1G7XA

Aspartate aminotransferase active site mutant n194a/r292l/r386l
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHAPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAILANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGLVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Strain is more important than electrostatic interaction in controlling the pKa of the catalytic group in aspartate aminotransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 133
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2000-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1g7xA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1g7xA01
3PIUA 3L8AA 1BJ4A 3LVJA 3AEMA 3II0A 4TN4A 4W91A 1GC3A 3WCOA 3A9YA 4WYDA 4MKJA 1DGEA 2W8TA 3G7QA 2AY7A 1YIYA 2BHXA 4GSAA 4CBRA 1TOIA 4CVQA 1D7VA 5DJ9A 2HOZA 1CQ6A 2W7JA 3USFA 4JE5D 4JF1A 3W1IA 2D63A 2X8UA 5M4DA 2DKBA 3FQAA 4IX8A 1N8PA 3E2ZB 4XAUA 5D5SA 5EFSA 1LC7A 1AMAA 5EQCA 4R5FA 3NYUA 3GBXA 3UWCA 4R2NA 4WXFA 3R9AA 3NUIA 2NMPA 2OGAA 3HQTA 4RM1A 4XEWA 3PJ0A 2CJGA 3VK3A 4M2MA 2DKJA 1WSTA 1OHYA 3F9TA 1AMRA 4DGTA 2VLHA 3F6TA 1IUGA 1QJ5A 4F5GA 1ARHA 4QGRA 5M46A 3IHJA 2FNIA 3BWNC 4JEWA 3EI6A 2D7YA 4XJLA 1MDZA 1QITA 4Q6RA 1OXOA 1DTYA 1GC0A 4ZASA 4BQ0A 2AY5A 5C6UA 1LC5A 1AJSB 5J8QA 1ZODA 3WKRA 3RBFA 2VMWA 4IXOA 5FT8A 3KGWA 4W1VA 1FG7A 3BB8A 1AHEA 4XJPA 5F9SA 3A8UX 3WX9A 4RIZA 1WYUB 3QGUA 2YKUA 1G4XA 4UHNA 3K7YA 4JF0A 3G0TA 3BCXA 1C4KA 3FVUA 1KKJA 2JJFA 3D6KA 1FG3A 1WYVA 1ASBA 1BJNA 1S06A 2VGTA 1YIZA 4AO9A 1ARSA 2CTZA 1CZCA 3LVMA 5JAYA 1AICA 1H1CA 4FFCA 3FQ8A 4JEZA 4EFFA 4CBSA 4L0OA 4MQPA 4E3RA 3N75A 3VK2A 2Z9VA 1ARTA 1ASCA 4F5LA 1S07A 1WKHA 4WYEA 1YJSA 2HUUA 3DXVA 1V2DA 4MKKA 1C7NA 3FFRA 7AATA 2HORA 2VI8A 2YHKA 3LY1A 4WP0A 2OATA 1TOJA 5EAAA 4ADEA 4GDYA 1PFFA 5EIGA 4E1OA 1PMMA 4J8LA 1BJOA 3ELPA 3GZCA 3KE3A 1YNUA 3VK4A 2VGUA 2YCTA 4GEBA 3ZRRA 4RAEA 2VMPA 2VI9A 1LW4A 3BCAA 3CAIA 3G8MA 3VP6A 3EI7A 4XQ2A 5G09A 1YOOA 3NNKA 3TATA 3NYTA 2ZY3A 1SZKA 3FVSA 1O61A 1UU0A 3LG0A 3NYSA 3PAAA 1XI9A 2YCNA 2ZP7A 3GR9A 4HF8A 4W8IA 1B5OA 4BMKA 2AY1A 4WB0B 3KKIA 2BKWA 2CY8A 4ISYA 1GBNA 1T3IA 1U08A 4GE4A 1YJZA 5D95A 4ZDLA 1M0PA 3E2FA 2Z67A 4N0WA 3E2ZA 1OXPA 1VP4A 1W7MA 1CL1A 1M4NA 2BIEA 2GMSA 3ASBA 4WD2A 1M6SA 2W8WA 1SF2A 3PPLA 3PD6B 4GE7A 2Z9XA 4AZJA 2WKAA 1V72A 4A0FA 2QMAA 4UHOA 2BI9A 1VJOA 3B8XA 3B1DA 3A9XA 3LVKA 3TFUA 2X5FA 4DBCA 1LW5A 1EQBA 3NUBA 1O69A 3OKSA 1AMSA 1ASMA 1KL2A 3I16A 4IYOB 3W1HA 4BHDA 1AAMA 2WK9A 1KL1A 1GEWA 1OHWA 1AIAA 1AJSA 2VLFA 2YKYA 1MAPA 4F5FA 2YKXA 2HP2A 1PMOA 4U1TA 1P3WA 2VMOA 2GSAA 3AEOA 3HL2A 2TPLA 1AMQA 3CQ6A 4F5MA 1S08A 2ZJGA 2R5CB 3FDBA 1BQAA 3VAXA 1GC2A 3PGYA 1JG8A 3QHXA 1ELQA 4UHMA 1H0CA 2VYCA 4N0BA 5E3KA 1AHXA 2ZSMA 1IX7A 4F5HA 5M4BA 1B9HA 3N0LA 5DJ1A 5G4JA 1AHGA 2YOBA 3GETA 2E7JA 3E9KA 3LVLB 3EI5A 3MAFB 4OTLA 2W7MA 3MBBA 3WCNA 1IX6A 2C7TA 3FRKA 4ADDA 1B5PA 1AY5A 2W7FA 2GQNA 3ZZKA 3ATHA 2HOXA 1M7YA 3QM2A 5FT6A 4A0GA 4OC9A 1JS6A 4OBVA 4RKCA 1GEXA 2FN6A 4AZKA 2G6WA 3ASAA 3AOVA 3B1EA 3QI6A 4ZM4A 2PO3A 2XH1A 4I8AA 4U2HA 2BI3A 4AO4A 4ZM3A 5HXXA 3MKJA 3QN6A 1GCKA 1CJ0A 2WK8A 2YCPA 4E3QA 2AEUA 5M49A 2W7EA 1N2TA 1VEFA 2VMTA 5LHAA 1X28A 4W1WA 4AH3A 5HHYA 4F5JA 4LC3A 4PFFA 1PG8A 1UU1A 1CL2A 4MSOA 1I29A 4MGRA 1SZSA 1MDXA 3L44A 2QA3A 1LK9A 2AATA 5G2QA 2CJDA 2O1BA 3GZDC 3EI8A 3WY7A 4ZDPA 3BWNA 2AY6A 3Q8NA 1UU2A 1O62A 3DRDA 5G2PA 1D7UA 1E5FA 3CQ5A 1G7XA 3MAUA 3JZLA 3BV0A 1QISA 3AENA 5FT4A 3NTJA 4ITXA 1ORDA 1BQDA 1KKPA 5IWQA 2VIBA 1TASA 3E6GA 2E7UA 2PB2A 2V0YA 2F8JA 3EIBA 3ISLA 4FL0A 3AEPA 2VGSA 3GWPA 4IXSA 4UOYA 4XJMA 2HZPA 3AATA 4H51A 2W7IA 4TV7A 1RV4A 2EO5A 3ZRPA 3DXWA 3BS8A 3GZDA 2E54A 1ZOBA 2VMSA 8AATA 2BWPA 4ADCA 4WLJA 3R4TA 1DFOA 3FVXA 4IYOA 3LWSA 4A0HA 3FFHA 2VMZA 1AKBA 3DZZA 3P1TA 4K2BA 5LH9A 3MEBA 1Y4IA 1YAAA 4CXQA 2ZY5A 2VMUA 4DQ6A 1DGDA 4LW2A 3ECDA 4ITGA 1IVRA 1WKGA 3UAKA 3EUCA 1QGNA 2FYFA 4ZLVA 4Q76A 1S09A 2JISA 9AATA 2ZSLA 1B9IA 1ASGA 2BWNA 2D61A 3PA9A 2EZ1A 5EUDA 2O0RA 3COGA 2D65A 4J5UA 3WGCA 1B4XA 1MDOA 1AJRA 2R5CA 5E4ZA 2BI5A 4NOGA 4WBTA 1BW0A 1GC4A 3FQ7A 4JEXA 5EAVA 5TF5A 1IAXA 2HUFA 3I4JA 2ORDA 3AEJC 4F5KA 2OGEA 3RQ1A 1AIBA 1G7WA 3MAFA 2HP1A 1AY4A 3CBFA 3BN1A 2AY3A 2BI1A 3FZ8A 3WGBA 4RJYA 3RCHB 2ZY4A 4KYOA 1AY8A 4M2JA 4RJ0A 1AKCA 4OYTA 1WYTB 4ZSYA 4WLHA 3KGXA 1ASEA 3EZSA 1W3UA 2AY9A 2EH6A 1X2AA 2VMVA 2Z1YA 2QB3A 3DU4A 4KXKA 4A0RA 2OQXA 2CB1A 2D7ZA 3N5MA 4K2MA 3K28A 1ECXA 4OMAA 3WLXA 4OCAA 4E77A 5EUNA 4PVFA 4EB7A 2GB3A 2X5DA 4OBUA 3EZ1A 3LV2A 4XJOA 5BJ4A 4ADBA 2DGKA 3TCMA 1JS3A 1S0AA 1CZEA 4A6RA 1I48A 3FZ6A 2FQ6A 1B8GA 3BWOA 1V2EA 3DR4A 3F0HA 3GSBA 2CJHA 1RVUA 3QBOA 4Q75A 3AEMC 2Z61A 1TOGA 4PFNA 4ZDOA 1AHYA 2BYLA 4M2KA 1C9CA 3WZFA 1WYUA 1W23A 1ZC9A 4UQVA 2FNUA 1I43A 4O6ZA 3H14A 2HOYA 2VGWA 5EIGB 2CSTA 4LNJA 2FM1A 1YJYA 3NU8A 4LNLA 1BJOB 4WYAA 1DJ9A 2Z20A 2CANA 4WYGA 1KMJA 4BA5A 1W7NA 3PDBB 3QPGA 4TMRA 4EMYA 2YKVA 3JWBA 3VOMA 1LC8A 2BIGA 4JEYA 3WKSA 2BWOA 2AY8A 4P3MA 4RKDA 2ZY2A 2JJGA 4XK1A 1C7GA 1SFFA 2AY4A 1IBJA 3ACZA 1ELUA 1BJWA 3E77A 3HBXA 3RBLA 2VMNA 3JW9A 4F4EA 4ZAHA 4LW4A 2C81A 3JU7A 4K2IA 5HDMA 3PDXA 3BC8A 1EG5A 3E2YA 4WYFA 2VMXA 1ASFA 1TPLA 5G4IA 4HVKA 1QJ3A 4ZSWA 1M0QA 1QIRA 3AV7A 1O4SA 1G4VA 3DODA 4WXBA 1M0NA 2YRRA 3OP7A 4EU1A 2W7GA 1OATA 2DOUA 3TQXA 3BCBA 4MQRA 3DYDA 1BKGA 2OKKA 1GD9A 1V2FA 4B98A 4ATPA 2D66A 2DGLA 2DR1A 1DJUA 2ZYJA 2V1PA 3A2BA 2W8UA 1ASDA 4WB0A 5K8BA 3EIAA 1UKJA 4ZWMA 2D5YA 1IJIA 2R5EA 3FZ7A 1ASNA 3ZZJA 1AX4A 3AOWA 1GDEA 3NU7A 1E5EA 1SVVA 1I41A 1X0MA 3RCHA 1ASLA 1D7SA 1MGVA 1GEYA 1AAWA 2Q7WA 2O7CA 2W8VA 3HMUA 4KAMA 1CQ8A 3GJUA 3PD6A 4EB5A 1WYTA 2VMRA 3MC6C 2JJEA 2DGMA 2GMUA 2VMYA 3NRAA 4MY5A 2R2NA 4W5KA 4OT8A 2BIAA 4LNMA 1RVYA 1C0NA 1LS3A 1RV3A 4PIWA 4CXRA 1CS1A 1M32A 2AEVA 2HUIA 3HT4A 2Z9UA 1D2FA 5AX8A 3NX3A 3ELEA 3HDOA 4A00A 3DR7A 2CINA 3FCRA 3EI9A 2CH2A 1W7LA 1BT4A 3IF2A 1SPAA 1FC4A 2JGTA 2E7IA 2W8JA 1JF9A 1TOKA 2D64A 3MC6A 2W7HA 5FT5A 4ZWVA 5DB5A 5G0AA 1TATA 3I5TA 4GE9A 2CH1A 3HVYA 4JEVA 2QLRA 4A6TA 3FSLA 2QBTA 2ZC0A 1OHVA 4P7YA 3PDBA 4Y0IA 2RFVA 1TARA 4BA4A 1ASAA 1BS0A 2QB2A 3FKDA 4RLGA 1DJEA 4IY7A 2CFBA 2EGYA 3FTBA 2R0TA 1DKAA 2C0RA 5I92A 2X3LA 2XBNA 2BI2A 1EJIA 1XEYA 2VMQA 3ZRQA 1WYVB 1QZ9A 3NDNA 2W7LA 1AKAA 1D7RA 5F8VA 1ARIA 3AEJA 2EZ2A 3AENB 1MLZA 2Z9WA 5E5IA 3RUYA 3MADA 4Y0HA 1N31A 4RITA 4B9BA 3CQ4A 4R8DA 1C7OA 2VGVA 2ZUKA 2BYJA 4R5ZA 3W1JA 4A6UA 2EPJA 2OKJA 1J32A 2PB0A 3HLMA 3RI6A 4A72A 3DC1A 2YRIA 3TFTA 3FD0A 3FDDA 3B1CA 4WXGA 2VGZA 1IX8A 1X29A 2JG2A 4Q31A 2VIAA 3UE8A 1Z7DA 4IXZA 1AHFA 3B46A 1MLYA 4MQQA 2Z1ZA 4WYCA 2AY2A 1ARGA 1SZUA 3P6KA 2WK7A 1J04A 3A9ZA 2W7KA 4Y0DA 2W7DA 3JTXA 4GRXA 2C44A 3AELA 3K40A 4ATQA 4IW7A 1LKCA 1M0OA 1Z3ZA 3JWAA 1MAQA 1IAYA 2JJHA 5BJ3A 5EUEA 4AOAA 3T32A 1KMKA 5DX5A 3M5UA 3H7FA 4W1XA 4JE5A 1CQ7A 1TOEA 4F5IA
chains in the Genus database with same CATH superfamily
3PIUA 3L8AA 1BJ4A 3LVJA 3AEMA 3II0A 4TN4A 4W91A 1GC3A 3WCOA 3A9YA 4WYDA 4MKJA 1DGEA 2W8TA 3G7QA 2AY7A 1YIYA 2BHXA 4GSAA 4CBRA 1TOIA 4CVQA 1D7VA 5DJ9A 2HOZA 1CQ6A 2W7JA 3USFA 4JE5D 4JF1A 3W1IA 2D63A 2X8UA 5M4DA 2DKBA 3FQAA 4IX8A 1N8PA 3E2ZB 4XAUA 5D5SA 5EFSA 1LC7A 1AMAA 5EQCA 4R5FA 3NYUA 3GBXA 3UWCA 4R2NA 4WXFA 3R9AA 3NUIA 2NMPA 2OGAA 3HQTA 4RM1A 4XEWA 3PJ0A 2CJGA 3VK3A 4M2MA 2DKJA 1WSTA 1OHYA 3F9TA 1AMRA 4DGTA 2VLHA 3F6TA 1IUGA 1QJ5A 4F5GA 1ARHA 4QGRA 5M46A 3IHJA 2FNIA 3BWNC 4JEWA 3EI6A 2D7YA 4XJLA 1MDZA 1QITA 4Q6RA 1OXOA 1DTYA 1GC0A 4ZASA 4BQ0A 2AY5A 5C6UA 1LC5A 1AJSB 5J8QA 1ZODA 3WKRA 3RBFA 2VMWA 4IXOA 5FT8A 3KGWA 4W1VA 1FG7A 3BB8A 1AHEA 4XJPA 3N4RA 5F9SA 3A8UX 3WX9A 4RIZA 1WYUB 3QGUA 2YKUA 1G4XA 4UHNA 3K7YA 4JF0A 3G0TA 3BCXA 1C4KA 3FVUA 1KKJA 2JJFA 3D6KA 1FG3A 1WYVA 1ASBA 2A1VA 1BJNA 1S06A 2VGTA 1YIZA 4AO9A 1ARSA 2CTZA 1CZCA 3LVMA 5JAYA 1AICA 1H1CA 4FFCA 3FQ8A 4JEZA 4EFFA 4CBSA 4L0OA 4MQPA 4E3RA 3N75A 3VK2A 2Z9VA 1ARTA 1ASCA 4F5LA 1S07A 1WKHA 4WYEA 1YJSA 2HUUA 3DXVA 1V2DA 4MKKA 1C7NA 3FFRA 7AATA 2HORA 2VI8A 2YHKA 3LY1A 4WP0A 2OATA 1TOJA 5EAAA 4ADEA 4GDYA 2FKIA 1PFFA 5EIGA 4E1OA 1PMMA 4J8LA 1BJOA 3ELPA 3GZCA 3KE3A 1YNUA 3VK4A 2VGUA 2YCTA 4GEBA 3ZRRA 4RAEA 2VMPA 2VI9A 1LW4A 3BCAA 3CAIA 3G8MA 3VP6A 3EI7A 4XQ2A 5G09A 1YOOA 3NNKA 3TATA 3NYTA 2ZY3A 1SZKA 3FVSA 1O61A 1UU0A 3LG0A 3NYSA 3PAAA 1XI9A 2YCNA 2ZP7A 3GR9A 4HF8A 4W8IA 1B5OA 4BMKA 2AY1A 4WB0B 3KKIA 2BKWA 2CY8A 4ISYA 1GBNA 1T3IA 1U08A 4GE4A 1YJZA 5D95A 4ZDLA 1M0PA 3E2FA 2Z67A 4N0WA 3E2ZA 1OXPA 1VP4A 1W7MA 1CL1A 1M4NA 2BIEA 2GMSA 3ASBA 4WD2A 1M6SA 2W8WA 1SF2A 3PPLA 3PD6B 4GE7A 2Z9XA 4AZJA 2WKAA 1V72A 2QSRA 4A0FA 2QMAA 4UHOA 3N7NA 2BI9A 1VJOA 3B8XA 3B1DA 3A9XA 3LVKA 3TFUA 2X5FA 4DBCA 1LW5A 1EQBA 3NUBA 1O69A 3OKSA 1AMSA 1ASMA 1KL2A 3I16A 4IYOB 3W1HA 4BHDA 1AAMA 2WK9A 1KL1A 1GEWA 1OHWA 1AIAA 1AJSA 2VLFA 2YKYA 1MAPA 4F5FA 2YKXA 2HP2A 1PMOA 4U1TA 1P3WA 2VMOA 2GSAA 3AEOA 3HL2A 2TPLA 1AMQA 3CQ6A 4F5MA 1S08A 2ZJGA 2R5CB 3FDBA 1BQAA 3VAXA 1GC2A 3PGYA 1JG8A 3QHXA 1ELQA 4UHMA 1H0CA 2VYCA 4N0BA 5E3KA 1AHXA 2ZSMA 1IX7A 4F5HA 5M4BA 1B9HA 3N0LA 5DJ1A 5G4JA 1AHGA 2YOBA 3GETA 2E7JA 3E9KA 3LVLB 3EI5A 3MAFB 4OTLA 2W7MA 3MBBA 3WCNA 1IX6A 2C7TA 3FRKA 4ADDA 1B5PA 1AY5A 2W7FA 2GQNA 3ZZKA 3ATHA 2HOXA 1M7YA 3QM2A 5FT6A 4A0GA 4OC9A 1JS6A 4OBVA 4RKCA 1GEXA 2FN6A 4AZKA 2G6WA 3ASAA 3AOVA 3B1EA 3QI6A 4ZM4A 2PO3A 2XH1A 4I8AA 4U2HA 2BI3A 4AO4A 4ZM3A 5HXXA 3MKJA 3QN6A 1GCKA 1CJ0A 2WK8A 2YCPA 4E3QA 2AEUA 5M49A 2W7EA 1N2TA 1VEFA 2VMTA 5LHAA 1X28A 4W1WA 4AH3A 5HHYA 4F5JA 4LC3A 4PFFA 1PG8A 1UU1A 1CL2A 4MSOA 5KTBA 1I29A 4MGRA 1SZSA 1MDXA 3L44A 2QA3A 1LK9A 2AATA 5G2QA 2CJDA 2O1BA 3GZDC 3EI8A 3WY7A 4ZDPA 3BWNA 2AY6A 3Q8NA 1UU2A 1O62A 3DRDA 5G2PA 1D7UA 1E5FA 3CQ5A 1G7XA 3MAUA 3JZLA 2G7JA 3BV0A 1QISA 3AENA 5FT4A 3NTJA 4ITXA 1ORDA 1BQDA 1KKPA 5IWQA 2VIBA 1TASA 3E6GA 2E7UA 2PB2A 2V0YA 2F8JA 3EIBA 3ISLA 4FL0A 3AEPA 2VGSA 3GWPA 4IXSA 4UOYA 4XJMA 2HZPA 3AATA 4H51A 2W7IA 4TV7A 1RV4A 2EO5A 3ZRPA 3DXWA 3BS8A 3GZDA 2E54A 1ZOBA 2VMSA 8AATA 2BWPA 4ADCA 4WLJA 3R4TA 1DFOA 3FVXA 4IYOA 3LWSA 4A0HA 3FFHA 2VMZA 1AKBA 3DZZA 3P1TA 4K2BA 5LH9A 3N4SA 3MEBA 1Y4IA 1YAAA 4CXQA 2ZY5A 2VMUA 4DQ6A 1DGDA 4LW2A 3ECDA 4ITGA 1IVRA 1WKGA 3UAKA 3EUCA 1QGNA 2FYFA 4ZLVA 4Q76A 1S09A 2JISA 9AATA 1KAFA 2ZSLA 1B9IA 1ASGA 2BWNA 2D61A 3PA9A 2EZ1A 5EUDA 2O0RA 3COGA 2D65A 4J5UA 3WGCA 1B4XA 1MDOA 1AJRA 2R5CA 5E4ZA 2BI5A 4NOGA 4WBTA 1BW0A 1GC4A 3FQ7A 4JEXA 5EAVA 5TF5A 1IAXA 2HUFA 3I4JA 2ORDA 3AEJC 4F5KA 2OGEA 3RQ1A 1AIBA 1G7WA 3MAFA 2HP1A 1AY4A 3CBFA 3BN1A 2AY3A 2BI1A 3FZ8A 3WGBA 4RJYA 3RCHB 2ZY4A 4KYOA 1AY8A 4M2JA 4RJ0A 1AKCA 4OYTA 1WYTB 4ZSYA 4WLHA 3KGXA 1ASEA 3EZSA 1W3UA 2AY9A 2EH6A 1X2AA 2VMVA 2Z1YA 2QB3A 3DU4A 4KXKA 4A0RA 2OQXA 2CB1A 2D7ZA 3N5MA 4K2MA 3K28A 1ECXA 4OMAA 3WLXA 4OCAA 4E77A 2KFPA 5EUNA 4PVFA 4EB7A 2GB3A 2X5DA 4OBUA 3EZ1A 3LV2A 4XJOA 5BJ4A 4ADBA 2DGKA 3TCMA 1JS3A 1S0AA 2EYQA 1CZEA 4A6RA 1I48A 3FZ6A 2FQ6A 1B8GA 3BWOA 1V2EA 3DR4A 3F0HA 3GSBA 2CJHA 1RVUA 3QBOA 4Q75A 3AEMC 2Z61A 1TOGA 4PFNA 4ZDOA 1AHYA 2BYLA 4M2KA 1C9CA 3WZFA 1WYUA 1W23A 1ZC9A 4UQVA 2FNUA 1I43A 4O6ZA 3H14A 2HOYA 2VGWA 5EIGB 3H9XA 2CSTA 4LNJA 2FM1A 1YJYA 3NU8A 4LNLA 1BJOB 4WYAA 4H63Q 1DJ9A 2Z20A 2CANA 4WYGA 1KMJA 4BA5A 1W7NA 3PDBB 3QPGA 4TMRA 4EMYA 2YKVA 3JWBA 3VOMA 1LC8A 2BIGA 4JEYA 3WKSA 2BWOA 2AY8A 4P3MA 4RKDA 2ZY2A 2JJGA 4XK1A 1C7GA 1SFFA 2AY4A 1IBJA 3ACZA 1ELUA 1BJWA 3E77A 3HBXA 3RBLA 2VMNA 3JW9A 4F4EA 4ZAHA 2WB6A 4LW4A 2C81A 3JU7A 4K2IA 5HDMA 3PDXA 3BC8A 1EG5A 3E2YA 4WYFA 2VMXA 1ASFA 1TPLA 5G4IA 4HVKA 1QJ3A 4ZSWA 1M0QA 1QIRA 3AV7A 1O4SA 1G4VA 3DODA 4WXBA 1M0NA 2YRRA 3OP7A 4EU1A 2W7GA 1OATA 2DOUA 3TQXA 3BCBA 4MQRA 3DYDA 1BKGA 2OKKA 1GD9A 1V2FA 4B98A 4ATPA 4K05A 2D66A 2DGLA 2DR1A 1DJUA 2ZYJA 2V1PA 3A2BA 2W8UA 1ASDA 4WB0A 5K8BA 3EIAA 1UKJA 4ZWMA 2D5YA 1IJIA 2R5EA 3FZ7A 1ASNA 3ZZJA 1AX4A 3AOWA 1GDEA 3NU7A 1E5EA 1SVVA 1I41A 1X0MA 3RCHA 1ASLA 1D7SA 1MGVA 1GEYA 1AAWA 2Q7WA 2O7CA 2W8VA 3HMUA 4KAMA 1CQ8A 3GJUA 3PD6A 4EB5A 1WYTA 2VMRA 3MC6C 2JJEA 2DGMA 2GMUA 2VMYA 3NRAA 4MY5A 2R2NA 4W5KA 4OT8A 2BIAA 4LNMA 1RVYA 1C0NA 1LS3A 1RV3A 4PIWA 4CXRA 1CS1A 1M32A 2AEVA 2HUIA 3HT4A 2Z9UA 1D2FA 5AX8A 3NX3A 3ELEA 3HDOA 4A00A 3DR7A 2CINA 3FCRA 3EI9A 2CH2A 1W7LA 1BT4A 3IF2A 1SPAA 1FC4A 2JGTA 2E7IA 2W8JA 1JF9A 1TOKA 2D64A 3MC6A 2W7HA 5FT5A 4ZWVA 5DB5A 5G0AA 1TATA 3I5TA 4GE9A 2CH1A 3HVYA 4JEVA 2QLRA 4A6TA 3FSLA 2QBTA 2ZC0A 1OHVA 4P7YA 3PDBA 4Y0IA 2RFVA 1TARA 4BA4A 1ASAA 1BS0A 2QB2A 3FKDA 4RLGA 1DJEA 4IY7A 2CFBA 2EGYA 3FTBA 2R0TA 1DKAA 2C0RA 5I92A 2X3LA 2XBNA 2BI2A 1EJIA 1XEYA 2VMQA 3ZRQA 1WYVB 1QZ9A 3NDNA 2W7LA 1AKAA 1D7RA 5F8VA 1ARIA 3AEJA 2EZ2A 3AENB 1MLZA 2Z9WA 5E5IA 3RUYA 3MADA 4Y0HA 1N31A 4RITA 4B9BA 3CQ4A 4R8DA 1C7OA 2VGVA 2ZUKA 2BYJA 4R5ZA 3W1JA 4A6UA 2EPJA 2OKJA 1J32A 2PB0A 3HLMA 3RI6A 4A72A 3DC1A 2YRIA 3TFTA 3FD0A 3FDDA 3B1CA 4WXGA 2VGZA 1IX8A 1X29A 2JG2A 4Q31A 2VIAA 3UE8A 1Z7DA 4IXZA 1AHFA 3B46A 1MLYA 4MQQA 2Z1ZA 4WYCA 2AY2A 1ARGA 1SZUA 3P6KA 2WK7A 1J04A 3A9ZA 2W7KA 4Y0DA 2W7DA 3JTXA 4GRXA 2C44A 3AELA 3K40A 4ATQA 3N4XA 4IW7A 1LKCA 1M0OA 1Z3ZA 3JWAA 1MAQA 1IAYA 2JJHA 5BJ3A 5EUEA 4AOAA 3T32A 1KMKA 5DX5A 3M5UA 3H7FA 4W1XA 4JE5A 1CQ7A 1TOEA 4F5IA
chains in the Genus database with same CATH topology
3PIUA 3L8AA 1BJ4A 3LVJA 3AEMA 3II0A 4TN4A 4W91A 1GC3A 3WCOA 3A9YA 4WYDA 4MKJA 1DGEA 2W8TA 3G7QA 2AY7A 1YIYA 2BHXA 4GSAA 4CBRA 1TOIA 4CVQA 1D7VA 5DJ9A 2HOZA 1CQ6A 2W7JA 3USFA 4JE5D 4JF1A 3W1IA 2D63A 2X8UA 5M4DA 2DKBA 3FQAA 4IX8A 1N8PA 3E2ZB 4XAUA 5D5SA 5EFSA 1LC7A 1AMAA 5EQCA 4R5FA 3NYUA 3GBXA 3UWCA 4R2NA 4WXFA 3R9AA 3NUIA 2NMPA 2OGAA 3HQTA 4RM1A 4XEWA 3PJ0A 2CJGA 3VK3A 4M2MA 2DKJA 1WSTA 1OHYA 3F9TA 1AMRA 4DGTA 2VLHA 3F6TA 1IUGA 1QJ5A 4F5GA 1ARHA 4QGRA 5M46A 3IHJA 2FNIA 3BWNC 4JEWA 3EI6A 2D7YA 4XJLA 1MDZA 1QITA 4Q6RA 1OXOA 1DTYA 1GC0A 4ZASA 4BQ0A 2AY5A 5C6UA 1LC5A 1AJSB 5J8QA 1ZODA 3WKRA 3RBFA 2VMWA 4IXOA 5FT8A 3KGWA 4W1VA 1FG7A 3BB8A 1AHEA 4XJPA 3N4RA 5F9SA 3A8UX 3WX9A 4RIZA 1WYUB 3QGUA 2YKUA 1G4XA 4UHNA 3K7YA 4JF0A 3G0TA 3BCXA 1C4KA 3FVUA 1KKJA 2JJFA 3D6KA 1FG3A 1WYVA 1ASBA 2A1VA 1BJNA 1S06A 2VGTA 1YIZA 4AO9A 1ARSA 2CTZA 1CZCA 3LVMA 5JAYA 1AICA 1H1CA 4FFCA 3FQ8A 4JEZA 4EFFA 4CBSA 4L0OA 4MQPA 4E3RA 3N75A 3VK2A 2Z9VA 1ARTA 1ASCA 4F5LA 1S07A 1WKHA 4WYEA 1YJSA 2HUUA 3DXVA 1V2DA 4MKKA 1C7NA 3FFRA 7AATA 2HORA 2VI8A 2YHKA 3LY1A 4WP0A 2OATA 1TOJA 5EAAA 4ADEA 4GDYA 2FKIA 1PFFA 5EIGA 4E1OA 1PMMA 4J8LA 1BJOA 3ELPA 3GZCA 3KE3A 1YNUA 3VK4A 2VGUA 2YCTA 4GEBA 3ZRRA 4RAEA 2VMPA 2VI9A 1LW4A 3BCAA 3CAIA 3G8MA 3VP6A 3EI7A 4XQ2A 5G09A 1YOOA 3NNKA 3TATA 3NYTA 2ZY3A 1SZKA 3FVSA 1O61A 1UU0A 3LG0A 3NYSA 3PAAA 1XI9A 2YCNA 2ZP7A 3GR9A 4HF8A 4W8IA 1B5OA 4BMKA 2AY1A 4WB0B 3KKIA 2BKWA 2CY8A 4ISYA 1GBNA 1T3IA 1U08A 4GE4A 1YJZA 5D95A 4ZDLA 1M0PA 3E2FA 2Z67A 4N0WA 3E2ZA 1OXPA 1VP4A 1W7MA 1CL1A 1M4NA 2BIEA 2GMSA 3ASBA 4WD2A 1M6SA 2W8WA 1SF2A 3PPLA 3PD6B 4GE7A 2Z9XA 4AZJA 2WKAA 1V72A 2QSRA 4A0FA 2QMAA 4UHOA 3N7NA 2BI9A 1VJOA 3B8XA 3B1DA 3A9XA 3LVKA 3TFUA 2X5FA 4DBCA 1LW5A 1EQBA 3NUBA 1O69A 3OKSA 1AMSA 1ASMA 1KL2A 3I16A 4IYOB 3W1HA 4BHDA 1AAMA 2WK9A 1KL1A 1GEWA 1OHWA 1AIAA 1AJSA 2VLFA 2YKYA 1MAPA 4F5FA 2YKXA 2HP2A 1PMOA 4U1TA 1P3WA 2VMOA 2GSAA 3AEOA 3HL2A 2TPLA 1AMQA 3CQ6A 4F5MA 1S08A 2ZJGA 2R5CB 3FDBA 1BQAA 3VAXA 1GC2A 3PGYA 1JG8A 3QHXA 1ELQA 4UHMA 1H0CA 2VYCA 4N0BA 5E3KA 1AHXA 2ZSMA 1IX7A 4F5HA 5M4BA 1B9HA 3N0LA 5DJ1A 5G4JA 1AHGA 2YOBA 3GETA 2E7JA 3E9KA 3LVLB 3EI5A 3MAFB 4OTLA 2W7MA 3MBBA 3WCNA 1IX6A 2C7TA 3FRKA 4ADDA 1B5PA 1AY5A 2W7FA 2GQNA 3ZZKA 3ATHA 2HOXA 1M7YA 3QM2A 5FT6A 4A0GA 4OC9A 1JS6A 4OBVA 4RKCA 1GEXA 2FN6A 4AZKA 2G6WA 3ASAA 3AOVA 3B1EA 3QI6A 4ZM4A 2PO3A 2XH1A 4I8AA 4U2HA 2BI3A 4AO4A 4ZM3A 5HXXA 3MKJA 3QN6A 1GCKA 1CJ0A 2WK8A 2YCPA 4E3QA 2AEUA 5M49A 2W7EA 1N2TA 1VEFA 2VMTA 5LHAA 1X28A 4W1WA 4AH3A 5HHYA 4F5JA 4LC3A 4PFFA 1PG8A 1UU1A 1CL2A 4MSOA 5KTBA 1I29A 4MGRA 1SZSA 1MDXA 3L44A 2QA3A 1LK9A 2AATA 5G2QA 2CJDA 2O1BA 3GZDC 3EI8A 3WY7A 4ZDPA 3BWNA 2AY6A 3Q8NA 1UU2A 1O62A 3DRDA 5G2PA 1D7UA 1E5FA 3CQ5A 1G7XA 3MAUA 3JZLA 2G7JA 3BV0A 1QISA 3AENA 5FT4A 3NTJA 4ITXA 1ORDA 1BQDA 1KKPA 5IWQA 2VIBA 1TASA 3E6GA 2E7UA 2PB2A 2V0YA 2F8JA 3EIBA 3ISLA 4FL0A 3AEPA 2VGSA 3GWPA 4IXSA 4UOYA 4XJMA 2HZPA 3AATA 4H51A 2W7IA 4TV7A 1RV4A 2EO5A 3ZRPA 3DXWA 3BS8A 3GZDA 2E54A 1ZOBA 2VMSA 8AATA 2BWPA 4ADCA 4WLJA 3R4TA 1DFOA 3FVXA 4IYOA 3LWSA 4A0HA 3FFHA 2VMZA 1AKBA 3DZZA 3P1TA 4K2BA 5LH9A 3N4SA 3MEBA 1Y4IA 1YAAA 4CXQA 2ZY5A 2VMUA 4DQ6A 1DGDA 4LW2A 3ECDA 4ITGA 1IVRA 1WKGA 3UAKA 3EUCA 1QGNA 2FYFA 4ZLVA 4Q76A 1S09A 2JISA 9AATA 2ZSLA 1B9IA 1ASGA 2BWNA 2D61A 3PA9A 2EZ1A 5EUDA 2O0RA 3COGA 2D65A 4J5UA 3WGCA 1B4XA 1MDOA 1AJRA 2R5CA 5E4ZA 2BI5A 4NOGA 4WBTA 1BW0A 1GC4A 3FQ7A 4JEXA 5EAVA 5TF5A 1IAXA 2HUFA 3I4JA 2ORDA 3AEJC 4F5KA 2OGEA 3RQ1A 1AIBA 1G7WA 3MAFA 2HP1A 1AY4A 3CBFA 3BN1A 2AY3A 2BI1A 3FZ8A 3WGBA 4RJYA 3RCHB 2ZY4A 4KYOA 1AY8A 4M2JA 4RJ0A 1AKCA 4OYTA 1WYTB 4ZSYA 4WLHA 3KGXA 1ASEA 3EZSA 1W3UA 2AY9A 2EH6A 1X2AA 2VMVA 2Z1YA 2QB3A 3DU4A 4KXKA 4A0RA 2OQXA 2CB1A 2D7ZA 3N5MA 4K2MA 3K28A 1ECXA 4OMAA 3WLXA 4OCAA 4E77A 2KFPA 5EUNA 4PVFA 4EB7A 2GB3A 2X5DA 4OBUA 3EZ1A 3LV2A 4XJOA 5BJ4A 4ADBA 2DGKA 3TCMA 1JS3A 1S0AA 2EYQA 1CZEA 4A6RA 1I48A 3FZ6A 2FQ6A 1B8GA 3BWOA 1V2EA 3DR4A 3F0HA 3GSBA 2CJHA 1RVUA 3QBOA 4Q75A 3AEMC 2Z61A 1TOGA 4PFNA 4ZDOA 1AHYA 2BYLA 4M2KA 1C9CA 3WZFA 1WYUA 1W23A 1ZC9A 4UQVA 2FNUA 1I43A 4O6ZA 3H14A 2HOYA 2VGWA 5EIGB 3H9XA 2CSTA 4LNJA 2FM1A 1YJYA 3NU8A 4LNLA 1BJOB 4WYAA 4H63Q 1DJ9A 2Z20A 2CANA 4WYGA 1KMJA 4BA5A 1W7NA 3PDBB 3QPGA 4TMRA 4EMYA 2YKVA 3JWBA 3VOMA 1LC8A 2BIGA 4JEYA 3WKSA 2BWOA 2AY8A 4P3MA 4RKDA 2ZY2A 2JJGA 4XK1A 1C7GA 1SFFA 2AY4A 1IBJA 3ACZA 1ELUA 1BJWA 3E77A 3HBXA 3RBLA 2VMNA 3JW9A 4F4EA 4ZAHA 2WB6A 4LW4A 2C81A 3JU7A 4K2IA 5HDMA 3PDXA 3BC8A 1EG5A 3E2YA 4WYFA 2VMXA 1ASFA 1TPLA 5G4IA 4HVKA 1QJ3A 4ZSWA 1M0QA 1QIRA 3AV7A 1O4SA 1G4VA 3DODA 4WXBA 1M0NA 2YRRA 3OP7A 4EU1A 2W7GA 1OATA 2DOUA 3TQXA 3BCBA 4MQRA 3DYDA 1BKGA 2OKKA 1GD9A 1V2FA 4B98A 4ATPA 4K05A 2D66A 2DGLA 2DR1A 1DJUA 2ZYJA 2V1PA 3A2BA 2W8UA 1ASDA 4WB0A 5K8BA 3EIAA 1UKJA 4ZWMA 2D5YA 1IJIA 2R5EA 3FZ7A 1ASNA 3ZZJA 1AX4A 3AOWA 1GDEA 3NU7A 1E5EA 1SVVA 1I41A 1X0MA 3RCHA 1ASLA 1D7SA 1MGVA 1GEYA 1AAWA 2Q7WA 2O7CA 2W8VA 3HMUA 4KAMA 1CQ8A 3GJUA 3PD6A 4EB5A 1WYTA 2VMRA 3MC6C 2JJEA 2DGMA 2GMUA 2VMYA 3NRAA 4MY5A 2R2NA 4W5KA 4OT8A 2BIAA 4LNMA 1RVYA 1C0NA 1LS3A 1RV3A 4PIWA 4CXRA 1CS1A 1M32A 2AEVA 2HUIA 3HT4A 2Z9UA 1D2FA 5AX8A 3NX3A 3ELEA 3HDOA 4A00A 3DR7A 2CINA 3FCRA 3EI9A 2CH2A 1W7LA 1BT4A 3IF2A 1SPAA 1FC4A 2JGTA 2E7IA 2W8JA 1JF9A 1TOKA 2D64A 3MC6A 2W7HA 5FT5A 4ZWVA 5DB5A 5G0AA 1TATA 3I5TA 4GE9A 2CH1A 3HVYA 4JEVA 2QLRA 4A6TA 3FSLA 2QBTA 2ZC0A 1OHVA 4P7YA 3PDBA 4Y0IA 2RFVA 1TARA 4BA4A 1ASAA 1BS0A 2QB2A 3FKDA 4RLGA 1DJEA 4IY7A 2CFBA 2EGYA 3FTBA 2R0TA 1DKAA 2C0RA 5I92A 2X3LA 2XBNA 2BI2A 1EJIA 1XEYA 2VMQA 3ZRQA 1WYVB 1QZ9A 3NDNA 2W7LA 1AKAA 1D7RA 5F8VA 1ARIA 3AEJA 2EZ2A 3AENB 1MLZA 2Z9WA 5E5IA 3RUYA 3MADA 4Y0HA 1N31A 4RITA 4B9BA 3CQ4A 4R8DA 1C7OA 2VGVA 2ZUKA 2BYJA 4R5ZA 3W1JA 4A6UA 2EPJA 2OKJA 1J32A 2PB0A 3HLMA 3RI6A 4A72A 3DC1A 2YRIA 3TFTA 3FD0A 3FDDA 3B1CA 4WXGA 2VGZA 1IX8A 1X29A 2JG2A 4Q31A 2VIAA 3UE8A 1Z7DA 4IXZA 1AHFA 3B46A 1MLYA 4MQQA 2Z1ZA 4WYCA 2AY2A 1ARGA 1SZUA 3P6KA 2WK7A 1J04A 3A9ZA 2W7KA 4Y0DA 2W7DA 3JTXA 4GRXA 2C44A 3AELA 3K40A 4ATQA 3N4XA 4IW7A 1LKCA 1M0OA 1Z3ZA 3JWAA 1MAQA 1IAYA 2JJHA 5BJ3A 5EUEA 4AOAA 3T32A 1KMKA 5DX5A 3M5UA 3H7FA 4W1XA 4JE5A 1CQ7A 1TOEA 4F5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIU A;  3L8A A;  1BJ4 A;  3LVJ A;  3AEM A;  3II0 A;  4TN4 A;  4W91 A;  1GC3 A;  3WCO A;  3A9Y A;  4WYD A;  4MKJ A;  1DGE A;  2W8T A;  3G7Q A;  2AY7 A;  1YIY A;  2BHX A;  4GSA A;  4CBR A;  1TOI A;  4CVQ A;  1D7V A;  5DJ9 A;  2HOZ A;  1CQ6 A;  2W7J A;  3USF A;  4JE5 D;  4JF1 A;  3W1I A;  2D63 A;  2X8U A;  5M4D A;  2DKB A;  3FQA A;  4IX8 A;  1N8P A;  3E2Z B;  4XAU A;  5D5S A;  5EFS A;  1LC7 A;  1AMA A;  5EQC A;  4R5F A;  3NYU A;  3GBX A;  3UWC A;  4R2N A;  4WXF A;  3R9A A;  3NUI A;  2NMP A;  2OGA A;  3HQT A;  4RM1 A;  4XEW A;  3PJ0 A;  2CJG A;  3VK3 A;  4M2M A;  2DKJ A;  1WST A;  1OHY A;  3F9T A;  1AMR A;  4DGT A;  2VLH A;  3F6T A;  1IUG A;  1QJ5 A;  4F5G A;  1ARH A;  4QGR A;  5M46 A;  3IHJ A;  2FNI A;  3BWN C;  4JEW A;  3EI6 A;  2D7Y A;  4XJL A;  1MDZ A;  1QIT A;  4Q6R A;  1OXO A;  1DTY A;  1GC0 A;  4ZAS A;  4BQ0 A;  2AY5 A;  5C6U A;  1LC5 A;  1AJS B;  5J8Q A;  1ZOD A;  3WKR A;  3RBF A;  2VMW A;  4IXO A;  5FT8 A;  3KGW A;  4W1V A;  1FG7 A;  3BB8 A;  1AHE A;  4XJP A;  5F9S A;  3A8U X;  3WX9 A;  4RIZ A;  1WYU B;  3QGU A;  2YKU A;  1G4X A;  4UHN A;  3K7Y A;  4JF0 A;  3G0T A;  3BCX A;  1C4K A;  3FVU A;  1KKJ A;  2JJF A;  3D6K A;  1FG3 A;  1WYV A;  1ASB A;  1BJN A;  1S06 A;  2VGT A;  1YIZ A;  4AO9 A;  1ARS A;  2CTZ A;  1CZC A;  3LVM A;  5JAY A;  1AIC A;  1H1C A;  4FFC A;  3FQ8 A;  4JEZ A;  4EFF A;  4CBS A;  4L0O A;  4MQP A;  4E3R A;  3N75 A;  3VK2 A;  2Z9V A;  1ART A;  1ASC A;  4F5L A;  1S07 A;  1WKH A;  4WYE A;  1YJS A;  2HUU A;  3DXV A;  1V2D A;  4MKK A;  1C7N A;  3FFR A;  7AAT A;  2HOR A;  2VI8 A;  2YHK A;  3LY1 A;  4WP0 A;  2OAT A;  1TOJ A;  5EAA A;  4ADE A;  4GDY A;  1PFF A;  5EIG A;  4E1O A;  1PMM A;  4J8L A;  1BJO A;  3ELP A;  3GZC A;  3KE3 A;  1YNU A;  3VK4 A;  2VGU A;  2YCT A;  4GEB A;  3ZRR A;  4RAE A;  2VMP A;  2VI9 A;  1LW4 A;  3BCA A;  3CAI A;  3G8M A;  3VP6 A;  3EI7 A;  4XQ2 A;  5G09 A;  1YOO A;  3NNK A;  3TAT A;  3NYT A;  2ZY3 A;  1SZK A;  3FVS A;  1O61 A;  1UU0 A;  3LG0 A;  3NYS A;  3PAA A;  1XI9 A;  2YCN A;  2ZP7 A;  3GR9 A;  4HF8 A;  4W8I A;  1B5O A;  4BMK A;  2AY1 A;  4WB0 B;  3KKI A;  2BKW A;  2CY8 A;  4ISY A;  1GBN A;  1T3I A;  1U08 A;  4GE4 A;  1YJZ A;  5D95 A;  4ZDL A;  1M0P A;  3E2F A;  2Z67 A;  4N0W A;  3E2Z A;  1OXP A;  1VP4 A;  1W7M A;  1CL1 A;  1M4N A;  2BIE A;  2GMS A;  3ASB A;  4WD2 A;  1M6S A;  2W8W A;  1SF2 A;  3PPL A;  3PD6 B;  4GE7 A;  2Z9X A;  4AZJ A;  2WKA A;  1V72 A;  4A0F A;  2QMA A;  4UHO A;  2BI9 A;  1VJO A;  3B8X A;  3B1D A;  3A9X A;  3LVK A;  3TFU A;  2X5F A;  4DBC A;  1LW5 A;  1EQB A;  3NUB A;  1O69 A;  3OKS A;  1AMS A;  1ASM A;  1KL2 A;  3I16 A;  4IYO B;  3W1H A;  4BHD A;  1AAM A;  2WK9 A;  1KL1 A;  1GEW A;  1OHW A;  1AIA A;  1AJS A;  2VLF A;  2YKY A;  1MAP A;  4F5F A;  2YKX A;  2HP2 A;  1PMO A;  4U1T A;  1P3W A;  2VMO A;  2GSA A;  3AEO A;  3HL2 A;  2TPL A;  1AMQ A;  3CQ6 A;  4F5M A;  1S08 A;  2ZJG A;  2R5C B;  3FDB A;  1BQA A;  3VAX A;  1GC2 A;  3PGY A;  1JG8 A;  3QHX A;  1ELQ A;  4UHM A;  1H0C A;  2VYC A;  4N0B A;  5E3K A;  1AHX A;  2ZSM A;  1IX7 A;  4F5H A;  5M4B A;  1B9H A;  3N0L A;  5DJ1 A;  5G4J A;  1AHG A;  2YOB A;  3GET A;  2E7J A;  3E9K A;  3LVL B;  3EI5 A;  3MAF B;  4OTL A;  2W7M A;  3MBB A;  3WCN A;  1IX6 A;  2C7T A;  3FRK A;  4ADD A;  1B5P A;  1AY5 A;  2W7F A;  2GQN A;  3ZZK A;  3ATH A;  2HOX A;  1M7Y A;  3QM2 A;  5FT6 A;  4A0G A;  4OC9 A;  1JS6 A;  4OBV A;  4RKC A;  1GEX A;  2FN6 A;  4AZK A;  2G6W A;  3ASA A;  3AOV A;  3B1E A;  3QI6 A;  4ZM4 A;  2PO3 A;  2XH1 A;  4I8A A;  4U2H A;  2BI3 A;  4AO4 A;  4ZM3 A;  5HXX A;  3MKJ A;  3QN6 A;  1GCK A;  1CJ0 A;  2WK8 A;  2YCP A;  4E3Q A;  2AEU A;  5M49 A;  2W7E A;  1N2T A;  1VEF A;  2VMT A;  5LHA A;  1X28 A;  4W1W A;  4AH3 A;  5HHY A;  4F5J A;  4LC3 A;  4PFF A;  1PG8 A;  1UU1 A;  1CL2 A;  4MSO A;  1I29 A;  4MGR A;  1SZS A;  1MDX A;  3L44 A;  2QA3 A;  1LK9 A;  2AAT A;  5G2Q A;  2CJD A;  2O1B A;  3GZD C;  3EI8 A;  3WY7 A;  4ZDP A;  3BWN A;  2AY6 A;  3Q8N A;  1UU2 A;  1O62 A;  3DRD A;  5G2P A;  1D7U A;  1E5F A;  3CQ5 A;  1G7X A;  3MAU A;  3JZL A;  3BV0 A;  1QIS A;  3AEN A;  5FT4 A;  3NTJ A;  4ITX A;  1ORD A;  1BQD A;  1KKP A;  5IWQ A;  2VIB A;  1TAS A;  3E6G A;  2E7U A;  2PB2 A;  2V0Y A;  2F8J A;  3EIB A;  3ISL A;  4FL0 A;  3AEP A;  2VGS A;  3GWP A;  4IXS A;  4UOY A;  4XJM A;  2HZP A;  3AAT A;  4H51 A;  2W7I A;  4TV7 A;  1RV4 A;  2EO5 A;  3ZRP A;  3DXW A;  3BS8 A;  3GZD A;  2E54 A;  1ZOB A;  2VMS A;  8AAT A;  2BWP A;  4ADC A;  4WLJ A;  3R4T A;  1DFO A;  3FVX A;  4IYO A;  3LWS A;  4A0H A;  3FFH A;  2VMZ A;  1AKB A;  3DZZ A;  3P1T A;  4K2B A;  5LH9 A;  3MEB A;  1Y4I A;  1YAA A;  4CXQ A;  2ZY5 A;  2VMU A;  4DQ6 A;  1DGD A;  4LW2 A;  3ECD A;  4ITG A;  1IVR A;  1WKG A;  3UAK A;  3EUC A;  1QGN A;  2FYF A;  4ZLV A;  4Q76 A;  1S09 A;  2JIS A;  9AAT A;  2ZSL A;  1B9I A;  1ASG A;  2BWN A;  2D61 A;  3PA9 A;  2EZ1 A;  5EUD A;  2O0R A;  3COG A;  2D65 A;  4J5U A;  3WGC A;  1B4X A;  1MDO A;  1AJR A;  2R5C A;  5E4Z A;  2BI5 A;  4NOG A;  4WBT A;  1BW0 A;  1GC4 A;  3FQ7 A;  4JEX A;  5EAV A;  5TF5 A;  1IAX A;  2HUF A;  3I4J A;  2ORD A;  3AEJ C;  4F5K A;  2OGE A;  3RQ1 A;  1AIB A;  1G7W A;  3MAF A;  2HP1 A;  1AY4 A;  3CBF A;  3BN1 A;  2AY3 A;  2BI1 A;  3FZ8 A;  3WGB A;  4RJY A;  3RCH B;  2ZY4 A;  4KYO A;  1AY8 A;  4M2J A;  4RJ0 A;  1AKC A;  4OYT A;  1WYT B;  4ZSY A;  4WLH A;  3KGX A;  1ASE A;  3EZS A;  1W3U A;  2AY9 A;  2EH6 A;  1X2A A;  2VMV A;  2Z1Y A;  2QB3 A;  3DU4 A;  4KXK A;  4A0R A;  2OQX A;  2CB1 A;  2D7Z A;  3N5M A;  4K2M A;  3K28 A;  1ECX A;  4OMA A;  3WLX A;  4OCA A;  4E77 A;  5EUN A;  4PVF A;  4EB7 A;  2GB3 A;  2X5D A;  4OBU A;  3EZ1 A;  3LV2 A;  4XJO A;  5BJ4 A;  4ADB A;  2DGK A;  3TCM A;  1JS3 A;  1S0A A;  1CZE A;  4A6R A;  1I48 A;  3FZ6 A;  2FQ6 A;  1B8G A;  3BWO A;  1V2E A;  3DR4 A;  3F0H A;  3GSB A;  2CJH A;  1RVU A;  3QBO A;  4Q75 A;  3AEM C;  2Z61 A;  1TOG A;  4PFN A;  4ZDO A;  1AHY A;  2BYL A;  4M2K A;  1C9C A;  3WZF A;  1WYU A;  1W23 A;  1ZC9 A;  4UQV A;  2FNU A;  1I43 A;  4O6Z A;  3H14 A;  2HOY A;  2VGW A;  5EIG B;  2CST A;  4LNJ A;  2FM1 A;  1YJY A;  3NU8 A;  4LNL A;  1BJO B;  4WYA A;  1DJ9 A;  2Z20 A;  2CAN A;  4WYG A;  1KMJ A;  4BA5 A;  1W7N A;  3PDB B;  3QPG A;  4TMR A;  4EMY A;  2YKV A;  3JWB A;  3VOM A;  1LC8 A;  2BIG A;  4JEY A;  3WKS A;  2BWO A;  2AY8 A;  4P3M A;  4RKD A;  2ZY2 A;  2JJG A;  4XK1 A;  1C7G A;  1SFF A;  2AY4 A;  1IBJ A;  3ACZ A;  1ELU A;  1BJW A;  3E77 A;  3HBX A;  3RBL A;  2VMN A;  3JW9 A;  4F4E A;  4ZAH A;  4LW4 A;  2C81 A;  3JU7 A;  4K2I A;  5HDM A;  3PDX A;  3BC8 A;  1EG5 A;  3E2Y A;  4WYF A;  2VMX A;  1ASF A;  1TPL A;  5G4I A;  4HVK A;  1QJ3 A;  4ZSW A;  1M0Q A;  1QIR A;  3AV7 A;  1O4S A;  1G4V A;  3DOD A;  4WXB A;  1M0N A;  2YRR A;  3OP7 A;  4EU1 A;  2W7G A;  1OAT A;  2DOU A;  3TQX A;  3BCB A;  4MQR A;  3DYD A;  1BKG A;  2OKK A;  1GD9 A;  1V2F A;  4B98 A;  4ATP A;  2D66 A;  2DGL A;  2DR1 A;  1DJU A;  2ZYJ A;  2V1P A;  3A2B A;  2W8U A;  1ASD A;  4WB0 A;  5K8B A;  3EIA A;  1UKJ A;  4ZWM A;  2D5Y A;  1IJI A;  2R5E A;  3FZ7 A;  1ASN A;  3ZZJ A;  1AX4 A;  3AOW A;  1GDE A;  3NU7 A;  1E5E A;  1SVV A;  1I41 A;  1X0M A;  3RCH A;  1ASL A;  1D7S A;  1MGV A;  1GEY A;  1AAW A;  2Q7W A;  2O7C A;  2W8V A;  3HMU A;  4KAM A;  1CQ8 A;  3GJU A;  3PD6 A;  4EB5 A;  1WYT A;  2VMR A;  3MC6 C;  2JJE A;  2DGM A;  2GMU A;  2VMY A;  3NRA A;  4MY5 A;  2R2N A;  4W5K A;  4OT8 A;  2BIA A;  4LNM A;  1RVY A;  1C0N A;  1LS3 A;  1RV3 A;  4PIW A;  4CXR A;  1CS1 A;  1M32 A;  2AEV A;  2HUI A;  3HT4 A;  2Z9U A;  1D2F A;  5AX8 A;  3NX3 A;  3ELE A;  3HDO A;  4A00 A;  3DR7 A;  2CIN A;  3FCR A;  3EI9 A;  2CH2 A;  1W7L A;  1BT4 A;  3IF2 A;  1SPA A;  1FC4 A;  2JGT A;  2E7I A;  2W8J A;  1JF9 A;  1TOK A;  2D64 A;  3MC6 A;  2W7H A;  5FT5 A;  4ZWV A;  5DB5 A;  5G0A A;  1TAT A;  3I5T A;  4GE9 A;  2CH1 A;  3HVY A;  4JEV A;  2QLR A;  4A6T A;  3FSL A;  2QBT A;  2ZC0 A;  1OHV A;  4P7Y A;  3PDB A;  4Y0I A;  2RFV A;  1TAR A;  4BA4 A;  1ASA A;  1BS0 A;  2QB2 A;  3FKD A;  4RLG A;  1DJE A;  4IY7 A;  2CFB A;  2EGY A;  3FTB A;  2R0T A;  1DKA A;  2C0R A;  5I92 A;  2X3L A;  2XBN A;  2BI2 A;  1EJI A;  1XEY A;  2VMQ A;  3ZRQ A;  1WYV B;  1QZ9 A;  3NDN A;  2W7L A;  1AKA A;  1D7R A;  5F8V A;  1ARI A;  3AEJ A;  2EZ2 A;  3AEN B;  1MLZ A;  2Z9W A;  5E5I A;  3RUY A;  3MAD A;  4Y0H A;  1N31 A;  4RIT A;  4B9B A;  3CQ4 A;  4R8D A;  1C7O A;  2VGV A;  2ZUK A;  2BYJ A;  4R5Z A;  3W1J A;  4A6U A;  2EPJ A;  2OKJ A;  1J32 A;  2PB0 A;  3HLM A;  3RI6 A;  4A72 A;  3DC1 A;  2YRI A;  3TFT A;  3FD0 A;  3FDD A;  3B1C A;  4WXG A;  2VGZ A;  1IX8 A;  1X29 A;  2JG2 A;  4Q31 A;  2VIA A;  3UE8 A;  1Z7D A;  4IXZ A;  1AHF A;  3B46 A;  1MLY A;  4MQQ A;  2Z1Z A;  4WYC A;  2AY2 A;  1ARG A;  1SZU A;  3P6K A;  2WK7 A;  1J04 A;  3A9Z A;  2W7K A;  4Y0D A;  2W7D A;  3JTX A;  4GRX A;  2C44 A;  3AEL A;  3K40 A;  4ATQ A;  4IW7 A;  1LKC A;  1M0O A;  1Z3Z A;  3JWA A;  1MAQ A;  1IAY A;  2JJH A;  5BJ3 A;  5EUE A;  4AOA A;  3T32 A;  1KMK A;  5DX5 A;  3M5U A;  3H7F A;  4W1X A;  4JE5 A;  1CQ7 A;  1TOE A;  4F5I A; 
#chains in the Genus database with same CATH topology
 3PIU A;  3L8A A;  1BJ4 A;  3LVJ A;  3AEM A;  3II0 A;  4TN4 A;  4W91 A;  1GC3 A;  3WCO A;  3A9Y A;  4WYD A;  4MKJ A;  1DGE A;  2W8T A;  3G7Q A;  2AY7 A;  1YIY A;  2BHX A;  4GSA A;  4CBR A;  1TOI A;  4CVQ A;  1D7V A;  5DJ9 A;  2HOZ A;  1CQ6 A;  2W7J A;  3USF A;  4JE5 D;  4JF1 A;  3W1I A;  2D63 A;  2X8U A;  5M4D A;  2DKB A;  3FQA A;  4IX8 A;  1N8P A;  3E2Z B;  4XAU A;  5D5S A;  5EFS A;  1LC7 A;  1AMA A;  5EQC A;  4R5F A;  3NYU A;  3GBX A;  3UWC A;  4R2N A;  4WXF A;  3R9A A;  3NUI A;  2NMP A;  2OGA A;  3HQT A;  4RM1 A;  4XEW A;  3PJ0 A;  2CJG A;  3VK3 A;  4M2M A;  2DKJ A;  1WST A;  1OHY A;  3F9T A;  1AMR A;  4DGT A;  2VLH A;  3F6T A;  1IUG A;  1QJ5 A;  4F5G A;  1ARH A;  4QGR A;  5M46 A;  3IHJ A;  2FNI A;  3BWN C;  4JEW A;  3EI6 A;  2D7Y A;  4XJL A;  1MDZ A;  1QIT A;  4Q6R A;  1OXO A;  1DTY A;  1GC0 A;  4ZAS A;  4BQ0 A;  2AY5 A;  5C6U A;  1LC5 A;  1AJS B;  5J8Q A;  1ZOD A;  3WKR A;  3RBF A;  2VMW A;  4IXO A;  5FT8 A;  3KGW A;  4W1V A;  1FG7 A;  3BB8 A;  1AHE A;  4XJP A;  3N4R A;  5F9S A;  3A8U X;  3WX9 A;  4RIZ A;  1WYU B;  3QGU A;  2YKU A;  1G4X A;  4UHN A;  3K7Y A;  4JF0 A;  3G0T A;  3BCX A;  1C4K A;  3FVU A;  1KKJ A;  2JJF A;  3D6K A;  1FG3 A;  1WYV A;  1ASB A;  2A1V A;  1BJN A;  1S06 A;  2VGT A;  1YIZ A;  4AO9 A;  1ARS A;  2CTZ A;  1CZC A;  3LVM A;  5JAY A;  1AIC A;  1H1C A;  4FFC A;  3FQ8 A;  4JEZ A;  4EFF A;  4CBS A;  4L0O A;  4MQP A;  4E3R A;  3N75 A;  3VK2 A;  2Z9V A;  1ART A;  1ASC A;  4F5L A;  1S07 A;  1WKH A;  4WYE A;  1YJS A;  2HUU A;  3DXV A;  1V2D A;  4MKK A;  1C7N A;  3FFR A;  7AAT A;  2HOR A;  2VI8 A;  2YHK A;  3LY1 A;  4WP0 A;  2OAT A;  1TOJ A;  5EAA A;  4ADE A;  4GDY A;  2FKI A;  1PFF A;  5EIG A;  4E1O A;  1PMM A;  4J8L A;  1BJO A;  3ELP A;  3GZC A;  3KE3 A;  1YNU A;  3VK4 A;  2VGU A;  2YCT A;  4GEB A;  3ZRR A;  4RAE A;  2VMP A;  2VI9 A;  1LW4 A;  3BCA A;  3CAI A;  3G8M A;  3VP6 A;  3EI7 A;  4XQ2 A;  5G09 A;  1YOO A;  3NNK A;  3TAT A;  3NYT A;  2ZY3 A;  1SZK A;  3FVS A;  1O61 A;  1UU0 A;  3LG0 A;  3NYS A;  3PAA A;  1XI9 A;  2YCN A;  2ZP7 A;  3GR9 A;  4HF8 A;  4W8I A;  1B5O A;  4BMK A;  2AY1 A;  4WB0 B;  3KKI A;  2BKW A;  2CY8 A;  4ISY A;  1GBN A;  1T3I A;  1U08 A;  4GE4 A;  1YJZ A;  5D95 A;  4ZDL A;  1M0P A;  3E2F A;  2Z67 A;  4N0W A;  3E2Z A;  1OXP A;  1VP4 A;  1W7M A;  1CL1 A;  1M4N A;  2BIE A;  2GMS A;  3ASB A;  4WD2 A;  1M6S A;  2W8W A;  1SF2 A;  3PPL A;  3PD6 B;  4GE7 A;  2Z9X A;  4AZJ A;  2WKA A;  1V72 A;  2QSR A;  4A0F A;  2QMA A;  4UHO A;  3N7N A;  2BI9 A;  1VJO A;  3B8X A;  3B1D A;  3A9X A;  3LVK A;  3TFU A;  2X5F A;  4DBC A;  1LW5 A;  1EQB A;  3NUB A;  1O69 A;  3OKS A;  1AMS A;  1ASM A;  1KL2 A;  3I16 A;  4IYO B;  3W1H A;  4BHD A;  1AAM A;  2WK9 A;  1KL1 A;  1GEW A;  1OHW A;  1AIA A;  1AJS A;  2VLF A;  2YKY A;  1MAP A;  4F5F A;  2YKX A;  2HP2 A;  1PMO A;  4U1T A;  1P3W A;  2VMO A;  2GSA A;  3AEO A;  3HL2 A;  2TPL A;  1AMQ A;  3CQ6 A;  4F5M A;  1S08 A;  2ZJG A;  2R5C B;  3FDB A;  1BQA A;  3VAX A;  1GC2 A;  3PGY A;  1JG8 A;  3QHX A;  1ELQ A;  4UHM A;  1H0C A;  2VYC A;  4N0B A;  5E3K A;  1AHX A;  2ZSM A;  1IX7 A;  4F5H A;  5M4B A;  1B9H A;  3N0L A;  5DJ1 A;  5G4J A;  1AHG A;  2YOB A;  3GET A;  2E7J A;  3E9K A;  3LVL B;  3EI5 A;  3MAF B;  4OTL A;  2W7M A;  3MBB A;  3WCN A;  1IX6 A;  2C7T A;  3FRK A;  4ADD A;  1B5P A;  1AY5 A;  2W7F A;  2GQN A;  3ZZK A;  3ATH A;  2HOX A;  1M7Y A;  3QM2 A;  5FT6 A;  4A0G A;  4OC9 A;  1JS6 A;  4OBV A;  4RKC A;  1GEX A;  2FN6 A;  4AZK A;  2G6W A;  3ASA A;  3AOV A;  3B1E A;  3QI6 A;  4ZM4 A;  2PO3 A;  2XH1 A;  4I8A A;  4U2H A;  2BI3 A;  4AO4 A;  4ZM3 A;  5HXX A;  3MKJ A;  3QN6 A;  1GCK A;  1CJ0 A;  2WK8 A;  2YCP A;  4E3Q A;  2AEU A;  5M49 A;  2W7E A;  1N2T A;  1VEF A;  2VMT A;  5LHA A;  1X28 A;  4W1W A;  4AH3 A;  5HHY A;  4F5J A;  4LC3 A;  4PFF A;  1PG8 A;  1UU1 A;  1CL2 A;  4MSO A;  5KTB A;  1I29 A;  4MGR A;  1SZS A;  1MDX A;  3L44 A;  2QA3 A;  1LK9 A;  2AAT A;  5G2Q A;  2CJD A;  2O1B A;  3GZD C;  3EI8 A;  3WY7 A;  4ZDP A;  3BWN A;  2AY6 A;  3Q8N A;  1UU2 A;  1O62 A;  3DRD A;  5G2P A;  1D7U A;  1E5F A;  3CQ5 A;  1G7X A;  3MAU A;  3JZL A;  2G7J A;  3BV0 A;  1QIS A;  3AEN A;  5FT4 A;  3NTJ A;  4ITX A;  1ORD A;  1BQD A;  1KKP A;  5IWQ A;  2VIB A;  1TAS A;  3E6G A;  2E7U A;  2PB2 A;  2V0Y A;  2F8J A;  3EIB A;  3ISL A;  4FL0 A;  3AEP A;  2VGS A;  3GWP A;  4IXS A;  4UOY A;  4XJM A;  2HZP A;  3AAT A;  4H51 A;  2W7I A;  4TV7 A;  1RV4 A;  2EO5 A;  3ZRP A;  3DXW A;  3BS8 A;  3GZD A;  2E54 A;  1ZOB A;  2VMS A;  8AAT A;  2BWP A;  4ADC A;  4WLJ A;  3R4T A;  1DFO A;  3FVX A;  4IYO A;  3LWS A;  4A0H A;  3FFH A;  2VMZ A;  1AKB A;  3DZZ A;  3P1T A;  4K2B A;  5LH9 A;  3N4S A;  3MEB A;  1Y4I A;  1YAA A;  4CXQ A;  2ZY5 A;  2VMU A;  4DQ6 A;  1DGD A;  4LW2 A;  3ECD A;  4ITG A;  1IVR A;  1WKG A;  3UAK A;  3EUC A;  1QGN A;  2FYF A;  4ZLV A;  4Q76 A;  1S09 A;  2JIS A;  9AAT A;  1KAF A;  2ZSL A;  1B9I A;  1ASG A;  2BWN A;  2D61 A;  3PA9 A;  2EZ1 A;  5EUD A;  2O0R A;  3COG A;  2D65 A;  4J5U A;  3WGC A;  1B4X A;  1MDO A;  1AJR A;  2R5C A;  5E4Z A;  2BI5 A;  4NOG A;  4WBT A;  1BW0 A;  1GC4 A;  3FQ7 A;  4JEX A;  5EAV A;  5TF5 A;  1IAX A;  2HUF A;  3I4J A;  2ORD A;  3AEJ C;  4F5K A;  2OGE A;  3RQ1 A;  1AIB A;  1G7W A;  3MAF A;  2HP1 A;  1AY4 A;  3CBF A;  3BN1 A;  2AY3 A;  2BI1 A;  3FZ8 A;  3WGB A;  4RJY A;  3RCH B;  2ZY4 A;  4KYO A;  1AY8 A;  4M2J A;  4RJ0 A;  1AKC A;  4OYT A;  1WYT B;  4ZSY A;  4WLH A;  3KGX A;  1ASE A;  3EZS A;  1W3U A;  2AY9 A;  2EH6 A;  1X2A A;  2VMV A;  2Z1Y A;  2QB3 A;  3DU4 A;  4KXK A;  4A0R A;  2OQX A;  2CB1 A;  2D7Z A;  3N5M A;  4K2M A;  3K28 A;  1ECX A;  4OMA A;  3WLX A;  4OCA A;  4E77 A;  2KFP A;  5EUN A;  4PVF A;  4EB7 A;  2GB3 A;  2X5D A;  4OBU A;  3EZ1 A;  3LV2 A;  4XJO A;  5BJ4 A;  4ADB A;  2DGK A;  3TCM A;  1JS3 A;  1S0A A;  2EYQ A;  1CZE A;  4A6R A;  1I48 A;  3FZ6 A;  2FQ6 A;  1B8G A;  3BWO A;  1V2E A;  3DR4 A;  3F0H A;  3GSB A;  2CJH A;  1RVU A;  3QBO A;  4Q75 A;  3AEM C;  2Z61 A;  1TOG A;  4PFN A;  4ZDO A;  1AHY A;  2BYL A;  4M2K A;  1C9C A;  3WZF A;  1WYU A;  1W23 A;  1ZC9 A;  4UQV A;  2FNU A;  1I43 A;  4O6Z A;  3H14 A;  2HOY A;  2VGW A;  5EIG B;  3H9X A;  2CST A;  4LNJ A;  2FM1 A;  1YJY A;  3NU8 A;  4LNL A;  1BJO B;  4WYA A;  4H63 Q;  1DJ9 A;  2Z20 A;  2CAN A;  4WYG A;  1KMJ A;  4BA5 A;  1W7N A;  3PDB B;  3QPG A;  4TMR A;  4EMY A;  2YKV A;  3JWB A;  3VOM A;  1LC8 A;  2BIG A;  4JEY A;  3WKS A;  2BWO A;  2AY8 A;  4P3M A;  4RKD A;  2ZY2 A;  2JJG A;  4XK1 A;  1C7G A;  1SFF A;  2AY4 A;  1IBJ A;  3ACZ A;  1ELU A;  1BJW A;  3E77 A;  3HBX A;  3RBL A;  2VMN A;  3JW9 A;  4F4E A;  4ZAH A;  2WB6 A;  4LW4 A;  2C81 A;  3JU7 A;  4K2I A;  5HDM A;  3PDX A;  3BC8 A;  1EG5 A;  3E2Y A;  4WYF A;  2VMX A;  1ASF A;  1TPL A;  5G4I A;  4HVK A;  1QJ3 A;  4ZSW A;  1M0Q A;  1QIR A;  3AV7 A;  1O4S A;  1G4V A;  3DOD A;  4WXB A;  1M0N A;  2YRR A;  3OP7 A;  4EU1 A;  2W7G A;  1OAT A;  2DOU A;  3TQX A;  3BCB A;  4MQR A;  3DYD A;  1BKG A;  2OKK A;  1GD9 A;  1V2F A;  4B98 A;  4ATP A;  4K05 A;  2D66 A;  2DGL A;  2DR1 A;  1DJU A;  2ZYJ A;  2V1P A;  3A2B A;  2W8U A;  1ASD A;  4WB0 A;  5K8B A;  3EIA A;  1UKJ A;  4ZWM A;  2D5Y A;  1IJI A;  2R5E A;  3FZ7 A;  1ASN A;  3ZZJ A;  1AX4 A;  3AOW A;  1GDE A;  3NU7 A;  1E5E A;  1SVV A;  1I41 A;  1X0M A;  3RCH A;  1ASL A;  1D7S A;  1MGV A;  1GEY A;  1AAW A;  2Q7W A;  2O7C A;  2W8V A;  3HMU A;  4KAM A;  1CQ8 A;  3GJU A;  3PD6 A;  4EB5 A;  1WYT A;  2VMR A;  3MC6 C;  2JJE A;  2DGM A;  2GMU A;  2VMY A;  3NRA A;  4MY5 A;  2R2N A;  4W5K A;  4OT8 A;  2BIA A;  4LNM A;  1RVY A;  1C0N A;  1LS3 A;  1RV3 A;  4PIW A;  4CXR A;  1CS1 A;  1M32 A;  2AEV A;  2HUI A;  3HT4 A;  2Z9U A;  1D2F A;  5AX8 A;  3NX3 A;  3ELE A;  3HDO A;  4A00 A;  3DR7 A;  2CIN A;  3FCR A;  3EI9 A;  2CH2 A;  1W7L A;  1BT4 A;  3IF2 A;  1SPA A;  1FC4 A;  2JGT A;  2E7I A;  2W8J A;  1JF9 A;  1TOK A;  2D64 A;  3MC6 A;  2W7H A;  5FT5 A;  4ZWV A;  5DB5 A;  5G0A A;  1TAT A;  3I5T A;  4GE9 A;  2CH1 A;  3HVY A;  4JEV A;  2QLR A;  4A6T A;  3FSL A;  2QBT A;  2ZC0 A;  1OHV A;  4P7Y A;  3PDB A;  4Y0I A;  2RFV A;  1TAR A;  4BA4 A;  1ASA A;  1BS0 A;  2QB2 A;  3FKD A;  4RLG A;  1DJE A;  4IY7 A;  2CFB A;  2EGY A;  3FTB A;  2R0T A;  1DKA A;  2C0R A;  5I92 A;  2X3L A;  2XBN A;  2BI2 A;  1EJI A;  1XEY A;  2VMQ A;  3ZRQ A;  1WYV B;  1QZ9 A;  3NDN A;  2W7L A;  1AKA A;  1D7R A;  5F8V A;  1ARI A;  3AEJ A;  2EZ2 A;  3AEN B;  1MLZ A;  2Z9W A;  5E5I A;  3RUY A;  3MAD A;  4Y0H A;  1N31 A;  4RIT A;  4B9B A;  3CQ4 A;  4R8D A;  1C7O A;  2VGV A;  2ZUK A;  2BYJ A;  4R5Z A;  3W1J A;  4A6U A;  2EPJ A;  2OKJ A;  1J32 A;  2PB0 A;  3HLM A;  3RI6 A;  4A72 A;  3DC1 A;  2YRI A;  3TFT A;  3FD0 A;  3FDD A;  3B1C A;  4WXG A;  2VGZ A;  1IX8 A;  1X29 A;  2JG2 A;  4Q31 A;  2VIA A;  3UE8 A;  1Z7D A;  4IXZ A;  1AHF A;  3B46 A;  1MLY A;  4MQQ A;  2Z1Z A;  4WYC A;  2AY2 A;  1ARG A;  1SZU A;  3P6K A;  2WK7 A;  1J04 A;  3A9Z A;  2W7K A;  4Y0D A;  2W7D A;  3JTX A;  4GRX A;  2C44 A;  3AEL A;  3K40 A;  4ATQ A;  3N4X A;  4IW7 A;  1LKC A;  1M0O A;  1Z3Z A;  3JWA A;  1MAQ A;  1IAY A;  2JJH A;  5BJ3 A;  5EUE A;  4AOA A;  3T32 A;  1KMK A;  5DX5 A;  3M5U A;  3H7F A;  4W1X A;  4JE5 A;  1CQ7 A;  1TOE A;  4F5I A; 
#chains in the Genus database with same CATH homology
 3PIU A;  3L8A A;  1BJ4 A;  3LVJ A;  3AEM A;  3II0 A;  4TN4 A;  4W91 A;  1GC3 A;  3WCO A;  3A9Y A;  4WYD A;  4MKJ A;  1DGE A;  2W8T A;  3G7Q A;  2AY7 A;  1YIY A;  2BHX A;  4GSA A;  4CBR A;  1TOI A;  4CVQ A;  1D7V A;  5DJ9 A;  2HOZ A;  1CQ6 A;  2W7J A;  3USF A;  4JE5 D;  4JF1 A;  3W1I A;  2D63 A;  2X8U A;  5M4D A;  2DKB A;  3FQA A;  4IX8 A;  1N8P A;  3E2Z B;  4XAU A;  5D5S A;  5EFS A;  1LC7 A;  1AMA A;  5EQC A;  4R5F A;  3NYU A;  3GBX A;  3UWC A;  4R2N A;  4WXF A;  3R9A A;  3NUI A;  2NMP A;  2OGA A;  3HQT A;  4RM1 A;  4XEW A;  3PJ0 A;  2CJG A;  3VK3 A;  4M2M A;  2DKJ A;  1WST A;  1OHY A;  3F9T A;  1AMR A;  4DGT A;  2VLH A;  3F6T A;  1IUG A;  1QJ5 A;  4F5G A;  1ARH A;  4QGR A;  5M46 A;  3IHJ A;  2FNI A;  3BWN C;  4JEW A;  3EI6 A;  2D7Y A;  4XJL A;  1MDZ A;  1QIT A;  4Q6R A;  1OXO A;  1DTY A;  1GC0 A;  4ZAS A;  4BQ0 A;  2AY5 A;  5C6U A;  1LC5 A;  1AJS B;  5J8Q A;  1ZOD A;  3WKR A;  3RBF A;  2VMW A;  4IXO A;  5FT8 A;  3KGW A;  4W1V A;  1FG7 A;  3BB8 A;  1AHE A;  4XJP A;  3N4R A;  5F9S A;  3A8U X;  3WX9 A;  4RIZ A;  1WYU B;  3QGU A;  2YKU A;  1G4X A;  4UHN A;  3K7Y A;  4JF0 A;  3G0T A;  3BCX A;  1C4K A;  3FVU A;  1KKJ A;  2JJF A;  3D6K A;  1FG3 A;  1WYV A;  1ASB A;  2A1V A;  1BJN A;  1S06 A;  2VGT A;  1YIZ A;  4AO9 A;  1ARS A;  2CTZ A;  1CZC A;  3LVM A;  5JAY A;  1AIC A;  1H1C A;  4FFC A;  3FQ8 A;  4JEZ A;  4EFF A;  4CBS A;  4L0O A;  4MQP A;  4E3R A;  3N75 A;  3VK2 A;  2Z9V A;  1ART A;  1ASC A;  4F5L A;  1S07 A;  1WKH A;  4WYE A;  1YJS A;  2HUU A;  3DXV A;  1V2D A;  4MKK A;  1C7N A;  3FFR A;  7AAT A;  2HOR A;  2VI8 A;  2YHK A;  3LY1 A;  4WP0 A;  2OAT A;  1TOJ A;  5EAA A;  4ADE A;  4GDY A;  2FKI A;  1PFF A;  5EIG A;  4E1O A;  1PMM A;  4J8L A;  1BJO A;  3ELP A;  3GZC A;  3KE3 A;  1YNU A;  3VK4 A;  2VGU A;  2YCT A;  4GEB A;  3ZRR A;  4RAE A;  2VMP A;  2VI9 A;  1LW4 A;  3BCA A;  3CAI A;  3G8M A;  3VP6 A;  3EI7 A;  4XQ2 A;  5G09 A;  1YOO A;  3NNK A;  3TAT A;  3NYT A;  2ZY3 A;  1SZK A;  3FVS A;  1O61 A;  1UU0 A;  3LG0 A;  3NYS A;  3PAA A;  1XI9 A;  2YCN A;  2ZP7 A;  3GR9 A;  4HF8 A;  4W8I A;  1B5O A;  4BMK A;  2AY1 A;  4WB0 B;  3KKI A;  2BKW A;  2CY8 A;  4ISY A;  1GBN A;  1T3I A;  1U08 A;  4GE4 A;  1YJZ A;  5D95 A;  4ZDL A;  1M0P A;  3E2F A;  2Z67 A;  4N0W A;  3E2Z A;  1OXP A;  1VP4 A;  1W7M A;  1CL1 A;  1M4N A;  2BIE A;  2GMS A;  3ASB A;  4WD2 A;  1M6S A;  2W8W A;  1SF2 A;  3PPL A;  3PD6 B;  4GE7 A;  2Z9X A;  4AZJ A;  2WKA A;  1V72 A;  2QSR A;  4A0F A;  2QMA A;  4UHO A;  3N7N A;  2BI9 A;  1VJO A;  3B8X A;  3B1D A;  3A9X A;  3LVK A;  3TFU A;  2X5F A;  4DBC A;  1LW5 A;  1EQB A;  3NUB A;  1O69 A;  3OKS A;  1AMS A;  1ASM A;  1KL2 A;  3I16 A;  4IYO B;  3W1H A;  4BHD A;  1AAM A;  2WK9 A;  1KL1 A;  1GEW A;  1OHW A;  1AIA A;  1AJS A;  2VLF A;  2YKY A;  1MAP A;  4F5F A;  2YKX A;  2HP2 A;  1PMO A;  4U1T A;  1P3W A;  2VMO A;  2GSA A;  3AEO A;  3HL2 A;  2TPL A;  1AMQ A;  3CQ6 A;  4F5M A;  1S08 A;  2ZJG A;  2R5C B;  3FDB A;  1BQA A;  3VAX A;  1GC2 A;  3PGY A;  1JG8 A;  3QHX A;  1ELQ A;  4UHM A;  1H0C A;  2VYC A;  4N0B A;  5E3K A;  1AHX A;  2ZSM A;  1IX7 A;  4F5H A;  5M4B A;  1B9H A;  3N0L A;  5DJ1 A;  5G4J A;  1AHG A;  2YOB A;  3GET A;  2E7J A;  3E9K A;  3LVL B;  3EI5 A;  3MAF B;  4OTL A;  2W7M A;  3MBB A;  3WCN A;  1IX6 A;  2C7T A;  3FRK A;  4ADD A;  1B5P A;  1AY5 A;  2W7F A;  2GQN A;  3ZZK A;  3ATH A;  2HOX A;  1M7Y A;  3QM2 A;  5FT6 A;  4A0G A;  4OC9 A;  1JS6 A;  4OBV A;  4RKC A;  1GEX A;  2FN6 A;  4AZK A;  2G6W A;  3ASA A;  3AOV A;  3B1E A;  3QI6 A;  4ZM4 A;  2PO3 A;  2XH1 A;  4I8A A;  4U2H A;  2BI3 A;  4AO4 A;  4ZM3 A;  5HXX A;  3MKJ A;  3QN6 A;  1GCK A;  1CJ0 A;  2WK8 A;  2YCP A;  4E3Q A;  2AEU A;  5M49 A;  2W7E A;  1N2T A;  1VEF A;  2VMT A;  5LHA A;  1X28 A;  4W1W A;  4AH3 A;  5HHY A;  4F5J A;  4LC3 A;  4PFF A;  1PG8 A;  1UU1 A;  1CL2 A;  4MSO A;  5KTB A;  1I29 A;  4MGR A;  1SZS A;  1MDX A;  3L44 A;  2QA3 A;  1LK9 A;  2AAT A;  5G2Q A;  2CJD A;  2O1B A;  3GZD C;  3EI8 A;  3WY7 A;  4ZDP A;  3BWN A;  2AY6 A;  3Q8N A;  1UU2 A;  1O62 A;  3DRD A;  5G2P A;  1D7U A;  1E5F A;  3CQ5 A;  1G7X A;  3MAU A;  3JZL A;  2G7J A;  3BV0 A;  1QIS A;  3AEN A;  5FT4 A;  3NTJ A;  4ITX A;  1ORD A;  1BQD A;  1KKP A;  5IWQ A;  2VIB A;  1TAS A;  3E6G A;  2E7U A;  2PB2 A;  2V0Y A;  2F8J A;  3EIB A;  3ISL A;  4FL0 A;  3AEP A;  2VGS A;  3GWP A;  4IXS A;  4UOY A;  4XJM A;  2HZP A;  3AAT A;  4H51 A;  2W7I A;  4TV7 A;  1RV4 A;  2EO5 A;  3ZRP A;  3DXW A;  3BS8 A;  3GZD A;  2E54 A;  1ZOB A;  2VMS A;  8AAT A;  2BWP A;  4ADC A;  4WLJ A;  3R4T A;  1DFO A;  3FVX A;  4IYO A;  3LWS A;  4A0H A;  3FFH A;  2VMZ A;  1AKB A;  3DZZ A;  3P1T A;  4K2B A;  5LH9 A;  3N4S A;  3MEB A;  1Y4I A;  1YAA A;  4CXQ A;  2ZY5 A;  2VMU A;  4DQ6 A;  1DGD A;  4LW2 A;  3ECD A;  4ITG A;  1IVR A;  1WKG A;  3UAK A;  3EUC A;  1QGN A;  2FYF A;  4ZLV A;  4Q76 A;  1S09 A;  2JIS A;  9AAT A;  2ZSL A;  1B9I A;  1ASG A;  2BWN A;  2D61 A;  3PA9 A;  2EZ1 A;  5EUD A;  2O0R A;  3COG A;  2D65 A;  4J5U A;  3WGC A;  1B4X A;  1MDO A;  1AJR A;  2R5C A;  5E4Z A;  2BI5 A;  4NOG A;  4WBT A;  1BW0 A;  1GC4 A;  3FQ7 A;  4JEX A;  5EAV A;  5TF5 A;  1IAX A;  2HUF A;  3I4J A;  2ORD A;  3AEJ C;  4F5K A;  2OGE A;  3RQ1 A;  1AIB A;  1G7W A;  3MAF A;  2HP1 A;  1AY4 A;  3CBF A;  3BN1 A;  2AY3 A;  2BI1 A;  3FZ8 A;  3WGB A;  4RJY A;  3RCH B;  2ZY4 A;  4KYO A;  1AY8 A;  4M2J A;  4RJ0 A;  1AKC A;  4OYT A;  1WYT B;  4ZSY A;  4WLH A;  3KGX A;  1ASE A;  3EZS A;  1W3U A;  2AY9 A;  2EH6 A;  1X2A A;  2VMV A;  2Z1Y A;  2QB3 A;  3DU4 A;  4KXK A;  4A0R A;  2OQX A;  2CB1 A;  2D7Z A;  3N5M A;  4K2M A;  3K28 A;  1ECX A;  4OMA A;  3WLX A;  4OCA A;  4E77 A;  2KFP A;  5EUN A;  4PVF A;  4EB7 A;  2GB3 A;  2X5D A;  4OBU A;  3EZ1 A;  3LV2 A;  4XJO A;  5BJ4 A;  4ADB A;  2DGK A;  3TCM A;  1JS3 A;  1S0A A;  2EYQ A;  1CZE A;  4A6R A;  1I48 A;  3FZ6 A;  2FQ6 A;  1B8G A;  3BWO A;  1V2E A;  3DR4 A;  3F0H A;  3GSB A;  2CJH A;  1RVU A;  3QBO A;  4Q75 A;  3AEM C;  2Z61 A;  1TOG A;  4PFN A;  4ZDO A;  1AHY A;  2BYL A;  4M2K A;  1C9C A;  3WZF A;  1WYU A;  1W23 A;  1ZC9 A;  4UQV A;  2FNU A;  1I43 A;  4O6Z A;  3H14 A;  2HOY A;  2VGW A;  5EIG B;  3H9X A;  2CST A;  4LNJ A;  2FM1 A;  1YJY A;  3NU8 A;  4LNL A;  1BJO B;  4WYA A;  4H63 Q;  1DJ9 A;  2Z20 A;  2CAN A;  4WYG A;  1KMJ A;  4BA5 A;  1W7N A;  3PDB B;  3QPG A;  4TMR A;  4EMY A;  2YKV A;  3JWB A;  3VOM A;  1LC8 A;  2BIG A;  4JEY A;  3WKS A;  2BWO A;  2AY8 A;  4P3M A;  4RKD A;  2ZY2 A;  2JJG A;  4XK1 A;  1C7G A;  1SFF A;  2AY4 A;  1IBJ A;  3ACZ A;  1ELU A;  1BJW A;  3E77 A;  3HBX A;  3RBL A;  2VMN A;  3JW9 A;  4F4E A;  4ZAH A;  2WB6 A;  4LW4 A;  2C81 A;  3JU7 A;  4K2I A;  5HDM A;  3PDX A;  3BC8 A;  1EG5 A;  3E2Y A;  4WYF A;  2VMX A;  1ASF A;  1TPL A;  5G4I A;  4HVK A;  1QJ3 A;  4ZSW A;  1M0Q A;  1QIR A;  3AV7 A;  1O4S A;  1G4V A;  3DOD A;  4WXB A;  1M0N A;  2YRR A;  3OP7 A;  4EU1 A;  2W7G A;  1OAT A;  2DOU A;  3TQX A;  3BCB A;  4MQR A;  3DYD A;  1BKG A;  2OKK A;  1GD9 A;  1V2F A;  4B98 A;  4ATP A;  4K05 A;  2D66 A;  2DGL A;  2DR1 A;  1DJU A;  2ZYJ A;  2V1P A;  3A2B A;  2W8U A;  1ASD A;  4WB0 A;  5K8B A;  3EIA A;  1UKJ A;  4ZWM A;  2D5Y A;  1IJI A;  2R5E A;  3FZ7 A;  1ASN A;  3ZZJ A;  1AX4 A;  3AOW A;  1GDE A;  3NU7 A;  1E5E A;  1SVV A;  1I41 A;  1X0M A;  3RCH A;  1ASL A;  1D7S A;  1MGV A;  1GEY A;  1AAW A;  2Q7W A;  2O7C A;  2W8V A;  3HMU A;  4KAM A;  1CQ8 A;  3GJU A;  3PD6 A;  4EB5 A;  1WYT A;  2VMR A;  3MC6 C;  2JJE A;  2DGM A;  2GMU A;  2VMY A;  3NRA A;  4MY5 A;  2R2N A;  4W5K A;  4OT8 A;  2BIA A;  4LNM A;  1RVY A;  1C0N A;  1LS3 A;  1RV3 A;  4PIW A;  4CXR A;  1CS1 A;  1M32 A;  2AEV A;  2HUI A;  3HT4 A;  2Z9U A;  1D2F A;  5AX8 A;  3NX3 A;  3ELE A;  3HDO A;  4A00 A;  3DR7 A;  2CIN A;  3FCR A;  3EI9 A;  2CH2 A;  1W7L A;  1BT4 A;  3IF2 A;  1SPA A;  1FC4 A;  2JGT A;  2E7I A;  2W8J A;  1JF9 A;  1TOK A;  2D64 A;  3MC6 A;  2W7H A;  5FT5 A;  4ZWV A;  5DB5 A;  5G0A A;  1TAT A;  3I5T A;  4GE9 A;  2CH1 A;  3HVY A;  4JEV A;  2QLR A;  4A6T A;  3FSL A;  2QBT A;  2ZC0 A;  1OHV A;  4P7Y A;  3PDB A;  4Y0I A;  2RFV A;  1TAR A;  4BA4 A;  1ASA A;  1BS0 A;  2QB2 A;  3FKD A;  4RLG A;  1DJE A;  4IY7 A;  2CFB A;  2EGY A;  3FTB A;  2R0T A;  1DKA A;  2C0R A;  5I92 A;  2X3L A;  2XBN A;  2BI2 A;  1EJI A;  1XEY A;  2VMQ A;  3ZRQ A;  1WYV B;  1QZ9 A;  3NDN A;  2W7L A;  1AKA A;  1D7R A;  5F8V A;  1ARI A;  3AEJ A;  2EZ2 A;  3AEN B;  1MLZ A;  2Z9W A;  5E5I A;  3RUY A;  3MAD A;  4Y0H A;  1N31 A;  4RIT A;  4B9B A;  3CQ4 A;  4R8D A;  1C7O A;  2VGV A;  2ZUK A;  2BYJ A;  4R5Z A;  3W1J A;  4A6U A;  2EPJ A;  2OKJ A;  1J32 A;  2PB0 A;  3HLM A;  3RI6 A;  4A72 A;  3DC1 A;  2YRI A;  3TFT A;  3FD0 A;  3FDD A;  3B1C A;  4WXG A;  2VGZ A;  1IX8 A;  1X29 A;  2JG2 A;  4Q31 A;  2VIA A;  3UE8 A;  1Z7D A;  4IXZ A;  1AHF A;  3B46 A;  1MLY A;  4MQQ A;  2Z1Z A;  4WYC A;  2AY2 A;  1ARG A;  1SZU A;  3P6K A;  2WK7 A;  1J04 A;  3A9Z A;  2W7K A;  4Y0D A;  2W7D A;  3JTX A;  4GRX A;  2C44 A;  3AEL A;  3K40 A;  4ATQ A;  3N4X A;  4IW7 A;  1LKC A;  1M0O A;  1Z3Z A;  3JWA A;  1MAQ A;  1IAY A;  2JJH A;  5BJ3 A;  5EUE A;  4AOA A;  3T32 A;  1KMK A;  5DX5 A;  3M5U A;  3H7F A;  4W1X A;  4JE5 A;  1CQ7 A;  1TOE A;  4F5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...