Q5YA 1JRHH 4RAVB 2G9HA 2HVKA 3FB8A 4OCYH 2D7MA 4P4KB 3C6SB 4HW6A 1U8NB 4QTIH 3UPRA 1QSEB 5H35A 1VEPA 5K9QI 1DBBH 1PG7H 4O02H 3OJDB 3ULUC 3NCJL 1UZ6F 4QT5A 5J12C 3T8XA 4APQC 3AGVA 2DQUH 5I8CB 1X3DA 1NL0H 1CXFA 3O11A 4FA8A 3BP5B 4XPGL 2UV3A 3SDAD 4NYLB 3L95B 5D2LA 2GK2A 4XP1H 1TJIL 5FO8A 1PYWB 3GGWB 5I76A 5CZXC 5E56A 2BVPA 2M1KA 1ZLUK 1ACZA 4PG9A 3RBSA 2ZCHH 3IDGA 4AMKH 1KCSL 4X83A 3V2AR 3DX7A 1JF1A 5IMMB 4Y4HB 1XT5A 4M6NL 1K8DB 3H7BA 4LIQE 2UVFA 1NAKL 2BHUA 3L7FB 1HSBA 3RDTC 4YO0B 4DEPC 4LKCA 5CEYB 3QH3A 3C9NA 4QHMA 5T3ZL 3SCMB 5FDWB 2BERA 4M5YH 3BKMH 4L3CB 4QNPF 1SEQL 3E6FA 4H0GA 3MODH 1HI6B 2R0LH 4XNUL 3CZFB 3T77B 2BDNH 4HWBA 3FHAA 2YD1A 5MP6H 1TNMA 8FABA 4XC3H 2WW8A 4OLYL 2GTWA 1KEGH 4LCWE 3VRIB 1YMHB 1A14H 5JW4R 3DROB 3TBSB 4NFDA 3LKQB 4JFEE 4PJEA 3A6CL 5MERA 1NKOA 1U8KA 2OR8A 3JVGA 1Z2KA 1ZMYA 1BQLL 3D25B 3MV9A 4UIMB 4F80A 2HJKA 4GUPB 2IQAA 5C6WH 5T3XH 1KLUA 4PJAA 1CF8L 3C09B 5MENB 5C2BH 4G9FE 4HKJA 1KELH 5EN2B 1AKJD 1OSPH 4O9HH 1CR9L 4KVNL 4WHDA 4C56A 1MRFH 4MNGE 3H7LA 3RX7A 4YDLC 5C0CB 1INDH 1G1CA 1MCRA 4GRWH 1MWAH 5D1XD 2Z35A 2MCG1 3RVWC 3RWFB 1J8HE 3AAZB 3BX7C 4OZGF 2QQKH 4UU9A 4XPTL 3DETC 3NIDF 1NBQA 3NCEB 3HNSL 1R24B 4LLAA 4MDJB 1MIEH 1MWAA 3N85L 1W0VA 3PDOA 4OZFB 5D6CB 3SGDH 2FR4A 2BNRB 2EDKA 3ZKXC 4MXWL 1Q9LB 3EW3B 3NFNA 1DZBA 2P47B 5EUOB 3ULVD 3MJGX 1A7NH 3W0WA 5C1MB 2MHAB 3IJSA 5DT1H 2V5YA 3QI9A 3NPZB 1IAOB 3LQAC 4JY6A 1JZ2A 3VFSB 5D9SA 4DAGL 5HDQL 1E4XH 2OK0L 1MFCL 3KLSA 4JY5H 4UV7L 4HGWB 2OJEB 3O3AA 3T65A 3TH3T 1JE6A 5E6ID 4UV4L 3EYUL 5CILL 1VCAA 4Q9QL 2J4WL 5D1QD 1FZKA 4LDLB 5DK0B 1BLNA 5CEZL 4QF1A 5C3LD 5M7QA 1TQBB 4Y19B 3CDCA 3OZ9H 2DICA 1U3HD 2CO7B 2ICWJ 3TCXA 1SBSH 3HR5A 3M17B 3BPNB 4PJ9B 4P4KD 2EKSB 1QSED 5EOTB 1A6ZB 3V5KA 2UZIL 1R3JB 4DOHB 1DUYB 1DBKH 2VDRH 4H88H 2EH7H 3BQUA 3OR7A 4L9LA 1FZOB 3RGVB 4JKPH 3QXWA 4OZHF 2D3VA 3B9KC 5SWZB 5EPMA 3MV7A 3NOIA 2OZ4L 1FCGA 1OSZA 4JFXB 4GQ9H 4EZMA 4Z18A 1QVOB 4YHPA 2X4UA 2GT9B 1RUMH 5IB2B 2W0FA 4ZUUB 2GKIA 3D3VE 2VSDA 1S7WA 5IFAL 5F1OB 1F13A 4QRUA 4Y4HD 1LO3L 3RUGB 3SJVB 4ELME 1N59A 3N9GH 3HPJB 5IBUB 3TBTA 3SDXF 2WNGA 1WBZA 4YE4H 3P30H 1MJ8L 3SCMD 2IAMC 2DQHH 3I6KB 4NPYB 4FTVB 4QHNB 3D39A 2ZG1A 3KLDA 1EX0A 4JO4L 3V6OC 1FAIL 4JDZA 4GO6B 1EH9A 2Y5TA 1DQLL 3BH9B 4JPKL 4LLMB 4NO2A 5JHLL 1IQWL 5FV1L 4IOSD 1E6OH 1J1OH 4GXUM 5HVHC 1YUHB 5GS2D 3MLTB 5E8NB 1NCAH 1UCTA 5C0BE 1JCKA 1UM6L 3ARGB 2FNBA 3CFIC 1F90H 2YSSB 5EB9A 4JFYB 3TN0B 3VG9B 2VXVL 5IB5A 1IGJA 2FATH 4U1LA 3KPRA 3OG6B 1PZUB 4XX1G 2WM0A 3WFCL 3UTTE 4X7CC 3INUL 5MEND 1FDLH 5TE6L 1T83C 3PG2A 3MUJA 1HINL 1CU4H 3BRFA 1F6AA 3C8HA 5KW9L 2XZZA 4CU7A 1IEAA 2FIKB 4OFDA 5C0CD 4HUWB 4LVOB 4QRPB 3V0VA 5EBLB 3NPSB 5C3TA 4JFZH 2HLAA 3C6LC 1M6OA 2EYTB 2FH6A 3FB7A 4FQJL 2Q76B 2EDWA 1ZA3A 2DQFB 1U0QA 1MNUH 4Z77B 1FNGA 3LRGA 4LLUB 2AKRB 2BNRD 1I8KB 1G7JA 1AE6L 2ZUXA 1HHGB 3I85A 1MFAL 3PWNB 1KLFA 4JFQB 3P11H 1BJ8A 3DX6B 2R2HA 3VFUB 5J6GA 3MV8E 5ESVB 1RHHA 2O5ZH 2UY7A 4YXKH 4RA3A 2M2DA 1DFBH 2WP3T 3HZVA 2YA2A 4QRTA 1ZLVK 1GH7A 1RVFH 4JZNB 4BK5A 1FNFA 5GS1C 3WIFB 1XF4B 5E2VL 1ERNA 5E9DA 4LL9A 3EJYC 3WHE0 4IDLA 4KVCL 1IL1A 4BSVB 4Y19D 1M7IB 3SE8H 1D5BA 3KAAA 3MRCA 5I74C 3QEUA 4PJ9D 4XPAL 1T89C 1CT8B 3HLAB 5FEBA 4CKVX 4S0TD 1R5WA 4M7LH 1CXKA 2XZAL 3T0DA 4MNQA 5CHNB 3DRQA 4N9OB 2IANE 4KI5E 4CJ0A 5LKNA 3ALXA 4OGAC 4JY4B 3RGVD 4GS7B 4XH2B 3LY6A 4PRAA 3ARDA 5SWZD 4BQ6A 2F74A 4OI8A 5IFJB 2J88H 3I9GL 4YPGA 3QPQD 4MA8H 3P3YA 1VB9A 1QLFA 4BZYA 1A9EA 4FXKB 1OT2A 1JWSA 1EAJA 1FHGA 4HT1H 4NO3B 5LBSH 4ODWA 1NC2A 3WFBH 4PREA 3SJVD 4MZ2A 4PRIB 1VFOA 4HF5L 3O41B 4MQTB 3FT4B 4BA8A 4FTVD 2GSIB 1AHWC 4OBRA 3B2VH 4HIIB 2GAZB 1UEYA 1EEZA 1AGFB 3HC3H 5DJYB 5HHME 2AJSH 5KJRH 5JLZB 4U6VH 3TO4A 4M62L 5D7IE 5DD6A 5FUOL 2NY4C 5CEXA 4JPWH 2Q6WA 4D0CB 1BD2E 1E27A 3H8NA 2EC8A 2Q7YA 1A5FL 2V2WA 1CL7H 1EXUA 1WWBX 5FHAL 1OAUH 5BV7H 3ARGD 3EOTL 5E2JA 1KNOB 3TN0D 2VL5B 3PQYB 4MXQC 5HGAA 4R26H 1XH3B 3MR9A 5FF6B 1FORH 4ELKB 4F9PA 1LP9E 1UVQA 4NKQB 3IFLH 4X4XB 4ZUWA 4YXHH 1MI5B 2LVEA 1BQSA 4Y16C 4WI3A 1QFUL 1JMXA 5IB3A 4YEFA 1PSKH 1AO7E 1IC5L 1KC5H 4QRPD 3B8YA 4H20L 3RPIA 2GI7A 6FABH 2K9UA 2ZZUT 3ZSSA 4XMKH 4KZDH 5KTEH 2VC2L 4NNPH 5HI3C 1WFNA 3IDXL 1RJCA 5ICYB 2P48B 3G5YA 2DJUA 1MFEH 43CAB 3VU2A 1AGDB 1HHJA 4Y89A 4JZOA 1H5BC 2BY2A 2EH8H 2YEZA 1KCVH 1BX2B 3X13B 1FL5A 4NRYA 2YZ8A 2O93L 4HWEL 1T7YA 3HE6B 4OLUL 1ZGLA 3GHEH 2Y36H 4GW1B 5EU4A 1BF8A 1S9WB 2VDMH 2B5IB 1OAYL 3I02A 2VLJE 5T1MB 4JG1L 5IVOA 2Y6SC 3QG6B 4NHUA 5ACZB 4NQVB 2P5EA 4P2RB 4MJ5A 2NY6B 4RFNC 3K7UA 1JYXA 3MRHA 4AEFA 3NH7L 2D7TH 4KK8C 5FFLA 4ODVH 1NLBH 4TPRL 3BDYL 5E0QA 5DJ8A 1GZPB 5CEZD 4GKZA 2VN4A 1NCTA 1OWWA 3VWKC 1C12B 4OAWA 5HYJB 4MA1C 3FQTB 2DBLH 4C55A 3TJHC 2R2CA 5D2LF 3MRFB 2AJUH 5GPRA 4F7TB 1LO5A 3BFOA 4K2UH 3VXSA 3EO9H 4UUJA 3G08B 3OMZA 5FYKL 1HILB 2X1WL 3OKKA 1F5WA 2V7NA 2MOVA 4N68A 4NQDE 2KZ1B 3VA2C 1K3IA 5GGUA 4GMSL 3SGJC 2HP4A 1IKFL 4U3XA 2EO1A 3SKNA 2EE6A 2FECI 1NBYA 2B1AH 2O5XL 3QUKB 1NEUA 4O5LH 1BMGA 1JYVA 5IQ7H 2XWBA 3O3BB 4PRID 1QFWI 4DN4L 4MQXD 1ZHKB 4P48A 2PR4L 5TFSH 3LEYH 3D9AL 3DSFL 4OLVL 3REVB 4M7LT 3GMQA 1A9BB 3D87B 1S5IH 4NWTL 4OI7A 4YUEH 4NT6A 1YPZE 2P49B 5IVNA 4OUUA 4ZQKA 1KBGH 4XMPL 1Q0YL 4OZ4B 4YGVB 4ONHB 2AXGA 5DUMH 2BC4B 2ADJB 5E08L 4NUJA 4CMHB 1WC7B 5C0RH 3N1PC 3LIZH 2D9QB 4P3CL 1XCTB 5I8OL 3F8UB 3OF6A 1CE1L 1P9MC 1ULVA 4KUZL 4JREC 3T1FA 3VXNB 5IFHL 3CNKA 3TM6A 3PQYD 3S36H 3QQ3A 3MRNB 4QXGH 2AGJH 3SPVA 3QFDA 4PLOB 4PJFA 3QNYB 3IU3B 3RJQB 2X1PA 3OHXB 4YR6B 5DRWB 2BRQA 5IJKA 5GJSL 1MI5D 3UBXA 3P4OA 4M43L 1XIWB 5I8EA 3X11A 1MCNA 1RZ8B 3QCTH 2RCSL 4L8DB 4NBYB 3ZDYE 4LGRB 4OCSH 2YXFA 2HT4D 1Q1JH 5ID0B 2VR9A 1RIHL 2AXFB 1IAKB 1SJEB 2CXGA 2BVTA 5F1IB 3VFVB 1MVUB 5DGQA 2XTJC 3WNLA 3P4NA 5JOPD 1RURH 5F97E 1XF3B 4G7YH 1Q72L 5INCB 2YRPA 1RIVL 1VHPA 3CU1A 3CH1B 3V7MA 4XVTH 5JO5A 2Q86A 3RY5A 5A1AA 1FNLA 3GO1H 5BMFH 1M71A 4JAMA 1CDCA 3WUWA 3LSOA 5CJXA 3W2DH 3HE6D 3GM0A 4P2OC 4KKLD 2WINB 3MLSL 1RV6X 4Q6IB 5HY9B 3F12A 1IGMH 1OP3K 3RL2B 2VJXA 4U1SA 1B0WA 3L1OL 2F8XC 1ACYL 1Y18B 1P4LA 4NM4L 2NLJA 4P2RD 5HHOE 2NY6D 1NCWL 3FZUC 3THML 5F9JB 3CFKA 3V4PH 1LD9B 2OR7A 4C54A 5K9KA 1OB1A 4WFGD 4IS6B 4L29A 3CLEL 5IT2L 3L3GB 1HSAA 2BSSB 3HUJF 4KHXH 1JRHI 2VLLA 4ACPA 4OV6F 5E2UL 5HYJD 3U0PA 3PL6B 2FL5B 3P0GB 3OX8A 3DIFB 1FL3B 3VGAB 3QULB 1MEXL 1ZT1B 1KB9J 5EU6B 1UXSB 3ORJA 2AAVA 1BBDH 4YIQB 3QEGL 4ZFOA 3EDDA 2PW2A 3KHOA 3HZMA 5I1IH 3W9EB 3ARFB 4XVSL 5J8OA 4XCEB 2ZUVA 1PG7X 4YHOH 4Y5YC 2Z31A 5GSVB 3RWEB 2W91A 3ZKND 5GS0H 3MJ6A 3EFFB 1I7TA 4X9IA 1I1AA 1QSFB 1UZ8A 4MQ7A 5CKAA 2YUVA 3O6ML 1ZS8A 4YZFE 2G75A 3DTXA 3K8KA 4U49A 2OI9C 2B0SH 4HWUA 4U1NB 1H3PH 1I75A 3GIZL 2WQRA 2H9GB 3AXLB 2XQYG 1NGPH 1P7KA 1AFVL 1QSEE 2NW2A 5E5MB 2DJ4A 3QT2A 3IKCA 3D1MC 5AZEL 1RZKH 3F7YB 3MJ9A 3HI6H 4N9GB 3VFNA 2IG2H 4OQ1A 4MA7L 3GUTA 1B2WH 4IOIA 4XNYL 5DA4A 3O4LA 4LLQA 5C0JB 3LPWA 3BN3B 3HNVH 5JR1H 4L3EB 4HC1A 1F4AA 1SJXA 1TLKA 2FJHA 3BWAB 1R5VB 4LPVA 1AJ7H 3NA9L 4K7PY 4MJIA 3QEQA 4OZGB 4AQOA 1UYWL 4I2XA 2AQ3A 2GJJA 3FOLB 4R8WL 2I9LB 1F42A 5JW3L 1BVKB 3KJ4C 3EZJB 3WS6A 5DUPH 1UEMA 3KPMA 5E6ZA 3RNKA 3MNVB 3SKMB 4WI9A 1N6QL 3FQXB 1RQ5A 5B8CB 4NNXA 2CK0H 2E7LA 3BPCA 4NC1E 1IVLA 3RVXC 1XIWD 1ZGLP 1A1MA 1F4XL 3MV01 3SKJL 3AM8A 4JHZA 1FSKB 2A73A 1S7QB 5DJ0B 4DKEL 4PB9L 4FQ1L 4K3DH 4M5ZL 5IMKA 1X5GA 5JZ7C 3X3GL 2H6PB 4RNRA 4HKXB 2OP4L 1FYTB 2AABL 4P5KB 2JJTC 1IEHA 4LVHB 4NGHL 3H9SA 3L5XH 1Y6KR 1UWGH 2XN9A 3U30B 4GKNB 1AD0B 5GRUL 5C0DB 3T04D 3MLRL 3QJFB 4ETQA 4WEMB 5MENE 5I71B 4XWGL 3TGXA 1KENH 3GRWA 3UP1A 4MD5A 1AQDB 5C0CE 3PABB 3RAJL 1BREA 3ME0A 2VZSA 5TJWK 3UCRA 4UBDC 5EC1B 2IPTL 2Z8RA 3WXVH 4OLZH 4JDTL 3ARBA 25C8H 1FLRL 3TPUA 1GAFH 3QNZB 2FECL 4PJCA 1MFDH 4LKXA 1ONQA 3EAKA 4LVNC 2BNRE 1QFWL 5BQ7A 1U8PB 3SHSA 3DMMB 3CFBA 5EU3B 3PL6D 5EUOE 5HHPA 4LPUA 3IDNA 3WFHB 1F4HA 4JPIB 3SDXB 5FYJL 5BXFB 2OYPA 4I4WB 5ISZB 3LZFH 3IDJA 5HHXH 1PLGH 5EU6D 4K7FB 4AG4L 5D7SH 1LE9A 1Q9KB 4QWWD 3ARFD 1MJJA 4RCAA 3ZE0E 2R0KH 3NA4A 4D9RD 2Y1VA 1IARB 3RGHA 4MSWB 3A0OA 1NDMB 4UTAH 3MCKB 2EIEA 3VFWB 1T7WA 1KCUL 1T5XB 4NFBA 5FYKD 1BWMA 3UJJH 1MOEA 1KB5A 2NY5H 4S1QH 5EU5B 1CGSL 5C0FA 5EZJA 1X5ZA 4Y19E 4WWKB 1WAAA 5ESAA 3TFKD 3IDMA 3OAZH 1ND0B 1TQCB 3HE7C 5F6IC 1P7QA 5CD5C 4DOHE 3QDGA 1T7VA 2FYYA 4OD2A 4LSVH 3ZHDA 1I85A 3BZFA 4NZUL 5D93B 3C8KB 2W9EH 5SWSA 1EVTC 4ALAL 1WWWX 4L3ED 5E00A 1LNUB 3VCLB 5SWZE 5HD8C 2F5BH 5K59F 4OCRH 2DQCH 1F2XK 4PP1C 1H3XA 4Y4KC 1YY8B 3I50L 3VDBA 4MQSB 1QO3A 1XR8A 15C8L 3DUHA 3JV6B 1TITA 1Q38A 2DMCA 2HN7A 4G8EA 5DURB 1BGXL 5DWUL 4HIJA 3RUGE 3SJVE 4B5EA 2HFEA 4N0FA 3L7EA 3RVUC 2GK0A 2QADC 4P46C 4KZEL 4Y0GA 5FCSH 5DO2C 2XZCL 3B9AA 3S4SG 4OJFL 2R15A 4R7DB 4OD3L 4R9HA 4LLYA 4J3VA 5EFIA 5C7XL 3EYSL 2VE6A 4M6MH 3CFDB 3REWA 4LLWB 3QFJA 5GJTL 2V5RA 3IFNH 3N1FC 2OM5A 2IALA 1VPOL 1WZKA 3RPKA 4N8VG 5E8OB 4AZ8A 1LEGA 3QRFM 1DP0A 3E0GA 4M7KH 1FYTD 1GGIH 1ZHNB 3VE0B 4G9DA 5KSUA 1L7TH 3I2CH 1JHLH 2WV3A 2P43B 5FHBL 4ZSOA 3UJTH 4QXTB 4WTZG 3ALWA 5C70A 2IFFL 3ARSA 3KPPA 5SV4A 5F6HI 5C09A 3VH8A 3BZ4B 4XPHL 4FXGA 5K93A 5FOJA 1IGIH 3B83A 3BDBA 4QRPE 4AL8H 5J56B 1HH6A 2DF3A 5MEQA 3ARRA 1QBAA 3EO1B 4Z78A 2YBRB 4TUJB 3QNXB 2AV1A 4IRJB 1T1XA 4POYA 4AMKL 1PBYA 2VO5A 5FIEA 1OTTC 3K8LA 1MY5A 1K9TA 1AI1H 4RDQF 3QRGH 3QZWB 4GBXB 1DLHB 3DMMD 4HWBL 3AU1A 3O6FC 3UC0L 4NKOB 4QRQA 5IKCA 3BKML 5ISZD 5DJ2A 4ZUSA 2GCYA 4D2NA 2V2XA 3DV4A 1FIGH 3R0MA 4WO4B 2H2PC 1A7BA 3OKLA 3GSNB 3LOWA 3LS5L 4PRDB 4MA3A 4S2SA 3QIWA 2OJZL 4P5TB 5TE4H 3RJDA 3IFOA 4K94L 4I3GA 1S7UB 5ICXA 4HZLA 3MGTB 1YN7A 2YK1H 3L6FA 4FQ2H 2Y07H 4FFYL 1IT9H 4M93C 3TBWA 4JKWA 4WWKD 1F4YH 3WKNA 3GSXA 4X8JB 3V5DA 1B90A 5CEZE 3HB3C 2NPLX 2E7HA 2IMNA 4EUPB 3ZE2F 3NIFE 2WBWB 3GMNA 3RWHA 2DB8A 4PGEA 4EN3A 2DI9A 4Z7UB 1J0ZA 1G9NL 2YS4A 1XF2A 4OD1L 5ID1A 1WWCA 2Y23A 1KCKA 4JO3H 4YEEA 4GKSB 1XZ0A 2EXWD 3BKYH 1BJMA 5KN5B 1KJ2L 1FJ1A 2QQKL 2J8UB 5CCKH 4JHWL 5FYLL 4JLRA 3WLBB 4KKNA 1PKQB 2APVA 2J12B 3KGRA 1IGFL 1KPRB 3PP4L 2CKBL 5E94A 1SEBB 5DURD 3LN4A 2FX9H 4P57A 4J3SA 3WJLC 3RZCA 5H94B 4PRIE 4D8PA 5C07B 3VFTB 1N3NA 2VZOA 3AREB 3GIVA 1HWHB 1A7NL 1VSCA 3ABZA 1L0QA 3RX5A 3WJJA 2DTSA 2NY2B 5HHQA 4P3DA 3RA7L 1NGXB 5IK3A 4PGCA 3BP7B 2KL6A 5JPNB 4UNUA 2H32B 1F45A 4EKXA 4OFYD 1BBJA 2X4TB 4RWYL 2JJSA 2FJFB 1NFIB 2DQDL 4PLKC 1OP9A 2G9HB 4N0CD 1XR9A 3UPRB 2D7PA 3PWJA 1K85A 1SBSL 4XAWL 3PQYE 1RUQH 3ZKMC 3S5LB 1G7QA 3EOAA 1JPFB 1SYSA 4QT5B 3C2SA 3T8XB 3V4VL 4UB0L 4X6EA 1DBKL 2XOTA 3CDGA 3E8UH 1Q94A 3O11B 4U0RC 1MI5E 4FZEH 4Z76A 3WNPA 4ZAKA 2CPCA 3O2VL 5FO8B 4LPXA 43C9A 5I18L 1I1YB 4CUCA 3ILQD 5I76B 3SDYH 2C4FU 2BVPB 3WN5C 1B6DA 2Z0BA 3IDGB 1S78D 2CDGA 3DX7B 1JF1B 1LEKB 2FD6H 4ETYA 4IRJD 1FG2A 3U9PH 1RUML 4I3SH 4HV8A 1HHIB 2A77H 3HMWL 3TLRA 2X9YA 3C9NB 5JOPE 1UB5A 5CP3A 3C5ZA 3N9GL 4U2ZA 1MVFA 4ZUVB 3BN9C 4GBXD 5F7EH 1T5WA 3E6FB 4D9LH 1I3VA 4Y8AA 1FC1A 3T2OA 3QHFH 2DQHL 2YN5A 2PETA 1E6JH 4KC3B 4WO4D 3OB0K 3B5HA 4PGBA 5I1EH 1UA6L 2GTWB 1PQZB 1O5DT 4P5TD 4OM0H 3CXHK 4G8IA 9CGTA 4P2RE 4LCIL 4X7SL 2PYEB 3KPLA 4PJEB 1Q9WA 5MERB 3DUSA 5JW4N 4FABL 1U8KB 1MQKL 1DBML 3FN0H 4PY8J 2HJKB 5DRXB 3VMOA 3UTZB 2IQAB 2NX5E 4W4NA 2WUBH 1KLUB 4PJAB 4HKJB 5HYJE 4WU7A 4XVUD 3UYOD 4KK5C 3U46A 4C56B 3EOBA 1FDLL 5J0BA 2QHRH 4WW2C 1NANI 1CU4L 2W0LA 2Z35B 4PJDB 4UU9B 3RZWA 5E4EB 1JPSH 2PUQT 3V7AE 5M94B 3FOMA 4GRWB 1MWAB 1K6QL 3MRKA 2Q8BL 3ZT7A 3PDOB 1G6VK 3AS0A 4X4YA 1FFPA 1C7SA 1NMAH 2DKSA 4YHML 4Y7MA 3NFNB 1MNUL 4RGOH 1T0PB 2DQGL 1RZJL 2X5PA 3TZVA 5JOFA 3W0WB 1E4WH 3KPSA 5HPMA 1X5FA 3QI9B 3UBXI 5C07D 1GIGH 4P5MA 2OXHA 4JY6B 1JN6A 2QBWA 4POZC 4Z8FL 2R0WH 3L9RA 2ZCLL 3QXTA 2NY2D 3S36X 3T65B 5HGBB 1DFBL 2C4FT 2CGRH 2D0GA 4X0KA 4M48L 1J1XH 3G6DH 1FZKB 5J9PA 3SBWA 1BLNB 1NCNA 3PJSA 4QF1B 5D1XC 4KXZH 2AK4A 2CR6A 1TMCB 1F3JA 2M26A 5AYUL 5GZND 5EG6C 4M7JH 3V5KB 4J6RH 1FGVL 1KG0B 4Y2DC 2NY1B 3OXSA 3FQRB 3BQUB 3N06B 4L9LB 3VDAA 5I1LA 3LN5A 3VMNA 5EPMB 1TIUA 1NLDL 4OCXH 5EOQH 1TZGL 1OSZB 1N2RA 3BGFC 4HLZG 3MXVH 2ZSVA 4YHPB 4WEBH 1FRGH 4ZUTA 3IVKA 1JMZA 1S7WB 5F96H 1OLZA 1OAZH 1C5BH 1EBAA 5E2TH 1MF2L 5E6IC 1IGYA 3P4MA 1YQ2A 3TBTB 5C0IA 1VA9A 5D1QC 2VWEC 5GHWH 4LSUL 2QQNL 3GFUA 3HN3A 1KIUA 5C08A 4K8RH 3D39B 1MREH 4OIIH 5HXMA 5IGXH 2BMKA 4JDZB 4P4KC 2Y5TB 5DD0H 1CD1A 2C5DC 3MRMB 4NO2B 3B2VL 4BZ1L 2MCPL 1JZ5A 2H3NA 4YPJA 4HXBL 1HQRA 1A0QL 3FO0H 1OQOA 4JPWL 1D5XA 4YK4B 4HAGA 4Z7VE 1U93A 4G80A 4G6JH 2PYED 3JWOC 4GLRI 1FNEA 5IF0A 1EHAA 4P9MH 2DQEL 1OAUL 1IGJB 4LLVA 5IB5B 4U1LB 2BJMH 5IHZB 3KPRB 3TESA 4HHAB 2YHGA 3MOBL 1DLFL 1IKNA 2IPUK 2HTKC 3GSRB 1RIUH 4HKBB 4LRNH 1MCWW 1KJ3H 4P23C 1P4BH 4G6AC 2YA1A 5D7LA 3EZ8A 5DD3H 1F6AB 5CGYD 4JR9H 4C56D 4DKDC 1IEAB 4Q97A 4L8BA 3ZDZF 3DVNA 1W0YT 4D9QE 4FQXC 4XVJH 5CZKA 3TPKA 3V0VB 4JFFA 4YNYA 5EU6E 5T3XD 3ULSA 3QIBC 2HLAB 4NC1C 4MWFA 2AK1H 3FB7B 1T1WA 4DK3A 2XQBH 1LO2L 4D9RE 4APQA 1QNZL 1ZA3B 1OM3H 3SEPA 1OPGL 3TF7C 5FYKE 4O4YL 1FNGB 5TPWL 1U8HA 3NCYS 4F58L 4YHYB 1QSFE 1G7JB 5FYLD 1U8MA 4NHCH 1B3JA 1KIQB 3MXWH 2Y06H 3LRSA 1FFQA 4XCNA 2KUTA 4JKMA 2JCCA 1SMAA 2HKFL 2I5YH 3W0WD 4JZJB 2R2HB 1NFDA 5GGVY 2MQ3A 3QI9D 5J6GB 1EHNA 3KJ6H 1RHHB 2VLRE 3PHQA 2A1WH 4PLJD 3HZVB 2OMNA 4WU5A 5I1AA 3RDTA 5IP4A 4NKMA 3V6FB 2V9QA 4QO1A 4HIHA 3C09C 5DSCA 3STLA 5HYIA 2ADFH 5E9DB 4L3EE 1JPST 1IL1B 3SGEI 2AI0H 2B2XL 1AD9A 2P42B 4QEGA 2VMFA 1D5BB 3PWVA 4Y5VC 2D7TL 5CUSL 3WD5L 5I0ZA 3VFGL 2AJYH 3C08H 1A6WH 2OR9H 1B0GA 2F19H 1R5WB 3IAGC 1KCLA 1AXTL 3MMEA 5CBEA 4MNQB 2R69L 4JM4H 1W72L 2NY1D 3DRQB 1SVCP 5D5MF 4HZAA 4LCYA 3KR3L 4QY8A 1N8ZA 3BQUD 4HDIA 5E7FA 3WDIA 4GFTB 4HS8H 5F3BA 4PRAB 1R3HA 2A9NH 2F74B 1D6EA 1NCCH 4UINL 1HN1A 3P0YL 2H1PL 4WHYH 1JWSB 1OP5H 3FTGA 4NWUL 2HH0L 1CD8A 3MBXL 3OJ2C 1NC2B 4PREB 4K7PL 4DZ8B 5BZWA 2HKHL 2DM7A 1FYTE 1J11A 3QJHA 1CDHA 4CADA 1BEYL 4MVBD 1DQML 1TQBC 3D39D 5ESQA 1EEZB 2F5AL 2NR6C 3EJZD 4PJ9C 3LQAH 1BVLA 2LQRA 5KSVA 3TO4B 5DD6B 4AIOA 4PJGA 1ZE3C 4S10A 4HK0B 5CEXB 1ADQH 1E27B 1NCBL 5LGHH 3ARTA 2Q7YB 2V2WB 1L9MA 4E5XA 4PY7A 4QRRA 4ZS7L 1EXUB 1QKZL 5JMRA 5CJOL 1ZAGA 3WSQL 5C0RL 1JNLH 2YN3A 5L88H 1RAMA 2J1KA 4HGKC 2G2RA 3TCLA 2EDRA 4OFVA 3G6JA 3MR9B 3W81A 3KPRD 2ITDA 3CFEA 1UVQB 5BV7B 1TPXB 4IDJH 5J11B 5M95B 3V52L 1ORQA 3QDAA 2W9DH 4Z7QE 3GDBA 3TJEL 1YEEH 3TNNA 3GKWH 2AP2A 3MUHL 5ISZE 4NP4H 4MAYC 4ISVA 3BXNA 3RPIB 2AEQL 3WYRA 4KQ3H 3CXHJ 4QHUA 3K46A 3QAZC 2ICWB 4WW1A 2XA8H 5ERWA 1HHJB 3B9KA 4HPYL 5T5FH 4XMLL 4J23A 4L3AA 2OL3A 4KY1H 2YEZB 2M8XA 3NZ8A 5HBBA 2KZWA 4G7YL 3GBNH 1FL5B 1DN0A 1NPUA 4NRYB 3JV4A 5D1ZC 4X4MA 3ULVH 1ZGLB 1S7XA 2WZPD 1REIA 5ICZA 5EU4B 1XGQA 4HJGA 3E1F1 3I02B 2CRIA 4CU8A 1TVDA 5KANI 2VKWA 4TULL 1MJ7H 4ZTOL 2IAMA 4MJ5B 5MI0B 5E9DD 4OCMC 2CRMA 1NSNH 3MRHB 4G42A 4J2XA 3V6OA 3ZLQC 3QG7H 1GPOL 4H8WL 3GB7A 1EHLL 2JB5H 1DQDL 3O2WH 4EI6A 1IAMA 2VXSH 5DJ8B 5FCUL 4HCRH 4OCNC 3NPSC 2VQ1A 4LHUA 4GKZB 2X1XR 5EO9B 4AEHL 3BGAA 4JRXA 1ES0B 2YKLH 1GC1L 4OAWB 4HFUH 2DIJA 1ZVSA 3F6IA 1IAIL 4MNQD 1JGUH 1LEIB 2FGWL 4HCRA 4ZFOL 1TJGH 1EJOL 4OBSA 1A1NA 1LO5B 4HGMA 3DGGA 3TT3H 4I1NB 4CBPA 5DQ9A 5C6TL 2NY0D 3VXSB 4UUJB 2ZOKA 3ARDD 4RFEA 1ZT4A 5T1LB 3OKKB 5D72L 2V7NB 4KHTL 1FFOA 4JN1H 5GGUB 3MA9L 3FFCB 5D70H 3SKNB 4CN1A 4M03A 1NBYB 3CSBA 5AWNL 3DX8A 4Z0BL 4B0MM 1NC2D 1QG3A 1KOAA 2MFNA 2DQTH 4WHCA 1WTGT 3C6LA 2XWBB 4UT9H 1CFVL 3MJ9L 4C83A 4B53A 3PE9A 5I6XB 1F2QA 4K9EH 3GMQB 1Q8MA 4HX1A 1NGPL 2R1YB 4NOBA 4NT6B 2VOTA 5CLTA 1G7MA 4OUUB 2VDKH 4HC1L 4YHZL 2QQLL 4ZQKB 3TO4D 4U31A 5IQ9A 4HH8A 5I1HL 1ZHBA 3UZVB 1G7LB 1U3JA 2AXGB 3SKUD 1DANU 4NUJB 2VDNH 2BFVH 3CX5K 1JPTL 3HNVL 4F57L 3UO1L 4XNQA 3TV3H 2B7DT 1QBLH 1AJ7L 1VFAA 5A3ID 5GS2H 3T1FB 1JNHA 3DURA 2VDPL 4KJQD 3ETBF 4ZPTA 1OGAA 5GS1A 5D7JC 4TVSa 5D71H 3QQ3B 3SPVB 1VFBA 3QFDB 4PJFB 4NQEA 5F8RC 4ENED 1OWRM 4AK1A 4MYWB 3P4OB 3VW3H 3X11B 1T89A 5JXAH 3FMGH 5H8DA 4X98A 5IMOA 4XC1H 5DJDA 3QUYC 4HIEA 3HFMH 2VUYA 4X6CA 1KTDA 5HGHA 3GJFA 4LEOB 3X17A 1FG9C 3P2TA 3A6BH 4HWZA 4JQIL 4DKFL 2R2BA 2NZ9C 5DR5H 3U83A 5GQBA 1RU9L 4HG4J 2R8SH 2ADGB 5FKPA 3TA3B 4FFZH 1XGPA 3L5XL 2CLZA 4S11A 1N7ML 3WIIL 4KUCD 2DKMA 2Q86B 4WUKH 1HCFX 4PP2A 3AVEA 1M71B 4LNRA 3WUWB 3LSOB 3GRWL 2XICA 3W9DA 5L9DH 1YEJH 1ZLUH 1KEMH 4Z7UE 3KXFA 4NJAH 1P4LB 1SM3L 2NLJB 1KJVA 3BRGC 4DTGH 3BP6A 1AHWA 2EDDA 1TTGA 1HHHB 1QP1A 3CFKB 1GHFH 3GMPB 5K9KB 5TQ0L 5FGBC 1NMBH 2J8UE 2W38A 3IT8D 4L29B 1UH2A 1PKQE 1HSAB 3BPOB 3GI8L 3KYMA 5E8EA 1YYLL 1MFDL 2VLLB 1FV1A 3U0PB 2EEBA 2R9HD 5LG1A 4ERSH 3B9DA 3OX8B 5F7FA 2DRUA 2XG4A 4FXLA 5TF1L 5C07E 4V2BA 2H8PA 4ZFOB 2FBJL 3NIGF 1WFUA 3VXSD 2PW2B 2VABA 3HZMB 5HHXL 1KTLA 5T1LD 2CR3A 5FGSA 3NCJH 1KB5L 1G7IA 3U0WH 4Z7WF 3HE6C 4GAGL 1I7TB 1I1AB 1UZ8B 4KKLC 3WKML 4MQ7B 1CXLA 2B5IC 3FFCD 1ZS8B 4FQLL 2G75B 4XPGH 4WHTB 3MLXL 3PXJA 4N0UB 4UDUA 3BPLC 1TJIH 2PTTA 2NY5L 4S1QL 1P7KB 3QDJA 4YFLF 2NW2B 2VLKA 4PV9A 1FO0H 1MRCL 3IKCB 4J1UA 3ZL4L 3PWPA 4ZMAT 4M6NH 5CWSB 5HVGB 1YYMH 4IOIB 1NBZA 4XCFL 1VESA 1NAKH 3O4LB 3BE1L 3QQ4A 1FO0A 3T0EC 1MUJB 1IGTA 2HYMA 4LSVL 5T3ZH 2FJHB 3PWUA 1MCLA 3LPFA 4G6KL 1JGDA 2IBZX 1BECA 4MJIB 3QEQB 3Q3GA 4XNUH 5BVPL 4F37F 3IFPA 2YZ1A 3OF6D 4I2XB 4MZ3A 4NKIL 4XWOD 1T1ZA 5FK9A 4NKDA 5F9WC 4OLYH 3RL1A 1IBGL 3S37L 3ZKNC 3KPMB 3RNKB 4X6DA 1CWVA 2J6EA 2I24N 4NNXB 4O51B 1TVBA 1CTOA 2IC2A 3BPCB 3A6CH 3OTTA 3U0TA 3ULUF 1PEWA 1A1MB 1WK0A 3IAQA 1BQLH 2ITCB 3VWKA 2D4DA 2A73B 5B4MC 3GMLA 4XNMA 4PYHA 1T2QL 1CF8H 1YEIL 1C16A 1U8LB 2J7LA 5IMKB 2VRAA 1C8PA 5T1DL 1CR9H 1X7QA 4KVNH 2JCCF 1H3TA 2C3WA 3WXWL 3RY6C 4HFWA 3OKYA 1A4KB 2PYEE 4PJEE 4PJHA 4XPTH 2UWEF 3ZKQD 5E24E 5J1AA 3TA3D 4PJ5A 4YC2C 1I8MA 3MUY1 4U3CA 3SGJA 3DECA 4YBLC 3N85H 4ETQB 1VEMA 4PJAE 3EO0A 1MHCA 1U3YA 3FB6A 4MXWH 4C56E 3EYVA 2D4FA 4BQ9A 4PJDE 5T3XE 1D5MB 4LARL 3FO1A 2B8OT 5EUKA 4DAGH 3ARBB 4AL8L 1O0VA 5HDQH 3EHBC 3TPUB 2OK0H 3KS0H 4PJCB 1MFCH 4GRWE 4RIRA 1QYGL 2J8OA 5KVEL 1I9JH 4LKXB 2CUHA 3RVVD 4E41B 3QISA 4XP9L 1UJ3C 3LD8B 4UV4H 5BQ7B 3EYUH 2GFBA 5CILH 4Q9QH 1MAML 3CFBB 4KDTC 4KK9C 5HHPB 1EGJA 3IDNB 1FPTL 3FT3A 1P9MA 4KTEL 3W0WE 5CEZH 5JW5A 2ZOLA 3HZYA 3QRGL 4KJWD 3T0WA 1S7TB 2C3VA 3IDJB 1I3GH 1F11A 4I9WD 1ZOXA 1M7DB 4D0DA 4AH2A 4G6FB 1LE9B 5F93C 2UZIH 1PVHA 4AT6B 2V5MA 5DFVC 3VXMA 2VXQL 5IR1A 2O5YL 3K1KC 4NN5B 5I9QB 4KTDL 3BKCL 3ZKSD 1I1AD 4PJ7A 4PYGA 1KB5B 4K3JH 5C0FB 5EZJB 4GG6A 1ITBB 1WCBA 2OZ4H 1EO8H 1KTRL 5ESAB 5DUBA 5GS0D 1V5JA 3IDMB 1DEEA 5HGDB 3L3OA 3S34L 1IT9L 1BZ7B 3RVTD 1P7QB 4YFLI 5IFAH 5CBAB 1LO3H 1KYOJ 2AEIT 2FYYB 4OD2B 5FO9B 4FG6C 3FCTB 3BZFB 2ZP0T 3O4LD 5DC4B 3GHBH 3PL6C 2VH5L 5E00B 1MJ8H 1AGBA 3W39A 3RKDC 3VGAC 4KV5E 1CLZL 1EZVY 4PPTA 4HMDA 4MJID 3QEQD 5GZOC 4JO4H 4LSQL 2CD0A 1QO3B 4P2OA 1DQLH 4JPKH 5CJQL 1E0OB 5JHLH 1IQWH 2AXHA 4QWWC 3G04A 2HN7B 4G8EB 5BZDB 2JF1A 5KG9A 3PNWA 2X4QA 4HIJB 2HFEB 4N0FB 3L7EB 2GK0B 1ZLVH 4TNVK 3VGFA 1EPFA 1IGCH 1UM6H 4HS3B 4PTTA 2XIDA 3D39E 1D9KC 2VXVH 4LLYB 5EFIB 4PJBA 4K3EL 2VE6B 4U1GB 1AIFA 3REWB 3W82A 2BY3A 2X1QA 3QFJB 3WFCH 5IIEA 3INUH 3DPBA 1HIML 3LKOA 3I75A 5GS3A 2IALB 3ARWA 5TE6H 2WK2A 1HINH 4OKDA 3V6ZA 4PFEA 3KPQA 5KW9H 5C0EB 4AIXA 5C8JA 4I0CC 2BHYA 1HEZA 5EIVA 4R7NA 4G9DB 4Y5YA 5KSUB 3KPRE 3CVHA 4ZSOB 4PG2C 5I30H 3QO1A 3KPPB 5IHUL 2VDOL 1BOGA 5C09B 3VH8B 4WIQA 1AE6H 3SQOL 4NCDA 1MFAH 4M9PA 1J0HA 4I8DA 2HT3D 4XRCA 3WLWD 1ZHLA 1HH6B 5HYSA 5FA3A 5EA0L 5E4IA 3ARBD 4BUHA 1FNHA 1G9EA 4E41D 3O4OC 5L7XL 4NQCB 1UM4L 5LJYH 3CK0L 2WWMD 3I84A 3U9PL 5E2VH 4J4PC 2YR3A 1YJDL 4KVCH 3P73A 3SDCC 3AU1B 4H1LH 4NZTL 4QRQB 5IKCB 4POUB 4ZUSB 1FL6A 4EI5C 2GCYB 2C3HA 4PTUA 2V2XB 4XPAH 3DV4B 4G8FA 4G6FD 3OKLB 3QHZH 4F7MA 3VRJB 2AJVL 4MA3B 4H1LA 3QIWB 4S2SB 3DSNA 3MREA 3F7VA 1K4DA 3IFOB 1QRNA 2IADA 5ICXB 4HZLB 5ALBL 5F72S 1G84A 1YN7B 5E9DE 3L6FB 4OV5A 1WZ1L 5I73C 4M8QA 4K3GA 2QQQA 4OTXL 2IH1A 1TNNA 3TBWB 3GSXB 3I9GH 2AJ3A 4IOFD 3V5DB 4FOMA 3LMJL 3MACL 1JGVL 4X6FA 5AZ2L 1P7QD 2F54A 1YZZA 4MCZA 3RWHB 4PGEB 5L2JA 4DGIH 2JJTA 1T6WA 1NGQH 1FLTX 1B0RA 3QDGD 5HDBE 3PXHA 4Z6AT 4OZFG 5GGVL 5ID1B 5B3JF 5L8JB 5SWQA 1KPVA 4HF5H 3DMMC 4KGLA 4ODUA 4UIKH 4WI7A 4C58B 4R4BA 1U92A 1QEWA 2L0DA 1P84J 1FJ1B 5JMOC 2VUOA 3B3IA 1V7NL 4JLRB 1G7HA 3P4LA 1UB6A 4M62H 1GGCH 3QXVA 4PJIA 1B6UA 5D2NC 5FUOH 2HJFA 2Z4QA 3VI4F 1EEQA 2BZDA 3LN4B 4YHKL 1A5FH 5TQ2L 2HJLA 4P57B 1MAKA 1DE4A 3RZCB 2BSRB 4LHQB 1N3NB 3GIVB 5FHAH 3EOTH 2Z91A 4PJXA 3RHWK 1OW0C 5HI5D 1JP5A 3MFFA 32C2B 3QO0A 1XAUA 2ZKHL 3DBXA 4OCLC 5HHQB 5I1GH 1TQCC 4P3DB 5IK3B 4PGCB 2XWTA 3O3DA 3QFJD 4ELMA 4QOKB 3HI5L 1CGXA 4JKLA 5EU7E 3ROLA 1QFUH 1IC5H 1OARL 4HUUA 1XR9B 3PWJB 3IS1X 3IAPA 3ZTJH 5IWLC 1BQHA 1MFNA 3OG4B 1M4KA 4V1DA 2VC2H 3R8BB 1G7QB 3IDXH 3EOAB 4L8CA 1TJHL 1SYSB 4QHLA 1MCWM 4X6EB 5CINL 2R4SL 3WHXA 1AQKL 3VG0L 1C1EL 3CDGB 1Q94B 5C09D 4Z76B 3K8MA 1U41A 2BVOA 43C9B 5IBUG 2RQ8A 2NNAB 5DJXA 1NGWA 4HWEH 5B39B 4Z7NE 3HPLA 4ODTH 1RK0A 2BXZA 1OAKL 4OLUH 3VRLE 1DJSA 1OAYH 1FG2B 1MCOL 4WEBL 4JG1H 3VMPA 2R1XA 4HV8B 4I5BA 2Z8VC 2JB6A 2DAVA 3ZMRA 2VQUA 1UB5B 1QA9B 2HRLA 1X5JA 3AB0C 4Y4KA 3NH7H 1T5WB 4TPRH 3G5XA 4NQTA 1TZIA 2VLMD 3BDYH 4N0CC 2GYSA 4LFHD 4K8RL 1MREL 4TTDD 4XPFH 5B3NA 2X9WA 5EBMA 3FAWA 4PD4J 1UH3A 4AM0A 4IRSB 3I6LD 3QIWD 1F4WL 1HDMA 2LVCA 4G8IB 1FZMA 2OSLA 4OSUL 2K7QA 2LAGB 1D5IH 3KPLB 1MCPL 1I7ZB 3FO0L 2AEWA 4LRIC 3DUSB 3U36B 2PXYB 3RI5F 5DYOA 1JBJA 3CXDL 3IXAA 4G6JL 1YA5A 2IGFL 3D69A 3ILQC 5FYKH 4HBCH 3BHBA 1CGVA 3DX9B 2A6JA 3RWDB 2CDFA 2QSQA 4GMSH 1LHZA 4RGNE 4WU7B 1IKFH 5HVFB 3U46B 4LGPB 4XI5C 4F8QA 3EOBB 1HK6A 1J88A 3ULUL 5DD3L 4DN4H 4R6UA 2FLBT 2PR4H 2YWYA 3HCVA 3VXSE 4DZBA 3D9AH 3DSFH 4OLVH 5GRVL 4OLEA 4OFKA 4NWTH 4JDVA 4BELD 3FOMB 3GSVA 1JWUA 1BFOA 3T4AA 3T3ME 4X4YB 1Q0YH 4MNHA 4JCMA 2GITA 1FFPB 4QCIA 1NCDL 3FFCE 4JJ5A 5E08H 1HNFA 4ZOAA 3G5VA 3TZVB 5JOFB 1MHPL 3KPSB 3MXWL 3RZCD 5HPMB 4P3CH 1TTFA 1RJZA 5I8OH 1A3QA 1CE1H 5DJCB 4KUZH 5HHNA 1JN6B 5IFHH 4N5EC 3SGKC 5DC0A 3O2DL 1YNLL 2X89A 4RZCB 3L9RB 2OTWA 5JDSA 3KJ6L 2WANA 2A38A 4M1GL 2A1WL 2K1MA 3QIUC 1OAXL 4R0LA 4F37K 4X0KB 1FCCA 4L4TE 3FO2A 2APFA 4QOKD 2P8PA 5AEAA 5J9PB 3O6FA 4PJHF 4MD4A 3PJSB 5JNYA 4LSRL 4M43H 5DQJA 5T5NG 5BW7C 2XQYK 1IEBA 2RCSH 1VGKA 3OPZL 1F3JB 1DN2A 3IGAA 2QV2A 4Z7OE 7FABL 2D7QA 1RIHH 3L3JA 5T33L 1EMTH 3OXSB 4PJFE 4F8TA 1X5IA 3TBVB 5JW4Q 3BDXA 3UX9B 3N50A 1WBXB 1MHEA 5I1LB 1Q72H 1QFWM 2XWJA 1RIVH 3BUYA 4ZAKD 3DO7A 2FZ3A 1E4JA 2VR5A 4HS8L 3AREC 4HIXL 4HUXA 3FQUA 2A6DA 1YN6A 3GSWA 3IU4L 1VKXA 5L0QB 3IVKB 5AAMA 1E4KC 2NY2C 4L5FL 1NAMA 1IGYB 2IPUG 3P4MB 4J3UA 5C0IB 4NM4H 2AV7A 5LVEA 5IEHA 1AC6A 4TTGA 1NCWH 4G5ZL 1AO7A 3THMH 3H3PL 1LO0L 4M61A 1GJIA 2UYLA 2WLZA 4OZHA 1UC6A 2BMKB 3IJYA 2X6MA 3U4EA 4AEEA 2GEEA 1QBBA 3C5SA 5IT2H 1VADB 5GZNC 2VXTL 4WJ5A 4HBQA 3CSGA 4YHNA 2H3NB 2HFGH 2X4NA 5E2UH 3PV6A 4PJ7F 1HQRB 4JFOA 3UPCA 2XT1B 3W5NA 2CLVA 2FWOA 2X9XA 4M6AA 1MEXH 3DHJA 2A0LD 4AQ1B 4LOUC 4X80L 3K4AA 4G80B 4YQXL 1FNEB 2PXYD 3QEGH 5IF0B 1KF9B 4OLWH 4M6OL 4ZO9A 5JQ6L 5A40E 4HQQL 1FH5L 3DNKA 4U0QB 3MUZ1 3S3JA 1VFMA 1CVSC 5D7LB 3O6MH 4HK3J 1ZWIA 2DWEA 2VITA 3DVNB 1EERB 2W9DL 3GIZH 4JFFB 4I9WE 4YNYB 5BJTB 1JZ6A 1GGTA 3M07A 4DVRL 4S1DD 4X5XB 1AFVH 4M02A 3MRRA 1A64A 4MWFB 1WITA 4NP4L 5F8QC 3LCYA 4MJ6A 1T1WB 2I60L 5ECJE 5AZEH 2V7HA 5J12B 2PTUA 1S9YB 1MJUL 2ENSA 2OL3L 4JFDE 2QLVB 4MA7H 4XNYH 5D6DC 3MJ7A 4EBQH 3MZTA 4U6YA 1U8MB 3WIHA 4KPHL 1CG9A 1XEDA 1YNKL 3LRSB 2E7BA 3SQBA 4MS8C 3NA9H 2JCCB 4PRHA 3TZVD 4N0UE 3WN5A 2IWGA 1NFDB 3NFPA 3KPSD 1Z6JT 4PJBF 5E8PA 4Q0XL 1UYWH 3K74B 4KKCD 1NUFA 3B6SB 5I19L 3PHQB 4R8WH 2E9WA 4WU5B 3JWDC 3RDTB 4DEPB 4NKMB 4HIHB 3STLB 3TEUA 1BAFL 1R3KA 5DSCB 1N6QH 3O4LE 4TSAL 3QPXH 4YXLL 4KJPC 5CGYC 2RR3A 2XNAA 3VDCA 5J06A 2VDLL 1AD9B 2YD4A 3RTQC 2BNUA 5LXGL 3PWVB 3BGMA 3QEQE 3SO3C 1F4XH 3O6KH 2EDXA 3SKJH 5A2FA 4I2XE 4JE4B 3ZYIA 4DKEH 2VXSL 4PB9H 5CBEB 3V7AG 4CRPA 2E6JA 4FQ1H 4M5ZH 3Q48A 5IM7B 1R5IA 4ZTPL 2EC9U 5DI8A 4GOSA 3X3GH 4CNIA 2OP4H 2W07A 2AABH 1N8ZB 4HDIB 4QY8B 3DVGA 4LBEA 4NGHH 2YC1A 5F3BB 4RMSA 1R3HB 1A4JA 1D6EB 3K1DA 4F7PA 3TT3L 4NZJA 3T0BA 5GRUH 1FVEA 3P77A 3H9HA 4D3CL 3MLRH 3ARZA 4UT6L 4YDLB 2OLDA 3RWCA 4FNLL 3IB4A 4WW2A 2VR4A 4R97B 2NQCA 5BZWB 3QJHB 3RAJH 3LDBC 3SO5A 4ZODA 3L3KA 4CADB 4CGTA 2IPTH 3E2HC 3MRQA 3VXTA 4JDTH 5ESQB 4YHLL 3OAYK 1FLRH 2B1HL 1RK1A 5EOCL 1BVLB 1L7IL 5KSVB 3ZKXB 4PJGB 4PS4L 3VD7A 3B2UC 1QFWH 2VDKL 3RKPA 5FOBA 3QXDB 4K8RD 2NY1C 5LCVL 4FQIL 4PGDA 4PY7B 4QRRB 5FYJH 4LPCA 1ZLWH 2IQ9L 1RFDL 1ZTXH 2G2RB 4PJCE 3G6JB 3PHOA 4E41E 3D18B 2ITDB 3CFEB 1HYSD 1CDGA 1IZKA 2VTFA 1CFTB 2WUCH 5D1XA 1CGSH 5D7LD 5HHOA 3U9UA 4XAKD 3R4DA 3U1SL 3T0XA 1CE6A 1FVCA 3JTTA 3BXNB 4JFFD 3K4ZA 1P4IL 3ET9F 5LGKA 4Y2DA 1YQVL 5EORL 3FMGL 4QHUB 3LQZA 1QLEL 4KKAC 3HFML 4APQD 3Q6GH 3KPTA 1N6VA 2WIIA 4WW1B 5ERWB 4NZUH 1IFHL 4TQEL 3B9KB 4XBEH 5I1KL 1OCWL 5IHLB 4LPTA 2OL3B 4DVBA 4KKBC 3S35H 2PNDA 3NZ8B 5CZXD 4YK4C 1WAAE 4ZOCA 5TE7L 1DN0B 4FQHA 3JV4B 3K2UL 3I50H 5EO0A 15C8H 4DWHA 5ICZB 4ELMF 3BJLA 3UJIL 3IYLW 1XGQB 4HJGB 4P9HL 4G6ML 3JUYA 4R2GB 1BGXH 5DWUH 5D1QA 3RDTD 4X5WA 3CFCL 2IAMB 4KZEH 1KEML 3MRLA 2XZCH 4FQPA 2MKWA 3D85A 1ETZA 4YDVA 4NRZA 1PEZA 2NMSA 4P4KA 4OD3H 5ITBL 4EI6B 3KYAA 2QSCL 5FYJU 5C7XH 2VQ1B 4LHUB 2EDLA 3OJDA 4XXCC 4JRXB 5GJTH 3OR6A 3SDDB 1ZVSB 2Z9TA 3HR6A 4W81A 5HYFA 5I8CA 5DD1L 4WCYL 3VFMA 3MCLL 3BP5A 3L95A 1A1NB 1RZFL 3DGGB 5DQ9B 3PGDA 2ZOKB 1CGUA 1ZT4B 3T0VA 2FRGP 4S1SL 4JZJC 5J1TC 3BKJL 1T1YA 2ICEA 1X6LA 1DCLA 4P23A 5FHBH 3QFJE 1S9XA 4L4JA 2IFFH 4K55A 1K8DA 1P2CA 2DLHA 1CTNA 3U0WL 4XPHH 1R0AL 3DX8B 4FQXA 1AGEA 4H26A 5CEYA 1JPGB 3RVWD 2ZG3A 3M8OL 3DETD 4NFCA 3QIBA 5HI4D 4WFFD 4C83B 4BYHA 1A7RL 3RX8A 1WICA 2A74A 4UOW0 4OF5A 2W59A 4HX1B 2D31A 2R29L 4JO2L 2WSKA 2D2OA 1FO0L 4D0BA 3GSUA 1A3RL 1DDHA 2RFXB 1ZHBB 1YMHA 3VRIA 5IQ9B 1KULA 3I3DA 4GT7A 3DROA 1DVFC 5C09E 1YYML 1Z5LB 3LKPB 2NXYC 4HMCA 4HWBH 3OAUL 4QRRD 3UC0H 4XNQB 4LAJH 1BFSA 1VFAB 5D8JL 1ROWA 2C4XA 1JNHB 3DURB 1B4JH 1KPUA 1OGAB 5GS1B 2X2YA 3LS5H 1CLOH 1VFBB 2BNQA 2J6EL 3DXAB 1WTLA 2OJZH 3GK8L 4NQEB 2NW3A 4K94H 5EN2A 2F53B 1HZHL 3P40A 1IQDA 4NQCE 2ZCKL 1WJ3A 3F7PC 4IBLT 4X5LA 1YEDA 1Y6NR 3RRQA 4LQFH 3CAFA 4Y5VA 1IC1A 2ATPA 1XF1A 5I74B 3AAZA 4FFYH 1KXQE 2VLME 2XXCB 2KQMA 3K0WA 4U4BA 1VGEH 4X98B 1R24A 5DJDB 1E28A 4K23L 4CDGC 2NYYC 1BHGA 1PX3A 4X6CB 3RI5K 4Z0XA 1KTDB 2C3XA 3I3BA 5HGHB 3I6LE 2XXMB 4KI5F 5F44A 4HWZB 1OHQA 4O58L 3MUGA 3TO4C 2R2BB 1G9NH 4OD1H 3WNMA 3B9KD 4U7KA 4GAJH 5IEKA 4RWHA 3M45A 4IIQC 3UTSA 5FKPB 1JF5A 2P8LA 5HHVL 5EU7C 3I3EA 2R23A 1XGPB 1KJ2H 3MBEC 2CLZB 3ESVF 3MRDA 1GL4B 5A3IC 4JHWH 5FYLH 2DLTA 1BP3B 4S1RL 1JZ3A 4PP2B 2CUIA 4LNRB 2OJEA 2G5BB 2MSPA 3VXRE 3W9DB 2WAHA 1IGFH 3CLFL 3PP4H 2CKBH 4GSDL 5F1SA 1KJ2A 4X9HA 3DWTA 4R2GD 3KXFB 2ZSWA 4G7VL 2PKDA 4F9PC 5BV7C 2IAMD 3DV6A 3BP6B 4Y19A 1J10A 3RWGA 1C5CL 4MD0A 3GSQB 4DFIA 2CKBA 4JVUA 2NCMA 3FB5A 4FFWC 5KS9B 5D7IF 3MLVL 4KMQA 4U1KA 3EDEA 2YMXH 3KYMB 5E8EB 3RA7H 4LHUD 3RQ3A 1R6VA 2HT2C 1EGJL 4JRXD 3SDDD 1I9JL 1FV1B 5DK3A 1QSVA 3FQWA 1UM5L 3AS1A 5C0GA 5GGTH 4LHJB 1NMCB 4RWYH 1FZOA 2E6PA 2DQDH 4RMRA 3OB0H 3HG1B 1MLBA 5TGBB 5A2IH 4JANA 1BQUA 2EXYC 2VABB 1QFHA 5GGTA 3KLHC 1I3GL 4XAWH 1LP9F 3T3PE 3LB6D 1G7IB 3V4VH 4UB0H 3SJVA 3D0LA 4MXVE 4QOKE 5IVZA 4XCCL 4LCUA 1VERA 5AYQA 1FE8L 3HNTL 3HUJA 1KT2B 4MAYA 5C0NC 4UDUB 4N1CA 3O2VH 3V0AC 2PTTB 1A1OA 4K3JL 5I18H 5DDHA 1DSFL 5MI0C 4NPYA 3KNBA 3C6LD 1FNSL 2MKLC 3QDJB 1EO8L 2VLKB 2JTDA 1ZXQA 3QXUA 4PV9B 4J1UB 5DJZA 3PWPB 3BH9A 3R0NA 3ECBB 1F02I 4EQ2A 1NBZB 5DEZA 3MA7A 4RGNC 3LHPL 2IBBA 3HMWH 1OLLA 5E8NA 3QQ4B 2X41A 1FO0B 4C4KT 3CC5A 3MC0A 3CFJA 3PWUB 1JGDB 1UCBL 3GHBL 4OUOA 3Q3GB 5D1ZA 4TOYH 3CJJA 3IFPB 2RHEA 1N64L 5LAXA 4HK3N 2OTUA 4GG8A 1T1ZB 3LV3A 5FK9B 4NKDB 5L2KA 1OGAD 1UA6H 4OFIA 3RL1B 3DXAD 4AIZB 4OT1L 4NQED 4RFNB 3EJYD 1R3LB 4X6DB 2F53D 2YUZA 3QXAA 3OAZK 1U91A 3BYYA 4LCIH 4X7SH 4F15B 1TVBB 4XP6L 3BAEL 2PW1A 4FABH 1MQKH 1IGCL 5B38A 1DBMH 4YAQB 1A6UH 1OTSD 3VWKB 4LIQL 3FONB 4UT7L 4MA1B 4NC0B 4XNMB 1DBJL 5F7KC 1ZGLM 4ZS6C 1OT1A 3OBAA 1C16B 4WY7L 4F33A 4XXDA 4MCYA 3G9VA 1X7QB 3VXOA 4M4PA 4OGAD 1W8NA 3PWNA 4M1CC 5TH2A 4HFWB 5FUCE 2FX8L 1KTKE 4PJHB 4AEIL 1O7SA 4OF3A 2AS5M 4UNVA 1F6FB 3CVHL 5J1AB 3VFUA 4PJ5B 3D6GA 4UILL 1I8MB 3ARUA 1K6QH 1MELA 3PGFL 4XWOC 2Q8BH 3EO0B 4O2EA 5KZCB 1U8JB 2VXUL 3FB6B 3WIFA 3E3QE 4YHMH 5I30L 3EYVB 2DQGH 1RZJH 3DO3A 4PUBL 3Q0HA 3KXFD 4AENA 1YC8A 4KRPC 4P2QA 1T66C 3LEVL 4ODXB 3FO1B 3QZWG 4HJJH 1U2HA 1CXIA 4MHHI 4Z8FH 2ZCLH 4RIRB 1KB9K 4TUKL 1CFSA 1WIOA 2GFBB 4M48H 1I4FB 5GGSB 5FB8A 4JY4A 4M1DH 3FT3B 4TUOA 5JW5B 2ZOLB 4JREB 1F3DH 3KPSE 4XH2A 3HG1D 2C3VB 3GM8A 1F11B 5D7JA 5AYUH 5FV2A 3CVIL 3TA3C 5SX5H 4AH2B 4R4FH 1V7ML 3IDIA 3L3IA 4ZDHB 1FGVH 4WW2F 2FHBA 3VXMB 3QHZL 4ZXBA 5IR1B 3TWCL 1Q9OA 1L0YA 5CJXC 4EUPG 1P6AB 3MO1A 2DOCA 2LAAA 2X4PA 4YH6A 4GG6B 3EGSB 1NLDH 1WCBB 3ARPA 3ZDYF 3ZE1E 1TZGH 1N4XH 2ZJSL 3QUYA 4JCLA 4TSBL 3EOYG 3FT4A 4HIIA 3QDJD 5HI3D 4R3SA 2VLKD 3F7QA 1W8OA 2WBJB 3PWPD 3BW9B 3RVVC 1NEZB 1NFKA 1S9VA 1MF2H 3Q6FA 1V8HA 3PIQA 3CUPA 3BEWA 2EECA 4DGIL 5LGJA 2CXKA 1NGQL 3V95A 4LSUH 2QQNH 2DTMH 1AGBB 1I8LC 4MB5A 3W39B 1FN4A 4R90L 4PRPA 4KROB 4UIKL 2V9TA 4MX7A 2LV4A 1I8IA 4P9HC 4WWID 5EIIA 4BZ1H 1I9IL 3MX0A 2MCPH 3O9WC 5T3ZD 2Y6SD 1JTTA 3G04B 4LEXH 1EIBA 4ELKA 4EVNA 1S3KL 5KG9B 2X4QB 4HXBH 1GGCL 4OQTH 1A0QH 5ETUA 4DN3L 4KK8D 2P4AB 4QKXB 1T03L 1AGCA 1X5LA 5FGBA 4U1HA 5GS0C 2DQEH 4OQTA 4PJBB 3VWKD 3MOBH 1AIFB 1DLFH 5IIEB 2AW2A 3LKOB 3I75B 3RWJA 3TJHD 1SY6L 5I1GL 43CAA 1AGDA 2V2TB 4NO0A 3S5LG 3V6ZB 5FM8A 4FP8L 5DRZA 5IVXB 1HEZB 1RZKC 2IBGA 4R7NB 4Y5YB 2F8OA 4PJ5D 1CQKA 1LO2H 1KIPA 1AXIB 1CN4A 1QNZH 1MFBL 1XCQA 2W60A 1OPGH 2KH2B 3QO1B 4O4YH 5TPWH 4F58H 4YZFF 1BOGB 5KZCD 3Q1SL 5ACZA 2OI9B 4NQVA 5D7LE 3QA3A 4Y4FB 3ZZ1A 4XAKE 2A83A 4JQVC 2HKFH 4RAUB 4XRCB 1YDPA 1ZHLB 4JFFE 2ED8A 5HYSB 3QQ9C 2NX5A 2CDEA 5DJ6B 4ODTL 4YX2L 2C1PA 3FQTA 3HA0A 3T0EA 2VAJA 1JIBA 3QCUL 1HKLL 2P7TA 2EDOA 2B2XH 5E1AA 2W0PA 1Z9SA 4I18C 2DN7A 2JCCE 4J3TA 2NY3C 1NFDE 3G08A 1FL6B 5CUSH 4PTUB 4OIAA 2P45B 3WD5H 2JE8A 3KJ4B 3MCG1 3VFGH 4MAUL 4G8FB 5E99L 4F7MB 3Q5OA 1AXTH 5BVJA 2X4SB 4H1LB 2R69H 3MREB 4XPFL 1W72H 1QRNB 5DQDL 3VXMD 2IADB 2A6KA 1ITCA 3EKCA 1NGYA 3KR3H 3QUKA 4YDKH 4OV5B 2HWZL 4M8QB 1EO7A 3O3BA 5EWIL 2IH1B 1D5IL 1W72A 5GGQL 3NVQA 2AJ3B 1NH6A 4UINH 3MROB 1LK3L 4OLXL 3PDGA 4X6FB 3P0YH 2H1PH 4HBCL 5HVWA 5F89A 2F54B 4MCZB 1CXEA 5L2JB 1A02N 2WBJD 2UZYB 2BRRL 4OZ4A 4YGVA 4NWUH 2HH0H 3MBXH 3RY6A 1B0RB 4K7PH 5CP7A 4F7EA 3BI9X 3ROOA 2HKHH 2BC4A 2BK8A 2WWMC 5SWQB 4ODUB 5IOPA 1S5HA 1BEYH 4R4BB 1DQMH 1QEWB 5AG9A 1GGUA 1U8QA 3V6BR 1NUNB 4KROD 3B3IB 3VI3E 2F5AH 5JA9A 1G7HB 1UB6B 3MRNA 4JM2C 1NANH 4DGVL 4PJIB 1RJLA 1YEKL 4BKLA 2Z4QB 1PAMA 1NCBH 5DRWA 2HJLB 2Y9RT 4NN5C 5I9QC 3MYZA 1DE4B 4ZS7H 1QKZH 4HUKB 3FZUD 4WFFE 4DQOL 1NKRA 5CJOH 3WSQH 4HUMB 2Z91B 1A2YB 4PJXB 1RZ8A 1J0IA 2BVUA 3MZGB 4H0IA 4OZIA 1GOHA 4GQPH 3QO0B 1UJ3A 3K80A 5ID0A 4LVNB 3DBXB 3QWOA 4IJ3C 3GI9L 1EEYA 4CW1A 4PJGE 2D0HA 3HAEH 2XWTB 3O3DB 5K9JH 4KDTA 4G8GB 5EUOF 2CIIA 4BH7A 1IILE 3GMOA 1MVUA 2FIRT 4NNYA 3AMLA 3V52H 5CSZA 4ESKA 5IJVA 4OF0A 5J57B 3TJEH 1KJMB 3KG5A 4QRRE 1G9MC 1QACA 5CD3A 5DGRA 2E6QA 3HAEA 3TIDA 4HUUB 3BEVB 2AEQH 3ZE0F 3O8XC 1BQHB 1C5DB 3HMXA 4X9FA 4V1DB 3G6JE 4L8CB 4N1HB 4JHAL 3JV0A 1P6FA 5DMYA 1EMTL 4HPYH 4FN0A 3WHXB 4XMLH 2DLIA 2ESVA 4YBHA 1U36A 4HKZA 2FGZA 2GHWB 4Z7VA 2BVOB 2VSCA 4Y4FD 2JJUA 3MOAL 5DJXB 1JWMA 1CLYL 3MLUL 5IB4B 3HPLB 5ANMA 3OKMA 1NAML 3QDMA 4IS6A 2J3SA 4JG0L 4N1EA 1P5VA 3GBML 1WUNT 1MHHA 2EDYA 4TULH 4I5BB 1JZ7A 2JB6B 5DA0B 1EUTA 2BCKB 4ZTOH 1T4KA 1FL3A 2E9JA 4GXUN 4Y4KB 1ZT1A 4EDXA 3VGBA 2P46B 3G5XB 1UXSA 1GPOH 1VENA 4H8WH 1EHLH 3V0WL 1DQDH 3FQNA 5FAAA 3W9EA 5FCUH 4HUVB 4X4ME 2IJ0C 1XF5A 5EBMB 4AEHH 1GC1H 2QADB 4OM1L 3EFFA 1IAIH 5FKAA 3OV6A 3BIAX 4XBPA 3QHTC 1QSFA 3TC9A 1QRND 1HDMB 2HFGL 3KDMA 1G6RL 4Q74A 1FZMB 1J1PL 2FGWH 1EJOH 3ULVE 1D9KA 3RVXD 3NGBB 5C6TH 2XI9A 5DVLA 3R1GL 3V6OE 5DYOB 4KK6D 3IXAB 2VLRA 3D69B 5E5MA 1FBIL 1AY1L 1CDIA 2YUXA 4GXVL 3BHBB 5D72H 3DJ9A 5F9AC 4KHTH 2A6JB 3JTSA 4OLWL 2Q8AL 2CDFB 1M7XA 1U8OB 4JRXE 4Q7DA 2GQHA 5JZ7D 3MRGA 2EIDA 3MA9H 4RRPG 2F54D 2B39A 4GLRH 5AWNH 4Z0BH 4XP4L 3ARXA 2J2ZA 2VAAA 1CFVH 3MJ9H 1BPVA 4L9DA 3HCVB 4DZBB 5DS8A 4JDVB 1RSFA 5GRZA 4PG2A 3WIHL 4TTDC 4HS6B 1BFOB 4HC1H 1BVKA 2QQLH 4YHZH 3T4AB 3ZTNH 4Y5XC 4MNHB 5I1HH 4A6YH 2GITB 5EC2A 4JJ5B 1A7PL 5JIPA 3C8DA 2ERJC 4EBQL 2E8YA 3IS0X 1JPTH 2VL4A 3QUXC 4EXPX 3UO1H 4F57H 2RAMA 1RJZB 1FZJA 4A6YA 5ENWA 1P1ZA 1SMOA 5HHNB 4KAQL 2VDPH 2HG5A 1SJHB 3SE4C 2D9CA 3ILPA 5JDSB 2OTWB 2QSVA 3WS3A 4E9LA 4J4PA 4R0LB 2MQCA 3TT1H 2OBGA 3SDCA 4G8GD 4ZNEA 3C60C 3O6FB 4MD4B 3BJ91 5JNYB 4EI5A 4F9LC 3QPXL 1CYGA 3V79C 4XHJD 1IEBB 2ZUUA 5J89A 3IGAB 3NACL 4DUWA 12E8L 3O6KL 1OGAE 5C0DA 4V1DD 3P0VL 3SGEH 3DXAE 2Z8WC 2HMIC 4JQIH 4DKFH 2F53E 2GTZA 2L7UA 3IKKA 1A47A 4JPVH 2DWDB 2OX5A 4M93B 1MHEB 3CU7A 1RU9H 2XWJB 2DQIL 5DZLA 3BUYB 3IJHA 3DO7B 4ZD3L 3RZCC 2EZ0C 2FZ3B 1BVZA 4WV1A 4AJ0A 3SN6N 1N7MH 3WIIH 1F58H 5IBLD 4HUXB 3FQUB 2A6DB 3NIFF 5F7DA 1YN6B 3GSWB 4GRMB 1VKXB 5CD5D 4X6CE 1JHKL 3GRWH 4A2MA 3QUZB 1HXMA 5T5NF 1A6TB 5B22A 2E9IA 2E27L 1NAMB 1PDKA 3ARVA 3DMMA 4U7MA 1AH1A 1SM3H 2W92A 1M05A 5HD8D 3T2QA 2AV7B 1CS6A 3NCBB 4PP1D 4Y4KD 2V9RA 5MEOA 2HVJA 2P24A 3O45A 4OZHB 5TQ0H 3BMVA 3IJYB 5D2NA 3U4EB 3KVQA 3C5SB 1Q9KA 3GI8H 5I1JL 2CRYA 1YYLH 4WJ5B 1H8NA 2CIKA 1NDMA 1L6ZA 1OAQL 3PV6B 2W9LA 3RVUD 2IEPA 2QADD 4JFOB 5DO2D 4XPBL 4J3OC 1EUUA 2ARWA 4PRNA 2CJUL 1OW0A 5TF1H 5DMIH 3D2UB 2AQ2A 5HYQA 3VWJC 2FBJH 4MGXA 1F8TL 3K3QA 5KS9E 1ZTXL 4TNWK 1KB5H 4YHIA 4GAGH 3WKMH 3VFRA 2CMRL 3C8KA 4CDHA 4FQLH 2WUCL 5ADOL 2VITB 1QPPA 3MLXH 3HG1E 1XGYL 5A2JH 4LCCC 4UOJA 5IWLA 4W4OA 1ZANL 5J6HA 3WFDL 3MRRB 1A22B 5D96C 1MRCH 2W65A 3QDHA 4MJ6B 1SYVA 3ZL4H 5I2IA 1T0MA 5KSAC 4KRNA 4UZGA 4NCC1 5JTWA 3GMMB 4M9OA 4XCFH 3RWIA 3BP4A 3ZDXE 3TO2A 2W1NA 4I0PB 3MJ7B 5BRZA 4OF8A 4K71C 4U6YB 3Q6GL 1CG9B 3BE1H 3QUML 4IRSC 3OGCB 4G6KH 4XBEL 1WIUA 4PRHB 4EJ1C 3WN5B 2BOCA 1BFVL 2A0LC 3NFPB 3S35L 3OXRB 5BVPH 5E8PB 5I66A 2EIBA 3QDJE 2PXYC 2VLKE 4NKIH 4LSSL 3PWPE 2X89D 4QLRA 1IBGH 3S37H 3TVMB 1Y6MR 1N5AA 3G6AB 1TCMA 4HEME 3OKNA 2VIRB 4HWNA 2Z92A 2V17L 1ZT7A 2XNAB 3O6FD 4KMTL 4XCYA 2BNUB 3BGMB 3KPOB 4EIGB 5GRJL 1IM9A 4S1DC 2H2PD 4FTVE 1ZK9A 5CS7A 4PBVC 4RAHA 1T2QH 5T3ZE 3O0RL 1YEIH 3P9LA 3JWOL 3LS4L 1R5IB 3RNQA 4X7TB 5T1DH 4M3JA 4U7SA 3Q5TA 4X6DE 4CNIB 4LRIA 4BM7A 5I1CL 2H26A 3DVGB 3OKOB 3WXWH 4LBEB 2YC1B 4H0HB 4TRPL 1A4JB 1FC2D 4XGZA 3L3HA 4F7PB 1X44A 3TH4T 2SEBB 3M1BA 4PBWD 5INDA 4WI2A 1AR1C 2PCPA 3P77B 1MPAL 1CGYA 3UAJC 3QWRD 1I1FA 3C2AL 2DQJL 3QUZD 4WW2B 5DFWH 2JKXA 4NQSA 3TYGL 4KJYA 3L3KB 5IBTL 4PJHE 5D5MA 3UDWC 4LARH 4KI5C 4FHBD 1N5YL 2QSTA 3VXTB 3CMOL 2JIXA 5E2WL 4PJ5E 3KLAB 1IE5A 1TVHA 1RK1B 2KKQA 1QYGH 2N56A 5KVEH 4XP9H 2EO9A 3DVIA 3QWQB 3L5WA 3MNZA 4N5UA 5FOBB 1MAMH 4BFIA 3QEHA 4PGDB 1FPTH 1L9NA 1LILA 4KTEH 4NQUA 4X6BB 1JNNL 4E42A 1PFCA 5TDOB 3SGKA 3BIBX 3T4YB 3D2UD 4NDMA 4UDTA 4NO5B 3QIUA 2VZVA 5KVDH 1S7VA 3PHOB 5FECA 1B4JL 2HLFC 3TP4A 2VXQH 2VERN 3FO9A 4Y2OA 5IUSA 2O5YH 1LE5A 1CLOL 4KTDH 5L0QC 1IMHC 3BKCH 5BW7A 4PLKD 2R2EA 3VD5A 5HHOB 2KQNA 5IV2A 2EEAA 4GKSA 3VGDA 4LQFL 1CE6B 1FVCB 3JTTB 3FFDA 3S34H 3VD3A 3ZKMD 4OB5L 4Y2DB 1CXHA 1Y0LA 4ZOEA 1HE7A 1PKQA 1VGEL 3LQZB 4ODHL 4TVPL 5J13C 4ZPVA 1KPRA 2WIIB 4NRXA 5F9OL 3ZO0A 2J5LC 3WUWG 4I0PD 4LMQI 3SOBL 4PJ8C 3BGFB 3A6OA 2VH5H 3NAAL 4GG6E 5C07A 3AREA 4L8SC 4GAJL 4PRHD 4OZIF 4QYOA 1CLZH 1T21A 2AJXH 4NJ9L 4FQHB 4LSQH 1JUFB 4U1MA 4GRLC 5EO0B 3MV11 5CJQH 4ZFGL 4XZUB 1KXTB 1J05B 2ZNWA 5JPNA 2FH8A 4I3RL 4X5WB 5MEPA 3TVMD 3BN9D 2FJFA 2MMXA 3MRLB 3D85B 4YDVB 3WV0A 4NRZB 1UH4A 4K3EH 3S5LA 2NXZB 5DC9B 2R1WA 3OR6B 3UZEA 3MGOA 4XP5L 1U6AL 1HIMH 4YBQC 4PR5B 1JPFA 2YMXL 3U4BH 4N0RA 2FHCA 4IHOA 4ODSL 3IRZA 5A43C 4Z7VF 3LH2L 3VFMB 1N0XL 2VZ1A 4GMTL 5GGTL 2DIAA 1I1YA 1JYWA 3PGDB 1IC7L 5I8KL 2NY7L 2HVKB 3FB8B 2ICEB 1T1YB 4PJBE 5FXCH 5H35B 4NN6B 4P23B 1LEKA 5DJAA 2UUDK 1S9XB 4KK5D 5IHUH 1P2CB 3S6CA 2VDOH 1HHIA 3CGTA 3CZJA 3PP3K 3SQOH 2Q7NA 4FQXB 4H26B 1AGEB 2ZNXA 4Z5RA 2VDQL 4ZUVA 2EIZA 3VJ6A 3QIBB 4B7IA 2H2SC 5IVXE 1CICC 3VFOA 5D2LB 3T08A 4U33A 4NOFA 3KYOA 5EA0H 2A74B 2YD6A 3NCFB 1OD7A 2D31B 4PG9B 5F70A 5D6DA 2LABA 5CP3H 4D0BB 1J5OL 3GSUB 1DDHB 5L7XH 1PQZA 1H15A 1UM4H 5JXEC 3FN3A 3CK0H 4JB9L 4NZRH 1QPXA 3X14A 4GAYA 1RI8A 1YJDH 3H7BB 3JWDH 3H9ZA 3VXQA 3QCVL 2PYEA 1HSBB 1HNGA 4LKCB 3QH3B 4QHMB 4NZTH 2FSEA 1MQ8A 3VD4A 1RZ7L 2C26A 1GRWA 4O2CA 4POZD 1MLCA 1KPUB 4TOYL 1OGTA 5DRXA 3T2PA 3H42L 3UTZA 2AJVH 2BNQB 2NW3B 5FYJD 4NM8L 1HYRC 1IQDB 8FABB 5ALBH 3OSKA 1YEDB 2K7PA 5F7LB 3BIKA 3RTQA 3F7RA 4R97C 4Y5VB 1WZ1H 2ATPB 4PJDA 5HHOD 3WNNA 4OTXH 1ZEAL 1LDSA 2B4CC 5HI4C 2QL1A 4WEUD 3SDAC 3SY0A 3JWNC 4W68A 3LMJH 1E28B 2DYPA 3MACH 5CJ5A 1JGVH 4Y2DD 1A6UL 5AZ2H 4Z0XB 3MV9B 4WFGE 5CKGA 5JQHC 5I16A 1YNTA 1TCRA 1QRNE 3MUGB 1PY4A 5EZOL 3FHQA 2WBKA 4K7PX 1QTYT 5GGVH 3S96A 5IEKB 3UTSB 5I0DA 1YMMA 1J0JA 2P8LB 2R23B 3BRDA 1JGLL 3MRDB 3DVFA 2VN7A 5BCAA 1RZIA 1V7NH 5HGBA 2F54E 2GSGA 1W0VB 4GW4A 1KJ2B 2FR4B 2ZSWB 4ZOBA 4YHKH 5EZIL 1NCUA 5TQ2H 1GOGA 1BZ9A 4HPOL 1U95A 1EJ6A 3DV6B 3RWGB 2V5SA 4HUNB 4MD0B 3D85D 3G5ZA 1RUKL 2CKBB 3IJSB 5KAQG 3FAXA 1UKTA 2DDQL 1MCEA 3FB5B 3LVEA 1J0KA 4U1KB 2ZKHH 4RMUA 5D9SB 1BJ1J 3B9VA 4HJJL 1KG0A 3L5JA 4PJIE 3MRIA 2NXZD 3EJJX 3O3AB 3HS0A 3FQRA 3FQWB 1UFUA 5C0GB 1UWXK 2APWA 3HI5H 4GKOA 1S7RA 1U58A 1HOCA 5LWYL 4ZO8A 2X7LA 1HCVA 1ZLSL 3E6HA 1MLBB 1OARH 4M1DL 1LO4L 4JANB 4PJXE 3HR5B 3OKDA 3HRZA 4WNQA 1YEFL 2HTKD 3MJ8A 1F3RB 3DGCR 4R4FL 4P23D 1TJHH 4PB0H 2EKJA 4G6AD 4Z7QF 5CINH 4G8GE 3D0LB 2R4SH 5IVZB 1AQKH 3RIFK 3VG0H 1C1EH 4LCUB 4R2GC 5KSBA 1B4RA 3HUJB 4MAYB 4FQXD 3OR7B 1Z3GL 4W6XB 2JELL 1A1OB 5DDHB 1U8IA 3KNBB 3QIBD 3ULVC 3MV7B 4UQ3A 1ED3A 1KLGA 1UWEL 3DARA 1N4XL 3QAZB 5E1HB 3D5OF 1OAKH 5DJZB 4V1DE 3MRMA 3PWLA 5TDPA 2X4UB 1MCOH 3ALPA 4N0YL 2W0FB 2XPGA 3MA7B 4Z95L 1OQXA 3SDDC 4QRUB 2H41A 4WI6A 3CC5B 1TETH 1N59B 1VACA 3CFJB 4Z7WA 3EBAA 1WBZB 3EYQD 3SE3A 1U2CA 5D1ZB 5IESL 4LSTL 2DTML 1IAII 2FCBA 5LAXB 3AUVA 5EULV 1S7SA 2PO6A 2OTUB 5KVMC 4GG8B 1WLHA 1U3HC 5IHZA 3NCCB 4HHAA 3LV3B 1CCZA 4WI5A 5L2KB 3HC0A 3GSRA 4HKBA 2BNQD 4JO1L 5CAYB 3LB6C 1F4WH 3N1MC 4LPYA 1H0DA 3DOSA 3MLZL 3QXAB 4LEXL 1U91B 4OSUH 5KANG 4Y1AA 1UZ6E 2BVYA 2PW1B 1MCPH 4OQTL 1KV3A 5HSFA 1XGRA 1A7OL 5DLML 3CXDH 3SE9H 4YWGL 5B38B 5DXWA 2IGFH 2EYRA 4QXUL 1MY7A 4XXCA 4RRPA 3U7WL 2IPKA 4J7RA 2X05A 1URLA 4HG4K 5GSRA 3MV9D 4F33B 4XXDB 4MCYB 1K4CA 5F3HA 3VXOB 3WEXA 1RMFL 2E9BA 1KIQA 2RB8A 4Y4HC 5TH2B 4K9EC 4TVPD 4CMMA 3TNMA 3ULUH 1JF6A 5JIHA 3VH8G 4JZJA 3UTSD 2MQ0A 35C8L 1X5XA 3TIEA 3EDKA 3AFLA 3SCMC 4QNPE 1M6OB 2DL2A 5EOCJ 4XBGA 1L0XA 4O2EB 1IC4L 1PKOA 1NCDH 3V6FA 5J3HD 2L4OA 5L6YL 2FLRT 4AENB 1MHPH 4P2QB 2DBJA 3V5HA 1DL7L 2NR6D 5GISL 3O2DH 1YNLH 2DLFL 1OTSC 3ZYZA 2UWEA 1X5AA 4M1GH 4LFHG 1DVFA 1FP5A 4QRTB 1OAXH 1CFSB 5FB8B 3TYFA 1EK3A 3O2DA 3EYFA 4QRSA 4TUOB 4LSRH 2WWKT 1V3LA 2ZPKL 1A6VL 4LLDA 3C87A 4JHBA 3OPZH 5D7JB 2HRPL 3MRCB 7FABH 3IDIB 4OZGE 3L3IB 5T33H 3QEUB 2X09A 3NIDE 4OIBA 1A7QL 4ZXBB 1Q9OB 4OGYH 4KWUA 4DZ8A 1YEGL 2MPAH 3MO1B 2X4PB 1LVEA 2WMPA 2OQJA 3IF1A 3T1WA 1B9ZA 2GJ6A 4MAYD 3MLWL 4WTWA 5C0AA 4YDKL 3QUYB 1MCKA 4YDIL 2XFXA 2NY0B 2UVEA 3ARDB 1A21A 3OB8A 1KFAL 4HIXH 2FX7L 3MV7D 4EEEA 3HI1A 4R3SB 3IU4H 5DTFA 3UXFA 5J4MA 2WLYA 4YPGB 2GY5A 3WO3B 1QLFB 3U6RA 1S9VB 1A9EB 4HK0A 4L5FH 3Q6FB 2P5WA 4IIQA 3PIQB 3CUPB 3BEWB 5LGJB 4ODWB 3MSPA 5EO1A 1N26A 3ZHLA 3H3BC 4JQXC 3MBEA 5I75B 1NMCC 1FN4B 1MRDH 4G5ZH 2YA0A 4P0DA 3H3PH 1LO0H 2DKUA 4PRPB 4WVRA 1J18A 5JIIA 5D1ZD 5FO7A 1RD6A 4MX7B 1GCFA 1I8IB 4H5SA 4DW2L 2C7UA 2VXTH 5EIIB 4Z7UF 1GVIA 3BPNC 4ONGL 4TNVF 4EVNB 5L2KD 4M4RA 5DFTA 5ETUB 3TH2T 2Q6WB 4X80H 1AGCB 4YQXH 4O00A 4U1HB 1RUAL 2J8UF 3QR2A 1I3RA 2ATKA 3RGVC 1RZGA 4OZHE 1R3IL 1BJ1H 3VFPA 2VQTA 4M6OH 5JQ6H 4HQQH 3QPQC 1FH5H 1XGTA 2ICWA 5HGAB 5DVNA 3RWJB 4Q9RL 4NO0B 4BQCA 4I13B 5K9JL 4M3KB 5DRZB 3HMXL 4ZUWB 1WEJL 4DVRH 3SDXE 5IB3B 2C9AA 2G60H 5E03A 2I60H 3GSOA 1KIPB 3X12A 1Q0XH 1EA9C 3H0TA 1XCQB 1MJUH 2OL3H 2W60B 3HZKA 4RBPH 5B39G 3N0PB 2FB4L 3G5YB 4N8CL 4KPHH 3BPLB 1OL0A 1YNKH 3QA3B 4JRYA 1MCJA 1PZ5A 2A83B 3X3FL 4JZOB 1K8IA 1YDPB 4LQ1A 4F15C 4P2QD 4RISL 2XACC 1I9RL 3FRPG 4Q0XH 2D03L 4CN4A 5I19H 4IMLA 5TF0A 2NX5B 2FEDD 3ARGC 2CDEB 1TTUA 5EO9A 1ES0A 5LQBL 3TN0