1G7JB

Crystal structure of hen egg white lysozyme (hel) complexed with the mutant anti-hel monoclonal antibody d1.3 (vlw92h)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
112
Chain Sequence
QVQLQESGPGLVSLSITCTVSGFSLTGYGVNWVRQPPGKGLEWLGMIWGDGNTDYNSALKSRLSISKDNSKSQVFLKMNSLHTDDTARYYCARERDYRLDYWGQGTTLTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3
publication title Estimation of the hydrophobic effect in an antigen-antibody protein-protein interface.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase inhibitor/hydrolase
total genus 28
structure length 112
sequence length 116
ec nomenclature
pdb deposition date 2000-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1g7jB00
4S0TD 1F6FB 3IFNL 1FYTB 1YEDA 5LQBH 4EEEA 2YEZB 2Z31A 3GSQA 3K4DA 1CQYA 4PJEE 5E08L 3TVMC 3PHOA 1T66D 1UCBH 3ZKMD 3ARBB 4LNRA 5AZEH 3QDGE 4XX1E 2WBJB 2XRAL 5EA0H 2AABL 1DSFL 5I66A 4UILH 3V5HA 2NXZB 1BFOB 1JF6A 2MCG1 1CG9B 3FQTB 3QZWA 3QIBD 3SEPA 2FJHB 4KKNA 5FYJE 2MHAB 5T3ZE 1NLDL 2H26B 2FR4A 1TETH 1EUUA 4MNQB 2BOCB 2ZSVA 3SDYL 2APWA 2M2DA 4LARH 5IBUG 2V7NA 3HNTL 1HCVA 5INDB 3RIFK 4ZPVB 2FL5A 3O3BB 1D5IH 1JWUB 3KGRA 2P49B 3KPSE 3FB8B 2M8XA 1QLFA 3S98A 4LPTA 4RQQA 2BX5A 3GRWH 3L3GA 1AGCB 4CJ0A 4I5BB 2NX5E 3S97C 5FA4B 2V2XA 5E0QA 4W70A 5HI4D 3X13A 3P4NA 3GUTA 1H8SA 3UTQB 4DEPB 3X14B 2EDYA 1DDHB 3RVVC 4LSQL 1YEFH 1J1XH 4APQA 3T4YB 4OV5A 3P30H 2AV1B 3LN5B 3S36X 4D0BB 5BXFB 5SWSD 3PGFH 4OFKA 3EYQD 3JWNC 5DD0H 4XP6H 5AWNH 1GGCH 3SJVE 5D5MB 3O3AB 3HI1B 5AG8A 1JGEA 1U8HA 5C9JB 1CS6A 4JFFD 3OZ9H 3TN0D 4IRZH 1QO3B 4WFHE 5EU6D 2AS5M 4LLQB 4BKLA 3H9SA 1S7VB 2Z8WC 3GK8L 4ZAKA 3QIWD 3O6MH 3MGTA 3BAEH 1X4YA 1F3DJ 4K3DH 1C1EH 5DJAA 2HKHL 4MCYA 2PUQT 1Q1JH 5DHVA 5E2TL 2E7HA 3KJ4B 3LRSB 3PXJA 5HVFB 5ITBH 3MGOA 1ZGLP 1OAQL 4HKJA 4UT7H 1KB5H 1QKZL 4PJAB 4EDXB 2KKQA 3C2SA 4U6VH 3SDXF 4AT6B 2YSSB 4NNYB 4ERSH 5D1XC 1JMZA 2P4AB 5DFWH 1R3LB 2BHUA 1M7XA 5D70L 1FLRL 3VGAB 1A3RL 1GC1L 1QBML 4PJDA 4MVBD 5HD8D 3MBEA 3QDJD 3PWNA 1HHIB 2XOTA 2VUOA 2AEQH 3PWUB 2FBOJ 4GAYA 2IFFH 4CJ1A 2W0KA 1RJYA 3LS4L 5CILL 1R5VA 3QEQE 1U2CA 4WU5A 4L9DA 3MLTB 1MCPH 5ICZA 4X7FC 2EDWA 4RGMB 1DBJL 2AERT 2C4XA 4LLWA 5HJ3B 1XAUA 2Z0BA 1M05B 5CJOH 3NGBC 5KOVC 3U0PA 5GXBB 3O45A 2AGJL 2C26A 4R4NC 5DRZA 1U8LA 1FL6B 3WSQL 2LVCA 5D7LD 2I5YH 1N6QL 4FQXA 2IPUG 3CSYA 3OAZH 3CFBA 1TCRB 4HHAA 5GS3A 1WC7B 5CBEA 1XZ0A 1T1WB 4Q74A 3FT2B 5GGRY 5B38A 1ZVYA 3RHWF 2J7LA 4NO0B 1GGUA 1ZA6A 2XPGA 1P4BL 5JXEC 4WV1A 4FQLH 4X7TB 3SDDC 2CPCA 3KYMB 4YPGA 1YY8B 4ZPTA 4X5WA 1WLHA 2JCCF 1IBGL 5GRUH 4CDGC 4UZGA 3VFTA 4KHTL 4WW2B 5TE7H 4PJXB 5D8JL 3RGVC 5DRXA 4MYWB 1QEWA 4EDWL 2GJ6D 4KJWC 4N5ED 4X9HA 5IMMB 1ZXQA 1CXLA 1MFBL 1G7JB 3QBTB 4L1DA 3CX5J 5MENB 5CKAA 5DD1L 1A9BA 2YBRA 3HFML 5DK0B 2KZ1B 2AJZB 1KPRA 4DZ8B 3HUJF 3P4MA 5B21A 3HAEA 1SJHB 1WWCA 4HMCA 5EO9A 2UV3A 3VXRA 1RSFA 4BZ2L 4X9FA 5BS0B 2EZ0D 4HLJA 1TZGH 4F37K 2VXQH 3MV9E 4KQ3L 1L4IA 3CVHA 1UB6B 4BFIB 5EIQA 1ADQH 1B0GA 5ALCL 4DN3H 3U36A 4ZS6C 1PG7L 4XXDB 4HCRA 2EE6A 2EXWC 2PYEE 5DUBA 2DQJH 1A7NL 1P9MA 3CUPA 4HMEA 1K4DB 1YNKH 4YBLC 2WIIA 4U1LB 1YPZE 1YMMD 2HJFA 3OJVC 2EE2A 1MRCL 3VGGA 4ZTOH 3JV6A 4G8EB 4HH8A 2EH7H 3NH7L 2M1KA 2J6EL 1FZKA 2D7TH 3L3DA 3QT2A 3B5GA 3P9LA 3WFBL 2BP3A 1DL7L 4YQXL 4O02H 4IDJL 3SKMA 1MCFA 4HUWA 4UDUB 3BKCL 2PXYD 2Y06L 2AXGA 5T33L 4R2GB 4LBEA 2QADC 4E41D 3SDCB 3TA3C 1OCWH 2R2BA 3B9DA 1R3KA 1ZGLB 4D9RD 3FB6A 1S7XB 4EN3B 2O5YH 5CJ5A 5MEOA 4JPVH 2AJSH 3IJHA 1FL3A 2OM5A 2XNAA 4OAWB 4KZEL 3WIIL 1HIMH 3ZE1E 5B4MC 1Q38A 3CFCH 3ZYOA 5KSBE 2AJUH 4QRTB 1I3RA 3K8LA 3RWEB 4XHJD 1H8NA 3U2SB 5LJYH 2ZUQB 5GGVH 5KSAC 1CDBA 2P8MA 4QKXB 4RAUB 5FECA 3OAUH 3IB4A 4Z18A 5DEGB 1G6VK 5TPWH 2DQEH 5DD6B 2OI9C 2GJZA 5MP6H 3JTSB 2MPAL 1K9TA 1RZ8B 1SJEB 3GMPB 5L2KB 1MIEL 1UZ8B 2Y36L 5EBMB 3LZFH 1EFXD 3ROLA 4F3FB 1INDL 3WE6A 1GHFH 4NJAH 4DN4L 3IAGC 2AK1L 4GRWF 3MV8B 3H9ZA 4UQ2B 1W0YT 1UJ3A 4KI5C 5C2BL 4FZ8L 3O6LH 4JY5H 4JFDD 5FDYA 3QXUA 2YN3A 2QQKL 2CMRL 4XWGL 1K3IA 3MCLH 5BV7C 3H2WA 5F96L 1RFDH 2EE3A 5C1MB 4RBPH 4PGDA 1KELL 4PJAF 3TEUA 1V5JA 1NGXB 3JWDL 4HZLA 1N0XH 2H2SD 2HH0L 3QPQD 2NPLX 3PIQA 1WFTA 3ZT5A 4JGJA 2FX9L 2LE9A 3RA7L 3VGEA 1WZMA 3T04D 5JR1L 3EO9L 1OP3H 3RZCD 5T3XD 3RWCB 4GAJL 4RGND 5GIRA 4Y88A 1B0WA 5CJ8A 5D1QB 1D6VL 1VESA 3ZL4L 4UTBH 1CZ8H 5CS7A 1KEMH 1IGMH 2JJTC 4YHKL 4L5FL 5EBLA 5CHNB 4B53A 4P57B 4F7TB 5I0ZA 1CDGA 3T65B 2R8SL 3BIBX 4Z78B 1IL1B 2SEBA 4GLRH 4KK5D 1T1YA 4GG8A 1JPSL 4GXUM 3F58H 4YR6B 4CMMB 1FE8L 4OZFB 1KG0B 1CGYA 3BN3B 5I1IL 1E4XI 3VXMA 1XGTA 3PP3K 1QYGL 1XGYL 2E9IA 4UOJA 1MI5D 2I07B 2F53E 2QQLH 5HHOE 4HFUL 5KG9B 3MNZB 3QWOA 4U49A 3D69A 5FGCE 2VDNH 4PRAB 2P45B 5IESL 4ODUB 1JL8A 5CP3A 4NN5C 3TNMA 2GCYB 3DYPA 5JIPA 3RRQA 4HT1L 4PJ8B 4X7SH 2PTTB 1MHHB 4MDJA 5HI4C 4YXLH 4GBXC 1NJ9A 2XTJD 3HE6D 2AJ3B 1KYOJ 4QF1A 4WW2F 2OMBA 3IETA 4PJXF 4KPHL 3ZKSD 1OP5K 3QRFM 2OTUB 3O41B 4MJID 1TQCB 3HI5H 4KDTA 3U82B 4A2MA 1EGJH 3L3JB 2G75B 2Y6SC 5CD5D 2AKRA 1K8DA 4K3GA 5HYEA 1YA5A 5IWLC 3K4ZA 3M17B 4F7MA 3C5ZC 4Q9CA 4DAGH 3IU4L 5DJ0A 5IJKC 3QI9D 1T80A 2FH8A 3U30B 1EAJA 4P23A 5TF1H 4W6XB 3G5XB 4JFZL 2FCBA 5T1KB 3D39B 4XNUL 1B4JL 2MMXA 4Y1AE 1QFHA 1CGSL 3MQIA 4ZUWA 4JN1L 3BQUA 3NPSB 1I8LA 5I30H 4U3CA 1DBAH 4F9PC 2X4OA 4L3AA 3FOMB 1T21B 4LLYB 3V5KA 5EU7C 1QVOB 1PEWA 4I8DA 2IAMD 3D25A 2FHBA 5IEHA 2FWOA 4C4KT 4WI8A 5HD8C 4OCLC 3RGHA 5JNYB 5C0EA 1WEJH 1L0YA 3DI3B 3CC5B 5K9QG 4MSWB 4WWKC 4WI7A 3W9DB 3QUZA 1NANI 5GGQH 3QUXA 4QNPF 3OKNB 4OV6F 3RWFB 3O3UN 5ETUA 2CGRH 5GISH 3ARGC 4ZTPL 2H6PB 4HIHA 1KOAA 2NY3D 1URLA 3MJ7B 3OR7B 4GRLA 1PLGL 1IM9D 2G9HB 4UU9B 1EEZA 1J9CT 1FO0B 2VXTL 2F58L 5DJYB 2HG5B 4XCYA 2Q8BH 4Y2DD 3MO1B 5JPMA 2LVEA 4XNYH 3LS5L 5IMOA 1JIBA 3FB7B 2Y07L 5TE4L 3S4SB 3O2WL 1TPXB 4PRHB 3VXUE 1OOAA 1LD9A 4ODVH 1VEMA 3V6OA 1INQB 2GTWB 2QTEA 4PV8A 4G9FD 4DW2H 3ARZA 3QXWA 5DK2B 3NCCB 2VL5A 1IQDB 2EKJA 1UM4H 4XVJH 5I19L 4UV4L 4CN4A 3O6FA 5DHVH 4OLEA 1Y0LA 1NH6A 2P48B 3UJJH 3FRUA 4JREC 5BJTA 3I9GL 3MLWL 1T7YA 3LN4A 3KG5A 4OF0A 3STLA 1G6RB 2ARJQ 5I8CB 5IW3A 5I76A 4OZFG 3QAZC 4PG2C 1UM5H 1K6QL 2XZAL 1U91A 5EWIH 2EC9T 1I8MA 5F3HB 4YBHA 2BRQA 5ACZB 5C0NC 4MJ2A 2P5EA 1F6AB 4Y4FD 2Q3ZA 2RR3A 3WIFA 4TSAL 5F7YC 3G5YB 5D2NB 4NBZB 4HPYH 1B2WH 1L7IL 5E7FA 3REVB 2YC1B 1HKLH 5E03A 4OLXL 3I6KA 5GS2H 1WQVT 1UQSA 1JBJA 5F1SA 1OSPH 1KTKE 4JHAH 1MJ8H 2B0SL 3NAAL 4NQCD 3RY4A 2YWYA 3TH2T 1NCAH 1FL5A 5LAXA 1CFTB 3DO7B 3GMRA 4MQSB 3S37H 5JHDE 3KPRB 5JW4M 4R97C 3RNQA 5C0IB 1UXSA 1OW0C 2DN7A 4MX7B 5HHMB 2EDBA 4I3RH 3OJ2C 4TVSa 5L2JA 4TQEL 4OZ4A 1MCDA 1LEGB 1K85A 1V3LA 1FYHB 5IFHH 1FFPB 4M7LL 1R0AH 4XP1H 2WANA 3OJDA 3NACL 1JGLH 4JZJC 2QSCH 3BP6A 4KVCH 5C09D 4N9GB 3A67L 2DJUA 3BT2H 1NQBA 3VRLF 4PJCE 5IIEA 4P2OD 3PL6C 4C56D 4YHNB 2O5XH 1G7QB 1U9KA 5A16B 2WZPD 2DWDB 4NQDB 1TDQA 2PXYC 3OHXB 4DKFL 5C0DB 3QNXB 3UCRA 2GFBA 5IM7A 2OL3B 3IJYA 4LVOB 3BIKA 4YWGH 3ARFB 3ELAT 3T0EB 5IROA 3CSGA 1CDCA 1RV6X 5GRJL 1N3NA 4KK8D 4PREA 1IAKA 4M48H 4DKDC 2YUZA 3AS0A 4NN6C 4JG0H 3HAEH 3SGDH 12E8H 2EC9U 3CPLB 4WTZG 3KPPA 3ARBC 1Q72H 4YO0A 2P7TB 3T4AB 4J7RA 4YHYC 5KN5B 4DVRH 1KJ2A 4R4FL 3SDAB 3CVHH 1NAKL 4L4TD 1X5XA 1BBDH 1F11B 1PSKL 4I4WB 5I1DA 5IFJA 5J12C 3T2NL 1T5XA 4WO4B 4QHKI 2APFA 4HCRH 5EOCJ 1XIWB 2Z8SA 3VRJA 2JJSC 1ZTXH 3CNKA 4Y19E 5C07B 2GW5A 4JAMA 4RX4D 1FP5A 1IEAA 1WZLA 1EMTL 4LGRB 4YXHH 2C1OA 3MRGB 1HSBA 3WFEL 4TSBL 3S4SG 2VZ3A 4EI5D 4GKZA 4OCSH 4YE4L 1G0XA 4NHUB 1XCQA 4H0IA 2EYRB 1A4JB 1HDMB 3LQZA 1P4LA 2EEAA 5ALBL 4WU7A 3L5XL 5ISZD 1KCRL 5TQ2L 1D9KB 1MIML 3QUMH 1UWGL 4HIXH 4RRPG 1KLUA 3U4EA 3QXDB 3W5MA 1RZJC 5IB1A 4XT1C 3VXPA 1HXYA 4Y5YC 1R3IL 4X98A 4X99A 5TDNB 1NGQL 3DSFH 1RZFL 3L95A 3VDBA 3QRGH 4LMQE 4MB3A 4LEOA 5I1AA 2HVJA 2IH3A 5FCUH 2J8UB 5FUCE 1MCWM 4I0PD 2ZP0T 2YR3A 2R0WH 3UC0L 3ARED 1S9XA 4IIQA 3G6JB 1N59A 3GSUA 3MBXL 4HIJA 3GB7B 4OUUA 4DFIA 3KNBB 2IFGA 2GITB 3T3PE 5DUPH 2E9JA 3CVIL 5JOEA 1KBGH 2H41A 4MDIB 2L0DA 1CF8L 2ZCKH 4NUGL 5HYJA 3FB5A 5L6YH 3AU1A 1T22B 3TIEB 5B22A 2VDOL 4LSPH 1VFUA 1YN7B 3CMGA 2XWJB 4LLMA 5MEQA 3VFNB 3KJ4C 5TH2B 1T7WA 2W0FA 2VXVH 2NY5L 4XPGH 1IGIH 4OCYL 1TJIL 3ECBA 3MMEB 3QULA 1J8HD 1X4XA 3D85A 1V7NL 4JB9H 1UB5A 2X7LB 3BMWA 4LOUC 5ITFA 2KL6A 1CR9H 3MOBH 4QHMA 3VGAC 4JFQB 5DA4A 3MJ9H 2BC4B 1F4WL 4UTAH 4LPUA 1NCWH 1KC5H 4LU5L 1AP2A 4OM0L 4LHQB 3QIBB 3VWJD 1IGTB 3BP7A 5CSGA 1IEBA 4P2RB 1DQJB 4XI5C 4NQED 3DMMA 5TE6H 6FABL 4YHMH 2BXZA 1NUFA 4NO3A 2QHLA 4JRXA 4KY1H 2CIIB 5F88B 4R7NA 1YEEH 3H9YA 2FJGA 43CAB 2N1KA 4I18B 3GMMA 5HHQA 3X3FH 3DPBA 4UUJB 3SKUD 4Z0BH 3O8XB 4EUPA 3HR5B 1ZHBB 5MEPB 3VWKD 4F9LA 1DBKH 3A6CH 5IOPA 1RIHL 1JWMB 3EW3B 1PAMA 1U3HA 3DXAA 3AY4C 2FYYB 1NUNB 4UI2A 3GMQA 3C6SB 4PYHA 5D7JB 3W39B 5KTEL 1AI1H 5FKAA 1FORH 5B8CC 1EJOL 1JHKH 3RAJL 2NY0D 4LGSB 3P2TA 3G6DL 1JRHL 2CRIA 2R2HA 5DJDB 3ZYZA 1T89A 3P11L 3RWJA 3WHE0 3TWCL 4HQQH 3NCBB 3C5SB 3H7BB 4QRPA 4TUJB 2DI7A 1G9NL 4UINH 3RWIA 2P1YA 4PJBA 1T83A 1YEKH 5GZNC 1KCLA 3IFNH 4JFFB 4UIMA 4X7EC 3TN0B 4XPBL 3N06B 5E5MB 1VHPA 4NNPL 1JPTL 4Z7WB 5E08H 3QIWB 4KROB 4WFFD 4WW2C 1NGPL 5E2UH 3BIAX 1J0IA 4JJ5B 4MNGA 2B5IB 2XRAH 4LLDB 3CXHJ 3N1GC 4WTWA 4Z7UA 3T0VA 5KZCD 2DTMH 5CINH 1QG3A 3QDGD 1I7TB 2OP4L 1T0MA 3HR6A 2DKSA 2VWEC 3D87B 4RFOL 5E9DA 3VMPA 4OZIB 4JN2A 3EO1B 4LCUA 1YJDL 5JIKA 2IAMC 1NLDH 4V1DE 1BGXL 4I3SL 1QSED 4P4KB 4Q2ZA 3SDYH 4XXCC 1R3JA 5FAAA 1BF8A 3IGAB 4C83A 2R56L 5EZIL 1T1ZB 1SMOA 4KUZH 3V4VL 3QDJB 4KTEL 3E6FA 2ORBL 2BVPA 2YRLA 5K59F 3HC4H 5F9JB 2W9LA 4F37F 4QTHB 3VD7A 1CE6B 4YLQT 3QXTA 4QHKJ 3G04B 4K3EL 3BO8A 3KPSD 4MD0B 3QH3A 3NIFF 1GAFL 3L5WB 4YIQB 1XGPA 4NP4L 1DBMH 3HZVA 3MUJA 1CLYL 3WO4B 5CEYA 3Q3GA 2IH1B 4LSQH 5FF6A 4OF8A 1Q9LB 4JM2D 4AG4L 2BVTA 4OF7A 4G6JH 2NZIA 4GOSA 3I3BA 5C0AE 1TITA 4XCFH 1KIQB 3SJVD 2Z92B 5D7LB 4DGVL 1YEJH 3KR3L 3I02A 2IEPA 3X12B 4CN1A 5J3HD 1AR1C 4J3OC 2A6KA 1ETZB 1TVBA 2VKXA 2IBZY 3ILPB 4WFHD 4LSDA 5KW9L 2YPKA 3SDCC 5C0CA 3QQ3B 2VDPL 4E42B 2XWTA 2FECL 5E2TH 4EN3C 4P9ML 4AQ1B 1WT5A 2Z31D 5T1LD 3GNMH 4N0YH 4D8PA 4OGAD 3NBNA 2VC2L 3VI4F 1Q0XH 3RPIB 4DTGL 2R1YA 5D70H 2FGWL 1A3RH 2GJ6B 3ULVF 1KTLB 5JIHA 1QBMH 3B2VL 4AMKH 2A9MH 3DX8A 3TV3H 3GMLB 2ZUQC 2B20A 4C4KO 3V79C 2JIXA 3DBXB 2ITCB 2X89A 3MRDB 4Y4KC 1LO2L 1FIEA 5JMOC 1MFEL 5CILH 3LKSA 1S7UA 2X9XA 2J8UF 5EZLA 3HNVL 2EECA 1E4XH 1LK2B 3LV3B 3SOBH 4OZHB 3BPCB 3IRPX 5F1NA 5SWQA 2UY7A 4AYFA 2EDDA 5GJTL 2MNUA 4LRIC 3F7RA 3P0YH 5IHUL 1CDUA 1FHGA 3OAZK 5FKPB 3WSQH 2A0LD 2VXUH 3SE3C 5E99L 3IS1X 1YMMB 5HI3C 4XZUA 1AGDA 1DLHA 3V0AC 2EDXA 3NIDE 1MFAL 1DEEB 2OR9L 4LSSL 1RZIA 5TGBB 1I9RL 1I1AA 1ND0A 4N1CA 3WYRA 3GSOA 2B7DT 2UYLA 4O2EA 1BFTA 3MRFA 4P2OC 5DVOA 5EUOA 4BSJA 4R3SA 1P4BH 1AO7E 1XGUA 3RWHA 4WDIA 4R96A 1HOCA 1F4AA 4XNZB 1X5JA 3JV4B 4M5YH 1UXWB 3EJYD 3IFOB 1I3GL 4ZAKD 3BHBA 4CVUA 2HMID 4QHNA 4OLUH 5D8JH 5D6CA 2P5WB 1V7MH 3MLSL 3QPXL 3RWDB 4FXKA 1WUNT 2EDOA 3SO5A 4F15B 4XVTH 2ZJSL 1G7LA 2H3NB 4JVWA 1MFBH 4ZODA 1S9KC 2WWMC 2EDFA 3SQOL 1VACB 2H45A 3M8OH 1S78D 2BDNL 3HFMH 1DN0B 4JHWH 1I4FA 2QKIB 3PJSA 1A64A 4PJIB 2IWGA 2GTZA 4KHXH 5HVWA 4QOKA 5GGUB 5IVXB 3LKNB 4Y5XA 5EBWA 1AGEA 1PG7H 3ZKND 5C92A 1VPOL 5C6WH 3JSSA 3DVIA 1T7ZA 2ADGB 1A6AB 5ESQB 1A7NH 3CK0L 5E8DL 1P53A 3FRPA 5BRZE 2PYED 4XCEB 4GW4B 2UWEA 1HKFA 5IF0B 3MRPA 1JGUL 4U1KA 5GS2D 1DVFD 1MRCH 4N1HB 1O7SA 3R0MA 4L8BA 4Z7WF 1F3JB 5SV3A 3ISWA 1DCLA 1YYML 3DNKA 3GIZL 1A1MB 4E5XA 2BNRA 3V5DA 4ONGL 3WFBH 5GSRB 5DS8A 4YQXH 4JFDB 1KFAH 4IDJH 5CGYD 1KT2A 2WBWB 3TT1H 1U8IA 4FQXD 1Y18A 4OZIF 4NWUL 4BQCA 5HHPA 3LPFA 5LGHL 2Y06H 2Z93B 5HDQL 4WY7H 3KYKL 5JW4Q 1T1XB 2BVQA 4GRWE 2O26U 3U30C 4X6DA 2PTVA 4PLJD 2VISA 3PF2A 1PVHA 4P2QA 3QFJB 4GAGL 1P2CA 5F71A 1T3FB 2VH5L 3MR9B 3RZCB 5BZDB 1YEHH 1DZBA 4NOFA 5DMIL 1NGWB 1H0DA 1OGTA 1A5FH 3NPSC 4M6OL 2RQ8A 3G5ZB 4JANA 2HFFB 4KZEH 1CIDA 2RFXB 3QUKB 2OJEA 5F7KC 3G08B 3D0LA 4NQSB 4PJHE 2FD6H 4GKSA 3UJIL 1JHTB 1MAJA 2DM4A 3SCMC 4PGZA 3B8YA 3RL1B 4K7FA 5F9WC 1MCKA 2I25N 2AV7B 3WLBA 3EFFA 1IZJA 1ZWIA 4N0CC 3VFOA 1CD9B 3VXRD 2EDTA 2A9NH 1SM3L 3AB0C 4LDLB 4NKMA 1N4XH 3BUYA 3PWVA 1WBXB 4WHTB 2BNQA 2Y36H 4FQIL 2CK2A 1MI5B 4JRYA 2X10A 4LAQL 2ADJB 4DN4H 2HT4C 4LVHC 2H9GA 4EKXA 3T2QA 4XBGA 1S9WB 2P24A 3CSPA 3T8XB 2RHEA 5I2IA 3PDDA 4PR5A 4NKOA 4LCYB 5C2BH 3DX6A 2UY6A 4OIIL 3F65A 4PJ9C 4RBPK 5JQ6L 4ZFOB 1X6LA 3BDYL 3WN5B 4NC1C 4KMTL 2QQKH 1RUQH 3GSNL 4GRMB 1TPXC 1IQWL 5F96H 2F74A 3HE6B 4M43L 1VB9A 4ONHA 4L3EE 4DKAA 5FYKU 4X4YA 3S88L 5JZ7D 1K4CA 2R2EB 4MAYD 5DJZA 3KPNA 4NDMB 3HE7D 3P77B 1EIBA 4MJIB 5B3JE 2JJWA 3GHEL 2VE6A 1JHLL 3CDYA 4YGVA 3EO9H 3QFDB 4PG9A 3P4LA 5C08A 1X44A 2ADFL 3NPZB 2GK0B 4GAJH 2IPKB 3ZL4H 1XGQB 1D6VH 3AUVA 4GQPH 43C9B 4LCCA 4PJGE 4AJ0A 4PJ5A 1OGAE 1D3CA 3BI9X 4LSVL 3ALXA 1XGRB 1A6WL 4L5FH 3L3OA 4OZHF 1BOYA 2NYYC 4OLWH 3FOLA 2IPTL 3BH9B 4GG6B 2R8SH 2RGSA 5F1IA 5DO2C 3IDUA 1JK8A 4H26B 1JPSH 1TZHA 2NXYC 3GIVB 3I84A 1FE8H 1X5GA 4G8IA 4KMQA 4ZFFA 1GOHA 1QNZL 3C6LC 4LKCA 4CVXA 1UYWH 1RZGA 1TQBC 4HFUH 3WNMA 4EUPH 2DQIL 1FAIL 3ZTJG 4O2CA 5E8NA 3C87A 5IESH 2APBA 1MCQA 2YXMA 3ZTNH 1QRNA 2VXSL 3TO4C 2NQCA 1PY9A 4KH2A 4NKIL 1LEIA 1JNLL 4HT1H 3KYOA 4NZUL 1E27A 1YMHB 3UZEA 5EU5B 1BP3B 2R0KL 3ORJA 3UDWA 5FYLH 5ID1A 1IM9B 1FDLL 2EDNA 4FNLL 3CFKB 4KPHH 3QCUL 5BV7L 1M71B 5DJ8B 4MA3B 3UYRL 3MLYL 3O6KH 5JDSB 4N0UA 1YEIL 4ONOA 1A6UL 1LO0L 1ZAGA 4MMXC 3SKOB 3KLHC 4MWFA 1LE9A 3OR6A 4RGOL 3H6JA 3SQBA 5JO5A 5JW4R 4U1SA 1NGZA 4I2XA 3RZWA 4RAVB 3RDTC 4G9FB 2X1WL 4PJIF 2G5RA 1AQKL 2J5LC 1X7QA 3HS0B 3QEHA 4UNTA 4Q9QH 4LVOC 2FLRT 4JFZH 5IVXF 1B4JH 1KPUA 3RTQB 3RNKA 4M93C 4NHCL 4PJ7B 3OSKA 1HHHB 4JN1H 1EHNA 2WK2A 1CVRA 4ACPA 1OM3H 4YJZL 5C86A 1N6VA 2G2RB 4MJ5B 2VSCA 5FO9B 2GAZB 2LQRA 2HTLD 32C2A 1R3HB 4M62H 4JO2H 1TXKA 4GS7B 5EO1A 3SDAC 3TVMA 2I27N 3D3VB 1EAPA 3WS6C 3ZYIA 3IU3A 2DQDL 4L29A 5HGAB 1U42A 4Y4FB 3O4LA 3CCHB 3EYFB 4P5KA 1E28A 3E3QE 5BCAA 4Z7QF 4ZUTA 1X3DA 1MCSA 1N2RA 4GW1A 3GSRA 4OBSA 3DSNA 1ZT1B 4FQPA 3VMNA 4FRWA 4CU8A 5LGKA 2D7MA 2IG2L 3UJTL 1X9QA 2VDQH 3UTSB 3W81A 4JFEE 4Z0XB 3D2UB 2VXTH 3DGGB 3CZFB 2F58H 4NQCB 3MRRA 3G5VA 3H7LA 3MV8E 5I8EB 5FCSH 4UT9L 4FOMA 4X80L 4M6NH 3C2AL 5E8EA 2V17L 3W0WE 2K7PA 1D9KC 3OF6A 1I9JL 4G8GE 5HGBB 3SE9L 3SPVB 5DQ9B 3WIHL 3BEVA 1SYVA 2WUBL 1PZ5A 3FAWA 2D31A 2XQYK 4PLKD 3TBYA 1KSRA 1MCHA 1G7HB 5DZNA 3U4BH 1MHCA 1Q9KA 4APQC 4HGMA 2HFEB 1DANT 4H88H 4EOWL 1I7RA 3HRPA 1KV3A 4ORGB 3CX5K 4PRPB 3WHE1 3IDNA 3MV7A 5SX4H 5BQ7B 5C0GB 3ARDA 4PRNB 1MJJB 5C09B 3CLFH 1JGVH 3MLWH 4LL9A 4PS4L 4G6ML 4ZSOB 2I9TB 3I2CL 3H0TA 4ZAKC 1XR9A 2XZAH 1IGYB 4IS6B 4H5SB 1UWXK 3JBG7 3O0RL 5A40E 2E8ZA 3GM0A 4Q7DA 2D7PA 3KS0J 4MCZB 3ULUH 3BQUD 3RL2A 1JYWA 2NW2A 2CDGB 3PNWB 4IRSD 1RIUL 5D7IA 3WS3B 2FBJH 1RUKL 4FP8H 2E7CA 3O3DB 1MJUL 4X8JA 1R6VA 2CD0A 4L4TB 5JIIA 2YHGA 4KUCD 2GSGB 3O11B 4P9HC 2P42B 4U6HB 2BFVL 2VQTA 1BJMA 3MBEC 5GS1C 2HTKC 5BW7A 2B0SH 4E0RA 2YD2A 3LKPA 3NABL 4N68A 5FO8B 3QUXD 3E8UH 2NW3B 1F4XL 3VXTB 3BPOB 2VLJE 3RY6C 5IR1A 4WHDA 1CIUA 3P9WB 3CFEB 4EI5B 1WCBA 5I18L 4GRLD 2CDEA 4S2SA 3JVGA 2V9TA 2ZNWA 3KXFB 4WTXA 4OZGA 4FQCH 2NY2B 3BP4B 1BLNB 4BJLA 2QV2A 4BH7A 1WWWX 3MODH 4AEHL 4M7LH 4FQJL 3VFGL 5D7JC 4KWUA 4U1JB 3VFPB 3HPJB 3NACH 2D9QB 3T0DA 2DLGA 3BKJH 4IRJB 2R4SL 3CX2A 5J89A 3A67H 3CIQA 4ESKA 3F7VB 4GG6F 1HQ4B 4P99A 4WUUE 4DJMA 1HXMB 5GJSL 3L7EA 4HPOL 3DX9B 4I0PB 4DKFH 2XWBA 3AREB 5F7EL 2VABB 3O6FD 2VZVA 3WO3B 4LCWA 5GRJH 3LPWA 1DUZA 4WV1C 4LLUA 1Q94B 5FHBL 4KROC 3PHQA 5D2LF 4BYHA 2VERN 2WLYA 2VZUA 4ELME 2CDFA 4WENB 1NAKH 4OIAA 1PSKH 1BBJB 4JQXA 4MD5B 3T2NH 2P5ED 1PJ9A 1NEZA 5DJCA 4HD9A 3RGVA 5KS9B 5DI8A 4X4XB 3FONB 4ZO8A 4JKMA 1J8HB 1Q9OA 1S7SB 3D9AH 1EX0A 4AH2B 5EC2A 5DWUH 2N4IA 5K9KB 1EMTH 2R0LL 4PRBA 2R4RH 2HYMA 1U92B 2PYFB 2OK0L 5E7BA 3EO0B 4YE4H 3FO1B 3H3BC 5CBAA 3WKNA 4NQEB 3SGEH 1CDIA 1FSKC 3T2OA 2MQ3A 4S1DC 5ALBH 3I75A 4LMQI 2OZ4L 1KCRH 3NN8A 1MIMH 4YXKL 1UWGH 4HX1A 5SX5H 1OSZA 2C3VB 3NA9L 3QQ9D 5CWSB 1R3IH 4PGEB 3B3IA 4PJ7F 1NGQH 2DDQL 5DHYB 3GSXB 1RZFH 3QHTC 4LHUD 4ZYKB 4HS3A 2DQTL 2V9RA 5HGHB 3ESVF 3UC0H 1I7UB 3DUUB 3VFWB 1AD9B 3U7YL 3UO1H 3EHBC 3MA7A 3MBXH 3W9EA 5LBSL 4IBLT 3I6GA 4G8FA 3QXAB 4WHCA 5JZ7C 4L4VA 3GSNA 1JF1B 3CVIH 1U8QB 1AFVH 1U58A 3IAQA 4MD4B 1HSAA 3IT8D 4GT7A 3OPZH 4WJ5B 4NUGH 3A6BL 2XN9E 5CJQL 2VZSA 3MNVB 4PBXA 2A83B 4JKLA 2L7JA 1I3VA 1EA9C 4LF3A 2QHRL 4A6YL 2D0GA 4H8WC 5TQ0H 3TA3A 4MQ7B 1QLRA 2NY5H 3S35L 4HZAA 4BUGA 1AH1A 3HZMB 1RPQA 4OCYH 1J5OL 5IW6B 1RIVL 5FA3B 4FA8A 3GZKA 2YUXA 1YECH 1V7NH 1NBZA 4K23L 2QSVA 4FMFA 1VGKA 3PQYE 4L8SB 4PJEB 5KZCB 2WIMA 3QWRA 2NY6C 1F4WH 2ICCA 3QDGB 3WHXB 3FO2B 4LU5H 2VDML 4XVUC 1CFVL 1CDYA 4OM0H 1JTOA 5LCVL 4HKBA 1C12A 3NFPA 4KKAC 5J9PB 1GZQB 5IBLD 6FABH 2FB4L 2AJVH 1FNGA 2HT2C 1OAUL 1RUAL 5KSAA 4PJFA 1KIRA 3BPLB 1MH5B 3LRGA 1NC2A 2GT9A 5E6IB 3PWPA 1NDMA 4ODWB 1UZ6E 3GKWL 5J1AA 4B5EA 1H5BB 2C7UB 1EEYA 1RIHH 5C0BE 3E0GA 1YZZA 3BPNC 3KPSB 3NZHL 4QGTA 1AGBB 3FHQA 2GSIA 4QXGL 5F89B 3C9NB 5KTEH 1DQTA 2OTWB 3TBVB 2NX5B 1NGYB 4JDZB 4ZXBD 4JFXB 4U1HA 5JOFB 3P11H 2JF1A 4JM2B 4H1LB 2IANE 4LQFL 3MUZ1 5K59E 1G9NH 5TDPB 4Q9RL 3T2PA 1QLEL 3SJVB 3ZE0E 1F2QA 4MGXA 4XPBH 5A43C 1HHGA 4S1SL 1R5WB 3ULSB 2E6JA 4NNPH 1T4KA 5H8DA 1JPTH 1WV7T 2DTSA 4LPVA 4HV8A 4PB9H 1IC1A 5HGDB 4KZDH 4ZFGL 3JZ7A 4WW1B 1ZSDA 4Z7VB 3KPLA 4YFDB 3JWOC 4FQQB 1WZKA 1RJLB 1H3TA 4RFOH 4TPRL 1YJDH 2JJTA 5KSVA 5T1LB 4QCIB 4JFHD 3VG0L 4KRNA 1U8PB 4I3SH 4YDVA 1J8KA 4PBVC 4NOBA 1HWGB 4YUEL 3MYJA 5E00B 2R56H 5EZIH 2G5BB 3V4VH 4KTEH 1OAZH 2ORBH 1JUFB 3DMMD 4P5TA 3REWA 5I8OH 4CVZA 5CSZA 3T1FA 1GAFH 5JXAL 1FVEA 5E1AB 2VLKA 4MXVF 4XNQB 3GI9L 4NP4H 3WNNA 4Z7OF 4FTVA 1CLYH 5F9AC 3VXNB 4DFHA 3MRBB 2CRMA 3HLAB 5D4QA 3PG2A 1PYWB 4PRIA 2P43B 3L3GB 4S11A 1U3HD 3DYOA 3DXAD 4NN7B 4QRRE 2D7OA 4KI5E 2J88L 4GBXA 5J11B 1JYNA 2D0HA 1YC7A 1TJGH 3T3MF 3PWJA 1MWAL 1J88A 1BQLH 2F5BL 3H3PL 3KR3H 5C0AD 2W92A 5I1HH 5KS9F 3NCFB 5FYLD 1JGDA 3MA9H 4QRPD 3DWTA 1WBZA 5GGTL 4MJ4A 5IB3A 3GGWA 4XMPL 2QSTA 1I3UA 2Y7QB 4XX1G 3CU7A 1QQDA 5IWLA 3C5ZA 4DGIH 4L3CA 4P23C 4P9MH 4D0DA 1SY6L 1B88A 1T7XA 2V7HA 3JV0A 2DLFL 3E6HA 4KVNL 4JQVA 5EO0A 1Y6MR 4TTDD 2Z8RA 3O2DL 3BQUC 1Z5LA 1BM3L 3M45A 5DHVB 4M7ZC 5E9DD 1H15B 4F9PA 4HKJB 4HS8H 1UCBL 3QA3B 2NNAB 1LO2H 1SEBA 5EA0L 3CU1A 1MFEH 4OB5L 5CMAB 2DQHL 1JV5A 2VMFA 4PJDB 4PV9A 3AMKA 2JELL 3QUZC 4NQXA 1CDJA 3KLAB 1UFUA 4W81A 2UZIH 5SWZA 4LRNH 1TETL 3MV9B 3IVKA 5GJTH 2VLRA 4G7VH 5IHUH 1MHEA 4TUOA 2PYEB 2AXFA 3L3KB 4HUXA 2CKBB 3SDXA 4X6BB 5BVJB 4Y4HD 3HG1E 2Q76B 2EYTB 1DVFB 2OR9H 4LDOB 1YPZB 4LSSH 1W72L 2RBLA 1P7KA 1SMAA 3FZUD 2N56A 1OQXA 4X5LA 2EKSA 3V6OC 1YEGL 1CGUA 4PJEF 5SWSE 3VCLA 3O81A 5E8OA 4L8CA 3T0AA 1J1XL 3DVNB 4FQXB 1AO7D 3PGFL 4ELKA 1I3GH 3P4OA 1GGCL 4KKLC 3EDFA 5ACMA 5H35A 5B38B 2PNDA 5EU6E 3EOYG 3FMGH 5HYSB 2VAAB 5L88L 4OFIA 3OKOB 3QZWG 3MLSH 3QPXH 4PTTA 1OTSC 4F7PB 2ZJSH 4KXZI 2YPLA 4PG2A 3HZYA 2CLVA 1DQDL 3UTTA 4J12A 1FG2B 3TIDA 2KBGA 5KSUA 1IM3A 5IP4A 4K3DL 3TO2B 4BSVA 2UUDH 3NCEB 4KRPB 1Q9WB 1PKQE 4QEGA 1K5NB 1Q1JL 1HNGA 5H94B 3BVNA 5ITBL 5EU7E 4CW1B 3OBAA 1OWRM 4UT7L 1GZPA 4NFBA 5F6IB 4X6FA 1KB5L 1FN4A 1MUJA 5KSBB 3ULUD 3VU2A 2JIXD 1JPFB 1TENA 1KJMB 3RVXC 5DFVD 2FX7H 4ERSL 5GRZA 5EO9B 4JM2F 5GSVB 5F7UA 3OKEA 4GKOA 5E8DH 3EOBB 2JCCA 2RJMA 3MROA 1XF5B 3MRNA 4JDTL 1MLCA 3BEWA 4M61A 2IFFL 1EDQA 1JGUH 1U8KB 1JPGA 1WTGT 1DUYA 1NLBL 1KNOA 1NUGA 2BMKB 3DIFA 1OW0A 3GIZH 1MCPL 4GSDH 4MS8C 2PR4H 3TCLB 1QSFA 3J8F7 4ONGH 4Z7VF 1MHPL 4U0RC 2OZ4A 3S96A 3HUJA 4RFEA 5D93C 4ZG1A 4JEGB 5CJOL 2HWZL 4NWUH 1JWSB 1A7QL 3AAZA 5LGHH 5D7LE 5CEZH 4DVBA 1U8OA 3VE0A 2ZG3A 5DJXA 1YN6A 3GJFA 1NBYA 4X6CE 1AQDA 2I5YL 1CLZH 1O0VA 3MRHA 4M6AA 4MAYB 4NZRL 4GH7B 2PN5A 3HE7B 2P47B 3QUMB 3VI3E 3RTQC 1LO5B 3NCJL 2QLVB 4X9BA 3EBAA 4PFEA 4M6OH 2ZWLT 1CN4A 5ILTL 3FFDB 4OF3A 3BYTA 1FYTA 3QDMA 2YEZA 4J4PD 4R4BB 2CRZA 4HH9B 4GS7C 2Z35B 4Z6AT 2KQMA 3UJIH 2HLFD 3ARBA 2RAMA 2WBJA 2PO6D 3B2UC 1C7TA 1GGIL 4HS6B 5TE7L 1EO8H 1NSNH 1BFOA 1CG9A 3FQTA 3MOAL 3BZDA 3VD4A 1SM3H 1UCTA 2FJHA 2MHAA 1QFPA 4OQTL 3BP5B 4FQIH 3VXSE 2J4WH 4TSCH 4BH8B 4MNQA 3TPUA 2BOCA 4MB4A 5HDBE 4O5LL 3GJEA 5INDA 4MZ2A 4ZPVA 1IC7L 2F53B 5HHOB 3O3BA 4MQXD 4HJ0D 4HKXB 2X4RB 4NO2B 3TF7C 5FGCB 1HE7A 5DMGC 3FB8A 5D1ZB 1ADQL 4CU6A 3U9PL 4HC1L 1AGCA 4I5BA 1FNLA 3GSNH 1PKOA 3T77B 5H2BB 4GQ9H 3TJHD 3TYGL 2DQJL 5FA4A 1IQWH 2NY4D 3JXAA 5B38G 3QIUC 2Y25A 1ZOXA 1NFDE 2BSED 4J1UB 5L0QC 5D7KD 5HYSG 4KK9D 3X14A 1UJ3B 5I75B 4RMUA 3ZKQD 5IBTL 1RU9L 2AV1A 3LN5A 4D0BA 5BXFA 4PLOB 4OGYL 1ZHNB 4M8QB 1KPVA 2GYSA 5D5MA 3O3AA 2EH7L 4M1GL 3HI1A 2D7TL 4IHOB 5C9JA 1XH3A 2XA3A 1GPOL 1QO3A 4LLQA 3AXLA 4FG6D 4LSVH 1A6WH 1S7VA 4D9QD 5ANME 4PJDF 1XCTA 4E41E 2K1MA 3Q6GL 3WNKA 3DETD 5MI0C 4KTDL 2OXGA 3QDME 3IS0X 3HAEG 2CUHA 3R8BB 2NY1B 1OCWL 3LRSA 1FFNB 2ID5A 1N26A 1QNZH 5T1DL 4PJAA 3LB6C 4EDXA 4PJIE 4AT6A 2YSSA 1ORSB 2IJ0C 4NNYA 4M9PA 1X5KA 3OKDB 3L3HB 1LNUB 4HBCH 1R3LA 2DQIH 4D2NA 1YPZF 1HIML 3V4UL 4AL8L 1F2XK 1HHIA 4YC2C 5H37H 3DMMC 3PWUA 5ACLA 4P46B 1P84J 1MNUH 4NKIH 3V6FB 5EULV 4NZUH 1V3MA 4K8RC 4JRYD 5D7SH 4M4RA 2E7LC 3MLTA 2R0KH 2FIRT 3U1SL 3OL2A 3V52H 1PQZB 2HRPL 2NY2C 5MP6L 2L7UA 5BV7H 3QCUH 3UYRH 3TNMB 3MLYH 1LP9E 2CIKB 3LZFL 1YEIH 5HJ3A 1M05A 2J8HA 4PGBB 4NJAL 3BJLA 1LO0H 4IRJC 3IDJB 1AGFB 3RI5K 1NJ9B 4OLVL 15C8H 4Y5VB 4K94C 1FL6A 3N1QC 3A6OA 5EZJA 3IETB 4N0FB 3T09A 1IILE 3FAXA 5I71B 3VXUB 5B8CA 1T89C 2DLEA 1S3KL 5F7HA 4UAOB 1TCRA 4ODXB 4YDLB 1MQKL 1WC7A 3EJJX 1MWAA 1T1WA 3FT2A 1RFDL 1T83C 5KSBF 5C08D 2VJXA 4NO0A 1N0XL 4X7TA 2ITDB 1FQ9C 1EXUB 2DM2A 5C0FB 4K7PX 3KYMA 1YY8A 1AXTH 4PJ5D 4RGNE 2B4CC 1UWEL 1FFOB 4LLAA 3T0XA 5EH1A 4WW2A 1EUTA 4Q6IB 2Y5TB 4PJXA 3SE8L 1SY6A 4CRPA 1A14L 4XNMB 1CE1H 1CZ8L 1M1SA 1P6FA 4IRSB 3TCXA 1KEML 1IGML 5IMMA 2NLJB 1G7JA 3N50A 5MENA 5CD3B 3K46A 5DK0A 2AJZA 3RIAK 4DZ8A 3S3JA 2CJUH 5C3LD 1SJHA 4NQTA 1IGFH 5DGQA 5IEHB 4NKDA 3OKYA 5BS0A 2BVEA 5CZXD 5EORH 3F58L 5JORB 5E8PB 5IMKB 5DVLA 2DJSA 5C0EB 4BFIA 1UB6A 5K9QI 2E27L 4Y2OA 4JFED 1QRND 1LILA 4LAJH 4XXDA 4UT9H 3QUXB 2X44D 4X80H 2JJVA 2QQLL 3C2AH 3SO3C 1JVKA 1I9JH 3V7MA 4OF6A 2VDNL 1WAAE 3F62A 2FX8L 1K4DA 3O3EB 1B3JA 2WUBH 4U1LA 4G8GD 3P73A 5AG9A 1EEZB 2XZCL 3FN9A 2XTJE 1RUPL 2ILLA 4XPTL 5J6HB 4P5MB 4EOWH 4X7SL 4YHOL 3BGAA 3FZUC 4G8EA 4YXLL 3F7YB 3WL9B 3L6FB 4X4ME 3TFKD 3V9FA 3OWEA 3W2DL 1ACYL 4N8VB 3S5LB 4MJIE 4MJ6B 4QT5B 3AFLA 1WZ1L 3I2CH 3M1BB 4X0KB 2VL5B 4UDUA 4Z77B 4KKBD 3HI5L 2CUMA 2FECI 1A7BA 3MNWB 1QBAA 1ITBB 3UP1A 1YUHA 4RMVA 4FZEL 4JKKA 3SDCA 2DRUA 4DAGL 2NTSP 4WGWB 1ZGLA 1BVZA 3MRLB 1WT5C 1S7XA 3RKDC 3VA2C 4EN3A 3BD3A 1RUKH 4Z9KB 3CLEL 4TUKL 1NUDA 4FQ1L 1MJUH 1X5ZA 5IFAL 2ESVE 3TVMD 2DS4A 4MA1B 4OAWA 3QJFB 4BQ9A 1EO5A 2VWEE 2BFVH 1LE5B 4QRTA 1J0KA 3RWEA 3RJQB 2DIAA 3U2SA 1A2YB 3NABH 5DFVC 3HCVB 4RAUA 1F4XH 5A3IC 2CH8A 3BPLC 5DEGA 5D2LE 2R1WA 3T1WA 1QHPA 3H9HB 2OTPA 1D7FA 1OLZA 5E6IC 5LG1A 5DD6A 3ILQC 5I18H 3U7AA 1BJ1H 3JTSA 3T0BA 1RZ8A 2D2OA 3GMPA 5L2KA 3IDIB 5EBMA 5GGQL 4F3FA 2PF6A 4AEHH 1O5DT 4FQJH 3OF6D 3VFGH 5ID0A 4UQ2A 4LNVA 3MSPA 3DROB 4LRIA 1IRAY 2F54A 2R4SH 2LU3A 1IAIH 5DK3A 1CGTA 2Z8VC 4DZBB 5DF0A 5L2JB 3EJZC 1FNFA 4LHUB 4AM0B 1CXEA 4PP1C 4HPOH 3EYVB 3RVVD 4XNYL 3ZHKA 1BD2E 3HKFA 1I1AC 1JP5A 5F7EH 5GGSY 2A2QT 3DECA 4B7IA 1NGXA 5DURD 4U4BA 1MFCL 2EE9A 4DWHA 4DW2L 2YRZA 3DRQB 4HJGB 2WP3T 4OFYD 3C09B 3RWCA 3LDBC 5E2WL 5DEFB 2K9UA 4G6FD 1BX2B 2CO7B 4FFWC 5CEXB 4KFZC 4P57A 4F7TA 3ROOA 1ZT7B 4YO0B 3T65A 4ZUVB 4O51B 2R0LH 1IL1A 2EIDA 4M03A 4U1IB 3SKJL 5I1DB 5D1XD 4YR6A 2OK0H 3GBML 4L9LB 4R9HA 1KG0A 3VRJB 3AGVA 2XA8L 4HPYL 1B2WL 5SX5K 3NCMA 2I07A 3ARSA 3BMVA 5KG9A 1JYXA 3MNZA 1HKLL 2C1OB 3IRZA 2OZ4H 4PRAA 4HJ0C 4ODUA 4N8VG 3U83A 5IG7B 1FG9C 2X4SB 3S5LG 1OSPL 2WUCL 1BEYL 1OLLA 2DQFB 5EC1A 4K7PY 4JHAL 4XB8A 2DDQH 2GCYA 4E9LA 3TNNB 4PJ8A 3TJHC 3GJFH 3S37L 5FO7B 1MHHA 4Q97A 4ZUSB 4TYUA 1NFKA 3TP4A 3U7YH 2XQBL 2AJ3A 3BZ4B 5LBSH 1FIGL 2R15A 3VXPB 1I8IB 1MFNA 4ZXBB 4K71C 4R4ND 4U33A 5DRWA 1BZ7B 4JHBA 5HYQB 3RBGA 1NCDH 3U7WH 1I7ZB 2OTUA 3O41A 2BSRA 3A6BH 3EDDA 1SBSL 5CJQH 3L3JA 2G75A 4M4PA 1S9XB 4IIQB 4WHYG 5DR5H 2QSCL 3LEVH 3CD4A 4ZSOE 4C56E 1CQKA 5E6ZA 2XN9D 5AYQA 2QHRH 2O5ZH 4QXTA 4KUCF 4BELD 1NCBL 3VFSA 3ZDZF 4H25B 3S35H 5JXED 2O5XL 2CO6B 3ZKXB 3OX8B 5CEZD 3SDDD 2ZCLH 1KB9J 3G5XA 5T1KA 4HK0A 3D39A 2EDEA 4YWGL 3K0WA 4K23H 4R90H 5FB8B 5I6XB 5DT1H 3MXVL 5BVPH 4M48L 3LEYL 3RGVD 4JPWH 2VDMH 3PQYD 1CFVH 1L0XA 2IADB 5A2KH 5LCVH 4HFWB 4AZ8A 4Z76B 3FOMA 1T21A 4KJWD 4ZS7H 4LLYA 4Z7NE 5AZ2H 5FOJA 1QVOA 3QULB 2Q1EA 2V6HA 2R69L 4JCMA 4DVRL 1RUAH 1QFOA 3CVHL 1VSCA 4V1DB 1RK1B 3X3GL 1HHKA 2D9CA 5JNYA 4HCRL 3CC5A 4HMDA 4MSWA 4PP2B 1AP2B 3WXWH 1GGBL 3W9DA 1ZTXL 3GKWH 4LHUG 1N5YH 4WTZA 3OKNA 4M8VA 1YY9C 3RWFA 3QG6B 4YXHL 1RZJH 2AK4A 4JG1L 4ZS6D 4BQBA 1B0RB 4XP4L 3OR7A 1HYSC 1OAXH 2EXWD 2G9HA 4QXGH 5C0BD 2W65A 2FJGB 4OCSL 4UU9A 1FO0A 1MPAL 1CK0H 5ISZE 5DJYA 2VR9A 2BSSB 2YD9A 4XTRC 5IOPB 3MO1A 4PJ9A 4J3XA 1NBVL 1U3HB 4LQFH 1QR4A 3S4SA 4PRHA 4AEEA 4HIXL 1IC5L 2W91A 3GMQB 1CXHA 4LPCA 1AHWB 4Q9RH 4WFED 3D1MC 4WWID 1PBYA 1INQA 4U31A 2GTWA 2R1XB 4L4JA 4L4VD 3O9WB 4YDKL 5DQJB 5C0AB 3EOAB 1IQDA 1J0HA 4DQOL 1IEHA 3RWJB 3B9VA 1RI8A 5GS0C 3ZSTA 4ZFGH 3MLRL 4RRPA 5DLMH 3L5JA 2A77H 5HHXH 5IVZB 2DL2A 1G6RA 5I8CA 3FHAA 4JHZA 5CGTA 5EB9A 1YQVL 2FATH 2QADD 3TA3D 1KBGL 4GKNA 4HJJL 5M94B 2ZCKL 3UXFA 1BAFL 2XV6B 4OI7A 1CFNB 5F3HA 4JO1L 5DJ6A 4KRPC 5ACZA 5GGRB 4W4OC 2JB5L 1KF9B 1F6AA 3QWRD 5C7XH 2GUOB 5DEZA 3G5YA 4XPGL 1IGIL 5D2NA 5DTFB 4LCUB 2PCPB 4N1EA 1U41A 3C6LA 4U2ZA 1MCOH 2YC1A 3REVA 4DUVA 4JKPL 1RUMH 4G5ZL 4HBQA 2DF3A 4OBRA 4U6XB 5I74B 5KSAD 1CR9L 3B9AA 5GRWA 3VFRB 4G3YH 4HUMB 4UDTA 4NPYA 4UTAL 1R3JB 5DRNB 3R06B 5JXAH 5D72L 2D0FA 2ZG1A 1KC5L 3GI9H 4YX2H 1H3PH 3L1OL 1CFTA 3DVGA 3DO7A 1IE5A 1CFBA 4G9DB 4JCLA 1X6NA 4KY1L 5C0IA 2F9BT 2J88H 4MX7A 2VQUA 2FO4B 1D5BB 3X3FL 1XGPB 1MWAH 2J1KA 1NL0L 5IV2B 1LEGA 4QRRD 4EVNB 4NC1E 2F5BH 4F2MA 1DBKL 4U7KA 3A6CL 2EICA 1FFPA 4QHLB 4Y4HB 3X11B 1GIGH 8CGTA 4GMTL 1IFHL 4MA8H 3FO9B 3QQ4B 1EBPA 3L5IA 4N9GA 4XMPH 1AI1L 4O00A 1P5UA 5I1EH 1BZ9B 1G7QA 2JB6B 2YUVA 3RDTA 5A16A 2DWDA 1SY6H 2DWEB 4KRMB 4NQDA 5CSBA 1OPGL 5C0DA 2DLFH 3QNXA 1AO7B 4HQQL 4RNRB 3JWOL 4KVNH 2OL3A 3RUGE 1KN4H 3ARFA 3T0EA 4S10A 3O2DH 3Q6FA 2YPKB 3BW9A 3ZT7A 5J6GB 1S9VA 1SEQL 1YEKL 1B90A 3OG6B 4POZD 1KCVL 1BM3H 3IKKA 4AENB 1BQSA 2DLHA 2ZKHL 4JJHA 4WFFE 2ATKB 3K2MC 1QFWI 4TNWK 2IMNA 3CPLA 4UV7L 5D96B 3TYFB 2P7TA 3T4AA 2FSEB 3NCYS 5E2UL 2BHYA 5KVEH 3SDAA 1C5DB 2GKIA 2VLLB 5DYOB 4I4WA 4NRXB 4OB5H 2DTML 3WS6A 5CINL 4WO4A 3R0NA 1EZVX 2DQHH 3LMJH 4A2LA 3U0WH 1XIWA 4OLYL 3IXAA 2APVA 1QSEE 1A6TB 3L7FA 5C07A 2JELH 3MACL 5DC4B 1TLKA 2DLIA 1HH6B 1ZVSB 3MRGA 3Q5YA 5DC0A 3LKSB 1BECA 5F9DC 1S7UB 3KPTA 3PP4L 4FQ2L 3TGXA 1MREL 5FUZL 1SQ2N 2EYRA 2VLKD 4KV5E 4KUZL 5D1ZC 3RVWD 5KVFL 2XKUA 4FTVD 1A4JA 1HDMA 4NC2B 4XC3H 5SWQB 1PG7W 3BFOA 2C4FT 3HC4L 2X4PB 2ZOLA 5BRZB 3I3DA 1W72H 4PRID 2C5DC 1D9KA 1S7RB 1MCNA 3HG1D 3QXDA 1BJ8A 3F8UB 2A73B 4CMHC 5IUSA 2JK5B 4GBXD 1YEGH 4UIKL 1FZMA 5TDNA 1DBML 4QWWC 3QUYC 5E5UB 2J8UA 3HMXA 4JPKL 3TC9A 3G6JA 1FAKT 3ARDC 4G6JL 3GB7A 1OTTC 4YZFE 4XH2B 3WNPA 1OP9A 2GITA 3MLXL 2Y6SD 4XCFL 2NCMA 1A47A 5L88H 1H9VA 1WIUA 1C5BH 5ADPH 1HNFA 4LFHD 3C5ZD 1YEJL 2UUDK 3LD8B 3BE1H 4GRWB 5B3NA 4QRQA 4Z7VE 1KIPA 2AXJA 1T22A 1DQDH 1YN7A 2NY1C 4RMRA 2XWJA 3MLZH 2R23A 4QHNB 5TH2A 3ZHLA 3WFHB 1IMHC 4P48A 2XY2A 1A8JH 3MMEA 2D03H 5FOBB 1OB1B 3VG9B 4AY0A 3GNML 1II4E 4N0YL 2X7LA 2PO6B 4HUVB 5JPNB 4JFQA 1QSVA 4PJHB 1V3JA 1E6JL 1Q0XL 2BC4A 3SGJC 3HPLB 1ZS8A 4LLVA 5F97E 3KPOB 3RX7A 1A7PL 1DE4B 1ROWA 4F80A 3C8KB 5BW7C 3QIBA 3C8HA 1IGTA 4JDTH 1RD6A 4AMKL 2A9ML 4P2RA 1DQJA 4WNQB 3TV3L 5GS1A 1W8OA 3JTTA 3Q2CA 5I16B 4EI6B 4WWKD 2BSTA 2CIIA 3HHRB 5F88A 4HG4K 1MEXL 1NLBH 2I24N 3U0TB 3ARGD 1A1NB 3RY6A 4NZDA 2VLRD 1E4XL 5IB5B 43CAA 4I18A 3JVGC 3U48A 3WFCL 4UUJA 3SOBL 3O8XA 2C4FU 3HR5A 2I60H 5MEPA 5KVGL 1MHPH 1ZHKB 3AS2A 1HWHB 1JWMA 3AS3A 5ICYA 2HWZH 1CL7I 2FYYA 1A7QH 3KPQB 2C1PB 1OTUC 2NY4B 3P0YL 3C6SA 3FT4B 3RU8H 5D7JA 3W39A 4E5XB 2VXUL 3V5DB 3RI5F 3ABZA 1QZ1A 5DS8B 1QBBA 5DJDA 3FQRB 4NZRH 4YDLC 4L3EB 3C5SA 3H7BA 4TUJA 1U8IB 3NCJH 5ILTH 1VFBB 5D9SB 1LDSA 4Y7MA 25C8H 4JFFA 4RMQA 4XCNB 3TN0A 5E5MA 3H9SE 2WP3O 2PW2B 4Z7WA 3B9KC 1RQ5A 3QIWA 1AJ7L 1MY5A 4M5YL 4PJGB 4JJ5A 1OGAB 1FPTH 4LLDA 5DA0B 1GGIH 4JQXC 1KCKA 2F8XC 1MF2L 4OLUL 3K74B 2CRYA 1I7TA 4XPFH 5I9QB 3MOAH 1V7ML 5C0ND 3FTGB 4OZIA 3ARTA 3EO1A 5I0DA 4XVTL 3BH8B 4OQTH 5DGRA 4ODTL 5GHWL 5K9OB 5C0RH 1XMWA 3M8OL 2CLRB 4P4KA 3CH1A 4U6YB 1WIPA 4JHWL 2VDRL 4L8DB 4O5LH 2YD4A 4PJDE 3VXSD 3ZO0A 2FO1A 3IGAA 2QR0A 1IC7H 1ZWIB 3LKRB 1IGCL 1T1ZA 3MRKB 3OXRA 4KHXL 4WI3A 5ICXB 3NIDF 3QDJA 3IXTB 1W8NA 4NKMB 2DKUA 3P9MB 3BUYB 3PWVB 2FZ3A 5F9JA 3U9PH 1GC1C 4QTHA 4HC1H 4U1GB 1CE6A 1NMCB 1GOFA 1N64L 1HEZB 5CGMA 3TYGH 3VW3L 4MD0A 3ES6B 3L5WA 3CFJB 1XF4B 4OGZA 3DX6B 1SBBA 5IBTH 1RU9H 3FO0L 2XXMB 1Q9LA 2HJKB 3GI8H 1BHGA 3HZKB 2E9WA 1LVEA 1FZOA 3TZVB 4OGYH 3FCTB 3F12B 4UMGA 1I9IL 2E3VA 4M1GH 2KQNA 4DUWA 5IB4B 2WINA 4WCYL 1KIQA 2Z92A 2ATPB 1GPOH 1KFAL 3D0VB 1K4CB 5DJZB 5T5FH 1M7IB 3TT1L 3PL6D 1ETZA 1W2KT 3Q6GH 3ILPA 1JI1A 4ZQKB 4BM7A 4KTDH 1AXSB 3ULUF 4WY7L 3QQ3A 1GRWA 1NC4D 1NDGB 1FYTD 3TESA 1KJ2L 4JGMA 4LCCB 3C5JB 3QDMD 3MREB 4JPIA 1I8KB 5LGJB 3L3OB 5T1DH 4MA1C 1YEHL 3ARBD 2VIRB 1A5FL 3QNZB 5F1OB 3RPIA 5F1IB 5F7WC 2GJ6A 3E2HB 3V4UH 4AL8H 2DIJA 4YAQB 2BOBB 3GMLA 3RVUC 2ZG2A 4ZFFB 1F00I 2FD6L 3DBXA 4J3SA 3MRDA 4NRYB 1FO0H 4CVXB 5DDHB 3VXRE 3RY5A 1WIOA 1RZGB 3D6GA 9CGTA 1LK2A 2BNUA 3MXWH 4QY8B 3U1SH 4BSWB 2A9NL 3BYYA 4OZHA 2HRPH 7FABH 2DYPB 1IGJB 3BPCA 2R2CA 1N4XL 4JFEB 4MAUL 1QRNB 4X6EB 1LEIB 4PBWD 1AC6A 2P8LB 3S3PA 4OLVH 3W0WB 4G8GB 4YNYB 3QHZH 1JTTA 4WFGD 2D4FA 4U1MB 5I73C 2ZUXA 1S3KH 1G6RH 5TGBA 1RUQL 1MQKH 5F21B 1C16B 3LQAC 5FUCC 4NC0B 4G43B 1J10A 4HLZG 2ENSA 4YEFA 2X9WA 1GCFA 4M00A 4F7CB 4HUUB 4PJHF 4MLIA 1BFSA 1YNTB 3JV4A 3QEHB 1UXWA 2CLZB 3IFOA 1UWEH 5BZWB 5GGSA 3HN3A 1JZ4A 3UX9B 4POZC 3SE8H 1KN2L 1G7PB 1A14H 2P5WA 1JE6A 3HC3L 4PGCB 2X4TB 3RWDA 4KJPC 2LTQC 5IGXL 4F7EB 3EZ8A 3BJ91 1U95B 3PV6B 4OLWL 1NCUA 4XPAH 4FMKA 2QKIA 2PW1B 4GXUN 4LOUD 1G9MH 3MRCB 5FUOH 4L29B 4R7DB 4TVPL 1BZQK 5GGUA 4K8RL 5IVXA 2E27H 3DLQR 4P5TC 4IOFD 3FQUB 5HHVL 3H42H 1UYWL 4XI5D 1PFCA 2AI0L 3IJSA 1XFPA 4ZOEA 2VITB 1A6AA 5ESQA 4JLRB 1FNSL 4NQUA 2FX8H 3RVWC 2VLJB 4UQ3B 4XCEA 4GW4A 3ZTNL 5B3JF 1RURH 1CICB 1VKXB 2ZOKB 2I9LB 2XZCH 4LSUH 4XB7A 4RZCB 1RUPH 4XPTH 4XWOC 4YHOH 1QUNA 2P44B 3EYOB 1BQHB 1T0NB 1DJSA 4PJGF 5FYLL 3W2DH 1MLBA 1ACYH 4M3KB 5GSRA 4GO6B 5IB2A 2A74B 4JFDA 1WZ1H 5CZVH 1CXKA 1U93B 3O6KL 5LWYH 1F3DH 3AVEA 4WUUB 3BGFB 2Z93A 4OKVB 1MCLA 4J23A 2F5AL 3F7PC 4FZEH 2KPNA 3TT3H 3PGCB 2B4CL 1EHLH 3ZKXC 2FNBA 5GZND 1U3JA 4UOW1 3OXSA 4Q9QL 3QJHA 2APXA 3QFJA 3MCKB 3JWDC 3MR9A 3AS1A 1T3FA 1UG9A 3CLEH 4FQ1H 4JQVC 1M6OB 4TUKH 1XR9B 5BZDA 3RZCA 1NGWA 1R5IB 5IFAH 4RMWA 4IDLA 1Z3GL 2HFFA 4UNUA 2O61A 2RFXA 5DMKB 3QUKA 1OM3L 4ELMB 2ESVD 3G08A 3MV11 5KAQG 4I0CC 3D18B 4KJQC 1OF2B 4WIQA 2DD8H 4QRUA 4NQSA 4M62L 4JO2L 4PYGA 4XPHL 5MEND 1JHTA 4NM4L 3DUSB 3RL1A 3BWUC 1T6WA 2X2YA 4UBDC 3GM8A 2AV7A 3MJGX 4O9HL 5DFTA 5D1XB 4MXQC 2FJFB 4OCWL 3N85L 3VXME 4H0GA 4P4RB 4WHTA 1SJVA 1MI5A 2WV3A 4PY7B 2ADJA 5GZOC 2AEIT 3B4NA 2IGFH 2ZPKH 3MUHL 3LKOB 1UENA 1S9WA 2VDQL 1AD0B 3T8XA 1LO4L 3HMXH 2ARWA 4LCYA 5K33A 2WSKA 2CDEB 3MUY1 1GVIA 1CGXA 1GOGA 3QG7L 4JY4B 4NQVB 4ZFOA 5CP7B 3WN5A 1KLFA 4M6NL 4GRMA 2KH2B 2ARJA 4B41A 3VRIA 4LKXB 2BVYA 5C8JB 3NGBB 2CQVA 4RMSA 1BD2D 3MRQB 4HWUA 3O9WC 1MFCH 3OKLB 4QO1A 3U4BL 2ADIB 1HN1A 1F58H 2BVOB 2R2EA 4NDMA 3FFCA 5I8KH 3TH4T 3P77A 5KVMC 4FS0A 4H88L 4L1HA 3QFDA 2XWBB 4WEUD 1T7VA 1AR1D 2GK0A 2IPKA 3UZQA 5E2WH 3CLFL 1JGVL 2Q6WB 2XN9B 3LY6A 1XGQA 3WFDL 43C9A 3SDCD 1BF2A 3MYZA 1ZLSH 3KDMB 1KUMA 2I26N 1XGRA 3SDDB 4P9HH 4EN3D 5KAQF 3PHQB 3FN3A 1T03H 3BH9A 4GG6A 2ZCHH 1QFWH 3NZ8B 4H26A 3UZVB 1SYSB 5IT2L 3ULUL 3SKJH 2MCPH 3GBMH 2R29H 1UWXH 1WITA 5DUMH 1NEZB 3GIVA 1I1FB 3PQYB 1QOKA 2L4OA 2FBJL 4BZ1H 3I6LD 2XA8H 1RJZA 4FP8L 3ETBF 3ZDZE 1N8ZB 4FFVC 4LPWA 1BQHG 3BN9C 1KACB 3VGBA 4Y4KD 5E2VL 2XG4A 3S36L 4XP5L 3GJFK 35C8H 5EG6C 2WUCH 1BEYH 3QDHA 5FDWA 2XG5A 5CBAB 3LRHA 5L2KD 1FNEB 2A6IB 2MQCA 1TVHB 3E8UL 1YMHA 3WXVH 5HXMA 5JW4N 3VXQB 5EU5A 5J13C 4LPXA 3WUWB 1JZ3A 3U6RB 2XQBH 1IM9A 4HULB 5C0BB 2F54D 1FIGH 2IQAB 2Y23A 3CFKA 1M71A 1RHHA 1SJXA 3H3KA 4MA3A 5DJ8A 3WD5H 1EBAA 4FQCL 4YBLB 5JDSA 4HWZB 5HI3D 5J56B 3MODL 1CD1B 3OKMB 5FM8A 1SBSH 3SKOA 4R6UA 3K1KC 6CGTA 1OT1A 3C60B 3V6OE 3BKJL 2IANB 4RAVA 3EGSB 3GRWA 4G7YH 4G9FA 1NCBH 3GSNB 5A2LH 1FZJB 3HS0A 1J11A 3SBWC 2RCSH 2Q3AA 3RTQA 3KYNB 5FYJU 1OY3B 4HKZB 4J2XA 4PJ7A 3ZT6A 1HHHA 3ARYA 4NYLB 4NO5B 3MXVH 2UZYB 2G2RA 4MJ5A 4Y16B 3LEYH 5FO9A 2QADB 5IJVB 3TA3B 1AR2A 3K8KA 3EFDL 3NA4A 4RFNB 1VFAB 2C3GA 2R69H 2WBJC 2HT3C 3D3VA 4LSTL 2P5EE 2WWMD 3EIFA 1RZ7H 5HI5C 2NXZC 5HGAA 2FIKB 4Y4FA 3X3GH 5DJ2B 3EYFA 4HDIB 3V4PL 3GHBH 3QO1B 4ENEC 1AKJB 1GGBH 2C3XA 4HKBB 1C12B 1Y6NR 3D9AL 4QYOB 1ZT1A 3K3QA 3GO1L 5DWUL 1FNGB 4KJYB 2MKWA 1FVDB 4JG1H 5KSAB 3MRJA 4XP4H 2R4RL 3UTSA 1E4JA 4OT1L 5EZOH 3DV4A 2YRPA 4Z0XA 3D2UA 3W11C 4JR9H 4YHPB 3DGGA 1UACL 1MPAH 3CZFA 3MGAA 4LK4A 4PPTA 4ETQB 1DQML 1KEGH 4QRSA 5I8EA 2OI9B 2PETA 1XR8B 4I13B 4UB0L 3RIFF 3V0VB 3QEUA 4AK1A 1S8DB 1NBVH 4MNHB 2BHZA 3CMOL 5HGBA 2H1PL 2PTUA 3CDFA 1S7QB 3SPVA 4OI8A 5DQ9A 4DEPC 1IC5H 3QIUA 4XAWH 1OAYH 4FABH 1UVQB 1G7HA 4QRRB 4ODBD 4YDKH 4ELMF 2HFEA 4DQOH 4ZNEA 2OJZL 4ZFZB 4ORGA 4H8WH 4PRPA 2Q87A 3NFSH 3PABB 5BQ7A 5C0GA 1L6XA 4PRNA 1MJJA 5BV7B 3UO1L 5C09A 3MLRH 1QPPA 4QTIL 3GMOB 4LSRH 4HUNB 1NEZG 5IQ9B 1IKNA 1PG7X 1YQVH 1AFVL 3CH8A 4HJJH 3OPZL 5CFHA 5CKGA 1BAFH 4IS6A 1UH2A 4H5SA 1ZLWH 2DQUL 4U2YA 1W0WB 1FJ1A 4JO1H 4IMKA 4MCZA 2JB5H 2EYSA 3ALPA 3Q5TA 4WVRA 3PNWA 1ZV5A 5TQ0L 4EQ3A 2DM3A 3WS3A 3VG9C 5ERWB 4M3JA 5HPMB 5JW3H 1YECL 3WUWG 4JKPH 4L4TA 5LVEA 2E7BA 4G5ZH 2GSGA 3O11A 3SCMD 3BISA 3R1GH 4U6HA 3HA0A 1YC8A 2BRRL 2YXFA 4YDIH 3DV6A 5D72H 4N0CD 1WBYA 4IOFC 2V2TB 3OMZA 3KJ6H 4RX4A 3DX7B 3L1OH 5FO8A 3AM8C 2ZUVA 2NW3A 2AJVL 1FRGL 5B39B 1NFIB 2AK4D 4JQIL 5EFIB 4KKCC 3CFEA 1LEKB 4EI5A 1Z9MA 2VNCA 4HXAL 4LP4A 2HT4D 3N9GL 2E7LA 4QXWA 2IALA 1F90L 3MPCA 1YNLH 2H32B 3TH3T 1HCFX 2X70B 4XHQA 3TBSB 4RGMC 1NL0H 3KXFA 2VLME 4NN5B 1XF3B 4GMTH 4PJ9D 1IFHH 3G9VA 4JFPA 4U1JA 3DO3A 3HPJA 5HHNB 3HG1B 4IRJA 4NSKB 4PRHD 1DR9A 2H8PA 3F7VA 2V2WB 1HQ4A 4P2YA 5GS0L 3IFPA 1H3GA 1U3ZA 1P1ZB 1U8MB 2BXYA 4O2FB 3ZDYE 4I0PA 1OPGH 3AREA 3JWOH 5SWSB 3DTXB 1JFQH 2VABA 2YK1H 1V3KA 1SEQH 3GGWB 4P0DA 1KCVH 1U8JB 4KQ4L 5HYJE 1S5HB 1QQDB 2ZKHH 4L3CB 3ARXA 5EU6B 1WJ3A 4UV7H 3SE4A 4PB9L 2NYYD 4KZDL 5EU4B 1K2DA 3UYOD 1UZ6F 3MJ8B 5DO2D 4JFHE 5KS9A 3ARPA 4OLYH 1DQLH 4X4XA 5C9KA 5M7QA 4HWBA 1R24B 1J8HA 2NXYD 3MACH 3KHOA 4GLRI 1PKQB 5I1GH 5EN2B 4AH2A 1IZKA 1N7MH 3RX5A 2HVKB 5CP3H 3C6LD 1UH4A 1SEBB 5H37G 1J1OL 2XYCA 1U92A 2PYFA 5HY9B 3TBWB 3VD3A 3EO0A 3STZB 3PP4H 4FQ2H 3FO1A 1MREH 5FUZH 3VXOB 2HN7B 4H20L 4TVPE 5KVFH 4NQEA 1F13A 2HLAB 1OAZL 3LAFA 4JRXE 3VGHA 3S7GA 4AIOA 1X5YA 4WWKB 1QHOA 4Q9BA 3TO4D 4PTUB 3VFVB 1E0OB 4K7PH 4NIKB 4ZOCA 5I8OL 3ARGB 3ZE0F 3UPCA 2H2PC 2C3VA 3ARVA 5CWSA 4PGEA 4TUOB 4K9EH 4UIKH 3WNLA 4G80B 1BFVH 3K80A 5DHYA 3GSXA 4OD2B 4X5XA 3DXAE 4ZYKA 4XCCL 1KCUH 4JZOB 3RWGB 3TZVC 1EERB 4JPKH 5HGHA 1I7UA 1ED3B 3WFZA 1AD9A 4MQTB 4ZUUB 3MRIA 1HQRB 1P7KB 4HGWB 1OD9A 3CDGB 5L8KB 4FFYH 4HXBH 4KRLB 4XP9L 5EBGA 3QXAA 3KLHD 5ENWB 3TBTB 1TJGL 3MLXH 3HI6L 5FYLE 1BQLL 2DI8A 1U8QA 5JUEH 4M1DH 4QRPE 5D71L 3VCLB 2FEEI 3RDTD 5I1HL 4L8CB 4JY6B 8FABB 1M7DB 3OKKB 4X6CB 4PJBE 3MA9L 3MNVA 2GY5A 4R2GC 2A83A 3DURB 4Y8AA 4Z95L 1KJ3L 4DGIL 1FV1B 3HZMA 3IDGB 5IEKB 1RK0B 4MMZC 3DI2B 5IW6A 4QHUB 3QAZB 4MNGE 2GEEA 2NZ9C 2YZ8A 4Z7UE 5B39G 1WWBX 1OHQA 1F4HA 3SDAD 4PJEA 3MTRA 1E6JH 4C57C 5E9DE 3QDGA 3WHXA 3OAYH 5FGBA 1A7PH 3FO2A 3DRTB 4GUPA 5J9PA 4GFTB 1GZQA 3E3QC 4IOSD 5C07D 2C9AA 4HS8L 1KXQE 4KI5F 1MUJB 4DCQA 2A6JA 1WTLA 1MEXH 3VXSB 1RVFL 1MH5A 2NTFB 5FK9B 3OB8A 5E6IA 3WFCH 1JN6B 4ODWA 1D5XB 4EXKA 1U8NA 3MRNB 5KVGH 1VADB 2C7UA 4M61B 1Z9OA 4G42B 2UZIL 4NNXA 5JW5B 2VDKH 4LRNL 3QCVL 4JDVB 1LGVA 1JPGB 2YWZA 4EBQL 3KPSA 1DEDA 1AGBA 1ZHLB 1WK0A 1D9KD 4G7VL 5F89A 3C9NA 3MFGB 4R97B 3LPGA 4XBPB 3V6ZB 2A1WH 2OTWA 3TBVA 2NX5A 1BVLA 5K9JL 4JDZA 1VA9A 4J3TA 1Z0MA 4JFXA 4LFHG 3TJEH 4XGZB 1I9EA 1NFDB 5JOFA 2ZSWB 2FLBT 1INEL 1CXIA 1U6AH 1HK6A 4JM2A 4APQD 4EXPX 4H1LA 2Y1VA 2F15A 5TDPA 4POYA 4DVBB 1AIFB 1TVDA 2VQ1B 3CFIC 4JZJB 3FQNB 3SJVA 4K3JH 3GJFB 5J1TC 3ULSA 3PL6B 1AJ7H 3I3EA 5C0CE 3H9SD 5J0BA 2PXYB 5HGDA 3UAJC 2D4DA 1RZKC 2Z91B 5D1QC 1CI5A 5ANMB 1NC4B 4FQQA 5EOCH 1MF2H 4E41B 3FMGL 1RJLA 2RIKA 5CIPB 1ERNA 1K8IB 2IC2A 4KU1A 3QDMB 1EGJA 3P0GB 3NTCL 1EVTC 2HRLA 4NN6B 5T1LA 1T2QH 4QCIA 4C59B 4Q6YA 1U8PA 4ODTH 5GHWH 5I17B 1BMGA 4A6YB 5HTSA 1TTUA 4YHYB 3ARQA 2VDRH 3UMTA 2XZQL 5I1JH 2BCKB 5E00A 1IGCH 2G5BA 3ULUE 5J12B 2WQRA 1C08A 4P2RD 3MBED 1UKQA 2HTKD 1JUFA 1N64H 3TPUB 2FX7L 1A9EB 1PY4A 1S7WA 4S1QL 3VW3H 1VDGA 1NANH 3GJEB 4OD1L 3ARRA 3QCTL 5E1AA 4OFPA 1CICC 4XNQA 3QEQA 4XC1H 2UVEA 4G6KH 3O8XD 2W60A 3VXNA 4D0CB 3FO0H 3MRBA 2A6DB 3HLAA 3NCYP 4KAQH 4PJ8C 4WI5A 1EFXB 1PYWA 5F72S 5FFLA 3S9DB 1LP9B 1I9IH 5D7JD 4WCYH 1TCMA 4GSDL 2PR4L 1KENH 4Y5YB 4NRZB 4P3DA 1TQCC 3WLWC 5E4IA 3BGFC 1ZA3B 5L9DL 4R26H 4OFDA 5EUOE 1KPVB 1P7QA 5CEZL 2VKWA 1A22B 1BIIB 2Y7QA 3IF1B 1XH3B 4WEMB 1KJ2H 1VCAA 1CLZL 5CZKA 4U0QB 4XAKE 3AXLB 4ZMAT 2Q86B 2VO5A 5FYKL 4TOYH 4KROD 1XCTB 4YHZH 5DSCB 1HI6B 3SGDI 4RGNB 2VR4A 2EXYC 3QNYB 3UPRB 1S7TB 3ET9F 1H15A 2CUIA 4N8CL 2DMKA 1OT2A 2OCFD 3QA3A 3VD9A 1AY1L 2NNAA 1GGYA 5JA9A 3VGFA 4Y8DC 4P4KD 1G7IB 2VZ1A 3QXVA 5CMAA 1ONQB 4ZO7A 4QOKE 1EO8L 1NSNL 5CJXC 4GW5B 2XKSA 3PXHA 4KMLB 4FXGB 4F8QA 3ZDXE 3BZEA 4MAUH 1HILB 2BJMH 3KLAA 5C2UB 3EDKA 3MV9A 2J4WL 4TSCL 2YZ1A 4OGXH 4S1DD 2E7MA 4X6CF 5CCKH 4Z5RB 1G7MB 2NR6C 2UWEE 3ZMRA 4D94A 2PYEA 2WBKA 3L3KA 3VI3F 5C71A 2CKBA 4X6BA 4PD4J 1CLOH 2BY2A 3VFMB 5BVJA 4LVNB 4CN6A 3UTPD 2Q76A 2EYTA 1DVFA 1YPZA 4YDJB 5AYUL 5D7KE 1OARL 2BNRE 4GQ9L 2XTJB 3LIZH 4YEEA 1HH9B 4JFOA 3PDOB 3EHBD 5J8OA 2K7QA 5EZJB 1NAML 3DVNA 1BWMA 5B8CB 1CTNA 4U1NA 4LASH 4CNIB 3MRMB 5IW1B 4P2CG 1MWAB 1ORQA 4GJTB 4CDHA 4X6DE 3UBXB 1ZK9A 5E4EB 3GMNB 5HYSA 1KN2H 2VAAA 5L7XH 3OKOA 4D9QE 4P2QE 3HC3H 3PGDB 4M7JL 4F7PA 1I85C 3QI9B 5E95B 4BFEA 5MHSD 5IGXH 1NMBL 2X1XR 1TFHA 1VFOA 5HDBF 4HGKC 3GSVA 1IAMA 1FG2A 4R0LB 1RHFA 3TO2A 1QR1B 2F8OA 1Q9WA 4W4OA 4JZNB 2MOVA 1ZANH 2AJYL 2ESVB 4TVPH 1K5NA 1J05B 4TRPL 4DK6A 3QO0A 5D2NC 5H94A 2NY6D 1A1OB 1VERA 4CW1A 4HWEL 4K8RH 3OGCB 5HBBA 3HC0B 3KAAA 4XVUD 5KSBA 3KWWB 2OBGA 1JPFA 5HHVH 4KKAD 3IDMB 1KJMA 2AI0H 2IAMB 1NFDF 5JOPD 2HT2D 5E6YA 4HBCL 1IKFH 5GSVA 2R9HC 4NKDB 1FNSH 5FEBA 2VAJA 3GSWB 4XBEH 3EOBA 1XF5A 3BKML 2AQ1A 2BNQE 5D2LB 1I1CA 1XF2B 1I1YB 4JRYE 4OCRH 1G9MC 1FC2D 4MLSA 4U3XA 1KIUA 1MNUL 1U8KA 4K94H 3CAFA 5DD5H 5IK3B 3UTZB 5D7SL 4ODSH 2NY3B 4NCC2 4YBQC 4HSQA 2BMKA 3CZJA 1IARB 3HB3C 3TCLA 3V52L 2X4QB 5C0JA 5DXWA 1BVKB 1X5LA 3P73B 5CUSH 3LQAL 2W07A 1UGNA 3KLSA 4Y2DB 1FNHA 2MSPA 4RMTA 3C60C 1JWSA 1Z9SA 2DLTA 4XRCB 2OMNA 1DTUA 4ISVB 15C8L 4PY8I 2F5AH 1BD2B 1ZT4B 3LHPL 4HF5L 2B4CH 3FQWB 1W72B 4MAYA 2VOTA 3ZHDA 4HIIA 3B6SB 3HE7A 3QUMA 5C08E 3NIGF 2LV4A 3ARFC 1LO5A 1Y6KR 3T0EC 5IKCB 1HHJB 4JM4L 4HWBH 2XZZA 3FFDA 3BRDA 1Z3GH 5BMFL 1T5WB 4Y16C 1YUHB 1A3LH 1JCKA 4PJ5E 4HAGA 4CGTA 2HKFL 3QHFL 1B6UA 2P5WD 4HH9A 2Z4QA 4R4BA 3MZGB 4RFNC 5FM5M 3DYMA 3CFDA 1P69B 2Z35A 1AXTL 2AEWA 2X4NB 3LKQB 2EH8H 4XPHH 4NM4H 1EVUA 4HS6A 5KANG 4O9HH 4WO4C 5HYIA 1XIWC 1TTFA 4I9WD 3NMEA 1CE1L 1LP9F 4OCWH 3N85H 2CKNA 1LMKA 3INUH 4AIZA 3LCYA 1UKTA 4JO3L 3BP5A 5EPMB 4CVWA 4BH8A 1CD8A 4U05A 3VXMD 2CJUL 4IOIB 3VH8B 4Y4KB 1IGFL 1CXFA 2R1WB 3MZTA 2F53A 1HINH 5HHOA 2CXKA 4HKXA 5EORL 1LO4H 1QRNE 2D3VA 2X4RA 4NO2A 2OSLB 5D5MF 1KB5B 3OGOE 4XMLH 2OR8A 3Q48A 1JZ5A 3PWLA 3QG7H 5D1ZA 2E9BA 1QA9B 3MJ9A 3GFUA 3OB0H 2DQCL 3LN9A 3T77A 5H2BA 3ULVC 1WICA 1J86A 1H3UA 2V9QA 4XMKH 5ID0B 1WFUA 3UBXG 4J1UA 2F54B 3RVTC 1F8TH 5T1MB 3MUGA 4N0UE 1H8OA 3OJMB 3QUYA 4CKVX 1ZHNA 4M8QA 1LK3L 1OAKL 4I2XE 5DVKA 4IHOA 3WFDH 1A6ZB 4Y89A 1LHZA 1ITCA 4YFLF 4KGLA 4M9OA 4P2OB 3WNOA 4KK6C 4C56B 2V5RA 3S3SA 3EDJA 1CTOA 3WMSA 5I1LB 3VFUB 4P23D 3QFJD 5CLWA 4NBXB 1CT8A 5HVHB 2OQJB 1JPST 3ZSSA 2X4UA 5IT2H 4Y1AA 1JNHB 3I85A 5FYJH 3HTLX 1JNNH 5T3ZH 1FFNA 1T66C 2QQNL 1LDPH 3ZKMC 5DZOA 1WAAF 2EDKA 1PX3A 1Z9LA 5ESVB 3ROOB 1ORSA 3HRZB 3GBLA 1ES0B 3OKDA 2ICWB 3O4LE 3L3HA 1LNUA 5E2VH 3S36H 1MJ7H 3SGJA 5C6PB 4J8RB 3QIBC 4ONFH 3F5WB 4XP5H 1WCQA 3ME0A 4I48B 3G6AB 1F97A 4P46A 5DHXB 3QUZD 3V6FA 1F4YL 3VA6A 4I18C 1PDKA 3SY0B 1PQZA 3O8XC 4H1LH 1CFQB 1CD0A 5F7DB 5ESAB 1S9YB 1QSZA 5EC1B 4MXWL 2CIKA 4CADB 2HAZA 4PGBA 5ISZB 3IDJA 1AGFA 4HK3J 1NCCL 2FRGP 2R0ZL 1A4KB 4Y5VA 4M02A 5IHZB 2MQ0A 5AD0B 3BRFA 1IAIL 5HDLA 4N0FA 5DRWB 4Q58C 3VXUA 1QRKA 1UT9A 3EYQC 3FFCD 4DOHE 4ODXA 3MV7E 4FN0A 3WV0A 4NGHH 2BSRB 1JNJA 2Q7YA 3KVQA 4NM8L 1WISA 3P3YA 4KKLD 3P40A 3TN0C 5C3TA 5JA8B 3UROR 2ITDA 4QXTB 1EXUA 5C0FA 3VFSB 4P3WA 3FQXB 3EFDH 3QIWC 1UADC 1OTSD 1FFOA 2X1PA 3B9KA 4HIEB 4PY8J 4HK0B 2B5IC 4LST