1G7XA

Aspartate aminotransferase active site mutant n194a/r292l/r386l
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
396
structure length
396
Chain Sequence
b'MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHAPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAILANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGLVNVAGMTPDNMAPLCEAIVAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Strain is more important than electrostatic interaction in controlling the pKa of the catalytic group in aspartate aminotransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 133
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2000-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1g7xA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1g7xA01
2AY5A 3EI9A 4Q75A 2YKUA 3E6GA 3B46A 2V1PA 1SFFA 1P3WA 1M0PA 1C7GA 3ELPA 4GE7A 2D61A 2FM1A 4ZSWA 1BQDA 1WYTB 4N0WA 3TFUA 3QN6A 2Z67A 1IJIA 3CBFA 3IHJA 2JJFA 1RV4A 3BV0A 4HF8A 2V0YA 5D5SA 3EIAA 1CQ6A 1ASGA 4IXOA 4RM1A 4ADDA 4R5FA 4OBUA 1ASMA 1MDXA 2VIBA 3VK4A 1VP4A 3QPGA 3AV7A 3NUIA 4B98A 4N0BA 3W1IA 2JGTA 3GR9A 2W8JA 1FC4A 3NU7A 4TN4A 3VAXA 3BB8A 4JEYA 1IVRA 1ASAA 4OCAA 3N5MA 2ZJGA 3PDBA 4IXSA 1DJ9A 3AATA 4ZASA 2W8UA 3DXWA 1ASLA 2VGTA 2YCNA 4GE9A 2W7JA 3RBFA 4F4EA 3I5TA 3AEPA 5TF5A 4MQQA 1PFFA 3VP6A 3CQ4A 2X5DA 4ADCA 2W7FA 4W91A 1LW4A 4J5UA 1W7MA 4IY7A 2D63A 1BT4A 2YKYA 4WYFA 2VGUA 4WB0B 1BJWA 5BJ4A 2CJHA 1D2FA 4A72A 3FQAA 4IW7A 3L8AA 2TPLA 1CS1A 4FFCA 3LVJA 2ZC0A 3BCBA 2Z9XA 2CJDA 1UKJA 1X28A 4JF1A 1AMAA 1BJ4A 1S09A 1KKJA 4BMKA 2ZUKA 2HUIA 2W7EA 3PPLA 1E5FA 1ARTA 2W8WA 3PAAA 3PDXA 2QB3A 2BIEA 2YKXA 2W7KA 1AY5A 1WKGA 2EZ1A 1AHYA 4IX8A 4HVKA 4KYOA 5IWQA 1TOKA 4WXFA 1H0CA 3ZZKA 2VLFA 3BWNC 1O69A 4QGRA 3F0HA 4OYTA 3VK3A 4A0RA 5M46A 1B9IA 1CQ7A 2R5EA 2FN6A 4RAEA 5G4JA 1LC7A 5HDMA 4PVFA 1WYUA 1I29A 4F5KA 3GZCA 2R2NA 1ARSA 2VMWA 3AOWA 3E2FA 4WYGA 4RJYA 2OATA 3AEOA 1JS6A 1TARA 4P7YA 2DGLA 4LNMA 4WYDA 4MY5A 3WCOA 4ZM4A 3HLMA 5G09A 4Y0HA 3PDBB 4A6UA 2JJHA 1G4XA 4LNJA 4GRXA 1WYTA 3BWNA 1AICA 1OHWA 1RVUA 3MAFA 2CB1A 4XQ2A 1GEWA 3B1EA 2D65A 2HOYA 1QISA 2EZ2A 2ZYJA 2VMRA 3WZFA 4Y0DA 1M32A 4WLJA 4MSOA 5EUNA 1CL2A 3NRAA 1DFOA 3D6KA 1AY4A 1IX7A 1GC3A 1BJOA 2JG2A 5G2QA 5EUDA 3L44A 1SVVA 1MGVA 3E2ZA 2Z9UA 2VMPA 2D5YA 2D7ZA 1GEYA 2WK8A 3FTBA 1ASCA 4K2MA 1B5OA 1MAPA 2DOUA 1SZKA 4ADBA 2DKBA 4A0HA 4JF0A 2YKVA 3W1HA 3KGXA 2CY8A 4LW4A 2OGEA 3FD0A 1O61A 3QM2A 4WD2A 4ZWMA 4W1VA 3AOVA 2HOXA 3JTXA 1ASBA 3G7QA 2E54A 2AY1A 2QLRA 3USFA 3HQTA 2X8UA 3MEBA 2HP1A 3B1CA 1C9CA 1W3UA 2CFBA 4EFFA 4WB0A 5DJ9A 3KKIA 4XJPA 2CSTA 1VEFA 3RI6A 5M49A 5HHYA 1WYUB 4GE4A 4H51A 4UHMA 1LK9A 1CJ0A 2RFVA 1KL1A 2AY7A 3DZZA 1SZUA 2X3LA 1JG8A 3JWBA 1UU0A 2BI9A 5EUEA 3F9TA 1SPAA 2VMYA 5LHAA 1T3IA 4ZLVA 1D7SA 4F5FA 2D7YA 3NDNA 1MLYA 3MAFB 4Q31A 1AKCA 4OMAA 2OQXA 1X29A 4A6RA 4R8DA 1N8PA 1TOEA 4GDYA 5FT6A 2AY3A 3NUBA 4CBSA 2ZY2A 3N0LA 3AENB 4AO4A 3EI6A 3I16A 3FFRA 4UHNA 4AH3A 2ZP7A 1WKHA 3PIUA 1DJEA 3OP7A 3FVUA 1AKAA 1MAQA 2R5CB 1BJOB 5E5IA 4OBVA 1B8GA 4ZWVA 3E2ZB 3HBXA 3GBXA 4Q76A 3A9XA 1YJSA 2QA3A 4JEVA 8AATA 1JF9A 1IX6A 5EIGB 2DR1A 3LVMA 5FT8A 1W7NA 2HUFA 3MKJA 1EQBA 4W1XA 3FQ7A 5G2PA 2BI2A 4IXZA 1H1CA 1AKBA 4DBCA 1M0OA 1ELQA 3FVSA 3EI7A 7AATA 1RV3A 1EG5A 3GETA 3NYSA 2VGWA 4ATPA 3TCMA 3A9ZA 2OKKA 1DKAA 1G7XA 2FQ6A 4E1OA 2VMTA 1S0AA 4OTLA 3MADA 1KL2A 2E7JA 1N2TA 4JEWA 1C4KA 1TPLA 1YOOA 2AATA 3BN1A 4WYEA 1ZOBA 2BIGA 1DJUA 4A0FA 1M0NA 2C7TA 3FCRA 1AHEA 1Z7DA 3NYTA 3ZRPA 2Z61A 3ZZJA 2CJGA 3ASAA 1ARHA 3DC1A 3JU7A 3RUYA 3FZ6A 4XAUA 1GC0A 1YIYA 4EU1A 1AX4A 1C0NA 1XI9A 2YCTA 3A2BA 1BJNA 1ECXA 1LC5A 2W8VA 2PB0A 2X5FA 2ZY3A 4IYOA 3LVKA 2FNIA 1V2EA 1M0QA 3ZRQA 4AZKA 4AZJA 4LC3A 2XH1A 2BYJA 3RQ1A 2AY4A 9AATA 3UAKA 2VMVA 3WGCA 4F5IA 1TATA 4JEXA 3JW9A 1V2FA 1C7NA 1W7LA 2DGMA 2WK9A 3EI5A 4RKCA 1G4VA 4CXRA 2GMSA 1M7YA 2W7IA 3HL2A 2HORA 5BJ3A 1QIRA 4RLGA 3TFTA 1MLZA 1GEXA 3ACZA 5M4BA 3EZ1A 4RJ0A 3IF2A 1O4SA 4P3MA 3B1DA 2VI8A 3DXVA 2GMUA 2BWOA 2AY6A 3CQ5A 5F9SA 2Q7WA 3HMUA 4F5HA 4BQ0A 4M2KA 3WX9A 4LNLA 2BYLA 5D95A 3WGBA 2VMOA 2R0TA 1EJIA 3DRDA 3DU4A 2GSAA 1Y4IA 3E77A 1XEYA 2O0RA 4RKDA 3AENA 3ZRRA 5M4DA 1TOIA 2EGYA 3P1TA 1ARIA 1GD9A 3AEJC 2Z9VA 4GSAA 4W5KA 1ARGA 3E9KA 3PD6B 4ZDPA 3B8XA 2R5CA 4LW2A 2W7LA 3MC6C 4DGTA 5FT4A 2HZPA 1PG8A 1UU1A 3FQ8A 4W1WA 1W23A 1I41A 4ATQA 1SF2A 1ZODA 5EIGA 1IX8A 2G6WA 2HP2A 3ASBA 3DODA 1DGEA 3W1JA 1QGNA 1AIAA 3FRKA 3E2YA 3EIBA 1YJYA 3LG0A 4UOYA 2AEUA 5FT5A 5C6UA 3HT4A 3R4TA 2AEVA 4BHDA 4IYOB 3LVLB 3K28A 3OKSA 3MC6A 5JAYA 2OGAA 3RBLA 4NOGA 3EUCA 1E5EA 3NX3A 2C0RA 3GJUA 3ISLA 3KE3A 3PA9A 4I8AA 2ORDA 3EI8A 4KAMA 2EPJA 4TV7A 4Q6RA 4XJMA 4EB5A 1BQAA 2VMSA 3VK2A 3BCXA 3FFHA 1CL1A 3K40A 4XK1A 1AMRA 2Z9WA 4ZDOA 3RCHB 1GBNA 1LW5A 2EO5A 1GC2A 3VOMA 2HUUA 2F8JA 4ZSYA 1GDEA 3BCAA 1YJZA 1PMMA 4XJLA 5EAVA 1TASA 1G7WA 2BI5A 2CTZA 2JISA 4A0GA 2JJEA 4JE5A 3ATHA 1QJ5A 1LKCA 4F5GA 1MDOA 1TOGA 4J8LA 3UWCA 4WYCA 2O1BA 4EMYA 1O62A 3QHXA 1N31A 1QJ3A 2AY8A 2BI1A 2CANA 5EFSA 2W7GA 2AY2A 2BKWA 4E3RA 1FG7A 3BC8A 1AHGA 4K2IA 5J8QA 4JEZA 1I48A 2PO3A 3AEMC 1OXPA 3LV2A 4PFFA 2WKAA 2GB3A 4CXQA 2W8TA 1FG3A 4A00A 3WY7A 2VGSA 3DR4A 3ELEA 4OC9A 4L0OA 4ISYA 3II0A 2E7UA 2VGZA 3FZ8A 4E3QA 3NYUA 4FL0A 3NU8A 2FYFA 4MKJA 4Y0IA 4RIZA 1YNUA 2PB2A 4UQVA 1D7RA 2VIAA 3FZ7A 2YRIA 3AEMA 3I4JA 4PFNA 2CH2A 3PD6A 3PGYA 2OKJA 4MKKA 4ZM3A 3WLXA 2DGKA 1BS0A 5K8BA 2QMAA 2GQNA 3CQ6A 1X2AA 1WYVB 1OHYA 1AHXA 1AJRA 2Z1YA 4JE5D 1V2DA 2BHXA 4MQPA 2JJGA 1ASEA 1CZEA 4XEWA 5EQCA 3TATA 4XJOA 1J32A 1IBJA 1V72A 2VMUA 3HVYA 1VJOA 5E3KA 2VYCA 3A9YA 2W7MA 4B9BA 3TQXA 1D7VA 1IAYA 5I92A 2ZY4A 3JZLA 4CVQA 1AY8A 4F5MA 1GC4A 3FDBA 4A6TA 3T32A 3GWPA 3MAUA 1B9HA 2ZSLA 3A8UX 2VLHA 2XBNA 5LH9A 1U08A 2CH1A 3NNKA 4ITXA 5G4IA 2VMXA 4ADEA 1ASFA 1SZSA 2BIAA 4KXKA 5F8VA 3FDDA 4F5JA 2BI3A 1ZC9A 3GSBA 4WXBA 3LWSA 3BWOA 2VMZA 1J04A 3DR7A 3HDOA 3RCHA 2C81A 4ZDLA 3R9AA 2ZSMA 2ZY5A 1ASDA 1OHVA 1ORDA 1AJSA 1KMKA 3LY1A 3QGUA 1IAXA 2YOBA 4AOAA 3JWAA 1BW0A 3FKDA 4WBTA 1YAAA 4TMRA 4WXGA 5DJ1A 2W7HA 1M4NA 3QBOA 5HXXA 1BKGA 1LC8A 1RVYA 2HOZA 1OXOA 5AX8A 1DGDA 1TOJA 4F5LA 1AIBA 4OT8A 3G0TA 4O6ZA 5E4ZA 3FSLA 1D7UA 3BS8A 2YCPA 3MBBA 3GZDC 1AMSA 4W8IA 1C7OA 1AAMA 1QITA 2DKJA 2NMPA 1I43A 3N75A 2EH6A 2QBTA 3PJ0A 4K2BA 2FNUA 2C44A 5DB5A 1CZCA 4WYAA 3COGA 3WCNA 1B4XA 1UU2A 1DTYA 3G8MA 4BA5A 3CAIA 4R2NA 4WP0A 2O7CA 1GCKA 2VMNA 1YIZA 4U1TA 3AEJA 4RITA 1M6SA 3GZDA 4PIWA 3H14A 2VGVA 2D66A 1KMJA 2D64A 2VI9A 3QI6A 5G0AA 3F6TA 4R5ZA 4M2JA 3P6KA 4CBRA 1S06A 1JS3A 4GEBA 1QZ9A 1AAWA 4MGRA 1X0MA 1Z3ZA 1AHFA 1WYVA 3EZSA 4U2HA 1AMQA 2E7IA 4ZAHA 1S07A 1PMOA 2Z1ZA 4M2MA 3K7YA 4E77A 1ASNA 1WSTA 5EAAA 1S08A 2YRRA 2BWPA 2Z20A 1AJSB 4MQRA 3FVXA 3H7FA 2BWNA 2YHKA 3Q8NA 2VMQA 3KGWA 3NTJA 1LS3A 2AY9A 4ITGA 1IUGA 5DX5A 4BA4A 3ECDA 2CINA 4WLHA 1KKPA 3WKRA 3AELA 2WK7A 1CQ8A 3M5UA 1B5PA 3WKSA 4UHOA 3UE8A 4AO9A 3DYDA 1ELUA 2QB2A 2W7DA 4EB7A 1OATA 1MDZA 4DQ6A
chains in the Genus database with same CATH superfamily
2AY5A 3EI9A 4Q75A 2YKUA 3E6GA 3B46A 2V1PA 1SFFA 1P3WA 1M0PA 1C7GA 3ELPA 4GE7A 2D61A 2FM1A 4ZSWA 2A1VA 1BQDA 1WYTB 4N0WA 3TFUA 3QN6A 2Z67A 1IJIA 3CBFA 3IHJA 2JJFA 1RV4A 3BV0A 4HF8A 2V0YA 5D5SA 3EIAA 1CQ6A 1ASGA 4IXOA 4RM1A 4ADDA 4R5FA 4OBUA 1ASMA 1MDXA 2VIBA 3VK4A 1VP4A 3QPGA 3AV7A 3NUIA 4B98A 4N0BA 3W1IA 2JGTA 3GR9A 2W8JA 1FC4A 3NU7A 4TN4A 3VAXA 3BB8A 4JEYA 1IVRA 1ASAA 4OCAA 3N5MA 2ZJGA 3PDBA 4IXSA 1DJ9A 3AATA 4ZASA 2W8UA 3DXWA 1ASLA 2VGTA 2YCNA 4GE9A 2W7JA 3RBFA 4F4EA 3I5TA 3AEPA 5TF5A 4MQQA 1PFFA 3VP6A 3CQ4A 2X5DA 4ADCA 2W7FA 4W91A 1LW4A 4J5UA 1W7MA 4IY7A 2D63A 1BT4A 2YKYA 4WYFA 2VGUA 4WB0B 1BJWA 5BJ4A 2CJHA 1D2FA 4A72A 3FQAA 4IW7A 3L8AA 2TPLA 1CS1A 4FFCA 3LVJA 2ZC0A 3BCBA 2Z9XA 2CJDA 1UKJA 1X28A 4JF1A 1AMAA 1BJ4A 1S09A 1KKJA 4BMKA 2ZUKA 2HUIA 2W7EA 3PPLA 1E5FA 1ARTA 2W8WA 3PAAA 3PDXA 2QB3A 2BIEA 4K05A 2YKXA 2W7KA 1AY5A 1WKGA 2EZ1A 1AHYA 4IX8A 4HVKA 4KYOA 5IWQA 1TOKA 4WXFA 1H0CA 3ZZKA 2VLFA 3BWNC 1O69A 4QGRA 3F0HA 4OYTA 3VK3A 4A0RA 5M46A 1B9IA 1CQ7A 2R5EA 2FN6A 4RAEA 5G4JA 1LC7A 5HDMA 4PVFA 1WYUA 1I29A 4F5KA 3GZCA 2R2NA 1ARSA 2VMWA 3AOWA 3E2FA 4WYGA 4RJYA 2OATA 3AEOA 1JS6A 1TARA 4P7YA 2DGLA 4LNMA 4WYDA 4MY5A 3WCOA 4ZM4A 3HLMA 5G09A 4Y0HA 3PDBB 4A6UA 2JJHA 1G4XA 4LNJA 4GRXA 1WYTA 3BWNA 1AICA 1OHWA 1RVUA 3MAFA 2CB1A 4XQ2A 1GEWA 3B1EA 2D65A 2HOYA 1QISA 2EZ2A 2ZYJA 2VMRA 3WZFA 4Y0DA 1M32A 4WLJA 4MSOA 5EUNA 1CL2A 3NRAA 1DFOA 3D6KA 1AY4A 1IX7A 1GC3A 1BJOA 2JG2A 5G2QA 5EUDA 3L44A 1SVVA 1MGVA 3E2ZA 2Z9UA 2VMPA 2D5YA 2D7ZA 1GEYA 2WK8A 3FTBA 1ASCA 4K2MA 1B5OA 1MAPA 2DOUA 1SZKA 4ADBA 2DKBA 4A0HA 4JF0A 2YKVA 3W1HA 3KGXA 2CY8A 4LW4A 2OGEA 3FD0A 1O61A 3QM2A 4WD2A 4ZWMA 4W1VA 3AOVA 2HOXA 3JTXA 1ASBA 3G7QA 2E54A 2AY1A 2QLRA 3USFA 3HQTA 2X8UA 3MEBA 2HP1A 3B1CA 5KTBA 1C9CA 1W3UA 2CFBA 4EFFA 4WB0A 5DJ9A 3N7NA 3KKIA 4XJPA 2CSTA 1VEFA 3RI6A 5M49A 5HHYA 1WYUB 4GE4A 4H51A 4UHMA 1LK9A 1CJ0A 2RFVA 1KL1A 2AY7A 3DZZA 1SZUA 2X3LA 1JG8A 3JWBA 1UU0A 2BI9A 5EUEA 3F9TA 1SPAA 2VMYA 5LHAA 1T3IA 4ZLVA 1D7SA 4F5FA 2D7YA 3N4XA 3NDNA 1MLYA 3MAFB 4Q31A 1AKCA 4OMAA 2OQXA 1X29A 4A6RA 4R8DA 1N8PA 1TOEA 4GDYA 5FT6A 2AY3A 3NUBA 4CBSA 3N4SA 2ZY2A 3N0LA 3AENB 4AO4A 3EI6A 3I16A 3FFRA 4UHNA 4AH3A 2ZP7A 1WKHA 3PIUA 1DJEA 3OP7A 3FVUA 1AKAA 2G7JA 1MAQA 2R5CB 1BJOB 5E5IA 2EYQA 4OBVA 1B8GA 4ZWVA 3E2ZB 3HBXA 3GBXA 4Q76A 3A9XA 1YJSA 2QA3A 4JEVA 8AATA 1JF9A 1IX6A 5EIGB 2DR1A 3LVMA 5FT8A 1W7NA 2HUFA 3MKJA 1EQBA 4W1XA 3FQ7A 5G2PA 2BI2A 4IXZA 1H1CA 1AKBA 4DBCA 1M0OA 1ELQA 3FVSA 3EI7A 7AATA 1RV3A 2WB6A 1EG5A 3GETA 3NYSA 2VGWA 4H63Q 4ATPA 3TCMA 3A9ZA 2OKKA 1DKAA 1G7XA 2FQ6A 4E1OA 2VMTA 1S0AA 4OTLA 3MADA 1KL2A 2E7JA 1N2TA 4JEWA 1C4KA 1TPLA 1YOOA 2AATA 3BN1A 4WYEA 1ZOBA 2BIGA 1DJUA 4A0FA 2KFPA 1M0NA 2C7TA 3FCRA 1AHEA 1Z7DA 3NYTA 3ZRPA 2Z61A 3ZZJA 2CJGA 3ASAA 1ARHA 3DC1A 3JU7A 3RUYA 3FZ6A 4XAUA 1GC0A 1YIYA 4EU1A 1AX4A 1C0NA 1XI9A 2YCTA 3A2BA 1BJNA 1ECXA 1LC5A 2W8VA 3N4RA 2PB0A 2X5FA 2ZY3A 4IYOA 3LVKA 2FNIA 1V2EA 1M0QA 3ZRQA 4AZKA 4AZJA 4LC3A 2XH1A 2BYJA 3RQ1A 1KAFA 2AY4A 9AATA 3UAKA 2VMVA 3WGCA 4F5IA 1TATA 4JEXA 3JW9A 1V2FA 1C7NA 1W7LA 2DGMA 2WK9A 3EI5A 4RKCA 1G4VA 4CXRA 2GMSA 1M7YA 2W7IA 3HL2A 2HORA 5BJ3A 1QIRA 4RLGA 3TFTA 1MLZA 1GEXA 3ACZA 5M4BA 3EZ1A 4RJ0A 3IF2A 1O4SA 4P3MA 3B1DA 2VI8A 3DXVA 2GMUA 2BWOA 2AY6A 3CQ5A 5F9SA 2Q7WA 3HMUA 4F5HA 4BQ0A 4M2KA 3WX9A 4LNLA 2BYLA 5D95A 3WGBA 2VMOA 2R0TA 1EJIA 3DRDA 3DU4A 2GSAA 1Y4IA 3E77A 1XEYA 2O0RA 4RKDA 3AENA 3ZRRA 5M4DA 1TOIA 2EGYA 3P1TA 1ARIA 1GD9A 3AEJC 2Z9VA 4GSAA 4W5KA 1ARGA 3E9KA 3PD6B 4ZDPA 3B8XA 2R5CA 4LW2A 2QSRA 2W7LA 3MC6C 4DGTA 5FT4A 2HZPA 1PG8A 1UU1A 3FQ8A 4W1WA 1W23A 1I41A 4ATQA 1SF2A 1ZODA 5EIGA 1IX8A 2G6WA 2HP2A 3ASBA 3DODA 1DGEA 3W1JA 1QGNA 1AIAA 3FRKA 3E2YA 3EIBA 1YJYA 3LG0A 3H9XA 4UOYA 2AEUA 5FT5A 5C6UA 3HT4A 3R4TA 2AEVA 4BHDA 4IYOB 3LVLB 3K28A 3OKSA 3MC6A 5JAYA 2OGAA 3RBLA 4NOGA 3EUCA 1E5EA 3NX3A 2C0RA 3GJUA 3ISLA 3KE3A 3PA9A 4I8AA 2ORDA 3EI8A 4KAMA 2EPJA 4TV7A 4Q6RA 4XJMA 4EB5A 1BQAA 2VMSA 3VK2A 3BCXA 3FFHA 1CL1A 3K40A 4XK1A 1AMRA 2Z9WA 4ZDOA 3RCHB 1GBNA 1LW5A 2EO5A 1GC2A 3VOMA 2HUUA 2F8JA 4ZSYA 1GDEA 3BCAA 1YJZA 1PMMA 4XJLA 5EAVA 1TASA 1G7WA 2BI5A 2CTZA 2JISA 4A0GA 2JJEA 4JE5A 3ATHA 1QJ5A 1LKCA 4F5GA 1MDOA 1TOGA 4J8LA 3UWCA 4WYCA 2O1BA 4EMYA 1O62A 3QHXA 1N31A 1QJ3A 2AY8A 2BI1A 2CANA 5EFSA 2W7GA 2AY2A 2BKWA 4E3RA 1FG7A 3BC8A 1AHGA 4K2IA 5J8QA 4JEZA 1I48A 2PO3A 3AEMC 1OXPA 3LV2A 4PFFA 2WKAA 2GB3A 4CXQA 2W8TA 1FG3A 4A00A 3WY7A 2VGSA 3DR4A 3ELEA 4OC9A 4L0OA 4ISYA 3II0A 2E7UA 2VGZA 3FZ8A 4E3QA 3NYUA 4FL0A 3NU8A 2FYFA 4MKJA 4Y0IA 4RIZA 1YNUA 2PB2A 4UQVA 1D7RA 2VIAA 3FZ7A 2YRIA 3AEMA 3I4JA 4PFNA 2CH2A 3PD6A 3PGYA 2OKJA 4MKKA 4ZM3A 3WLXA 2DGKA 1BS0A 5K8BA 2QMAA 2GQNA 3CQ6A 1X2AA 1WYVB 1OHYA 1AHXA 1AJRA 2Z1YA 4JE5D 1V2DA 2BHXA 4MQPA 2JJGA 1ASEA 1CZEA 4XEWA 5EQCA 3TATA 4XJOA 1J32A 1IBJA 1V72A 2VMUA 3HVYA 1VJOA 5E3KA 2VYCA 3A9YA 2W7MA 4B9BA 3TQXA 1D7VA 1IAYA 5I92A 2ZY4A 3JZLA 4CVQA 1AY8A 4F5MA 1GC4A 3FDBA 4A6TA 3T32A 3GWPA 3MAUA 1B9HA 2ZSLA 3A8UX 2VLHA 2XBNA 5LH9A 1U08A 2CH1A 3NNKA 4ITXA 5G4IA 2VMXA 4ADEA 1ASFA 1SZSA 2BIAA 4KXKA 5F8VA 3FDDA 4F5JA 2BI3A 1ZC9A 3GSBA 4WXBA 3LWSA 3BWOA 2VMZA 1J04A 3DR7A 3HDOA 3RCHA 2C81A 4ZDLA 3R9AA 2ZSMA 2ZY5A 1ASDA 1OHVA 1ORDA 1AJSA 1KMKA 3LY1A 3QGUA 1IAXA 2YOBA 4AOAA 3JWAA 1BW0A 3FKDA 4WBTA 1YAAA 4TMRA 4WXGA 5DJ1A 2W7HA 1M4NA 3QBOA 5HXXA 1BKGA 1LC8A 1RVYA 2HOZA 1OXOA 5AX8A 1DGDA 1TOJA 4F5LA 1AIBA 4OT8A 3G0TA 4O6ZA 5E4ZA 3FSLA 1D7UA 3BS8A 2YCPA 3MBBA 3GZDC 1AMSA 4W8IA 1C7OA 1AAMA 1QITA 2DKJA 2NMPA 1I43A 3N75A 2EH6A 2QBTA 3PJ0A 4K2BA 2FNUA 2C44A 5DB5A 1CZCA 4WYAA 3COGA 3WCNA 1B4XA 1UU2A 1DTYA 3G8MA 4BA5A 3CAIA 4R2NA 4WP0A 2O7CA 1GCKA 2VMNA 1YIZA 4U1TA 3AEJA 4RITA 1M6SA 3GZDA 4PIWA 3H14A 2VGVA 2D66A 1KMJA 2D64A 2VI9A 3QI6A 5G0AA 3F6TA 4R5ZA 4M2JA 3P6KA 4CBRA 1S06A 1JS3A 4GEBA 1QZ9A 2FKIA 1AAWA 4MGRA 1X0MA 1Z3ZA 1AHFA 1WYVA 3EZSA 4U2HA 1AMQA 2E7IA 4ZAHA 1S07A 1PMOA 2Z1ZA 4M2MA 3K7YA 4E77A 1ASNA 1WSTA 5EAAA 1S08A 2YRRA 2BWPA 2Z20A 1AJSB 4MQRA 3FVXA 3H7FA 2BWNA 2YHKA 3Q8NA 2VMQA 3KGWA 3NTJA 1LS3A 2AY9A 4ITGA 1IUGA 5DX5A 4BA4A 3ECDA 2CINA 4WLHA 1KKPA 3WKRA 3AELA 2WK7A 1CQ8A 3M5UA 1B5PA 3WKSA 4UHOA 3UE8A 4AO9A 3DYDA 1ELUA 2QB2A 2W7DA 4EB7A 1OATA 1MDZA 4DQ6A
chains in the Genus database with same CATH topology
2AY5A 3EI9A 4Q75A 2YKUA 3E6GA 3B46A 2V1PA 1SFFA 1P3WA 1M0PA 1C7GA 3ELPA 4GE7A 2D61A 2FM1A 4ZSWA 2A1VA 1BQDA 1WYTB 4N0WA 3TFUA 3QN6A 2Z67A 1IJIA 3CBFA 3IHJA 2JJFA 1RV4A 3BV0A 4HF8A 2V0YA 5D5SA 3EIAA 1CQ6A 1ASGA 4IXOA 4RM1A 4ADDA 4R5FA 4OBUA 1ASMA 1MDXA 2VIBA 3VK4A 1VP4A 3QPGA 3AV7A 3NUIA 4B98A 4N0BA 3W1IA 2JGTA 3GR9A 2W8JA 1FC4A 3NU7A 4TN4A 3VAXA 3BB8A 4JEYA 1IVRA 1ASAA 4OCAA 3N5MA 2ZJGA 3PDBA 4IXSA 1DJ9A 3AATA 4ZASA 2W8UA 3DXWA 1ASLA 2VGTA 2YCNA 4GE9A 2W7JA 3RBFA 4F4EA 3I5TA 3AEPA 5TF5A 4MQQA 1PFFA 3VP6A 3CQ4A 2X5DA 4ADCA 2W7FA 4W91A 1LW4A 4J5UA 1W7MA 4IY7A 2D63A 1BT4A 2YKYA 4WYFA 2VGUA 4WB0B 1BJWA 5BJ4A 2CJHA 1D2FA 4A72A 3FQAA 4IW7A 3L8AA 2TPLA 1CS1A 4FFCA 3LVJA 2ZC0A 3BCBA 2Z9XA 2CJDA 1UKJA 1X28A 4JF1A 1AMAA 1BJ4A 1S09A 1KKJA 4BMKA 2ZUKA 2HUIA 2W7EA 3PPLA 1E5FA 1ARTA 2W8WA 3PAAA 3PDXA 2QB3A 2BIEA 4K05A 2YKXA 2W7KA 1AY5A 1WKGA 2EZ1A 1AHYA 4IX8A 4HVKA 4KYOA 5IWQA 1TOKA 4WXFA 1H0CA 3ZZKA 2VLFA 3BWNC 1O69A 4QGRA 3F0HA 4OYTA 3VK3A 4A0RA 5M46A 1B9IA 1CQ7A 2R5EA 2FN6A 4RAEA 5G4JA 1LC7A 5HDMA 4PVFA 1WYUA 1I29A 4F5KA 3GZCA 2R2NA 1ARSA 2VMWA 3AOWA 3E2FA 4WYGA 4RJYA 2OATA 3AEOA 1JS6A 1TARA 4P7YA 2DGLA 4LNMA 4WYDA 4MY5A 3WCOA 4ZM4A 3HLMA 5G09A 4Y0HA 3PDBB 4A6UA 2JJHA 1G4XA 4LNJA 4GRXA 1WYTA 3BWNA 1AICA 1OHWA 1RVUA 3MAFA 2CB1A 4XQ2A 1GEWA 3B1EA 2D65A 2HOYA 1QISA 2EZ2A 2ZYJA 2VMRA 3WZFA 4Y0DA 1M32A 4WLJA 4MSOA 5EUNA 1CL2A 3NRAA 1DFOA 3D6KA 1AY4A 1IX7A 1GC3A 1BJOA 2JG2A 5G2QA 5EUDA 3L44A 1SVVA 1MGVA 3E2ZA 2Z9UA 2VMPA 2D5YA 2D7ZA 1GEYA 2WK8A 3FTBA 1ASCA 4K2MA 1B5OA 1MAPA 2DOUA 1SZKA 4ADBA 2DKBA 4A0HA 4JF0A 2YKVA 3W1HA 3KGXA 2CY8A 4LW4A 2OGEA 3FD0A 1O61A 3QM2A 4WD2A 4ZWMA 4W1VA 3AOVA 2HOXA 3JTXA 1ASBA 3G7QA 2E54A 2AY1A 2QLRA 3USFA 3HQTA 2X8UA 3MEBA 2HP1A 3B1CA 5KTBA 1C9CA 1W3UA 2CFBA 4EFFA 4WB0A 5DJ9A 3N7NA 3KKIA 4XJPA 2CSTA 1VEFA 3RI6A 5M49A 5HHYA 1WYUB 4GE4A 4H51A 4UHMA 1LK9A 1CJ0A 2RFVA 1KL1A 2AY7A 3DZZA 1SZUA 2X3LA 1JG8A 3JWBA 1UU0A 2BI9A 5EUEA 3F9TA 1SPAA 2VMYA 5LHAA 1T3IA 4ZLVA 1D7SA 4F5FA 2D7YA 3N4XA 3NDNA 1MLYA 3MAFB 4Q31A 1AKCA 4OMAA 2OQXA 1X29A 4A6RA 4R8DA 1N8PA 1TOEA 4GDYA 5FT6A 2AY3A 3NUBA 4CBSA 3N4SA 2ZY2A 3N0LA 3AENB 4AO4A 3EI6A 3I16A 3FFRA 4UHNA 4AH3A 2ZP7A 1WKHA 3PIUA 1DJEA 3OP7A 3FVUA 1AKAA 2G7JA 1MAQA 2R5CB 1BJOB 5E5IA 2EYQA 4OBVA 1B8GA 4ZWVA 3E2ZB 3HBXA 3GBXA 4Q76A 3A9XA 1YJSA 2QA3A 4JEVA 8AATA 1JF9A 1IX6A 5EIGB 2DR1A 3LVMA 5FT8A 1W7NA 2HUFA 3MKJA 1EQBA 4W1XA 3FQ7A 5G2PA 2BI2A 4IXZA 1H1CA 1AKBA 4DBCA 1M0OA 1ELQA 3FVSA 3EI7A 7AATA 1RV3A 2WB6A 1EG5A 3GETA 3NYSA 2VGWA 4H63Q 4ATPA 3TCMA 3A9ZA 2OKKA 1DKAA 1G7XA 2FQ6A 4E1OA 2VMTA 1S0AA 4OTLA 3MADA 1KL2A 2E7JA 1N2TA 4JEWA 1C4KA 1TPLA 1YOOA 2AATA 3BN1A 4WYEA 1ZOBA 2BIGA 1DJUA 4A0FA 2KFPA 1M0NA 2C7TA 3FCRA 1AHEA 1Z7DA 3NYTA 3ZRPA 2Z61A 3ZZJA 2CJGA 3ASAA 1ARHA 3DC1A 3JU7A 3RUYA 3FZ6A 4XAUA 1GC0A 1YIYA 4EU1A 1AX4A 1C0NA 1XI9A 2YCTA 3A2BA 1BJNA 1ECXA 1LC5A 2W8VA 3N4RA 2PB0A 2X5FA 2ZY3A 4IYOA 3LVKA 2FNIA 1V2EA 1M0QA 3ZRQA 4AZKA 4AZJA 4LC3A 2XH1A 2BYJA 3RQ1A 2AY4A 9AATA 3UAKA 2VMVA 3WGCA 4F5IA 1TATA 4JEXA 3JW9A 1V2FA 1C7NA 1W7LA 2DGMA 2WK9A 3EI5A 4RKCA 1G4VA 4CXRA 2GMSA 1M7YA 2W7IA 3HL2A 2HORA 5BJ3A 1QIRA 4RLGA 3TFTA 1MLZA 1GEXA 3ACZA 5M4BA 3EZ1A 4RJ0A 3IF2A 1O4SA 4P3MA 3B1DA 2VI8A 3DXVA 2GMUA 2BWOA 2AY6A 3CQ5A 5F9SA 2Q7WA 3HMUA 4F5HA 4BQ0A 4M2KA 3WX9A 4LNLA 2BYLA 5D95A 3WGBA 2VMOA 2R0TA 1EJIA 3DRDA 3DU4A 2GSAA 1Y4IA 3E77A 1XEYA 2O0RA 4RKDA 3AENA 3ZRRA 5M4DA 1TOIA 2EGYA 3P1TA 1ARIA 1GD9A 3AEJC 2Z9VA 4GSAA 4W5KA 1ARGA 3E9KA 3PD6B 4ZDPA 3B8XA 2R5CA 4LW2A 2QSRA 2W7LA 3MC6C 4DGTA 5FT4A 2HZPA 1PG8A 1UU1A 3FQ8A 4W1WA 1W23A 1I41A 4ATQA 1SF2A 1ZODA 5EIGA 1IX8A 2G6WA 2HP2A 3ASBA 3DODA 1DGEA 3W1JA 1QGNA 1AIAA 3FRKA 3E2YA 3EIBA 1YJYA 3LG0A 3H9XA 4UOYA 2AEUA 5FT5A 5C6UA 3HT4A 3R4TA 2AEVA 4BHDA 4IYOB 3LVLB 3K28A 3OKSA 3MC6A 5JAYA 2OGAA 3RBLA 4NOGA 3EUCA 1E5EA 3NX3A 2C0RA 3GJUA 3ISLA 3KE3A 3PA9A 4I8AA 2ORDA 3EI8A 4KAMA 2EPJA 4TV7A 4Q6RA 4XJMA 4EB5A 1BQAA 2VMSA 3VK2A 3BCXA 3FFHA 1CL1A 3K40A 4XK1A 1AMRA 2Z9WA 4ZDOA 3RCHB 1GBNA 1LW5A 2EO5A 1GC2A 3VOMA 2HUUA 2F8JA 4ZSYA 1GDEA 3BCAA 1YJZA 1PMMA 4XJLA 5EAVA 1TASA 1G7WA 2BI5A 2CTZA 2JISA 4A0GA 2JJEA 4JE5A 3ATHA 1QJ5A 1LKCA 4F5GA 1MDOA 1TOGA 4J8LA 3UWCA 4WYCA 2O1BA 4EMYA 1O62A 3QHXA 1N31A 1QJ3A 2AY8A 2BI1A 2CANA 5EFSA 2W7GA 2AY2A 2BKWA 4E3RA 1FG7A 3BC8A 1AHGA 4K2IA 5J8QA 4JEZA 1I48A 2PO3A 3AEMC 1OXPA 3LV2A 4PFFA 2WKAA 2GB3A 4CXQA 2W8TA 1FG3A 4A00A 3WY7A 2VGSA 3DR4A 3ELEA 4OC9A 4L0OA 4ISYA 3II0A 2E7UA 2VGZA 3FZ8A 4E3QA 3NYUA 4FL0A 3NU8A 2FYFA 4MKJA 4Y0IA 4RIZA 1YNUA 2PB2A 4UQVA 1D7RA 2VIAA 3FZ7A 2YRIA 3AEMA 3I4JA 4PFNA 2CH2A 3PD6A 3PGYA 2OKJA 4MKKA 4ZM3A 3WLXA 2DGKA 1BS0A 5K8BA 2QMAA 2GQNA 3CQ6A 1X2AA 1WYVB 1OHYA 1AHXA 1AJRA 2Z1YA 4JE5D 1V2DA 2BHXA 4MQPA 2JJGA 1ASEA 1CZEA 4XEWA 5EQCA 3TATA 4XJOA 1J32A 1IBJA 1V72A 2VMUA 3HVYA 1VJOA 5E3KA 2VYCA 3A9YA 2W7MA 4B9BA 3TQXA 1D7VA 1IAYA 5I92A 2ZY4A 3JZLA 4CVQA 1AY8A 4F5MA 1GC4A 3FDBA 4A6TA 3T32A 3GWPA 3MAUA 1B9HA 2ZSLA 3A8UX 2VLHA 2XBNA 5LH9A 1U08A 2CH1A 3NNKA 4ITXA 5G4IA 2VMXA 4ADEA 1ASFA 1SZSA 2BIAA 4KXKA 5F8VA 3FDDA 4F5JA 2BI3A 1ZC9A 3GSBA 4WXBA 3LWSA 3BWOA 2VMZA 1J04A 3DR7A 3HDOA 3RCHA 2C81A 4ZDLA 3R9AA 2ZSMA 2ZY5A 1ASDA 1OHVA 1ORDA 1AJSA 1KMKA 3LY1A 3QGUA 1IAXA 2YOBA 4AOAA 3JWAA 1BW0A 3FKDA 4WBTA 1YAAA 4TMRA 4WXGA 5DJ1A 2W7HA 1M4NA 3QBOA 5HXXA 1BKGA 1LC8A 1RVYA 2HOZA 1OXOA 5AX8A 1DGDA 1TOJA 4F5LA 1AIBA 4OT8A 3G0TA 4O6ZA 5E4ZA 3FSLA 1D7UA 3BS8A 2YCPA 3MBBA 3GZDC 1AMSA 4W8IA 1C7OA 1AAMA 1QITA 2DKJA 2NMPA 1I43A 3N75A 2EH6A 2QBTA 3PJ0A 4K2BA 2FNUA 2C44A 5DB5A 1CZCA 4WYAA 3COGA 3WCNA 1B4XA 1UU2A 1DTYA 3G8MA 4BA5A 3CAIA 4R2NA 4WP0A 2O7CA 1GCKA 2VMNA 1YIZA 4U1TA 3AEJA 4RITA 1M6SA 3GZDA 4PIWA 3H14A 2VGVA 2D66A 1KMJA 2D64A 2VI9A 3QI6A 5G0AA 3F6TA 4R5ZA 4M2JA 3P6KA 4CBRA 1S06A 1JS3A 4GEBA 1QZ9A 2FKIA 1AAWA 4MGRA 1X0MA 1Z3ZA 1AHFA 1WYVA 3EZSA 4U2HA 1AMQA 2E7IA 4ZAHA 1S07A 1PMOA 2Z1ZA 4M2MA 3K7YA 4E77A 1ASNA 1WSTA 5EAAA 1S08A 2YRRA 2BWPA 2Z20A 1AJSB 4MQRA 3FVXA 3H7FA 2BWNA 2YHKA 3Q8NA 2VMQA 3KGWA 3NTJA 1LS3A 2AY9A 4ITGA 1IUGA 5DX5A 4BA4A 3ECDA 2CINA 4WLHA 1KKPA 3WKRA 3AELA 2WK7A 1CQ8A 3M5UA 1B5PA 3WKSA 4UHOA 3UE8A 4AO9A 3DYDA 1ELUA 2QB2A 2W7DA 4EB7A 1OATA 1MDZA 4DQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AY5 A;  3EI9 A;  4Q75 A;  2YKU A;  3E6G A;  3B46 A;  2V1P A;  1SFF A;  1P3W A;  1M0P A;  1C7G A;  3ELP A;  4GE7 A;  2D61 A;  2FM1 A;  4ZSW A;  1BQD A;  1WYT B;  4N0W A;  3TFU A;  3QN6 A;  2Z67 A;  1IJI A;  3CBF A;  3IHJ A;  2JJF A;  1RV4 A;  3BV0 A;  4HF8 A;  2V0Y A;  5D5S A;  3EIA A;  1CQ6 A;  1ASG A;  4IXO A;  4RM1 A;  4ADD A;  4R5F A;  4OBU A;  1ASM A;  1MDX A;  2VIB A;  3VK4 A;  1VP4 A;  3QPG A;  3AV7 A;  3NUI A;  4B98 A;  4N0B A;  3W1I A;  2JGT A;  3GR9 A;  2W8J A;  1FC4 A;  3NU7 A;  4TN4 A;  3VAX A;  3BB8 A;  4JEY A;  1IVR A;  1ASA A;  4OCA A;  3N5M A;  2ZJG A;  3PDB A;  4IXS A;  1DJ9 A;  3AAT A;  4ZAS A;  2W8U A;  3DXW A;  1ASL A;  2VGT A;  2YCN A;  4GE9 A;  2W7J A;  3RBF A;  4F4E A;  3I5T A;  3AEP A;  5TF5 A;  4MQQ A;  1PFF A;  3VP6 A;  3CQ4 A;  2X5D A;  4ADC A;  2W7F A;  4W91 A;  1LW4 A;  4J5U A;  1W7M A;  4IY7 A;  2D63 A;  1BT4 A;  2YKY A;  4WYF A;  2VGU A;  4WB0 B;  1BJW A;  5BJ4 A;  2CJH A;  1D2F A;  4A72 A;  3FQA A;  4IW7 A;  3L8A A;  2TPL A;  1CS1 A;  4FFC A;  3LVJ A;  2ZC0 A;  3BCB A;  2Z9X A;  2CJD A;  1UKJ A;  1X28 A;  4JF1 A;  1AMA A;  1BJ4 A;  1S09 A;  1KKJ A;  4BMK A;  2ZUK A;  2HUI A;  2W7E A;  3PPL A;  1E5F A;  1ART A;  2W8W A;  3PAA A;  3PDX A;  2QB3 A;  2BIE A;  2YKX A;  2W7K A;  1AY5 A;  1WKG A;  2EZ1 A;  1AHY A;  4IX8 A;  4HVK A;  4KYO A;  5IWQ A;  1TOK A;  4WXF A;  1H0C A;  3ZZK A;  2VLF A;  3BWN C;  1O69 A;  4QGR A;  3F0H A;  4OYT A;  3VK3 A;  4A0R A;  5M46 A;  1B9I A;  1CQ7 A;  2R5E A;  2FN6 A;  4RAE A;  5G4J A;  1LC7 A;  5HDM A;  4PVF A;  1WYU A;  1I29 A;  4F5K A;  3GZC A;  2R2N A;  1ARS A;  2VMW A;  3AOW A;  3E2F A;  4WYG A;  4RJY A;  2OAT A;  3AEO A;  1JS6 A;  1TAR A;  4P7Y A;  2DGL A;  4LNM A;  4WYD A;  4MY5 A;  3WCO A;  4ZM4 A;  3HLM A;  5G09 A;  4Y0H A;  3PDB B;  4A6U A;  2JJH A;  1G4X A;  4LNJ A;  4GRX A;  1WYT A;  3BWN A;  1AIC A;  1OHW A;  1RVU A;  3MAF A;  2CB1 A;  4XQ2 A;  1GEW A;  3B1E A;  2D65 A;  2HOY A;  1QIS A;  2EZ2 A;  2ZYJ A;  2VMR A;  3WZF A;  4Y0D A;  1M32 A;  4WLJ A;  4MSO A;  5EUN A;  1CL2 A;  3NRA A;  1DFO A;  3D6K A;  1AY4 A;  1IX7 A;  1GC3 A;  1BJO A;  2JG2 A;  5G2Q A;  5EUD A;  3L44 A;  1SVV A;  1MGV A;  3E2Z A;  2Z9U A;  2VMP A;  2D5Y A;  2D7Z A;  1GEY A;  2WK8 A;  3FTB A;  1ASC A;  4K2M A;  1B5O A;  1MAP A;  2DOU A;  1SZK A;  4ADB A;  2DKB A;  4A0H A;  4JF0 A;  2YKV A;  3W1H A;  3KGX A;  2CY8 A;  4LW4 A;  2OGE A;  3FD0 A;  1O61 A;  3QM2 A;  4WD2 A;  4ZWM A;  4W1V A;  3AOV A;  2HOX A;  3JTX A;  1ASB A;  3G7Q A;  2E54 A;  2AY1 A;  2QLR A;  3USF A;  3HQT A;  2X8U A;  3MEB A;  2HP1 A;  3B1C A;  1C9C A;  1W3U A;  2CFB A;  4EFF A;  4WB0 A;  5DJ9 A;  3KKI A;  4XJP A;  2CST A;  1VEF A;  3RI6 A;  5M49 A;  5HHY A;  1WYU B;  4GE4 A;  4H51 A;  4UHM A;  1LK9 A;  1CJ0 A;  2RFV A;  1KL1 A;  2AY7 A;  3DZZ A;  1SZU A;  2X3L A;  1JG8 A;  3JWB A;  1UU0 A;  2BI9 A;  5EUE A;  3F9T A;  1SPA A;  2VMY A;  5LHA A;  1T3I A;  4ZLV A;  1D7S A;  4F5F A;  2D7Y A;  3NDN A;  1MLY A;  3MAF B;  4Q31 A;  1AKC A;  4OMA A;  2OQX A;  1X29 A;  4A6R A;  4R8D A;  1N8P A;  1TOE A;  4GDY A;  5FT6 A;  2AY3 A;  3NUB A;  4CBS A;  2ZY2 A;  3N0L A;  3AEN B;  4AO4 A;  3EI6 A;  3I16 A;  3FFR A;  4UHN A;  4AH3 A;  2ZP7 A;  1WKH A;  3PIU A;  1DJE A;  3OP7 A;  3FVU A;  1AKA A;  1MAQ A;  2R5C B;  1BJO B;  5E5I A;  4OBV A;  1B8G A;  4ZWV A;  3E2Z B;  3HBX A;  3GBX A;  4Q76 A;  3A9X A;  1YJS A;  2QA3 A;  4JEV A;  8AAT A;  1JF9 A;  1IX6 A;  5EIG B;  2DR1 A;  3LVM A;  5FT8 A;  1W7N A;  2HUF A;  3MKJ A;  1EQB A;  4W1X A;  3FQ7 A;  5G2P A;  2BI2 A;  4IXZ A;  1H1C A;  1AKB A;  4DBC A;  1M0O A;  1ELQ A;  3FVS A;  3EI7 A;  7AAT A;  1RV3 A;  1EG5 A;  3GET A;  3NYS A;  2VGW A;  4ATP A;  3TCM A;  3A9Z A;  2OKK A;  1DKA A;  1G7X A;  2FQ6 A;  4E1O A;  2VMT A;  1S0A A;  4OTL A;  3MAD A;  1KL2 A;  2E7J A;  1N2T A;  4JEW A;  1C4K A;  1TPL A;  1YOO A;  2AAT A;  3BN1 A;  4WYE A;  1ZOB A;  2BIG A;  1DJU A;  4A0F A;  1M0N A;  2C7T A;  3FCR A;  1AHE A;  1Z7D A;  3NYT A;  3ZRP A;  2Z61 A;  3ZZJ A;  2CJG A;  3ASA A;  1ARH A;  3DC1 A;  3JU7 A;  3RUY A;  3FZ6 A;  4XAU A;  1GC0 A;  1YIY A;  4EU1 A;  1AX4 A;  1C0N A;  1XI9 A;  2YCT A;  3A2B A;  1BJN A;  1ECX A;  1LC5 A;  2W8V A;  2PB0 A;  2X5F A;  2ZY3 A;  4IYO A;  3LVK A;  2FNI A;  1V2E A;  1M0Q A;  3ZRQ A;  4AZK A;  4AZJ A;  4LC3 A;  2XH1 A;  2BYJ A;  3RQ1 A;  2AY4 A;  9AAT A;  3UAK A;  2VMV A;  3WGC A;  4F5I A;  1TAT A;  4JEX A;  3JW9 A;  1V2F A;  1C7N A;  1W7L A;  2DGM A;  2WK9 A;  3EI5 A;  4RKC A;  1G4V A;  4CXR A;  2GMS A;  1M7Y A;  2W7I A;  3HL2 A;  2HOR A;  5BJ3 A;  1QIR A;  4RLG A;  3TFT A;  1MLZ A;  1GEX A;  3ACZ A;  5M4B A;  3EZ1 A;  4RJ0 A;  3IF2 A;  1O4S A;  4P3M A;  3B1D A;  2VI8 A;  3DXV A;  2GMU A;  2BWO A;  2AY6 A;  3CQ5 A;  5F9S A;  2Q7W A;  3HMU A;  4F5H A;  4BQ0 A;  4M2K A;  3WX9 A;  4LNL A;  2BYL A;  5D95 A;  3WGB A;  2VMO A;  2R0T A;  1EJI A;  3DRD A;  3DU4 A;  2GSA A;  1Y4I A;  3E77 A;  1XEY A;  2O0R A;  4RKD A;  3AEN A;  3ZRR A;  5M4D A;  1TOI A;  2EGY A;  3P1T A;  1ARI A;  1GD9 A;  3AEJ C;  2Z9V A;  4GSA A;  4W5K A;  1ARG A;  3E9K A;  3PD6 B;  4ZDP A;  3B8X A;  2R5C A;  4LW2 A;  2W7L A;  3MC6 C;  4DGT A;  5FT4 A;  2HZP A;  1PG8 A;  1UU1 A;  3FQ8 A;  4W1W A;  1W23 A;  1I41 A;  4ATQ A;  1SF2 A;  1ZOD A;  5EIG A;  1IX8 A;  2G6W A;  2HP2 A;  3ASB A;  3DOD A;  1DGE A;  3W1J A;  1QGN A;  1AIA A;  3FRK A;  3E2Y A;  3EIB A;  1YJY A;  3LG0 A;  4UOY A;  2AEU A;  5FT5 A;  5C6U A;  3HT4 A;  3R4T A;  2AEV A;  4BHD A;  4IYO B;  3LVL B;  3K28 A;  3OKS A;  3MC6 A;  5JAY A;  2OGA A;  3RBL A;  4NOG A;  3EUC A;  1E5E A;  3NX3 A;  2C0R A;  3GJU A;  3ISL A;  3KE3 A;  3PA9 A;  4I8A A;  2ORD A;  3EI8 A;  4KAM A;  2EPJ A;  4TV7 A;  4Q6R A;  4XJM A;  4EB5 A;  1BQA A;  2VMS A;  3VK2 A;  3BCX A;  3FFH A;  1CL1 A;  3K40 A;  4XK1 A;  1AMR A;  2Z9W A;  4ZDO A;  3RCH B;  1GBN A;  1LW5 A;  2EO5 A;  1GC2 A;  3VOM A;  2HUU A;  2F8J A;  4ZSY A;  1GDE A;  3BCA A;  1YJZ A;  1PMM A;  4XJL A;  5EAV A;  1TAS A;  1G7W A;  2BI5 A;  2CTZ A;  2JIS A;  4A0G A;  2JJE A;  4JE5 A;  3ATH A;  1QJ5 A;  1LKC A;  4F5G A;  1MDO A;  1TOG A;  4J8L A;  3UWC A;  4WYC A;  2O1B A;  4EMY A;  1O62 A;  3QHX A;  1N31 A;  1QJ3 A;  2AY8 A;  2BI1 A;  2CAN A;  5EFS A;  2W7G A;  2AY2 A;  2BKW A;  4E3R A;  1FG7 A;  3BC8 A;  1AHG A;  4K2I A;  5J8Q A;  4JEZ A;  1I48 A;  2PO3 A;  3AEM C;  1OXP A;  3LV2 A;  4PFF A;  2WKA A;  2GB3 A;  4CXQ A;  2W8T A;  1FG3 A;  4A00 A;  3WY7 A;  2VGS A;  3DR4 A;  3ELE A;  4OC9 A;  4L0O A;  4ISY A;  3II0 A;  2E7U A;  2VGZ A;  3FZ8 A;  4E3Q A;  3NYU A;  4FL0 A;  3NU8 A;  2FYF A;  4MKJ A;  4Y0I A;  4RIZ A;  1YNU A;  2PB2 A;  4UQV A;  1D7R A;  2VIA A;  3FZ7 A;  2YRI A;  3AEM A;  3I4J A;  4PFN A;  2CH2 A;  3PD6 A;  3PGY A;  2OKJ A;  4MKK A;  4ZM3 A;  3WLX A;  2DGK A;  1BS0 A;  5K8B A;  2QMA A;  2GQN A;  3CQ6 A;  1X2A A;  1WYV B;  1OHY A;  1AHX A;  1AJR A;  2Z1Y A;  4JE5 D;  1V2D A;  2BHX A;  4MQP A;  2JJG A;  1ASE A;  1CZE A;  4XEW A;  5EQC A;  3TAT A;  4XJO A;  1J32 A;  1IBJ A;  1V72 A;  2VMU A;  3HVY A;  1VJO A;  5E3K A;  2VYC A;  3A9Y A;  2W7M A;  4B9B A;  3TQX A;  1D7V A;  1IAY A;  5I92 A;  2ZY4 A;  3JZL A;  4CVQ A;  1AY8 A;  4F5M A;  1GC4 A;  3FDB A;  4A6T A;  3T32 A;  3GWP A;  3MAU A;  1B9H A;  2ZSL A;  3A8U X;  2VLH A;  2XBN A;  5LH9 A;  1U08 A;  2CH1 A;  3NNK A;  4ITX A;  5G4I A;  2VMX A;  4ADE A;  1ASF A;  1SZS A;  2BIA A;  4KXK A;  5F8V A;  3FDD A;  4F5J A;  2BI3 A;  1ZC9 A;  3GSB A;  4WXB A;  3LWS A;  3BWO A;  2VMZ A;  1J04 A;  3DR7 A;  3HDO A;  3RCH A;  2C81 A;  4ZDL A;  3R9A A;  2ZSM A;  2ZY5 A;  1ASD A;  1OHV A;  1ORD A;  1AJS A;  1KMK A;  3LY1 A;  3QGU A;  1IAX A;  2YOB A;  4AOA A;  3JWA A;  1BW0 A;  3FKD A;  4WBT A;  1YAA A;  4TMR A;  4WXG A;  5DJ1 A;  2W7H A;  1M4N A;  3QBO A;  5HXX A;  1BKG A;  1LC8 A;  1RVY A;  2HOZ A;  1OXO A;  5AX8 A;  1DGD A;  1TOJ A;  4F5L A;  1AIB A;  4OT8 A;  3G0T A;  4O6Z A;  5E4Z A;  3FSL A;  1D7U A;  3BS8 A;  2YCP A;  3MBB A;  3GZD C;  1AMS A;  4W8I A;  1C7O A;  1AAM A;  1QIT A;  2DKJ A;  2NMP A;  1I43 A;  3N75 A;  2EH6 A;  2QBT A;  3PJ0 A;  4K2B A;  2FNU A;  2C44 A;  5DB5 A;  1CZC A;  4WYA A;  3COG A;  3WCN A;  1B4X A;  1UU2 A;  1DTY A;  3G8M A;  4BA5 A;  3CAI A;  4R2N A;  4WP0 A;  2O7C A;  1GCK A;  2VMN A;  1YIZ A;  4U1T A;  3AEJ A;  4RIT A;  1M6S A;  3GZD A;  4PIW A;  3H14 A;  2VGV A;  2D66 A;  1KMJ A;  2D64 A;  2VI9 A;  3QI6 A;  5G0A A;  3F6T A;  4R5Z A;  4M2J A;  3P6K A;  4CBR A;  1S06 A;  1JS3 A;  4GEB A;  1QZ9 A;  1AAW A;  4MGR A;  1X0M A;  1Z3Z A;  1AHF A;  1WYV A;  3EZS A;  4U2H A;  1AMQ A;  2E7I A;  4ZAH A;  1S07 A;  1PMO A;  2Z1Z A;  4M2M A;  3K7Y A;  4E77 A;  1ASN A;  1WST A;  5EAA A;  1S08 A;  2YRR A;  2BWP A;  2Z20 A;  1AJS B;  4MQR A;  3FVX A;  3H7F A;  2BWN A;  2YHK A;  3Q8N A;  2VMQ A;  3KGW A;  3NTJ A;  1LS3 A;  2AY9 A;  4ITG A;  1IUG A;  5DX5 A;  4BA4 A;  3ECD A;  2CIN A;  4WLH A;  1KKP A;  3WKR A;  3AEL A;  2WK7 A;  1CQ8 A;  3M5U A;  1B5P A;  3WKS A;  4UHO A;  3UE8 A;  4AO9 A;  3DYD A;  1ELU A;  2QB2 A;  2W7D A;  4EB7 A;  1OAT A;  1MDZ A;  4DQ6 A; 
#chains in the Genus database with same CATH topology
 2AY5 A;  3EI9 A;  4Q75 A;  2YKU A;  3E6G A;  3B46 A;  2V1P A;  1SFF A;  1P3W A;  1M0P A;  1C7G A;  3ELP A;  4GE7 A;  2D61 A;  2FM1 A;  4ZSW A;  2A1V A;  1BQD A;  1WYT B;  4N0W A;  3TFU A;  3QN6 A;  2Z67 A;  1IJI A;  3CBF A;  3IHJ A;  2JJF A;  1RV4 A;  3BV0 A;  4HF8 A;  2V0Y A;  5D5S A;  3EIA A;  1CQ6 A;  1ASG A;  4IXO A;  4RM1 A;  4ADD A;  4R5F A;  4OBU A;  1ASM A;  1MDX A;  2VIB A;  3VK4 A;  1VP4 A;  3QPG A;  3AV7 A;  3NUI A;  4B98 A;  4N0B A;  3W1I A;  2JGT A;  3GR9 A;  2W8J A;  1FC4 A;  3NU7 A;  4TN4 A;  3VAX A;  3BB8 A;  4JEY A;  1IVR A;  1ASA A;  4OCA A;  3N5M A;  2ZJG A;  3PDB A;  4IXS A;  1DJ9 A;  3AAT A;  4ZAS A;  2W8U A;  3DXW A;  1ASL A;  2VGT A;  2YCN A;  4GE9 A;  2W7J A;  3RBF A;  4F4E A;  3I5T A;  3AEP A;  5TF5 A;  4MQQ A;  1PFF A;  3VP6 A;  3CQ4 A;  2X5D A;  4ADC A;  2W7F A;  4W91 A;  1LW4 A;  4J5U A;  1W7M A;  4IY7 A;  2D63 A;  1BT4 A;  2YKY A;  4WYF A;  2VGU A;  4WB0 B;  1BJW A;  5BJ4 A;  2CJH A;  1D2F A;  4A72 A;  3FQA A;  4IW7 A;  3L8A A;  2TPL A;  1CS1 A;  4FFC A;  3LVJ A;  2ZC0 A;  3BCB A;  2Z9X A;  2CJD A;  1UKJ A;  1X28 A;  4JF1 A;  1AMA A;  1BJ4 A;  1S09 A;  1KKJ A;  4BMK A;  2ZUK A;  2HUI A;  2W7E A;  3PPL A;  1E5F A;  1ART A;  2W8W A;  3PAA A;  3PDX A;  2QB3 A;  2BIE A;  4K05 A;  2YKX A;  2W7K A;  1AY5 A;  1WKG A;  2EZ1 A;  1AHY A;  4IX8 A;  4HVK A;  4KYO A;  5IWQ A;  1TOK A;  4WXF A;  1H0C A;  3ZZK A;  2VLF A;  3BWN C;  1O69 A;  4QGR A;  3F0H A;  4OYT A;  3VK3 A;  4A0R A;  5M46 A;  1B9I A;  1CQ7 A;  2R5E A;  2FN6 A;  4RAE A;  5G4J A;  1LC7 A;  5HDM A;  4PVF A;  1WYU A;  1I29 A;  4F5K A;  3GZC A;  2R2N A;  1ARS A;  2VMW A;  3AOW A;  3E2F A;  4WYG A;  4RJY A;  2OAT A;  3AEO A;  1JS6 A;  1TAR A;  4P7Y A;  2DGL A;  4LNM A;  4WYD A;  4MY5 A;  3WCO A;  4ZM4 A;  3HLM A;  5G09 A;  4Y0H A;  3PDB B;  4A6U A;  2JJH A;  1G4X A;  4LNJ A;  4GRX A;  1WYT A;  3BWN A;  1AIC A;  1OHW A;  1RVU A;  3MAF A;  2CB1 A;  4XQ2 A;  1GEW A;  3B1E A;  2D65 A;  2HOY A;  1QIS A;  2EZ2 A;  2ZYJ A;  2VMR A;  3WZF A;  4Y0D A;  1M32 A;  4WLJ A;  4MSO A;  5EUN A;  1CL2 A;  3NRA A;  1DFO A;  3D6K A;  1AY4 A;  1IX7 A;  1GC3 A;  1BJO A;  2JG2 A;  5G2Q A;  5EUD A;  3L44 A;  1SVV A;  1MGV A;  3E2Z A;  2Z9U A;  2VMP A;  2D5Y A;  2D7Z A;  1GEY A;  2WK8 A;  3FTB A;  1ASC A;  4K2M A;  1B5O A;  1MAP A;  2DOU A;  1SZK A;  4ADB A;  2DKB A;  4A0H A;  4JF0 A;  2YKV A;  3W1H A;  3KGX A;  2CY8 A;  4LW4 A;  2OGE A;  3FD0 A;  1O61 A;  3QM2 A;  4WD2 A;  4ZWM A;  4W1V A;  3AOV A;  2HOX A;  3JTX A;  1ASB A;  3G7Q A;  2E54 A;  2AY1 A;  2QLR A;  3USF A;  3HQT A;  2X8U A;  3MEB A;  2HP1 A;  3B1C A;  5KTB A;  1C9C A;  1W3U A;  2CFB A;  4EFF A;  4WB0 A;  5DJ9 A;  3N7N A;  3KKI A;  4XJP A;  2CST A;  1VEF A;  3RI6 A;  5M49 A;  5HHY A;  1WYU B;  4GE4 A;  4H51 A;  4UHM A;  1LK9 A;  1CJ0 A;  2RFV A;  1KL1 A;  2AY7 A;  3DZZ A;  1SZU A;  2X3L A;  1JG8 A;  3JWB A;  1UU0 A;  2BI9 A;  5EUE A;  3F9T A;  1SPA A;  2VMY A;  5LHA A;  1T3I A;  4ZLV A;  1D7S A;  4F5F A;  2D7Y A;  3N4X A;  3NDN A;  1MLY A;  3MAF B;  4Q31 A;  1AKC A;  4OMA A;  2OQX A;  1X29 A;  4A6R A;  4R8D A;  1N8P A;  1TOE A;  4GDY A;  5FT6 A;  2AY3 A;  3NUB A;  4CBS A;  3N4S A;  2ZY2 A;  3N0L A;  3AEN B;  4AO4 A;  3EI6 A;  3I16 A;  3FFR A;  4UHN A;  4AH3 A;  2ZP7 A;  1WKH A;  3PIU A;  1DJE A;  3OP7 A;  3FVU A;  1AKA A;  2G7J A;  1MAQ A;  2R5C B;  1BJO B;  5E5I A;  2EYQ A;  4OBV A;  1B8G A;  4ZWV A;  3E2Z B;  3HBX A;  3GBX A;  4Q76 A;  3A9X A;  1YJS A;  2QA3 A;  4JEV A;  8AAT A;  1JF9 A;  1IX6 A;  5EIG B;  2DR1 A;  3LVM A;  5FT8 A;  1W7N A;  2HUF A;  3MKJ A;  1EQB A;  4W1X A;  3FQ7 A;  5G2P A;  2BI2 A;  4IXZ A;  1H1C A;  1AKB A;  4DBC A;  1M0O A;  1ELQ A;  3FVS A;  3EI7 A;  7AAT A;  1RV3 A;  2WB6 A;  1EG5 A;  3GET A;  3NYS A;  2VGW A;  4H63 Q;  4ATP A;  3TCM A;  3A9Z A;  2OKK A;  1DKA A;  1G7X A;  2FQ6 A;  4E1O A;  2VMT A;  1S0A A;  4OTL A;  3MAD A;  1KL2 A;  2E7J A;  1N2T A;  4JEW A;  1C4K A;  1TPL A;  1YOO A;  2AAT A;  3BN1 A;  4WYE A;  1ZOB A;  2BIG A;  1DJU A;  4A0F A;  2KFP A;  1M0N A;  2C7T A;  3FCR A;  1AHE A;  1Z7D A;  3NYT A;  3ZRP A;  2Z61 A;  3ZZJ A;  2CJG A;  3ASA A;  1ARH A;  3DC1 A;  3JU7 A;  3RUY A;  3FZ6 A;  4XAU A;  1GC0 A;  1YIY A;  4EU1 A;  1AX4 A;  1C0N A;  1XI9 A;  2YCT A;  3A2B A;  1BJN A;  1ECX A;  1LC5 A;  2W8V A;  3N4R A;  2PB0 A;  2X5F A;  2ZY3 A;  4IYO A;  3LVK A;  2FNI A;  1V2E A;  1M0Q A;  3ZRQ A;  4AZK A;  4AZJ A;  4LC3 A;  2XH1 A;  2BYJ A;  3RQ1 A;  1KAF A;  2AY4 A;  9AAT A;  3UAK A;  2VMV A;  3WGC A;  4F5I A;  1TAT A;  4JEX A;  3JW9 A;  1V2F A;  1C7N A;  1W7L A;  2DGM A;  2WK9 A;  3EI5 A;  4RKC A;  1G4V A;  4CXR A;  2GMS A;  1M7Y A;  2W7I A;  3HL2 A;  2HOR A;  5BJ3 A;  1QIR A;  4RLG A;  3TFT A;  1MLZ A;  1GEX A;  3ACZ A;  5M4B A;  3EZ1 A;  4RJ0 A;  3IF2 A;  1O4S A;  4P3M A;  3B1D A;  2VI8 A;  3DXV A;  2GMU A;  2BWO A;  2AY6 A;  3CQ5 A;  5F9S A;  2Q7W A;  3HMU A;  4F5H A;  4BQ0 A;  4M2K A;  3WX9 A;  4LNL A;  2BYL A;  5D95 A;  3WGB A;  2VMO A;  2R0T A;  1EJI A;  3DRD A;  3DU4 A;  2GSA A;  1Y4I A;  3E77 A;  1XEY A;  2O0R A;  4RKD A;  3AEN A;  3ZRR A;  5M4D A;  1TOI A;  2EGY A;  3P1T A;  1ARI A;  1GD9 A;  3AEJ C;  2Z9V A;  4GSA A;  4W5K A;  1ARG A;  3E9K A;  3PD6 B;  4ZDP A;  3B8X A;  2R5C A;  4LW2 A;  2QSR A;  2W7L A;  3MC6 C;  4DGT A;  5FT4 A;  2HZP A;  1PG8 A;  1UU1 A;  3FQ8 A;  4W1W A;  1W23 A;  1I41 A;  4ATQ A;  1SF2 A;  1ZOD A;  5EIG A;  1IX8 A;  2G6W A;  2HP2 A;  3ASB A;  3DOD A;  1DGE A;  3W1J A;  1QGN A;  1AIA A;  3FRK A;  3E2Y A;  3EIB A;  1YJY A;  3LG0 A;  3H9X A;  4UOY A;  2AEU A;  5FT5 A;  5C6U A;  3HT4 A;  3R4T A;  2AEV A;  4BHD A;  4IYO B;  3LVL B;  3K28 A;  3OKS A;  3MC6 A;  5JAY A;  2OGA A;  3RBL A;  4NOG A;  3EUC A;  1E5E A;  3NX3 A;  2C0R A;  3GJU A;  3ISL A;  3KE3 A;  3PA9 A;  4I8A A;  2ORD A;  3EI8 A;  4KAM A;  2EPJ A;  4TV7 A;  4Q6R A;  4XJM A;  4EB5 A;  1BQA A;  2VMS A;  3VK2 A;  3BCX A;  3FFH A;  1CL1 A;  3K40 A;  4XK1 A;  1AMR A;  2Z9W A;  4ZDO A;  3RCH B;  1GBN A;  1LW5 A;  2EO5 A;  1GC2 A;  3VOM A;  2HUU A;  2F8J A;  4ZSY A;  1GDE A;  3BCA A;  1YJZ A;  1PMM A;  4XJL A;  5EAV A;  1TAS A;  1G7W A;  2BI5 A;  2CTZ A;  2JIS A;  4A0G A;  2JJE A;  4JE5 A;  3ATH A;  1QJ5 A;  1LKC A;  4F5G A;  1MDO A;  1TOG A;  4J8L A;  3UWC A;  4WYC A;  2O1B A;  4EMY A;  1O62 A;  3QHX A;  1N31 A;  1QJ3 A;  2AY8 A;  2BI1 A;  2CAN A;  5EFS A;  2W7G A;  2AY2 A;  2BKW A;  4E3R A;  1FG7 A;  3BC8 A;  1AHG A;  4K2I A;  5J8Q A;  4JEZ A;  1I48 A;  2PO3 A;  3AEM C;  1OXP A;  3LV2 A;  4PFF A;  2WKA A;  2GB3 A;  4CXQ A;  2W8T A;  1FG3 A;  4A00 A;  3WY7 A;  2VGS A;  3DR4 A;  3ELE A;  4OC9 A;  4L0O A;  4ISY A;  3II0 A;  2E7U A;  2VGZ A;  3FZ8 A;  4E3Q A;  3NYU A;  4FL0 A;  3NU8 A;  2FYF A;  4MKJ A;  4Y0I A;  4RIZ A;  1YNU A;  2PB2 A;  4UQV A;  1D7R A;  2VIA A;  3FZ7 A;  2YRI A;  3AEM A;  3I4J A;  4PFN A;  2CH2 A;  3PD6 A;  3PGY A;  2OKJ A;  4MKK A;  4ZM3 A;  3WLX A;  2DGK A;  1BS0 A;  5K8B A;  2QMA A;  2GQN A;  3CQ6 A;  1X2A A;  1WYV B;  1OHY A;  1AHX A;  1AJR A;  2Z1Y A;  4JE5 D;  1V2D A;  2BHX A;  4MQP A;  2JJG A;  1ASE A;  1CZE A;  4XEW A;  5EQC A;  3TAT A;  4XJO A;  1J32 A;  1IBJ A;  1V72 A;  2VMU A;  3HVY A;  1VJO A;  5E3K A;  2VYC A;  3A9Y A;  2W7M A;  4B9B A;  3TQX A;  1D7V A;  1IAY A;  5I92 A;  2ZY4 A;  3JZL A;  4CVQ A;  1AY8 A;  4F5M A;  1GC4 A;  3FDB A;  4A6T A;  3T32 A;  3GWP A;  3MAU A;  1B9H A;  2ZSL A;  3A8U X;  2VLH A;  2XBN A;  5LH9 A;  1U08 A;  2CH1 A;  3NNK A;  4ITX A;  5G4I A;  2VMX A;  4ADE A;  1ASF A;  1SZS A;  2BIA A;  4KXK A;  5F8V A;  3FDD A;  4F5J A;  2BI3 A;  1ZC9 A;  3GSB A;  4WXB A;  3LWS A;  3BWO A;  2VMZ A;  1J04 A;  3DR7 A;  3HDO A;  3RCH A;  2C81 A;  4ZDL A;  3R9A A;  2ZSM A;  2ZY5 A;  1ASD A;  1OHV A;  1ORD A;  1AJS A;  1KMK A;  3LY1 A;  3QGU A;  1IAX A;  2YOB A;  4AOA A;  3JWA A;  1BW0 A;  3FKD A;  4WBT A;  1YAA A;  4TMR A;  4WXG A;  5DJ1 A;  2W7H A;  1M4N A;  3QBO A;  5HXX A;  1BKG A;  1LC8 A;  1RVY A;  2HOZ A;  1OXO A;  5AX8 A;  1DGD A;  1TOJ A;  4F5L A;  1AIB A;  4OT8 A;  3G0T A;  4O6Z A;  5E4Z A;  3FSL A;  1D7U A;  3BS8 A;  2YCP A;  3MBB A;  3GZD C;  1AMS A;  4W8I A;  1C7O A;  1AAM A;  1QIT A;  2DKJ A;  2NMP A;  1I43 A;  3N75 A;  2EH6 A;  2QBT A;  3PJ0 A;  4K2B A;  2FNU A;  2C44 A;  5DB5 A;  1CZC A;  4WYA A;  3COG A;  3WCN A;  1B4X A;  1UU2 A;  1DTY A;  3G8M A;  4BA5 A;  3CAI A;  4R2N A;  4WP0 A;  2O7C A;  1GCK A;  2VMN A;  1YIZ A;  4U1T A;  3AEJ A;  4RIT A;  1M6S A;  3GZD A;  4PIW A;  3H14 A;  2VGV A;  2D66 A;  1KMJ A;  2D64 A;  2VI9 A;  3QI6 A;  5G0A A;  3F6T A;  4R5Z A;  4M2J A;  3P6K A;  4CBR A;  1S06 A;  1JS3 A;  4GEB A;  1QZ9 A;  2FKI A;  1AAW A;  4MGR A;  1X0M A;  1Z3Z A;  1AHF A;  1WYV A;  3EZS A;  4U2H A;  1AMQ A;  2E7I A;  4ZAH A;  1S07 A;  1PMO A;  2Z1Z A;  4M2M A;  3K7Y A;  4E77 A;  1ASN A;  1WST A;  5EAA A;  1S08 A;  2YRR A;  2BWP A;  2Z20 A;  1AJS B;  4MQR A;  3FVX A;  3H7F A;  2BWN A;  2YHK A;  3Q8N A;  2VMQ A;  3KGW A;  3NTJ A;  1LS3 A;  2AY9 A;  4ITG A;  1IUG A;  5DX5 A;  4BA4 A;  3ECD A;  2CIN A;  4WLH A;  1KKP A;  3WKR A;  3AEL A;  2WK7 A;  1CQ8 A;  3M5U A;  1B5P A;  3WKS A;  4UHO A;  3UE8 A;  4AO9 A;  3DYD A;  1ELU A;  2QB2 A;  2W7D A;  4EB7 A;  1OAT A;  1MDZ A;  4DQ6 A; 
#chains in the Genus database with same CATH homology
 2AY5 A;  3EI9 A;  4Q75 A;  2YKU A;  3E6G A;  3B46 A;  2V1P A;  1SFF A;  1P3W A;  1M0P A;  1C7G A;  3ELP A;  4GE7 A;  2D61 A;  2FM1 A;  4ZSW A;  2A1V A;  1BQD A;  1WYT B;  4N0W A;  3TFU A;  3QN6 A;  2Z67 A;  1IJI A;  3CBF A;  3IHJ A;  2JJF A;  1RV4 A;  3BV0 A;  4HF8 A;  2V0Y A;  5D5S A;  3EIA A;  1CQ6 A;  1ASG A;  4IXO A;  4RM1 A;  4ADD A;  4R5F A;  4OBU A;  1ASM A;  1MDX A;  2VIB A;  3VK4 A;  1VP4 A;  3QPG A;  3AV7 A;  3NUI A;  4B98 A;  4N0B A;  3W1I A;  2JGT A;  3GR9 A;  2W8J A;  1FC4 A;  3NU7 A;  4TN4 A;  3VAX A;  3BB8 A;  4JEY A;  1IVR A;  1ASA A;  4OCA A;  3N5M A;  2ZJG A;  3PDB A;  4IXS A;  1DJ9 A;  3AAT A;  4ZAS A;  2W8U A;  3DXW A;  1ASL A;  2VGT A;  2YCN A;  4GE9 A;  2W7J A;  3RBF A;  4F4E A;  3I5T A;  3AEP A;  5TF5 A;  4MQQ A;  1PFF A;  3VP6 A;  3CQ4 A;  2X5D A;  4ADC A;  2W7F A;  4W91 A;  1LW4 A;  4J5U A;  1W7M A;  4IY7 A;  2D63 A;  1BT4 A;  2YKY A;  4WYF A;  2VGU A;  4WB0 B;  1BJW A;  5BJ4 A;  2CJH A;  1D2F A;  4A72 A;  3FQA A;  4IW7 A;  3L8A A;  2TPL A;  1CS1 A;  4FFC A;  3LVJ A;  2ZC0 A;  3BCB A;  2Z9X A;  2CJD A;  1UKJ A;  1X28 A;  4JF1 A;  1AMA A;  1BJ4 A;  1S09 A;  1KKJ A;  4BMK A;  2ZUK A;  2HUI A;  2W7E A;  3PPL A;  1E5F A;  1ART A;  2W8W A;  3PAA A;  3PDX A;  2QB3 A;  2BIE A;  4K05 A;  2YKX A;  2W7K A;  1AY5 A;  1WKG A;  2EZ1 A;  1AHY A;  4IX8 A;  4HVK A;  4KYO A;  5IWQ A;  1TOK A;  4WXF A;  1H0C A;  3ZZK A;  2VLF A;  3BWN C;  1O69 A;  4QGR A;  3F0H A;  4OYT A;  3VK3 A;  4A0R A;  5M46 A;  1B9I A;  1CQ7 A;  2R5E A;  2FN6 A;  4RAE A;  5G4J A;  1LC7 A;  5HDM A;  4PVF A;  1WYU A;  1I29 A;  4F5K A;  3GZC A;  2R2N A;  1ARS A;  2VMW A;  3AOW A;  3E2F A;  4WYG A;  4RJY A;  2OAT A;  3AEO A;  1JS6 A;  1TAR A;  4P7Y A;  2DGL A;  4LNM A;  4WYD A;  4MY5 A;  3WCO A;  4ZM4 A;  3HLM A;  5G09 A;  4Y0H A;  3PDB B;  4A6U A;  2JJH A;  1G4X A;  4LNJ A;  4GRX A;  1WYT A;  3BWN A;  1AIC A;  1OHW A;  1RVU A;  3MAF A;  2CB1 A;  4XQ2 A;  1GEW A;  3B1E A;  2D65 A;  2HOY A;  1QIS A;  2EZ2 A;  2ZYJ A;  2VMR A;  3WZF A;  4Y0D A;  1M32 A;  4WLJ A;  4MSO A;  5EUN A;  1CL2 A;  3NRA A;  1DFO A;  3D6K A;  1AY4 A;  1IX7 A;  1GC3 A;  1BJO A;  2JG2 A;  5G2Q A;  5EUD A;  3L44 A;  1SVV A;  1MGV A;  3E2Z A;  2Z9U A;  2VMP A;  2D5Y A;  2D7Z A;  1GEY A;  2WK8 A;  3FTB A;  1ASC A;  4K2M A;  1B5O A;  1MAP A;  2DOU A;  1SZK A;  4ADB A;  2DKB A;  4A0H A;  4JF0 A;  2YKV A;  3W1H A;  3KGX A;  2CY8 A;  4LW4 A;  2OGE A;  3FD0 A;  1O61 A;  3QM2 A;  4WD2 A;  4ZWM A;  4W1V A;  3AOV A;  2HOX A;  3JTX A;  1ASB A;  3G7Q A;  2E54 A;  2AY1 A;  2QLR A;  3USF A;  3HQT A;  2X8U A;  3MEB A;  2HP1 A;  3B1C A;  5KTB A;  1C9C A;  1W3U A;  2CFB A;  4EFF A;  4WB0 A;  5DJ9 A;  3N7N A;  3KKI A;  4XJP A;  2CST A;  1VEF A;  3RI6 A;  5M49 A;  5HHY A;  1WYU B;  4GE4 A;  4H51 A;  4UHM A;  1LK9 A;  1CJ0 A;  2RFV A;  1KL1 A;  2AY7 A;  3DZZ A;  1SZU A;  2X3L A;  1JG8 A;  3JWB A;  1UU0 A;  2BI9 A;  5EUE A;  3F9T A;  1SPA A;  2VMY A;  5LHA A;  1T3I A;  4ZLV A;  1D7S A;  4F5F A;  2D7Y A;  3N4X A;  3NDN A;  1MLY A;  3MAF B;  4Q31 A;  1AKC A;  4OMA A;  2OQX A;  1X29 A;  4A6R A;  4R8D A;  1N8P A;  1TOE A;  4GDY A;  5FT6 A;  2AY3 A;  3NUB A;  4CBS A;  3N4S A;  2ZY2 A;  3N0L A;  3AEN B;  4AO4 A;  3EI6 A;  3I16 A;  3FFR A;  4UHN A;  4AH3 A;  2ZP7 A;  1WKH A;  3PIU A;  1DJE A;  3OP7 A;  3FVU A;  1AKA A;  2G7J A;  1MAQ A;  2R5C B;  1BJO B;  5E5I A;  2EYQ A;  4OBV A;  1B8G A;  4ZWV A;  3E2Z B;  3HBX A;  3GBX A;  4Q76 A;  3A9X A;  1YJS A;  2QA3 A;  4JEV A;  8AAT A;  1JF9 A;  1IX6 A;  5EIG B;  2DR1 A;  3LVM A;  5FT8 A;  1W7N A;  2HUF A;  3MKJ A;  1EQB A;  4W1X A;  3FQ7 A;  5G2P A;  2BI2 A;  4IXZ A;  1H1C A;  1AKB A;  4DBC A;  1M0O A;  1ELQ A;  3FVS A;  3EI7 A;  7AAT A;  1RV3 A;  2WB6 A;  1EG5 A;  3GET A;  3NYS A;  2VGW A;  4H63 Q;  4ATP A;  3TCM A;  3A9Z A;  2OKK A;  1DKA A;  1G7X A;  2FQ6 A;  4E1O A;  2VMT A;  1S0A A;  4OTL A;  3MAD A;  1KL2 A;  2E7J A;  1N2T A;  4JEW A;  1C4K A;  1TPL A;  1YOO A;  2AAT A;  3BN1 A;  4WYE A;  1ZOB A;  2BIG A;  1DJU A;  4A0F A;  2KFP A;  1M0N A;  2C7T A;  3FCR A;  1AHE A;  1Z7D A;  3NYT A;  3ZRP A;  2Z61 A;  3ZZJ A;  2CJG A;  3ASA A;  1ARH A;  3DC1 A;  3JU7 A;  3RUY A;  3FZ6 A;  4XAU A;  1GC0 A;  1YIY A;  4EU1 A;  1AX4 A;  1C0N A;  1XI9 A;  2YCT A;  3A2B A;  1BJN A;  1ECX A;  1LC5 A;  2W8V A;  3N4R A;  2PB0 A;  2X5F A;  2ZY3 A;  4IYO A;  3LVK A;  2FNI A;  1V2E A;  1M0Q A;  3ZRQ A;  4AZK A;  4AZJ A;  4LC3 A;  2XH1 A;  2BYJ A;  3RQ1 A;  2AY4 A;  9AAT A;  3UAK A;  2VMV A;  3WGC A;  4F5I A;  1TAT A;  4JEX A;  3JW9 A;  1V2F A;  1C7N A;  1W7L A;  2DGM A;  2WK9 A;  3EI5 A;  4RKC A;  1G4V A;  4CXR A;  2GMS A;  1M7Y A;  2W7I A;  3HL2 A;  2HOR A;  5BJ3 A;  1QIR A;  4RLG A;  3TFT A;  1MLZ A;  1GEX A;  3ACZ A;  5M4B A;  3EZ1 A;  4RJ0 A;  3IF2 A;  1O4S A;  4P3M A;  3B1D A;  2VI8 A;  3DXV A;  2GMU A;  2BWO A;  2AY6 A;  3CQ5 A;  5F9S A;  2Q7W A;  3HMU A;  4F5H A;  4BQ0 A;  4M2K A;  3WX9 A;  4LNL A;  2BYL A;  5D95 A;  3WGB A;  2VMO A;  2R0T A;  1EJI A;  3DRD A;  3DU4 A;  2GSA A;  1Y4I A;  3E77 A;  1XEY A;  2O0R A;  4RKD A;  3AEN A;  3ZRR A;  5M4D A;  1TOI A;  2EGY A;  3P1T A;  1ARI A;  1GD9 A;  3AEJ C;  2Z9V A;  4GSA A;  4W5K A;  1ARG A;  3E9K A;  3PD6 B;  4ZDP A;  3B8X A;  2R5C A;  4LW2 A;  2QSR A;  2W7L A;  3MC6 C;  4DGT A;  5FT4 A;  2HZP A;  1PG8 A;  1UU1 A;  3FQ8 A;  4W1W A;  1W23 A;  1I41 A;  4ATQ A;  1SF2 A;  1ZOD A;  5EIG A;  1IX8 A;  2G6W A;  2HP2 A;  3ASB A;  3DOD A;  1DGE A;  3W1J A;  1QGN A;  1AIA A;  3FRK A;  3E2Y A;  3EIB A;  1YJY A;  3LG0 A;  3H9X A;  4UOY A;  2AEU A;  5FT5 A;  5C6U A;  3HT4 A;  3R4T A;  2AEV A;  4BHD A;  4IYO B;  3LVL B;  3K28 A;  3OKS A;  3MC6 A;  5JAY A;  2OGA A;  3RBL A;  4NOG A;  3EUC A;  1E5E A;  3NX3 A;  2C0R A;  3GJU A;  3ISL A;  3KE3 A;  3PA9 A;  4I8A A;  2ORD A;  3EI8 A;  4KAM A;  2EPJ A;  4TV7 A;  4Q6R A;  4XJM A;  4EB5 A;  1BQA A;  2VMS A;  3VK2 A;  3BCX A;  3FFH A;  1CL1 A;  3K40 A;  4XK1 A;  1AMR A;  2Z9W A;  4ZDO A;  3RCH B;  1GBN A;  1LW5 A;  2EO5 A;  1GC2 A;  3VOM A;  2HUU A;  2F8J A;  4ZSY A;  1GDE A;  3BCA A;  1YJZ A;  1PMM A;  4XJL A;  5EAV A;  1TAS A;  1G7W A;  2BI5 A;  2CTZ A;  2JIS A;  4A0G A;  2JJE A;  4JE5 A;  3ATH A;  1QJ5 A;  1LKC A;  4F5G A;  1MDO A;  1TOG A;  4J8L A;  3UWC A;  4WYC A;  2O1B A;  4EMY A;  1O62 A;  3QHX A;  1N31 A;  1QJ3 A;  2AY8 A;  2BI1 A;  2CAN A;  5EFS A;  2W7G A;  2AY2 A;  2BKW A;  4E3R A;  1FG7 A;  3BC8 A;  1AHG A;  4K2I A;  5J8Q A;  4JEZ A;  1I48 A;  2PO3 A;  3AEM C;  1OXP A;  3LV2 A;  4PFF A;  2WKA A;  2GB3 A;  4CXQ A;  2W8T A;  1FG3 A;  4A00 A;  3WY7 A;  2VGS A;  3DR4 A;  3ELE A;  4OC9 A;  4L0O A;  4ISY A;  3II0 A;  2E7U A;  2VGZ A;  3FZ8 A;  4E3Q A;  3NYU A;  4FL0 A;  3NU8 A;  2FYF A;  4MKJ A;  4Y0I A;  4RIZ A;  1YNU A;  2PB2 A;  4UQV A;  1D7R A;  2VIA A;  3FZ7 A;  2YRI A;  3AEM A;  3I4J A;  4PFN A;  2CH2 A;  3PD6 A;  3PGY A;  2OKJ A;  4MKK A;  4ZM3 A;  3WLX A;  2DGK A;  1BS0 A;  5K8B A;  2QMA A;  2GQN A;  3CQ6 A;  1X2A A;  1WYV B;  1OHY A;  1AHX A;  1AJR A;  2Z1Y A;  4JE5 D;  1V2D A;  2BHX A;  4MQP A;  2JJG A;  1ASE A;  1CZE A;  4XEW A;  5EQC A;  3TAT A;  4XJO A;  1J32 A;  1IBJ A;  1V72 A;  2VMU A;  3HVY A;  1VJO A;  5E3K A;  2VYC A;  3A9Y A;  2W7M A;  4B9B A;  3TQX A;  1D7V A;  1IAY A;  5I92 A;  2ZY4 A;  3JZL A;  4CVQ A;  1AY8 A;  4F5M A;  1GC4 A;  3FDB A;  4A6T A;  3T32 A;  3GWP A;  3MAU A;  1B9H A;  2ZSL A;  3A8U X;  2VLH A;  2XBN A;  5LH9 A;  1U08 A;  2CH1 A;  3NNK A;  4ITX A;  5G4I A;  2VMX A;  4ADE A;  1ASF A;  1SZS A;  2BIA A;  4KXK A;  5F8V A;  3FDD A;  4F5J A;  2BI3 A;  1ZC9 A;  3GSB A;  4WXB A;  3LWS A;  3BWO A;  2VMZ A;  1J04 A;  3DR7 A;  3HDO A;  3RCH A;  2C81 A;  4ZDL A;  3R9A A;  2ZSM A;  2ZY5 A;  1ASD A;  1OHV A;  1ORD A;  1AJS A;  1KMK A;  3LY1 A;  3QGU A;  1IAX A;  2YOB A;  4AOA A;  3JWA A;  1BW0 A;  3FKD A;  4WBT A;  1YAA A;  4TMR A;  4WXG A;  5DJ1 A;  2W7H A;  1M4N A;  3QBO A;  5HXX A;  1BKG A;  1LC8 A;  1RVY A;  2HOZ A;  1OXO A;  5AX8 A;  1DGD A;  1TOJ A;  4F5L A;  1AIB A;  4OT8 A;  3G0T A;  4O6Z A;  5E4Z A;  3FSL A;  1D7U A;  3BS8 A;  2YCP A;  3MBB A;  3GZD C;  1AMS A;  4W8I A;  1C7O A;  1AAM A;  1QIT A;  2DKJ A;  2NMP A;  1I43 A;  3N75 A;  2EH6 A;  2QBT A;  3PJ0 A;  4K2B A;  2FNU A;  2C44 A;  5DB5 A;  1CZC A;  4WYA A;  3COG A;  3WCN A;  1B4X A;  1UU2 A;  1DTY A;  3G8M A;  4BA5 A;  3CAI A;  4R2N A;  4WP0 A;  2O7C A;  1GCK A;  2VMN A;  1YIZ A;  4U1T A;  3AEJ A;  4RIT A;  1M6S A;  3GZD A;  4PIW A;  3H14 A;  2VGV A;  2D66 A;  1KMJ A;  2D64 A;  2VI9 A;  3QI6 A;  5G0A A;  3F6T A;  4R5Z A;  4M2J A;  3P6K A;  4CBR A;  1S06 A;  1JS3 A;  4GEB A;  1QZ9 A;  2FKI A;  1AAW A;  4MGR A;  1X0M A;  1Z3Z A;  1AHF A;  1WYV A;  3EZS A;  4U2H A;  1AMQ A;  2E7I A;  4ZAH A;  1S07 A;  1PMO A;  2Z1Z A;  4M2M A;  3K7Y A;  4E77 A;  1ASN A;  1WST A;  5EAA A;  1S08 A;  2YRR A;  2BWP A;  2Z20 A;  1AJS B;  4MQR A;  3FVX A;  3H7F A;  2BWN A;  2YHK A;  3Q8N A;  2VMQ A;  3KGW A;  3NTJ A;  1LS3 A;  2AY9 A;  4ITG A;  1IUG A;  5DX5 A;  4BA4 A;  3ECD A;  2CIN A;  4WLH A;  1KKP A;  3WKR A;  3AEL A;  2WK7 A;  1CQ8 A;  3M5U A;  1B5P A;  3WKS A;  4UHO A;  3UE8 A;  4AO9 A;  3DYD A;  1ELU A;  2QB2 A;  2W7D A;  4EB7 A;  1OAT A;  1MDZ A;  4DQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...