1G7JB

Crystal structure of hen egg white lysozyme (hel) complexed with the mutant anti-hel monoclonal antibody d1.3 (vlw92h)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
112
Chain Sequence
b'QVQLQESGPGLVSLSITCTVSGFSLTGYGVNWVRQPPGKGLEWLGMIWGDGNTDYNSALKSRLSISKDNSKSQVFLKMNSLHTDDTARYYCARERDYRLDYWGQGTTLTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3
publication title Estimation of the hydrophobic effect in an antigen-antibody protein-protein interface.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase inhibitor/hydrolase
total genus 28
structure length 112
sequence length 116
ec nomenclature
pdb deposition date 2000-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1g7jB00
3FQNA 2DIAA 3IDMB 3LZFH 4HIHB 2PW2A 1BZ7B 4RX4D 4U1KB 4U49A 1GH7A 3QEUA 4JQXC 3GBML 2BVYA 4L29A 1NDGA 3HE7C 3MC0A 1TITA 3TO4C 2A6IB 3MR9B 3N85H 4DN4H 2QV2A 4OZ4A 1N59A 5T3ZH 4U7KA 4LASH 1A7QL 3UYPA 5JIIA 4H5SA 2GJZB 4N8CL 5CJXA 3LEYL 1G6RA 2X70B 5I0ZA 4P9HH 4DOHB 4PJFE 2XKUA 1JBJA 2ERJB 3O3BB 1AIFB 2E27L 5GRZA 5B3JE 3CCHA 1UQSB 3QQ4B 3VFTB 3U9PH 5GGTA 2ARJA 4MCYA 4F7EB 1OM3H 1N6UA 4JFPB 3INUH 5JLZB 1IAMA 5C0GB 2W65B 5CBAA 4JDTH 3SBWC 3TYGH 2HRLA 3G9AB 4HFUL 3WLWD 1AGFB 2RBLA 1RJLA 1I75A 1HKFA 3L5WA 4KI5D 1KV3A 4XB7A 1PVHA 3F62A 3P0VH 4PV9B 4GS7C 4XNQA 1D5XA 1J8HA 5IB4B 3DTXB 4PJDE 1OGAD 3NOIA 1MFAL 5JW4M 5LGJB 2Q7YB 1K8IA 1N26A 1U8MA 1P2CB 3JXAA 3LIZH 4G6JL 1L4IA 4AG4L 4M3JA 1FFOB 3UP1A 4IMLA 4NZUL 5JDSA 2ICWJ 4Y5VC 1CICA 3VH8G 4PBWD 1WUNT 4X4ME 4JM2A 3PDOA 3TBVB 4X4XA 4QO1A 4NRZB 5MEQA 5ICZA 4NGHL 4KK5C 2VLKD 2DLFH 1KLFA 4OCLC 3G5XA 1MY7A 2PXYA 4HMCA 4X83A 2IPUG 5F3BB 2CLVB 4TTDC 4L5FL 2I07A 1WFNA 3HAEA 2PO6B 4OKDA 3T3PE 5GRJH 5JHDB 4M7JH 3L9RB 3PHQA 4KQ3L 2DJSA 2P24A 3CMOH 3U2SB 1NMAH 2Q3ZA 3FQRB 3G5VA 2IQAB 4WFGD 5T1DH 4HKBB 1IGML 1NFIB 1GGBH 4MJ6A 4I4WA 1CLZH 1YEIH 4DK3A 2CH8A 3KPMA 4KRPC 3LAFA 5D5MA 4QWWD 3DGCR 2PYEE 1JNHA 4X7SH 4P4KD 2VC2L 4NZTL 4XVSL 5EOTA 3MRBB 4MS8D 2P7TA 1IARB 1MJ8L 2VDLL 1IAOA 1R3LB 1MWAL 1WZLA 3KR3H 5DUMH 1BBDH 5JXAH 1EMTH 35C8L 4NHCH 3CSYB 5C7XH 5ITFA 5E70A 2NQCA 4U1KA 2CO7B 1N5YL 3BPOB 3MPCA 5J6HB 5EOCL 4LCCC 2MPAH 1BAFH 1QSEE 2A6IA 3MR9A 1GGIL 1T2QH 4Q58C 4QF1B 5BQ7A 2HA1A 2MCPL 4PG2A 2XNAB 4HK0A 4LAQH 2W0LA 4FXGB 4G6FB 1IE5A 4ACPA 1FNSH 1XGUB 1XGPB 3BI9X 1AIFA 2AEPH 3OBAA 1T1XB 1UQSA 3QQ4A 3VFTA 4UIKH 2HTKC 4MA8H 4KUZH 4F7EA 4JRWA 4PB0L 3RVXC 1JIBA 5I71C 4JFPA 4Z77B 3GSVB 5JLZA 4U1GB 5C0GA 2W65A 4OV5B 4WIQA 1RK1A 1EEYB 1AGFA 4MX7B 1Q1JH 2XOTA 4OCXL 4Z0BH 3KAAA 2XA3A 3EIFA 1AJ7H 1MRCL 1ED3B 4QRTB 4KK6C 2EDEA 5IB4A 3DTXA 4NN6B 2PW1B 1EFXD 3C09C 3TH3T 3GRWL 3LKSA 1JGLL 4X6CB 2EEBA 1AE6L 4W6XB 5LGJA 4GRLD 2Q7YA 4RFOH 1A1OA 1KCRL 4GKNB 2IANE 2NR6D 2CKNA 1P2CA 5DSCA 1DBKH 1FIGH 5E2UH 4QRUB 3DNKA 2YK1H 4XC1L 5IVZA 1RU9H 1U91B 1F02I 4NFDA 3IGAB 1HZHH 2WUCH 3QFJE 3VXTB 1CGVA 3HC4L 4EEEA 2FJFA 4WNQA 3TBVA 3P11L 4NRZA 4LU5H 3QDJD 3V2AR 1IL1B 5DJDA 5F3BA 4XPTH 2LABA 3BP7B 1WFUA 4Y8AA 1U9KA 4IBLT 2PO6A 4TQEH 2QHLA 5JHDA 2DBLH 4PJIB 5DR5L 3LKPB 3L9RA 4YHOL 5DRNA 3U2SA 2UWEB 1CDJA 3FQRA 2DD8L 1MLCA 2IQAA 4H26B 5FB8B 1X5FA 2C4FU 3NCJL 4AEIL 4AMKL 1NFIA 4LCWA 1CXLA 3EFFB 3HZVB 5CP3A 4LLWB 4XCCH 5CSBA 5BV7L 2AEWA 3TIEB 3DARA 1E4XI 5I76B 4M6NH 1RZ8A 4JKPL 3RVWC 4FP8H 1JPSH 5DZNA 1A6UL 3QIWD 1CDHA 4OGXH 1AXTL 2A1WL 3QJFB 3VD9A 4MWFB 3MRBA 5ITBH 2BVQA 1YMME 1Z3GL 2F5BH 1FN4A 4POUB 3V4UL 1VSCA 5IW3A 1LP9A 3IJHA 3QUMH 1Q9OB 5HGGS 1CD9B 2BMKB 4WI3A 1NCAH 2KUTA 1A2YB 4G5ZL 3CSYA 3QEQB 2K7PA 3RY5A 3KJ4B 1NPUA 4U6XA 3MNWB 3IXTB 3OGCB 4BZYA 5J6HA 2QQKH 2OK0L 1H3GA 1CTOA 1JMZA 1IGYB 4OQTA 4ORGB 4M5YL 3MACH 1I3VA 4ZPVB 4QF1A 4LSUL 2Q3AA 1DQDL 3ZLQC 1TZGL 4YXHH 5IP4A 2XNAA 1X5YA 1Z5LA 3RIAF 5ICYA 5K59F 4FXGA 5FA3B 4HZAA 2R15A 3ROLB 4ZO9A 5D2LE 3K1DA 1VADB 4XZUB 2VUOA 4AQOA 1XGPA 4NHUB 5FKPA 3B5HA 5CZKA 4XI5D 1T1XA 3W5MA 2HMIC 3ZKMC 4JZJB 2FNBA 5CGYC 4H20L 5CMAB 3JZ7A 2Y72A 3VFGL 4N90E 1DBAL 4P3DB 4Z77A 1VPOH 2BY0A 3GSVA 1JYVA 4G7VH 4Y4HB 1EEYA 2X10A 5J6GB 1NAKL 4MX7A 4NQEB 4KK9D 1AH1A 2VLRD 2GJ6D 1F4AA 4NC0B 4F58H 1U2CA 4ZD3H 4YHKL 1RIHL 3W0WE 5J3HC 1PSKL 5T3XL 3CDGB 5HI5C 1ED3A 4QRTA 1ITBB 5ISZB 2PW1A 1HKLH 3IF1A 2CQVA 4X6CA 4DW2H 1JYNA 5HHOB 3FB5B 3CK0L 3MJ8B 3ARFA 4Y5YB 1JZ6A 1LE5B 2DQCL 3MQIA 4HJ0D 1G9MC 5CSZB 4L4TA 5TE7L 1A6AB 4QRUA 3VDBA 5DZOA 4Z78B 1WTGT 1MAKA 2G60L 4PRDB 3CFIC 1U91A 2EH8L 2R8SL 2VR9A 3IGAA 4NJAL 3VXTA 3MLYL 1WAAF 2XXCB 1XIWD 3U46B 5ALBL 3GM8A 4P0DA 1FNEB 4WFHD 5CZXC 2H2SC 1IL1A 4YBQC 4JHWL 3CMGA 1HSBA 3QNYB 4HKZB 3ROOB 5DVNA 4I0PB 3BP7A 4BYHA 1VFUA 2DLGA 4KHXL 3VFVB 4S1SL 1S9KC 2V6HA 2D7MA 5K93A 2YPLB 1RQ5A 1CG9A 5TF1H 3LKPA 1B4JH 1ORQB 4TULH 2AEIT 1QUNA 1RPQA 1XEDA 5K9JH 2UWEA 5FOBB 3AS0A 2OJEB 1KIQB 3CD4A 5L88L 1TZHB 1RZ7H 5IM7A 4Y1AE 3HZVA 5DEFB 1I3GH 2DIBA 4LLWA 4NDMB 2J12B 4JG1H 4OBSA 1MFCH 5A2IH 4QXTB 4G8EA 1CDGA 3D0VB 5JHLL 1X6LA 1P4LB 3SE8H 3FRPA 4K3DL 3C2SA 3DSNA 4P2QB 4IS6B 4L8BB 4JPVL 1LHZA 5J1TC 2DMKA 4I0KA 1Q9OA 3DO3A 5KJRH 3ZL4L 2O5YL 2V17L 1Q9WB 4NQDD 5H2BB 1A2YA 5BZDB 3S34L 3QEQA 1NGQH 3Q48A 4N0RA 4JFFA 3O2DA 4TRPL 1F4HA 3IXTA 3OGCA 2Z31B 4NJ9H 4OCSH 1Q72L 3TVMD 3C2AH 1G7QA 4JHAH 2DQGL 4OAWB 1IGYA 4ORGA 3N9GH 3NGBB 4R97C 1PZ5A 3HCVB 1QSVA 4U33A 1A1MB 3CNKA 5FA3A 3ROLA 1EEUA 1R5IB 4HC1A 1MWAB 1QPXA 1VADA 3D3VB 4Z7WB 1DQML 1EGJL 1KJMB 3ARGB 4XZUA 2UY6A 4NHUA 4X6CF 4IRSC 3WDIA 1WZMA 4YX2H 1MCBA 1J05B 3MROB 4R4BB 4JZJA 5CMAA 2YD5A 3HZYA 2B39A 4P3DA 4D3CL 2WAHA 3H42L 3JWDH 4UAOB 4JGMA 5E9DD 5T1LD 4XMPL 4Y4HA 4ENEC 1CE1L 3GMMB 1YY8B 4XP6H 3S8WA 4NQEA 1PD6A 2NZ9D 4JDZB 1RMFL 3P4NB 5F7LB 3CLEH 3CDGA 5E2VH 4K71B 5JZ7C 1KXVC 4JG0H 5ISZA 5LBSL 1RFDL 4GBXD 2CIIB 3HPLB 3QI9C 5HHOA 5E08H 2ZSWB 4PJIF 3FB5A 1IKFL 3MJ8A 1UVQA 2DJ4A 3HRZB 4U6VH 4Y5YA 4JVUA 4OD3L 5KSBB 2UWEF 1LE5A 3BQUD 5CSZA 1A6AA 3TWCH 4XVUC 4BFIB 4Z78A 5B8CB 5IVXE 1IAKB 4PRDA 1CGWA 2XA8H 3OKOA 4Y5XB 3RNKB 2I5YH 4WW2C 1TTUA 5LWYH 5TE4L 1QHOA 5CUSL 2HVJA 3RWDA 4CAGA 3V5HA 1OW0C 1FNEA 5IFAL 3CAFA 3L95B 4Y16C 4I13B 5FYJD 1IFHL 2A6KB 3QNYA 4HKZA 4KK8D 2IAMD 3ROOA 1XMWA 2HLFD 4I0PA 5D7LE 4DCQB 2F54A 1QEWB 2YPLA 5E2WL 32C2B 1ORQA 3FOMB 3KWWB 4PJXF 5FOBA 5L7XH 2CMRH 3HZKB 2OJEA 3VWJC 1W0WB 4HWBL 4PRNB 4WFFE 5H37H 2BJML 3IXAB 1TZHA 3DHMA 3GSNH 4I1NB 4EDWH 1ORSB 4QYOA 4FZ8L 1I8LC 3TZVB 4LPXA 2WSKA 4NDMA 4UTBL 2W9EH 3W2DH 3FO2B 4FFZL 1MHEA 3EO1A 4QXTA 4TNVK 5T3ZE 3UZQA 3EHBC 1OGAB 3D0VA 4H1LG 2YSSB 1EK3A 4P2QA 4IS6A 4L8BA 5I17A 2BY3A 1OAKL 4ZO8A 2AXGB 1OAZL 4EN3A 5DJCA 1JRHH 4XP9L 3UJTL 5M95B 1PQZB 4PJ7F 4M1DL 1Q9WA 5H2BA 5BZDA 2OR9L 1CXIA 4KZDH 4HHAB 1CVSC 4PRPA 1J5OH 4FS0A 1ZT4B 4M6ML 3QQ3B 3OG6B 4OAWA 1QVOB 3VRLE 3D1MC 3HZMB 4HBCL 2DKSA 3HCVA 3FO0L 3DMMC 4Y19E 2MOVA 4FHBD 1R5IA 1XGQB 1MWAA 4I48B 4ODXB 4WUKL 3D3VA 4Z7WA 4XNUH 1KJMA 2H45A 3C5ZD 3V8OA 3HC3L 2OYPA 4ZS6C 4JM4H 3MROA 2Z93B 4R4BA 2APXA 5D7KD 4X0KB 1MREH 1F90H 4WDIB 2NZIA 5KOVC 4YBLB 2RFXB 2K3TA 2NXZD 5FUOH 5I6XB 1U58A 3O6ML 3MXVL 3TFKD 3D39D 4GRWB 5J12B 2AJSH 3O6FB 1QOKA 1YY8A 4J3VA 5HVWA 3U4EB 5F7UA 2R23B 3MUGB 1X7QA 4PUBH 4NM4L 5C2UB 4JDZA 5DJ0B 1AI1L 4P4KB 4LSSL 3U0PB 1UJ3B 3GNML 4J3TA 3UTPD 3P4NA 2V2XB 5EUKB 3V6BR 3VH8B 1B6DA 3RDTC 3P9MB 5EIQA 2D7QA 1A4KB 2Z92B 3RP1A 4MQTB 4JFZH 2DM2A 3F7RA 2W1NA 2HFGL 2W9DL 2ZWLT 3DJ9A 5BRZD 5F7HA 3RX7A 3HUJA 3MTRA 2DL9A 4P49A 5J4MA 4IJ3C 2ZSWA 3FO9B 1FPTL 2YUXA 4K23L 5KSBA 4LSDA 4S1QL 5KSUB 2B5IB 4TSBH 2OI9C 1ZTXL 1GGCL 4AY0A 3TO2B 5B8CA 3RNKA 2JTDA 1LD9B 3CX5K 3F7YA 4KKAC 2OXHA 4OZIB 2HJLA 3QG7H 3I6LE 1UWEH 4U0RC 3L95A 1BLNB 5B22A 3IFLL 1V7MH 3MBEA 1A7NH 2A6KA 3V8CA 4IRJD 3GRWA 5HDOA 4ODTL 1H3VA 3UJJL 4NZRH 3EOTH 1A7OL 5C9JA 1QEWA 1JGUL 3RHWF 4TUJB 3MJ7B 4OFYD 1IGCH 5EZJB 2DS4A 1W0VA 5FFLA 4Y2DA 3FOMA 5CJ8A 4PLKC 1GOGA 1ADQA 3WKNA 4F15B 5L2JB 3LRHA 1JE6A 1FNHA 3V52H 1W0WA 4PRNA 3VGHA 3IXAA 4ZFZB 4OGYL 1NC2D 1ORSA 3MLSL 5EBGA 3TZVA 4HK3J 2QQQA 2DQDL 3UPRB 4GQ9L 5C70A 1A3LH 3FO2A 5KVDH 1ZANL 4QRSA 1YNTB 1IC4H 4L3EA 5FYJL 1EFXB 5BO1H 2YSSA 4Z7WF 1J10A 2LAGB 4O5LH 1WWCA 2J5LC 4GRLB 4PGCA 2YUVA 1QFWH 2JB5H 1FVEA 1P6FA 2WBJC 1V05A 2EXWC 4NT6B 4H0IA 1YC8A 4HHAA 4FFYH 4HUXB 5LAXA 1NGYB 1ZT4A 3MNZB 3QQ3A 1QVOA 5C2BL 5D1ZD 1ZHNA 5HVGB 3QDJB 1I7RB 2Y7QB 1YUHB 5EO0A 3HMXH 5FO8B 3IAPA 2NY7L 4JANB 1MFBH 1SQ2N 4I48A 4ODXA 4RGOH 1QR4A 1NLDL 1HOCA 5E5MB 2R69L 1IGFL 3X13A 2Z93A 4HPYH 5KSBF 4X0KA 2LVEA 3DUSB 5KG9B 4PJEB 5EU4B 2FECL 4TNWF 4M00A 4Q2ZB 4HWNA 1N6QL 4FQ1H 3ARBB 4OUOA 4OCYL 3O6FA 5C3LD 4J4PA 1F97A 4M48H 1BM3H 3U4EA 2R23A 3MUGA 4HEPG 4UOW0 1S78D 3LS4H 1PAMA 2C3WA 1FLTX 4P4KA 3QIWB 3TO4D 3BP6B 2L7JA 4W6WB 5EUKA 2V2XA 3T0EE 3P9MA 5GGVH 3BRFA 3Q5TA 5SV3A 3BMWA 2CGRL 1SJHB 3NA4A 3ARVA 5DC9B 3AROA 1K85A 4MJID 3CC5A 3J8F7 5C86A 4IOIA 5GGRY 1SY6H 1ACYL 5I9QC 4S1RL 3O3UN 2ZCKH 4NKMB 4O2EB 4TPRH 4MB3A 3O3EB 3O3AB 4DVRH 4LKCA 1A0QH 1OQOA 4WV1A 4DN3H 4KI5F 3HNVH 1PG7W 1I4FB 1UEYA 2GJJA 1CFSA 4YAQA 1LD9A 1DUYA 1RURL 5KTEH 4WEBH 4OZIA 5HYJD 4WGWB 4QRPE 1I1AD 1IGJB 4QOKA 4D0CA 3BH9B 3NFSH 3ZDXE 4KKBC 1IQWL 3LMJL 4KKCD 5A40E 3NPZB 1F11B 5F7WC 1F00I 4FQ2L 3MREA 4TUJA 3MJ7A 4P59H 5EZJA 3NIFE 1HHKB 4O02L 1RZKH 5J13C 5L2JA 4PV8B 1QFHA 4OBRA 5GJTL 5L6YH 5KSAC 4XCEA 2VLRB 5J11B 4PJ9D 4DGVH 2GJ6B 4RBPH 3CDYA 3C08L 4IRZH 1J9CT 2ED7A 3AM8A 3UPRA 5F72S 4LEXL 2XZQH 4JFDD 4TUOB 2O61B 1PY4A 2Y1VA 4B7IA 1YNTA 1F8TL 5IIEB 1RJYB 2GFBA 1EFXA 2OL3H 5C0FB 1PBYA 1CD0A 4KK5D 4L4JA 4GRLA 1R0AH 1X5HA 4TTDD 3RJDA 3FHAA 5SV4A 5I1GH 5EC2B 5IJKA 4MLSA 1T20B 4PS4H 3DBXB 3WYRA 1INEH 3N0PB 2NXYC 1NGYA 1XIWB 1QG3A 2MJWA 1NMCB 3H0TB 2IQ9H 2VH5L 4M7KL 3QDJA 1I7RA 5EA0L 2Y7QA 1YUHA 2MSPA 4EKXA 3ZYOA 1GXEA 1FZOB 5IMMA 1S7XB 5FO8A 2DTMH 1FO0B 4KRPD 2VJXA 4PGDB 1ZHKB 1ZA6B 2E9BA 1ZT7B 4JANA 1MCNA 3T8XB 2NX5E 4CKVX 4OM1H 1MLBB 2EC9U 2A6JA 3E0GA 1KCSL 5A16B 5E5MA 1JWUB 1CFBA 3NH7H 2W60B 4XBGB 4PG9A 1B0WA 3V0WH 1UKQA 1IQDB 2YRPA 3DUSA 1KB5L 5KG9A 3KJ6H 4PRIE 5HGDB 1J1XH 4PJEA 5EU4A 1NGPL 1KJ3H 1HCVA 4Q2ZA 5K33A 2JCCB 4FMFA 3ARBA 4NN5C 2YD3A 3BP5B 3EGSB 3EKCA 4I0CC 5CAYB 3LD8C 1T0MB 3ES6B 3LKRB 1EIBA 1N6VA 2X1PA 3MRCB 3VCLA 4QHKJ 3UTTE 1A3RL 3BP6A 1H8OA 4Z7OF 2PYED 1P4IH 4GXUM 4LSVH 4Z6AT 1CFTB 4KXZI 4J7RA 1SJHA 4LEOB 3HB3C 5A3IC 3NACH 2LQRA 3MV8E 2W91A 5IT2L 2XY2A 2NMSA 5I19H 5C0AE 4NQDB 4HULB 4LIQH 3D5OF 3QH3B 1ZHBB 2V2TA 5F8QC 5DEZA 4NKMA 4O2EA 4MQ7B 3ALWA 3UJIL 4EXPX 1FCCA 4I5BB 3BGFC 4ZYKA 3O3AA 3TVMB 5AUMA 1T4KB 4OZHB 4PJGB 2PYFB 4LLDB 3GBMH 4P23A 1EHLL 3HI6L 4P99A 1KUMA 3RVXD 2CDFA 1I4FA 4M5ZH 1MSPA 1KOAA 4DEPC 4NCC1 4QT5A 1EAPB 3GIVB 5D1XB 3AUVA 1OGTB 5KVEH 1JPFB 2CLZB 2X1QA 5IQ9B 1IGJA 3WFZA 1W8OA 1YJDH 4WY7H 4ZUUB 5FYKU 5E6ZA 3TYFA 1F11A 2E27H 3K8MA 2G5RA 4JFHD 4LSPL 1KN2H 2P5WA 1NSNH 4GRMB 4OJFH 4W70A 5AEAA 1DEEA 4HXBH 5E9DB 5T1LB 1RHHB 4PV8A 1N0LA 1SJXA 5IVNA 2VLRA 2F19L 5D1QC 2EYTB 3TCXA 5MHSE 3QZWA 4V1DA 4KQ4L 4HMEA 3VXQA 2O61A 1E6JL 5IIEA 3G04B 5CJBA 2I60H 5F21B 5F8RC 1J0JA 1FG9C 4GBXB 5C0FA 1FG2B 4X8JB 5F9AC 3D2UD 3KXFE 3IS0X 4MAYC 3TJEL 1JRHI 1XF3B 1MFAH 3ARDB 3ULVH 4AM0B 1OHQA 5EC2A 3BQUB 4XNMA 1C7TA 4ODHL 4RGNB 1T20A 2VXQL 1N5AB 1VACB 4HWBA 4U6YB 2IAND 1N7MH 2MQCA 3S36X 4OLVL 4NZUH 2HAZA 1PEZA 1ZLSH 3TV3L 1CFNA 3H0TA 1U8PB 1TQBB 3ZKQD 4QTIL 4NGHH 5D71H 2IAMB 1FO0A 3SDXA 1ZHKA 1ZA6A 1ZT7A 3IDJB 3T8XA 3FCTB 2OZ4H 1MAML 4RBPK 5D7SL 3RVWD 1O7SA 1U8JB 3CFEB 2NCMA 1T7VA 5A16A 4KVCL 1JWUA 1U0QA 4QRRB 5IW6B 4UT6H 3JV6B 4GW1B 2W60A 4XBGA 2NTFB 1IQDA 4G9DB 4LMQE 4KQ3H 5C08D 5HGDA 5I18H 3K4ZA 2R0KL 3L3IB 1MH5B 4I2XA 2BFVL 3F7VB 2JCCA 5CSGA 1FGNL 3TBWB 4U1HB 3EGSA 4YC2C 4EDXB 4F37F 4KAQL 4HLJA 1T0MA 3ES6A 3LKRA 5DMJB 3MRCA 1T7YA 4QCIB 1C1EL 3A6CH 1HYSC 5I1IL 3PDGA 1QP1A 3H9ZA 4LK4A 2VC2H 4NZTH 3BMVA 1CFTA 1P7QD 2Y07H 5CJXC 4NRXA 2VDLH 3GSOB 1YMMD 3UXFA 5TQ0L 3VFWB 4R4NC 4U1MB 4NQDA 2XTJD 1J8HE 3KYAA 5HJ3B 3QH3A 4PRHD 3ARQA 1ZHBA 5D4QA 4MMZC 2FSEB 1NANH 4MQ7A 4I5BA 1S8DB 4YHZL 4ZAKC 2LU7A 3TVMA 3ZKMD 5E24E 2HMID 4OLEA 4OZHA 2ZPKH 4LLDA 4PJGA 2NY2C 3RQ3A 5EOCH 3QHFL 3QRFM 2AXFB 2Q8BL 3BKYL 5JPNB 4YUEL 3U9UB 5D1XA 1EAPA 2CRZA 4K94L 4NYLA 2MHAB 1OGTA 1JPFA 2CLZA 5IQ9A 3RIFK 5HHVL 3SKJH 3C5ZB 4AL8L 2OMNA 1VENA 5EU3B 3T0BA 5IB2B 3QIBB 4NQXB 1QPPA 5HI5D 1NCTA 1FSKC 2F74A 4WGVB 1KLUB 4H1LB 4OIIL 1ZSDB 2JLLA 4X4YA 2NXZB 4HIXL 4X6BB 1U8HB 4GRMA 4XWGL 2Z8SA 2E7HA 2WP3O 5E9DA 5T1LA 2V9TA 5TPWL 1JWMB 2EO1A 1RZFL 4PP1D 1CWVA 1F5WA 4PBVC 2F8XC 2NY6C 3HI5L 5EORL 3Q6GL 1RD6A 4OCXH 1UADC 4M61B 4JM2C 1OTUC 1TJHH 1Q0YL 1FNFA 3LOWA 1MRCH 3G04A 4YHPB 3W0WD 5BRZB 2WW8A 2W9LA 1QFWI 3P4LA 5D5ME 5CZXD 1FG2A 4OZFH 4X8JA 2VXTH 1XF3A 4Z7UB 3ARDA 4AM0A 2QQLL 4D8PB 3DX6B 1XZ0A 1HXYA 4YFLI 1Z2KA 1N0XL 3BQUA 4WO4D 1N5AA 1VACA 1G7JA 4V2BA 3VG9B 4U6YA 2WK2A 2Z35B 4WUUA 4B53A 2JCCF 1VHPA 4K8RL 4XC1H 5F9WB 3DXAD 2EDRA 4YHYB 2APBA 2XG5A 2XZAH 1BQHG 4HQQH 3HC4H 5ENWB 1U8PA 2N7BA 3SY0B 2B1HH 4OB5H 4YDIL 3OKYA 4IRJB 3U79A 2IAMA 1TJIL 3BD5A 4UT7L 2UUDH 3IDJA 4R8WL 3FB8B 1U8JA 3CFEA 1Z9LA 4LKXA 1XF5B 2VISA 3MA9L 3SGKA 1YN6B 4RGMB 5DA4A 3VA6A 5CWSB 4QRRA 1VFBB 3JV6A 2EE6A 2GTWA 4GW1A 4LLVA 5DR5H 2NTFA 4G9DA 4YHOH 1FAIL 3BZEB 3L7EB 4WI6A 1NC2B 1T1ZB 1KJ2L 2X09A 1MH5A 2DD8H 3F7VA 2N56A 3CLFL 2VLJD 3JVGA 3BPCB 3GGWB 4AEIH 4U1HA 1ODAA 2YD4A 2EH7H 1GGYA 4QCIA 2MWCA 5BV7H 4B50A 2L7UA 2V7NB 2QJDA 4QLRA 4PG2C 1A6UH 3VXPB 4YDKL 1AXTH 2A1WH 2YXMA 3REVA 3VI4E 1T7ZA 1FCGA 2LV4A 4EI6B 4CVXB 4H0GA 1ES0B 1EX0A 4HS8H 5K59E 3V4UH 2ERJC 1D5IH 2ZNXA 4L9LA 4ZMAT 4LFHG 4IRSD 2P8MB 4G5ZH 1VFAB 1S8DA 5HD8C 1JGEB 3O4OB 1GGTA 1AHWB 3OB0H 1BF8A 5D1ZB 3FMGH 2R1YB 2CUMA 3LPGA 2VLMD 4M5YH 3PL6D 5JPNA 3U9UA 4U31A 1TVHA 3BEVB 1TZGH 2Z0BA 5AWNH 2QTEA 3C5ZA 1H3XA 2XTLA 4G42B 1JF6A 3QIBA 3I6KB 5DHVB 3F6LA 3MOQA 3V4PH 3MFGB 3S3JA 4C57C 5JZ7D 2R2HB 1KLUA 4H1LA 4PJCB 4F57H 1ZSDA 3I2CL 3QI9D 5IMLB 1FE8L 2FX8H 4H20H 4X6BA 1U8HA 3SJVB 1V3MA 2CUHA 1DBAH 5JHDE 1KPVB 1JWMA 2WIMA 4TVPD 1ITCA 3Q3GB 1WWAX 4QXGL 1NQBA 3TO4B 4LFHD 4XVUD 5F6HJ 3WNMA 3RI5F 2EDHA 4M61A 4LCWE 4D9QE 4YHKH 1UG9A 3OZ9H 4YHPA 5T3XH 4MJIB 5BRZA 4JGUA 4L8SB 1T89A 3QAZC 1I1YB 5T5NG 2EDBA 4M1CC 1A6VL 4Y16D 1AXSB 4MA1C 4Z7UA 5GHWL 1BVLB 2ZG3A 2AQ3A 4D8PA 3DX6A 5E2TL 5CEZL 1KTDB 1M6OB 4KV5E 3CK0H 1HHGB 1VB9A 4DUXA 5ALCL 2DMCA 2DQCH 2QQNH 3P77B 1LP9E 3H9HB 1QFUL 5EZIL 2C9AA 4ZDHB 4ZUWB 2VE6B 2G60H 3FN9A 3FT3B 3TPUB 1MAJA 1U8KB 5HYJB 4YPGB 1WIUA 3MLYH 3OHXB 3RWJB 3VWJD 5ENWA 1EFQA 1I1AB 1EEQA 2YA1A 2FJHA 3SY0A 2P44B 4IRJA 4KJPC 5E8PA 4C56B 3ZHDA 1CXFA 4PJFB 3L3GB 3V6FB 2KBGA 3REWB 4G3YH 3FB8A 2J6EL 1A64A 4R4FL 2VERN 5DJYB 1CZ8L 2E7LC 3H3PL 3EHBD 5D7LD 1XF5A 5EFIA 1J0ZA 4NO5B 4OFYA 1YN6A 3NCEB 12E8L 5CWSA 1QLEH 1VFBA 1JCKA 3H6JA 4HGWA 4FQCL 5A1AA 3UDWA 1BGXH 4XVTH 3BZEA 4NKOB 4AENB 4PJ9B 1T1ZA 1Y6KR 5DD1L 2YMXH 5F7DA 3BPOC 4Y5VB 4JFDB 5LVEA 4UIMB 1BQSA 1S9VB 4EUPG 2AEQL 3P4MB 3WJJA 2VNCA 2V7NA 5F7YC 3VXPA 5T3ZD 4PJDB 5JHLH 5CIPB 4CVXA 4EI6A 3DMMD 4K3DH 4LCIL 4K7PL 1U8QB 5HGHB 4JRXD 1KB5A 4XNYH 3TIDB 1CL7L 3ZL4H 2HJFB 1XF2B 2P8MA 3S34H 4X6CE 4ZS6D 2MNUA 3CVHB 1X5IA 1IAIL 3MRPB 1JGEA 4TRPH 3LPWA 1AHWA 3BKJH 4Q9QL 5IJVA 4URTB 2JK5A 3V0AC 1MHPH 4L4TE 4RRPA 3CUPB 2X6MA 1HHIB 3CGTA 3U4BL 1LVEA 4ETQA 3OR7B 4NFBA 4KRPB 3S98A 1BEYL 4O00A 3WUZA 4Y19D 5E7FA 5J06A 2VXUH 4NNPH 4S11A 1DQMH 3M8OL 1EGJH 3I6KA 5DHVA 1MVUA 3RDTD 5D7IB 4Z7UF 1S7SA 2R2HA 1A4JB 4PJCA 1KEML 1U8IB 4K7FB 1YEFL 3MBXH 5IMLA 3K4DA 3QUYA 3ARFC 3R1GL 4RZCB 2D7NA 3SJVA 2YN5A 1KPVA 2IG2H 3H42H 3Q3GA 3RL2A 4XMPH 4LCCB 1QBBA 2UWEE 4LHUA 3TO4A 1AGEB 1V7NL 3B2UD 3O41B 4NP4H 3SCMD 1RUAH 4J3SA 5DK3A 2EO9A 3CU1A 1A47A 1MCPH 4G8GD 2CUIA 3P3YA 3CVIL 1T6WA 1VKXB 4L8SA 4D9RE 4OCRL 3S5LG 1I1YA 1CDIA 2CD0A 4PJAF 5LBSH 1RFDH 1AXSA 1I9IH 4P5KB 1BVLA 4WWKA 3QA3B 1UM4L 4GUPB 3MUHL 1KTDA 1M6OA 4OGAC 1IKFH 4M9PA 1HHGA 4OD3H 1D6VH 3EJJX 3OKKB 3P77A 3BWAA 1WSST 4MJ2A 4TVPL 1NGXB 4ZDHA 1LWRA 4HXAL 1T2JA 4ZUWA 4PLKD 3FT3A 1U8KA 3QEQE 2GITB 5HYJA 3O2VL 4JFFE 3RWJA 4ODUA 1I1AA 1S7TA 3LRGA 1CTNA 3T0XA 2IPKA 4LSTL 4G43B 4C56A 1KPRB 1EBAA 2CDGB 2VZOA 3L3GA 1TCRB 5E4EB 4FNLL 3V6FA 5KZCD 2CRYA 3REWA 1DLFL 3SOBL 5DJYA 2E3VA 1X5GA 3LKOA 2PR4L 3R06B 4YXKH 4BZ1H 2A74B 2D03H 4LIQE 3NPSC 1WITA 2VXVL 4UV7H 1SEBB 1QLFB 1MUJB 5ADOL 2WBJD 4NKOA 2ZUUA 4PJ9A 2EXWD 3B9AA 4LGRB 2B4CL 1P84J 2FL5B 1JZ5A 4Y5VA 4JFDA 3MXWL 4HAFA 2AJYL 3GHBL 2PF6A 3I50H 3TBTA 2AERT 5ID1A 4UTBH 5B4MC 1S9VA 4FFZH 4PGEA 4K3JL 3P4MA 2VKWA 4NQEE 3D2UB 3VGAC 4IDJL 2YWYA 3X12B 1MCHA 1HILB 2X4PB 4JN2B 4M43H 1TJGL 5CIPA 2FBOJ 1U8QA 4WHYH 1KGCE 4P3WA 5HGHA 1NANI 4PJCF 4ZTOL 1F42A 5JIHA 3ULUL 1OAZH 3P9LB 4KJYA 3EYUH 3TIDA 3WHE0 5FYLH 3VXOB 2WIIB 5ISZE 3UJTH 5JQ6L 2HJFA 3NABL 1XF2A 4JZJC 3OKEB 3V7AG 2OR9H 5HHOE 1KIUA 3CVHA 2BDNL 1FC1A 3MRPA 5FAAA 3LZFL 1IEAB 3GMLB 3WJLA 3DRTB 1JPTL 3CUPA 4Y4HC 1UH3A 5FDWB 5E03A 1RAMA 2AVGA 3X3GH 3OR7A 3K1KC 3DUUA 4HBCH 3WHXB 1U93B 3FO0H 1W72H 4LASL 3OTTA 2H26B 2R2BB 1BX2B 5D7IA 4XXCC 5EUOB 4QXWA 1V3KA 1ZV5A 1MJJB 2P45B 5CD3B 1A4JA 1JV5B 3R0NA 4RAUB 5C08B 2Y25A 1U8IA 4A2LA 2P8LB 3B8SA 3U9PL 4RZCA 1T5WB 2F54E 3WDHA 1KT2B 2YPLE 3E6FA 5LGHL 1H3TA 1C12B 3MXVH 1OM3L 4HZLB 2I27N 3INUL 3RU8L 3U0WL 1QBLL 3T1FA 2GT9B 3TYGL 4NM4H 2BRRH 1AI1H 4YIQB 3GNMH 4FZEH 1EO8L 3ME0A 1P7QB 5ESQB 2OTUB 3D85D 3MRIB 3OKMB 4PJFF 1VKXA 1YMMB 4QHNA 5A2KH 5DJXB 3P0VL 1L0XA 4MVBD 3DOSA 2XTJB 2HFGH 3VXNB 5B3JF 3E6HB 5CD5C 4PRHB 5IG7B 4I0PC 4P5KA 3HMWL 3QA3A 4OI8A 4GUPA 4KKBD 5L9DL 2X41A 4P2QE 3SDDA 3OKKA 1KNOA 1A6WH 3AS1A 3D0LB 3H9SA 3WIFB 3LIZL 1KFAH 2GITA 4JPIA 1MF2H 2JJTC 4C54A 2ADGB 3NFPA 4PRPE 5KSAD 3UTOA 4DK6A 4UTAL 4HBQA 2VUYA 1KIPA 2AV7B 3IFLH 3QFDB 1KPRA 1N3NB 4PJDF 1EAJA 2CDGA 1TCRA 3B2VH 1IM9D 2DLFL 1MI5D 5I1AB 15C8H 1BECA 3R06A 5DK0B 1JGUH 2A74A 3D3VE 4Z7WE 3MYZA 3SO3C 4EN3C 3JV0A 1I7ZB 3L3KB 1G7HB 1SEBA 1QLFA 1MUJA 1JK8A 1EEZB 3CMOL 1YPZB 1NMAL 3OAUH 1B0RB 5J1AB 5JPMB 4BJLA 1F3JB 2FL5A 4NWTL 2FYYA 1MIML 3I85A 2DQDH 2NXYD 2VRAA 1CLZL 2GK0A 5F1KC 4UILL 1MCEA 3W0WB 3NGBC 3I3EA 4HT1L 3X12A 1HILA 2X4PA 3T3PF 3W39B 3B5TA 1PG7X 3E3QE 5D7IF 3VXUA 4UQ2B 3T0WA 3IS1X 4JZOB 4HUWB 1MHHB 4DKDC 4WO4B 2IC2A 3LB6D 1S7WA 2QADC 4AT6B 4MCZB 3P9LA 5JA9A 4NQVB 4MZ2A 3VXOA 2WIIA 4V2CB 1KJ2A 3HUJE 3KR3L 5JXAL 3OKEA 1K2DB 1HINH 1D5BB 4NHCL 3DXAB 5GRUL 2Y6SC 1UGNA 5C7XL 1IEAA 3QNXA 3P4OB 1NBZA 1H3PL 3DRTA 3ARZA 3ALPA 5DUBB 3UCRA 3DX9B 5FDWA 5IHUH 2MPAL 4GG6A 1BAFL 1A6PA 2V9RA 3WHXA 2YC1B 1T2QL 1CQYA 1F2QA 2NY7H 2NY4C 3E3QC 4U3CA 3C9NA 4LAQL 3QXWA 3Q6FB 2H26A 4ZXBD 1C5CH 1X5JA 2EYRB 1G1YA 1BX2A 2VKXA 5EUOA 1TLKA 3QR2A 5JOFA 4YGAB 1FNSL 1QNZH 1F3DH 4WJ5B 43C9B 5F1IB 4RAUA 5C08A 1RIVH 5A3ID 1MHCB 1ZVSB 4ODBD 2AEPL 2P8LA 2B20A 4PGJA 1LO3L 1KN4L 4K3GA 4HUNB 4UIKL 1T5WA 2VLJB 4KUZL 4Y2OA 1KT2A 3FFCA 3KPQA 4NC1E 2YUZA 1KULA 2FH8A 1B90A 4XPGH 2DN7A 1BQLL 4TYUA 3SE9L 2GT9A 1PW3A 1MEXH 3KS0J 4UBDC 2G9HB 2ZKHH 4R97B 1CCZA 2DOCA 1P7QA 4Z0BL 5ESQA 1MCRA 2RJMA 3MRIA 3OKMA 1J1OL 1J8KA 5GS3A 4P4RB 5DJXA 3MBEC 3FN0H 1M05B 3NA9H 2R56L 3VGGA 1HWGB 4PRHA 4L3EE 4Q6IB 3T65B 4IRSB 5C0AD 1LE9B 1ACYH 1RI8A 4S1RH 4PFEA 4XVJH 2DBJA 4NC1C 4RFOL 4JAMB 4Y2DC 3D0LA 1OLZA 1DBKL 1FIGL 5ESVB 5DS8B 3PL6B 5E2UL 4P2CG 1VESA 5DHYA 2YK1L 3V6ZB 3TZVC 3N1MC 1HZHL 1RURH 2WUCL 2RHEA 5D1QD 5T1KD 3UBXI 2AV7A 3QFDA 4N5UA 1N3NA 1IGTB 1BVKB 2X1XR 5CZVL 2ATKB 4G7YL 5IGXH 3PP3H 1OAUH 1BQUA 1IQWH 4UV4H 5I1AA 3QI9B 1MJ7L 1UA6L 5DK0A 4FQ2H 4MAYD 1U36A 4W4OA 1I7ZA 3V4VL 5C0CA 1G7HA 2DBLL 1CGXA 3ABZA 4WFED 4PBXA 1YPZA 1B0RA 2H8PB 5J1AA 5JPMA 1F3JA 4WFGE 1HHHA 5BV7C 3NCFB 4LEXH 3GKWH 4FXKA 4GRWE 3V6OA 2ZUSA 4UDTB 2J6EA 3PWVA 2QHRL 4Y16B 5T33H 1BFOB 1DSFH 2YBRB 5C8JA 4FP8L 1JPSL 4OGXL 5EUOF 3IJYB 4UQ2A 2OBGA 1Z0NA 4JZOA 5ITBL 4HUWA 1MHHA 4WO4A 2F5BL 4MCZA 4NQVA 4OFPA 1EHNA 1D5BA 1NCAL 3DXAA 3CX2A 3MOBL 3DX7A 1LDSA 1K4DA 5GQBA 3P4OA 3VWJB 5I6XC 3MLXL 3EYVA 5DUBA 2YD7A 2WZPD 3DX9A 3O6FC 5DK2A 4J4PC 1HI6B 2YC1A 4P4KC 3STZB 3L5XH 5I1EL 4KHTL 4YXHL 1X44A 4OZIE 2DI7A 4XP5L 5D7LB 3Q6FA 3ZDYE 4DJMA 2EYRA 4QOKE 3CIQA 1KCSH 4AEHH 5F88B 1YN7B 4WTZG 4XPFL 4CNIB 1M7DB 5FM5O 4WJ5A 1QO3B 2BSTB 5F1IA 2B2XH 4DAGL 2P4AB 1ZVSA 3AREC 3G6AB 5D2NE 3SKOB 4X6EB 3L3OB 4R4ND 3IVKB 4HG4J 2VLJA 3FJTA 2HT2C 3MJGX 1NGPH 5SX4H 3K3QA 1R3JB 3OAYK 1VPOL 4WV1C 4ZAKD 1R5VB 4G7VL 3RUGB 2DKMA 1PZUB 2NY2D 2G9HA 2J8HA 4GAYB 4MD4B 4LLUB 4F7MB 4JO3L 5D2LF 4P4RA 4KJQC 4ZD3L 3NZHH 1I9JH 1GZQB 4JRXB 5IR1B 1M05A 4YHIB 2R4RL 5IF0B 5F70A 5IT2H 3MO1A 4Q6IA 3T65A 3ARTA 5D2NC 5KANI 4IRSA 1HKLL 1LE9A 4J3XA 4N9GB 1CDYA 1J8HD 2AP2A 2DMBA 3RWHB 4DW2L 2BNRD 3UJIH 1UCBL 1EZVX 2H9GB 3MMEB 1P84K 4JAMA 3QQNA 5DQJB 1YPZF 2FZ3B 5F44A 1ZGLB 1EHLH 3HI6H 5ESVA 3PL6A 4BKLB 3L6FB 1YC7A 3V6ZA 3IKKA 5FGCB 3MUZ1 4MA3B 3C5JB 4ALAH 3AM8C 1YNLH 4Y19B 3UC0H 1L7IL 1D5MB 3QRGH 1HEZB 3QDJE 3RDTB 5F6HI 4JM2D 1IGTA 1OTUD 2ATKA 3E8UL 5FEBA 4HX1A 3O4LD 3JTTB 3DSFL 1C08A 2DIJA 4P3CH 4JY6B 4GRLC 2GI7A 3D25A 3RZCC 5KBNC 3RX8A 1T6VN 5IJKC 4X80H 5TF1L 5B38G 2OI9B 1SJEB 2JE8A 4OV6F 5DDHB 2A38A 4TULL 5HY9B 2RAMA 4BH8B 5K9JL 1K8DA 3MCKB 4HUKB 3I3DA 2F19H 3SCMB 1U42A 4PJEE 4GQPH 4DFIA 4G8GB 1WK0A 2G5BB 3S37X 2FIKB 4UDTA 5IV2B 1E6JH 2IMMA 4FG6C 4U0RB 4BH7B 1MFCL 4Y16A 2YZ1A 1BFOA 5DVKA 4R9HA 2DTSA 4OI7A 3IJYA 4PJ5B 2X4SB 2IH1B 2FGWL 3IYLW 5JXEA 2XV6B 1JVKA 5KJRL 5LKNA 5HYSA 4Z7VB 1OLLA 1NGQL 1FGVH 3VWJA 3GMOB 1J0HA 3ARBC 1BJ1H 4NJ9L 4OCSL 1ZLWH 3C2AL 3ZSSA 2YWZA 3MV9A 5I30H 5GRXG 4JHAL 3N9GL 4QTIH 5F97E 1HI6A 1CD8A 3QSKB 1ZLUH 1QSFA 3STZA 5FO9B 4UOW1 4U6TA 5E00B 2QSCH 2N7AA 4LSRH 4XAKE 3T09A 4BFBD 2J5LB 5F88A 1YN7A 3EZJB 4CNIA 1M7DA 4KVCH 4QY8B 2BSTA 3S5LB 3G6AA 3SKOA 3L3OA 3IVKA 1FRGL 1I1RA 2P5WE 3B9KB 1R3JA 2VR5A 1HXMB 5HD8D 4P23C 1R5VA 3JWDL 4KAQH 2C7UB 3RUGA 2LE9A 4H8WC 3K80A 4L8DA 4XP6L 2W07A 1WBYA 4LBEB 2VLRE 4GAYA 1RJZB 5I1IH 4MD4A 1BREA 4F7MA 3MUJA 2QSVA 3BKCH 1OF2B 2Y9RT 5I8CB 4V1DE 3CLEL 4JRXA 5IR1A 1CK0L 5IF0A 4KMTH 2YD2A 3BWUC 1NC4A 1UM6L 1CR9L 1IC1A 3Q0HA 4JG0L 5BVPH 1DANU 2CR3A 4N9GA 2B0SH 3S7GA 1ZGLP 3OL2A 2DLHA 5GISL 5HGBA 2H9GA 5KVGH 3MMEA 2EZ0C 2YD6A 1S9YB 5DQJA 2FZ3A 4FN0A 4UQ3B 1XH3B 4BKLA 3TWCL 5ESAB 4WW2F 3ZE2E 2IWGA 5J11C 1DP0A 2XA8L 2Q8BH 3O6KL 2I5YL 4YUEH 1HQ4B 4MA3A 3C5JA 4K94H 4C59B 4HPOH 1D5MA 1WCQA 3RDTA 4JCMA 2CRMA 1NCWH 3FAXA 4OLXL 3JTTA 3NFNB 5HDLA 3SDXE 2CJUH 4XH2B 2GAZB 4JY6A 3LKQB 5CJ5A 4M1CD 4M4PA 1QFPA 1TZIB 2VIRA 3OJMB 3I75B 4HIXH 3RGVA 5GS2H 3Q5YA 2CLRB 5IVXF 1K4CB 1SJEA 5DDHA 4JREB 3MCKA 2CMRL 3SCMA 3MLVH 3IRPX 1H8SA 2BNUA 1CF8H 4G8GA 3GSNL 4I2XE 4OGZA 1NMCC 4I18B 2G5BA 2J4WH 2JCCE 3WXWH 3JTSB 4W68A 3EO9H 2FIKA 1YQVL 5IV2A 2FX9H 4LCWD 3W2DL 4D9QD 3OX8B 3FT2B 3FKUS 4BH7A 5TE6H 3HFML 1MOEA 2HKFH 2R0LL 1SMOA 4KJPD 5E5RB 1II4E 3PQYD 2FLBT 4PJ5A 3DROA 3ZTNL 2IH1A 5JW5B 3AXLB 1A3QA 3DIFB 5T5NF 3ZTJH 1ZEAL 2YPVH 3QDMD 1WGOA 1JRHL 1V5JA 3GSRB 4NQDE 5J13B 3FB6B 1XGTA 4Z7VA 3TCLB 4KZDL 2EKSB 5JMRA 3GMOA 1XF4A 4YWGH 4PJGE 4OZHE 1MRFL 4R6UA 3ZYIA 4LDLB 4HUVB 3O9WA 2W92A 3BUYA 4YDIH 3QNZA 1IM9B 5FO9A 1TJIH 2ICES 4JPWH 5E00A 2FHFA 3S96B 4QRQB 1MI5B 3QUZC 3A6BL 3MA9H 2EIZA 4XNUL 3QUMB 2A0LC 3U36B 3S5LA 4KTDL 3UAJC 4R26L 4JM4L 2AJZA 1UXWB 4OF7A 5EU6D 4ZTPL 4MHHI 1SYSA 2EE2A 3TVMC 2V5YA 3B9KA 3FTGB 2NXYB 4LOUC 3VRLF 3CLFH 1HXMA 5FUOL 2QSTA 2FEDC 2NY5L 2C7UA 5E9DE 3O0RL 1I3UA 3MRRA 3VFOB 1RJZA 4JE4B 5D1XC 2A77H 4PUBL 2X40A 1XR9B 3VA2C 2H1PH 5AZEL 1OF2A 1R24B 4YDKH 3NZ8B 2X9YA 1ZLWK 4HLZH 4MNGB 3EDJA 3CXDL 3GMRB 1ZLUK 5LG1A 1MCJA 3LN4A 3K8LA 2HH0H 2FH6A 4JFOB 4TSBL 4FABH 4RGNE 4UQ3A 5HYIA 3ARFD 1OTSC 5ESAA 4Q9RH 5MEPB 3LD8B 4L4TD 4WUUE 3TESA 1HQ4A 4G9FA 3ZDZF 3IU3B 3T0VA 5FO7B 3DVNA 4MD0B 2VZ3A 4ZXBB 4NUJB 3GSQB 3FRPG 1UWEL 1U8OB 2KZWA 4P5TC 4W4NA 4G8FA 5FYJE 1V7ML 3NFNA 4ZFGL 4KTEH 5BOPA 5JQHC 3ARDC 3LKQA 3EOTL 3I2CH 1FE8H 3OAZH 3BGMB 3L7FB 3WN5A 2CLRA 2DM7A 4KRNA 4RGNC 1K4CA 4OGAD 4QRRE 2IFGA 1FYTA 4X4ZA 3BP4B 4CMHC 3IDGB 5C0NC 4QXGH 3MUY1 4D0DB 3VGEA 5GS0H 2WBWB 4IIQB 4DEPB 3RY6A 4I18A 1RVFH 1LILA 1TQBC 1A3LL 5KVDL 4YDLC 5JTWA 3OX8A 2Z91B 4PY8I 2IAMC 4F7CB 5F1NB 1IC4L 2XIDA 3RKDD 5BO1L 5C0AB 1A6VH 5D8JH 4GT7A 2PN5A 3S35L 4N0YL 2HFFA 5HHQB 4O5LL 5JW5A 3DIFA 3EJZC 3SGKC 4TUKH 1QFWL 2R4SH 2JB5L 5EIIA 1JZ8A 1SEQH 1JTOA 5ALCH 4E5XB 1KEGH 5DTFA 4R3SB 3GSRA 4UZGA 3FB6A 1P69B 3HG1A 2BERA 1QFUH 3TCLA 4CDHA 2EKSA 4DVBA 2EDJA 1OSZB 5LCVH 5D1QB 2PKDA 5T1KB 4PLNC 4JFFD 3LV3B 3H2WA 3QHZL 2IADB 4JR9H 4HUVA 1UYWL 1IM9A 3VRJB 2UZYB 5B4MD 1KTRL 1CFVH 3HMXL 5K9QG 3S96A 4QRQA 1MI5A 4R4FH 4KDTA 2ADFL 4MAYB 4PJHB 1J11A 3QUMA 12E8H 2X4NA 4HF5H 1I85A 4QXUH 4L9LC 4FQCH 1IM3B 5D7KE 5C0BD 3BO8B 1S5HA 3K2UL 1V3JA 4KU1A 3FTGA 3PXHA 4J6RL 5TDNB 2BXYA 4XGZB 3NVQA 4FQ1L 3EZ8A 1T83A 1P1ZA 4RSVA 4M48L 2NTSP 4FOMA 4B7LA 2EDOA 1K3IA 2AEQH 2YEZA 3LS4L 1XR9A 3PWPD 3UTPE 1AD0B 5K9OB 1TETH 1R24A 3T2NH 1TQCC 3NZ8A 5C9KA 1RULH 2F53A 1JHTB 4YHNA 4KI1A 5JW4N 4JZNB 3CSPA 3K8KA 2BVPB 3QIBC 4MNGA 1FAKT 3G5YB 3T0DA 3L3DB 1AGCB 1MCCA 4YH6A 2X4UA 4Z76B 1CL7H 3GMRA 3K0WA 3TN0D 5ISZD 4MQXC 1SY6L 4Z7UE 2JJUA 1T21B 1T5XB 3CDFA 1H5BB 5HHOD 3QYCA 3TFKC 3BT2L 1NDMA 4TPRL 2VZ1A 4JFOA 4DVRL 2PW2B 4XC3L 1WIOA 1A0QL 4FTVA 5HHME 4FMKA 5MEPA 5IQ7L 3PGFL 2YN3A 4DN3L 3HNVL 2FLRT 5BJTB 2D0GA 5ANME 2E8ZA 2EIDA 2RGSA 4LRIA 3IU3A 4YDJB 4JDVB 4PPTA 5FO7A 3U4AA 4WEBL 4MD0A 2DDQH 4ZXBA 1BEYH 4UUJB 4NUJA 3GSQA 1J0KA 3L1OH 1U8OA 1ZGLM 2VDPL 1T89C 2VZVA 1RHFA 3NFSL 3ILQC 4ONOA 5EZOL 4XPHH 2OMBA 4HUUB 5CD5D 2CO6B 5E8OB 1YEJL 1YEFH 4GAJH 3BGMA 3L7FA 2Y06L 3EYFB 2ARJB 3WNKA 2F54D 4M6OH 4ZAKB 1PKQB 1RZKL 3VG9C 3BP4A 2OR7A 3K7UA 4NN7B 3P73B 4IM8A 3IJSA 2NY2B 2VQ1A 4D0DA 1IVLA 1MFDL 4IIQA 4YHYC 1JMXA 1F6AB 3ZYJA 3QJHA 3L5WB 4AZ8A 3CVIH 5E5UB 3ZDXF 4IRJC 3WNLA 2Z91A 2ESVA 4U7SA 2DQIH 4F7CA 5F1NA 3BHBA 3NCMA 3TBYB 3D87B 3EUUA 1J8HB 2OL3L 5JO5A 5HHQA 1FSKB 1HCFX 2BNRB 3NIFF 5F7FA 1OQXA 5IB5B 2GCYB 4RGMC 3V95A 2L0DA 4AYFA 1R0AL 1GC1L 4MXWH 3PF2A 4R3SA 5BS0A 4PS4L 2AJVL 1FJ1A 1ZWIB 1JNNH 4EN3D 4HXAH 1INEL 3STLB 3GI9H 2NY1C 1OSZA 3HLAA 5EOQH 3X14B 5D1QA 3KDMA 5T1KA 4RNRB 2ZUVA 3ALXA 3LV3A 4M02A 5CEYB 4PRPD 3QISA 2IADA 2VQTA 3LDBC 3MRFB 5IVOA 3VRJA 3O4LB 4X4XB 2Z8VC 3WJJC 3P2TA 5MEQB 5ICZB 4MMXC 4ESKA 4FNLH 2Y5EA 3G5XB 4PJHA 2GY5A 3SE4C 3N1GC 5CS7A 3D3VD 3QQ9C 1UT9A 1IM3A 2VXVH 2QADD 2BP3A 2YD9A 3R8QA 3V0WL 5ADOH 4WU5B 2FX7L 3PHQB 4ZOCA 3UEZA 3KJ6L 4KROD 2B4CH 1J1XL 4NQCB 4ODSH 4Z7NE 3G5VB 1KJ3L 3SJVE 2IPUK 3MXWH 2Y6SD 5TDNA 1KC5H 4XGZA 2AJYH 4MNQD 5EH1A 4XHJD 3Q1SH 3F65A 5DD3H 3D9AH 4K3JH 1A1NB 3KPMB 2BRQA 4XPAL 1FDLL 5DT1H 4AIZB 3LHPL 5K9OA 4PR5B 5JW4Q 4G6ML 4LSVL 4JZNA 2NY4D 2FATH 2BVPA 1JUFB 4GH7B 3BKML 3L3DA 1AGCA 2UVFA 2W59A 4Z76A 3NABH 4TNVF 1T21A 4YJZL 1T5XA 3BPLC 1H5BA 5GSRB 2BDNH 2M1KA 1IMHC 3QUYC 3FL7A 5H94B 5ITFB 2UVEA 1F3RB 1JPTH 5B38B 3LQMA 1S78C 4K3EL 5BJTA 3NCBB 4M5ZL 1YEHH 4PLOB 5CILL 4YDJA 4JDVA 5HYJE 4N1HB 4UBDD 1UXSA 5BQ7B 4UUJA 5KVEL 5BMFH 4HK0B 1NEUA 1I8KB 1QA9B 3TNMB 4L8SC 2H6PB 2WQ8A 3BSZL 3K4AA 3E1F1 4MXVF 1YJDL 4WY7L 4C56E 1TVDA 4D9LL 1S9XB 3MBED 5C09E 1IKNA 4HUUA 1W0YT 4WWKC 2Y4SA 5E8OA 2Z9TA 1KN2L 3EYFA 2X7LA 4E41B 1GJIA 1NSNL 3G5ZA 2GHWB 4ZAKA 1PKQA 3VMOA 5LGHH 3M1BA 4OJFL 3P73A 4HXBL 2AKRA 3RU8H 4Y2DD 2EC8A 1QBLH 3MJ9H 4LDOB 3U0WH 4C55A 3V0VA 1RK1B 5FIEA 5HHNB 1F6AA 1XCQA 1I1AC 4NNYB 5EWIH 3H7LA 3HHRB 1EO8H 4HIEB 4JFDE 3TZVD 2DWDB 4P46C 1E4KA 5GRYA 5HI4C 5E6ID 2I60L 3TBYA 4KKCC 4PJHF 1M7XA 3F5WB 3HMWH 4L3ED 2BNRA 1N8ZB 5IB5A 2GCYA 3ULVL 3LKSB 2BSED 1MIEH 2ATPA 3ZKND 5L9DH 4A2MA 5SWSD 4ELKB 2W0PA 4WTZA 1FLRH 3OJDB 1A1OB 1ZWIA 4PGBA 5DSCB 4PJ9C 3GSNA 3STLA 1N7ML 3X14A 4N68A 4HJGA 5F7EH 5IVZB 1YEDB 2OM5A 1ZLSL 4RNRA 1D9KA 5CEYA 1HH6B 4UTAH 2FJFB 1RIUH 3MRFA 4WNQB 2BY1A 2C4FT 3NIGE 5DI8B 3O4LA 5D71L 4ZPTB 2GKIA 4M7LH 3QAZB 5DJDB 3HRPA 1HIML 3OKNB 1YEKH 2OZ4L 3QWRD 4K3HA 4MA1B 2AI0L 3N1FC 5D7IE 4UT6L 3PHSA 1UENA 4WU5A 5DRNB 3C6SB 5I18L 4NQCA 4TN9A 2V5SA 1MLCB 4NWTH 1MIMH 3WJLC 3TH2T 5LJYH 1RK0B 2ENYA 4LCWB 5DGQA 4UILH 4L1HA 2A6DB 3T2QA 4HS3A 1A1NA 1G7LB 3O6FD 4J4PD 3A6CL 3QPQD 3PQYB 4HT1H 4AIZA 4PR5A 5FGBA 1SM3L 4G6AD 1HYRC 1RZ8B 5KOMC 2XRAH 4Q0XL 4F37K 4YBHA 1R6VA 2Y07L 1JUFA 2BVQB 3QDMB 1FN4B 2VABA 4OLWL 2R29H 2C1PB 1NCDL 4IDLA 3TT3H 5GGQH 1LP9B 3IJHB 1FZMB 1L6ZA 5GZNC 1E4JA 5GSRA 4F8QA 3ARED 5GRUH 1G6VK 5H94A 3S88H 5FYKH 4U6XB 1H3PH 2ZPKL 5GGUB 2HT2D 5B38A 3H9SE 4K94C 2VR4A 3DUHA 1P9MA 5CGTA 3X17A 3MZTA 3AY4C 2D7PA 4XTRC 1Z5LB 5KSVB 1I8KA 1QA9A 3SKJL 3TNMA 1FZJA 5T3XD 5ICYB 3LSOB 2D0FA 2H6PA 1H0DA 1BMGA 1F6LL 3BFOA 4KJQD 4QOKD 3UTSD 5HSFA 1S9XA 4J12A 5FKPB 4WI8A 3VXMD 5JOPD 5EU6B 5IB1B 4JFHE 3VFUB 1T1YB 3EJYD 4R7NB 3AFLA 1LO3H 1KN4H 4I77H 4UMGA 3QCVL 3WMSA 4BFEA 3SDDC 4E41A 5FOJA 1PFCA 4WTXA 1KB9K 4NQUA 4DKEH 1BQLH 1SJVA 3SE9H 4JQVA 2DI9A 1YNKL 3MLTB 4TOYL 1JWSB 5HHNA 2COQA 4JM2F 4NNYA 1DFBH 4HIEA 4M3KB 2DWDA 5ACZA 5IESL 1FL3B 3TBSA 4JO1H 1J1OH 1TJHL 1X5ZA 1RUPH 5JR1H 2EDWA 5E4EC 2R56H 2AK1H 4IOSD 5E94B 1RUQH 2FRGP 4N1CA 3QDGA 1T7XA 3F5WA 1N8ZA 2VXTL 3IF1B 3OV6A 3VXUE 5I74C 1AP2B 3RWEB 4ELKA 1M7IB 4OF8A 3KPRD 4XCNA 3ARFB 4K9EH 3OJDA 3RZCD 4K8RC 1B2WL 1Q8MA 4L4TB 2LU3A 3MJ6A 5CINH 4RA0C 1YEDA 2HTLD 1HH6A 2XZAL 4HQQL 3FQTB 4LDEB 5D7JC 5D5MF 5DI8A 2B1HL 4OB5L 5LXGH 4GG6E 5CZVH 4ZPTA 4G7YH 2VAJA 4FG6D 3OKNA 2DAVA 1HSBB 1BD2B 1CDCA 4R2GB 1MJ7H 1UA6H 1WFTA 2VMFA 5HDQL 2Z8WC 2V5MA 1F45A 5EUOE 1MQKH 2XKSA 3V4VH 2EKJA 2YZ8A 1CG9B 1BFTA 2IPTH 2X4OA 1UH4A 4Y89A 2BZDA 3FQWB 5C08E 3HE6C 3C6SA 3WHE1 1BFSA 2ARJQ 5F9JA 1RK0A 3FFCE 5IM7B 2A6DA 2EH7L 3HMXA 3ARBD 1G7LA 1NMBH 3VXRD 2EE3A 5IWLC 3HNTH 3CX5J 3PQYA 2QHRH 1B3JA 4G8EB 2KDGA 5KANG 2F9BT 1CL7I 1B4RA 2E7LA 3QDMA 5BVJA 5L2KA 1G9EA 5IEHB 4HS8L 2C1PA 3MV7D 1IAII 2XTJE 5I1CH 1D5IL 4PRHE 4XMKH 1FZMA 1EA9C 3NPSB 4OFVA 3I3BA 3MOBH 3ESUF 4JFFB 3MLXH 5GGUA 2FO1A 3LN5B 3FMGL 3DYMA 3QZWG 5DQDL 1G7QB 2F15A 3HN3A 2AK4D 4P23D 1X5AA 3MLRH 4M1GH 5SX5H 1OPGL 3VI4F 4DZ8B 1PZ5B 5I1EH 5I1JH 4KHTH 3VGAB 4CMMB 1NCBH 1F4YH 4XP5H 5AWNL 5KSVA 1FFRA 3LSOA 4K55A 4XAKD 2XTJC 1TFHA 4XPFH 3V4PL 2EECA 1SY6A 1TTGA 3EOBB 1V8HA 4DAGH 2HT3D 5C0BB 1R3HB 5EU6A 5IB1A 3VFUA 5CEZE 1T1YA 4R7NA 4F57L 2PTVA 4WHCA 2FX8L 5DGRA 3HZYB 3JWOH 3GK8H 2P5WD 5C0CE 2OP4H 3O2WH 2EZ0D 4I8DA 2X4QB 4MB4A 1JHKH 4HKXB 25C8L 3MLTA 5B3NA 1JWSA 1YPZE 3PWPB 2D2OA 4PB9H 1IGIH 4JO3H 4WHYG 4B41A 1FL3A 3UO1H 2N1KA 4ZFOL 2X2YA 3THMH 3OZ9L 4G6KH 4UB0H 4V1DD 2R4RH 3V6OE 4NBYB 3QIUB 5E94A 5CGMA 3TN0B 2H32H 3P30H 3T77B 3RWEA 1AP2A 1DUZB 5D93B 2J8OA 3I6GB 1M7IA 2WV3A 1NBVL 4YFLF 4BZ2H 1UCBH 1UVQB 1MNUH 4W4OC 4PP1C 2QQNL 2C3GA 1CD1B 1A02N 2IH3B 1DQTA 3PNWB 4DTGH 3DXAE 4HMDA 3BRDA 1WFOA 3OKOB 2E9IA 4CW1B 3FQTA 2HVJB 2EEDA 1Q94B 1L7IH 3RWDB 4BFGA 1P6AB 3V6OC 3V5HB 4BQ9A 1ZAGA 2OL3A 3E8UH 3W82A 3B9EA 1TENA 2OXGA 3DSFH 3GB7A 4G3YL 4KV5F 1PX4A 4QEGA 3WIIH 1BD2A 2AW2A 4IHOB 3HC0B 4WO4C 1LP9F 3RNQA 2F54B 4PJBE 3SGDH 3SDYL 1QLEL 5GXBB 3F58L 5ILTH 1UM5H 1BGXL 3FQWA 4XVTL 4ZNCD 4DFHA 3EO0B 4JVWA 4E9LA 2YMXL 2VLJE 2IJ0C 4QYOB 1MPAL 5IROA 5DYOB 4U1NB 3KLHC 4D94A 3PV6B 1MHEB 3VFRB 1WV7T 4FFWD 3EO1B 3DV6B 3MLWL 3WKML 1NEZG 3QXVA 2FGWH 4L1DA 2ARWA 3QUZD 5IEHA 4X9GA 4F7PB 5I17B 1XAUA 3HS0A 1PLGH 3SO3B 4XNYL 4EN3B 5DJCB 4YK4C 2E6QA 2A0LD 3MA7B 4XMLL 3UAJD 2VDOL 4HWZA 3Q5OA 2ZCLH 4YFEA 5F9DC 4S0SD 4PRPB 3BKJL 3LN5A 4BSJA 2JB6B 4LOUD 1MHPL 2CSPA 4FXLA 2VLME 4EIGB 3VD4A 1I7UB 4DZBA 2FEDD 3KYKL 2D7TH 4OLZH 4DZ8A 1LO0H 4CMMA 2QLVB 1T7WA 4W81A 2UZIH 4Y88A 3WO3B 4ZUSA 5D1XD 3IDNB 5IFJA 2VXUL 4PYGA 4NNPL 4TVSa 3W81A 3BISA 3EOBA 3CFKB 4Q6IC 3ZKXC 2QADB 5C0BA 4ZG1A 1R3HA 5CHNA 4KROB 4UNTA 3EBAA 4U2YA 1FRGH 3MBXL 4MDIB 4HEME 3MRGA 4MNQB 4TVPE 4YZFE 2A73B 1U58B 2IG2L 3PL6C 2VDKL 2X4QA 4GMSH 4HKXA 3K81A 3PWPA 1OTSD 1XF1A 4OF6A 4LVNC 1X7QB 4NP4L 1RUAL 4PP2A 1MCPL 3CDCA 1EJOH 1HSAB 1P5UA 1DBBL 2NY4B 1ZS8B 1CK0H 1NCCL 1FNGB 3QIUA 4P5TD 1UM6H 1CR9H 4XXCA 3TN0A 5MP6L 4LSQH 5SX5K 4XBEH 3HUJB 1I9IL 3T77A 4HK3N 1DUZA 3BVNB 1UC6A 3I6GA 2Y36H 4GXVL 5GISH 3ARDD 4JKWA 3TNNB 1K6QH 2OSLB 1D6VL 1CD1A 2IH3A 4RGND 3ARPA 3PNWA 3BE1H 1LMKA 4YPJA 3AS2A 3O6KH 4WUUD 5C0ND 4CW1A 1A9BB 4X9HA 5KAQF 3RJQB 3F7YB 5TJWK 1Q94A 2HJLB 3BEWB 2HKHL 3MV9E 2FO4B 1Q9LB 3MBEB 1G6RL 4OLXH 1QSFE 2F5AL 2EDTA 1E6OH 5J0BA 4CVWA 1A7PH 5HYFA 4IHOA 5C0JB 3HC0A 3VJ6B 5JXEC 3ULUE 5C9JB 1N64H 4YXKL 4BZ1L 3RIFF 2D03L 3EJZD 2VDQL 1W0VB 2B4CC 4Y2DB 4QRRD 4UV7L 2GUOA 3MGTB 2XG4A 1QFWM 3EO0A 4F3FB 1J87A 2X9WA 3ILPB 3TA3A 1WQVT 3DVIA 2P5ED 5DMYA 2JJTA 2AXJA 4LVHC 1WC7B 3I50L 4U1NA 5DYOA 1YQVH 4QHUB 3RUGE 5C1MB 2Q6WA 3PV6A 1L7TL 5E6IB 5AD0B 4NM8H 3VFRA 3DV6A 3HFMH 5C6TH 2OZ4A 4QRSB 2R0LH 1JFQH 4L3EB 3KNBA 3NCYS 1TDQA 3P40A 4LLAA 2BVOA 4M43L 3ZTNH 4LF3B 3ULUC 1WEJL 5SWSB 3KPLB 4JRXE 4F7PA 4PGCB 1ZEAH 4OIAA 4Z0XB 1FVEB 3EYUL 3MA7A 3M17B 4OCNC 5FYLL 1C7SA 4DGYL 5AYQA 5I75B 4U1JB 3PABA 5EU5A 2R39A 4NO2B 5LAXB 1MCIA 2OR8A 2JB6A 1MRFH 1DQQB 1AXIB 5BV7B 4X6DB 1I7UA 4UI2A 1ZHNB 4LAJH 3X3GL 3B6SB 5EO0B 2AJUH 1L9MA 4POZC 5FGCE 2B1AH 5I8OH 1OAQL 1W72L 2BHYA 3A6BH 3IDNA 3QWOB 4P9HC 4POYA 4Y8DC 3QWQB 4KY1H 1GPOL 3TO2A 1S7QB 2IGFH 1OAXL 3CFKA 3VW3H 1HOCB 4KTDH 2ZSVA 4U7MA 4R26H 3QIBD 1G1CA 1CDBA 3X13B 5JUEH 1OTTD 4JO4H 4ZTPH 4MDIA 4PTUA 4JO2H 4MQXD 3LS5H 4MNQA 2A73A 1LK3H 2NY5H 3O0RH 1D6EB 4OZGB 4GKZB 5IEKA 3MLZH 4GFTB 2WINB 5I1DB 2BRRL 2BSRB 4G8GE 3DI3B 2VDRH 4FZEL 5AZEH 1HSAA 4M7ZC 4RIRA 3ZDZE 1ZS8A 1FNGA 3WIHH 2YKLL 1UH2A 3IAQA 3CC5B 3CXDH 4L3CB 3CXHJ 4IOIB 4PJ5E 3AREB 3BVNA 3AMLA 1U3JA 2P8PB 3ILQD 1QYGH 2R0ZL 3IU4H 4F9PA 3ZO0A 3TNNA 1PYWB 3RGVC 2OSLA 2OCFD 1A6WL 4EI5B 3GO1H 4LKCB 3NBNA 3B2UC 1KFAL 4WV1B 5HHMD 1VEPA 3SCMC 2FD6H 4Z7VE 4DUWA 3O8XA 1MF2L 1CFSB 4YAQB 5DQ9A 1A9BA 4Z5RA 5CBEB 1DUYB 4NKDA 3LH2L 3BEWA 3LQZB 1ACZA 3MRKB 1HNGA 2XWTA 4PRBA 2FO4A 4OZFA 4QOKB 3KLDA 3UTSB 1Q9LA 4WEUD 4ZFGH 3B2VL 4D0CB 3VXMB 1SBSL 3OF6A 5C0JA 5D2NB 3KPPB 5DO2C 3VJ6A 15C8L 5DFVC 1RZIB 4PYHA 5MERA 2JJWA 3MREB 3PP4L 4XPBL 1KJVB 4G8IB 3MGTA 4RRPG 1RSFA 4F3FA 2QSQA 3ILPA 3OAUL 3NCCB 4XCEB 3JSSA 2KQMA 2NY1D 4MAUH 1WC7A 4U1IA 2WP3T 4APQC 1INQA 4QHUA 4GXUN 3W9DB 9CGTA 2AQ1A 2DRUA 3O9WC 4LVOB 5E6IA 5AD0A 2IFFH 3UBXB 4FQQB 5DWUH 4RMTA 5GRVL 5HDBF 2GFBB 1S5IH 2WWMC 3S35H 4N0YH 4LF3A 5BXFB 5SWSA 3S9DB 3KPRB 3KPLA 3L5IA 3WD5L 2QR0B 2A9NH 4Z0XA 3RZCB 3M17A 4WTWA 1YYML 1ERNA 3N06B 3MYJA 3T2OA 2OLDA 4U1JA 4WCYH 3QQ9D 4LHUG 4N9OB 1HINL 1T66C 3RWCB 1A8JH 2G75A 3LN9A 3B9KC 4NO2A 1WIPA 4RMWA 4ZUTB 3JWNC 1DQQA 3AC0A 4P2OD 4X6DA 3QHZH 5E99L 5IHUL 1UYWH 2W38A 3FONB 3NIDE 3EOAA 3ARWA 4NCC2 4Y4FA 3B6SA 1JI1A 5F9OH 5IMMB 2GTZB 4G9FE 3MX0A 3QT2A 4GKSB 2VOTA 3QWRA 2EIEA 3QWOA 1INDH 2R2EA 2J8UA 4BSWB 2ADFH 2KZ1B 1ZHLA 3H7BB 1OWRM 1C5CL 1HWHB 3UTQA 1S7QA 3HUJF 2A6JB 5ERWB 4LPWA 3K2MC 1QNZL 5J9PB 2VSDA 3BD3A 3G6JA 1RIVL 4PG9B 1G9MH 1VFOA 2IBGA 3K2UH 1J0YA 3MGOA 1FVDA 3ARRA 3A0OA 2FHCA 3RFZC 4J6RH 3QUYD 2YUWA 4RAVB 2ZUTA 3SJVD 1FYTE 1AKJD 1D6EA 4OZGA 4GKZA 2CK0H 3VXRB 4XPGL 1OP9A 1PDKA 2WINA 3MV11 1FVCB 2GSGA 5EC1B 1MEXL 3V7AE 5I1DA 2BSRA 4LHUD 3T3ME 1XR8B 2ZKHL 3FHQA 3VCLB 1NL0H 3GBNL 1MRDL 1MCKA 1CGSH 4HWUA 5CP7B 2HLAA 5ICXB 3MV7B 3FN0L 2Q87A 3NA9L 1GIGH 3MRQB 4L3CA 3WNNA 4C4KO 3AREA 4H88H 2P8PA 2XFXB 4XHQA 3WNPA 5HYQB 1A22B 1NGWB 2V2TB 4XVJL 1PYWA 4WWKD 5CLWA 3WN5C 3BT2H 4EI5A 4ZYKB 4JREC 4JB9H 3BN3B 5AUMB 1X9QA 2YRLA 4JY4B 2JIXD 4XC3H 2AK4B 2M26A 4P23B 5IQ7H 3HG1E 3PGFH 4J1UA 2CDFB 3VGFA 4O2CB 3IRZA 3QULA 3STBA 3RY6C 5CBEA 4I18C 5BOZG 5KS9B 4QT5B 5GZOC 5IMKA 1C8PA 3LQZA 8CGTA 2XZCH 3N1QC 3MRKA 4XAWH 4MVBC 1L6XA 2VDPH 4MYWB 3UTSA 2VLLA 4XP1H 4P46D 4JY5L 3GM0A 3VXMA 4C56D 5HI4D 5IGXL 1OAUL 5EZOH 5D2NA 4JRYD 1MI5E 3KPPA 1A21A 4UV4L 4JQIH 5C09D 3TYFB 1YEJH 1RZIA 3FFDB 2M8XA 1IZKA 3V79C 2Y06H 2P5WB 2A83B 1KJVA 4G8IA 5FHBL 5FGSA 2MTPA 5AG9A 4WI9A 4L8CB 3CJJA 1DEEB 2LTQC 3RWIB 1MFDH 4YGVA 2BNQE 1M71B 2VSCA 3HI1A 3W9DA 3GKWL 1JF5A 3WXVH 3QZWB 4V1DB 5E1HB 3VXQB 1PX3A 3UBXA 2ITCB 4FQQA 1SHMA 1FL5B 4NQTA 5T33L 4WWID 1DSFL 1EHAA 3EDKA 4KDTC 3S36H 5BXFA 5D96C 4O2FB 2F53E 4BK5A 3KPRA 2L4OA 4EOWH 2A2QT 2QR0A 3RZCA 1GC1H 2WQRA 1I85C 3MRNA 4QHLA 4MNGE 3VXSD 4XNMB 3RPKA 2I24N 2GQHA 1CLYH 2AJVH 3G6DL 1CS6A 5CJOH 2HFTA 4F2MB 1R3KA 3RWCA 3ZHKA 4OZGF 4GRWF 1X5XA 4ZUTA 1R5WB 3MODH 1F4WL 1CFNB 1T83C 4FTVE 4DWHA 3FONA 1X5LA 2A9ML 3JUZA 3WFHB 3GJFH 2GTZA 2VXSL 2ZNWA 4GKSA 3L5XL 3SE3C 3SDXB 2MQ3A 1ZXQA 2FBJH 4AIXA 4BSWA 3LB6C 3H7BA 5INCB 5MI0C 1A5FH 3CZFA 4AEHL 5ERWA 5EOCJ 5J9PA 3WFDL 2B2XL 1TIUA 5MENE 2CRIA 4FRWA 3IDIB 2IBBA 2FX7H 2J88L 4HV8B 5GZND 1F13A 4I2XB 5FUZL 4RAVA 4FQHB 1XGYH 5DD5H 3VXRA 5AZ2H 1AO7A 1CFQB 1OSPL 1YDPB 1FVCA 5EC1A 1JPST 1MCWW 4OZIF 1MCQA 4LRIC 4EBQH 3ZDYF 4OUUA 4XPAH 4JFEA 1XR8A 1FDLH 1NJ9B 1KACB 3LHPH 2J2ZA 4ZXBC 4NO3B 4G6MH 1EGJA 3QUZB 2LU4A 5CP7A 3NZHL 3MV7A 5ICXA 1I9JL 2EDYA 2NLJA 4XTRD 4F8TA 2ESVE 5DJ8B 4NRXB 3BKMH 1DZBA 1VEMA 2G2RB 3MRQA 1LGVA 4GLRH 3HA0A 5F71A 4MXVE 2XFXA 3DYPA 5HYQA 1NGWA 4FQPA 1YY9C 2P1YA 1FZKB 3DGGB 3EFDH 1QRNB 4Z95H 2EIBA 3HNSH 4JY4A 3SDDD 3RAJH 2AK4A 3IFOB 4RWYH 5BS0E 4K3EH 3H9SD 4O2CA 4IIQC 4L4VD 1RUKH 3QHTC 5CILH 1JGDB 1TMCB 5KS9A 4ALAL 4NYLB 2PCPA 1QHPA 1YNLL 3N1PC 3UC0L 5FK9B 3QCUL 3QRGL 3TH4T 3VFSB 1UWGH 2DYPD 3BSZH 2VO5A 3BZDA 4D9LH 3T4YB 3GMPB 1JZ3A 2F74B 4KJWD 3GZKA 3FFDA 4P3CL 1KCLA 1NEZB 2ZJSL 4PJHE 5EBLB 4QTHB 5FYJU 4K7PX 2A83A 4X4YB 4CN1A 4X80L 4YHLL 4WFEE 5M7QA 4L8CA 2R0WH 5D9SB 1SVCP 5T5FL 1VGEH 3RWIA 4K8RD 2DF3A 5C0DB 1M71A 2V7HB 5EO9B 5CKGA 4HLZG 4O51B 3LCYA 5JW4R 2ITCA 2AGJH 4P5TB 1FL5A 1KLGB 3C60C 1FL6B 2HT4C 5D7JD 4BM7A 4O2FA 4XWOD 3RWFB 3C8DA 1ETZB 1BHGA 4IOFC 4ZFFA 2XKNB 1XZ0B 3EYOB 3ISWA 3VXUD 4R96B 1HXYB 1T04B 1BJ8A 3D69B 1TNMA 2OJZL 1G7JB 2XN9D 4PJEF 4CMHB 4F2MA 4WUUB 1FGVL 2ZG2A 3HE6D 1R5WA 4LARH 3KHQA 3SKUD 5I30L 3WFHA 4YDLB 4EUPH 1AR2A 1KENH 2QSCL 1HIMH 3AS3A 3CXHK 4LSRL 2ORBH 5INCA 3PV7A 3FAWA 4LKXB 2VISB 3V7MA 4U1SB 2AI0H 2E7MA 1U3ZA 5DD0H 5BZWB 4HS6B 2GTWB 3IDIA 4LLVB 5C07A 3BOVA 3DWTA 1H5BC 1DN2A 2P5EB 4HV8A 3JWDC 1SVZA 2NY0B 1DQJB 1PKQE 4FQHA 5T1MA 1CFQA 4YXLL 3FFCD 3QO1A 1YDPA 3SDCD 4TSCL 5KS9F 3SDAA 1W72A 5J1SC 1NJ9A 3CFDB 1SM3H 3SKNB 3BKCL 4NO3A 4WENB 4Q0XH 5BW7C 4O4YH 3QUZA 3REVB 5DJ8A 4ZO6A 4RA3A 4EVNB 4KMTL 4FA8A 5I1LB 1RZGA 2G2RA 2MMXA 4OLWH 1NCDH 3I9GL 5BVPL 1IKNC 1WICA 4L9LB 1X4ZA 2B0SL 3GJFK 3CFCH 2BNRE 4PGZA 1FZKA 3DGGA 1QRNA 4WI4A 4PJ8D 2XZZA 5E0QA 5KVGL 1PJ9A 5INDB 4LRNH 2W0FA 1MCOH 3IFOA 4NN7C 1NAMH 5GS0D 1H9VA 1ZLVH 3WO4B 1JGDA 2HN7B 5F7KC 1TVHB 1G7IB 2YHGA 1MCLA 1ZVHA 2X05A 4HPOL 3H9YA 5FK9A 1E4KC 1TQCB 3VFSA 3W9EB 3QEHB 1KCUH 1UZ6E 5IBUB 2X5PA 3O4LE 1NCWL 3T4YA 3GMPA 3GIZH 4ETYA 2CJUL 3IDMA 5TGBB 4HIHA 1NEZA 5CEZD 1BZ7A 3H8NA 3KPOB 4QTHA 5EBLA 3QCVH 5I2IB 3EYQD 4PY7B 2HG5B 4XNXH 3ZE2F 2BHUA 4LPYA 3RY4A 5D9SA 4A6YH 1R3IH 5C0CD 3SKMB 2D4FA 1YNKH 5C0DA 3MLVL 4TOYH 2V7HA 4HIIB 4NQCE 4UINH 5JDJA 1CF8L 5EO9A 1D9KC 2GJZA 2J4WL 3P0GB 3WXWL 5IESH 1MFEH 4O51A 3EO9L 2X70A 1Y6NR 2CXGA 2FX9L 2WWKO 4P5TA 1KLGA 3BN9C 3SDXF 2H2PC 1FL6A 3C8KB 5TE6L 3O3BA 1HQRB 2HKFL 1NLBH 5BCAA 3CFJB 1KYOK 3RTQC 2H3NB 3RWFA 4EZMA 6FABL 4YLQT 1ETZA 2XKNA 3EYOA 4R96A 4RMVA 1T04A 3GHEH 2YPVL 1RZJL 3D69A 4LPTA 5HHMB 1B2WH 1FHGA 3AU1B 5ANMB 1BIHA 1KPUB 1MJUL 5DXWA 3OKDB 1VEOA 3SEPA 4PV9A 4YWGL 5FCUL 2FJHB 1T0PB 2RIKA 3LVEA 1JHLH 3KLHD 2JELH 4JPWL 5E8PB 4PRAB 3U1SH 5FGBC 2Y5TB 4JJHA 2YD8A 4KKLD 1U95B 5EFIB 4DQOH 5HDQH 5SWZD 4U1SA 1V3LA 5BZWA 4HS6A 1QLRB 2VYRE 4HGWB 3S4SB 1FFOA 1ADQL 4DGIL 2P5EA 4PJGF 2NY5C 4OZHF 5EULV 3KLAB 4E41E 2NY1B 1DQJA 3ULSB 1JYWA 5F7DB 4KWUA 1LEGB 3VG0L 3KLSA 3CH8A 3LDBB 1P9MC 2GK2A 2A77L 3CFDA 5HTSA 2CLVA 2AJXH 3SHSA 3SKNA 3QUXB 2DL2A 2DM3A 2H1PL 2RQ8A 3UYRH 2DQTL 2FWOB 1P53A 4OF0A 2DI8A 2Q20A 4EVNA 4O9HL 4ZS7H 5I1LA 1P7KB 2B8OT 1KB5B 43CAB 3QDGE 5TF0A 2J7LA 2NY3C 5ELIA 2JJVA 5D72H 4HKBA 2AS5M 4LPUA 2HH0L 4XCYB 4P2OB 5INDA 1AD9B 4FABL 2UY7A 1WAAA 2QL1A 2MQ0A 4P57B 5IJVB 2JK5B 5DQDH 4Q9RL 4JQVC 4P5MB 3R4DA 1OPGH 1G0DA 2HN7A 4ETQB 5KW9L 1G7IA 5DRZB 4YEFA 5B39B 2CKBH 4NOBA 1ZKAA 3W9EA 3QEHA 1P4BL 1TTFA 1R3LA 3VMPA 4U6HB 5JIKA 2PETA 1MVUB 1S7SB 5I73B 4KTEL 3EW3B 1NBYB 3PE9A 5TGBA 1J0IA 5HYSG 2V2WB 4UT9L 3KPOA 4PJXB 5I2IA 1CLOL 3BPLB 4PY7A 2HG5A 1GSMA 3QUYB 5I1KL 3MLUH 5DC4B 1AKJB 2J1KA 4YHMH 4QHMB 25C8H 3RL2B 3VI3E 3SKMA 5GS0L 4LHUB 4HH8A 4HIIA 4NO0B 2DM4A 5GSVB 5E1AB 2GSIB 4OM0L 1RVFL 3A67H 4YO0B 2JF1A 1XGUA 3C8KA 2DQJH 3WUWG 4Y4KD 1AGDB 1HQRA 4WHDA 3QCTL 5IBLC 4DUVA 3PQYE 1RV6X 1ZLVK 1UEMA 3CFJA 3TF7C 2H3NA 4OTXH 5D8JL 4KPHL 4PJ7B 4WWKB 1NBVH 4TUKL 2R4SL 3PWJB 3QDME 5FECB 5L2KE 3GKZA 1SEQL 2JIXB 5JXED 2FB4L 4KRMB 1KEGL 4OV5A 3BWAB 3AU1A 1U92B 5ANMA 1KPUA 4N0CC 3OKDA 2EDFA 4Z7QE 5LCVL 5I15L 5J57B 2EDNA 5FXCH 1DN0B 1HE7A 2DQUH 4KMLB 1NFDB 1OL0A 4ODUB 1S7TB 1U41A 4JR9L 4P46B 4HKJB 2V5RA 2IPKB 4U2ZA 3MV9D 4PRAA 1CFVL 4JVPA 2FDBP 4JRYB 2Y5TA 5C09B 1QSFD 4YR6B 1OT1A 1U95A 5EBMB 5C0EB 3LKOB 1KIRB 4GKNA 1X6NA 3SDYH 3ULUD 4HF5L 2XQBH 5C0RL 3TT1H 3F58H 1QLRA 4QXUL 3S4SA 4JN1H 1U6AH 4ODWB 5EU6E 4MJ5B 5F96H 1K5NB 4LP5A 3KLAA 5A2LH 3BYTA 3ZE1E 3ULSA 5ADPH 1LEGA 1MPAH 4N8VB 1PKOA 4N5ED 3TBTB 5ID1B 1K9TA 4PGEB 1J18A 4Q9BA 3QEGH 2RCSH 3U7WL 3QUXA 3MLWH 1TETL 3T2NL 3IDXL 3OJVC 1RULL 4POZD 3WKMH 4GLRI 4TSAL 2YA2A 1YYLH 2FWOA 3VWKC 2ZUWA 4PJIA 4OF5A 1JL8A 3SE4A 4MNHB 3VXSB