1G8OA

Crystallographic structure of the native bovine alpha-1,3-galactosyltransferase catalytic domain
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
287
structure length
287
Chain Sequence
SKLKLSDWFNPFKRPEVVTMTKWKAPVVWEGTYNRAVLDNYYAKQKITVGLTVFAVGRYIEHYLEEFLTSANKHFMVGHPVIFYIMVDDVSRMPLIELGPLRSFKVFKIKPEKRWQDISMMRMKTIGEHIVAHIQHEVDFLFCMDVDQVFQDKFGVETLGESVAQLQAWWYKADPNDFTYERRKESAAYIPFGEGDFYYHAAIFGGTPTQVLNITQECFKGILKDKKNDIEAQWHDESHLNKYFLLNKPTKILSPEYCWDYHIGLPADIKLVKMSWQTKEYNVVRNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYLLACTOSAMINIDE ALPHA-1,3-GALACTOSYLTRANSFERASE
publication title Bovine alpha1,3-galactosyltransferase catalytic domain structure and its relationship with ABO histo-blood group and glycosphingolipid glycosyltransferases.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 96
structure length 287
sequence length 287
ec nomenclature ec 2.4.1.87: N-acetyllactosaminide 3-alpha-galactosyltransferase.
pdb deposition date 2000-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1g8oA00
1W55A 1FXJA 2O1FA 2AH9A 1JYLA 4CVHA 5C4CA 1MP3A 3I0DA 3USRA 1JV3A 4HO2A 2VFZA 1FO8A 2PGVA 3CKJA 4HOCA 4KPXA 1H5SB 2P72A 2BO6A 1VGTA 4B4BA 1MC3A 1ZJ1A 2BO4A 2OI6A 5C8RA 2O1HA 3D98A 4B42A 4HO6A 1ZCYA 1LL0A 3K8EA 3BRKX 3T7NA 1XZ6A 4G87A 5C49A 5BXCA 1S4OA 4JISA 1GWWA 5JQQA 4YS8A 1NKHB 2NXVA 1R80A 1HJLA 2V0LA 2JCJA 3RSBA 1IINA 3ZF8A 1H5SD 1R7XA 2WEEA 2WVLA 1WT3A 1H7TA 4XWIA 5J49A 1H5TB 1G8OA 3R2WA 1WT2A 1H4EA 2GGQA 1INIA 2E3DA 4FRMA 2FYAA 1FRWA 1FGXA 3V8YA 5AJOA 2VS4A 2Z86A 1Z90A 2RIYA 3Q80A 5C3DA 4P02A 1H5SC 2RJ1A 3F1CA 2RIXA 3FWWA 4Y6UA 5FU0A 1ZHJA 4ASYA 3TQDA 4AC3A 5CMGX 1JYKA 2YESA 3OH1A 5CMJA 3POLA 1H7EA 3FOQA 3ST8A 3T7MA 2DPWA 2QKXA 2RIZA 1VGZA 2X60A 2P73A 3V0NA 4DECA 3RMWA 3OH2A 4FCEA 2Q4JA 1LL2A 2JCLA 2ZU9A 3E25A 3PNNA 3ZLLA 1VGWA 1PZYB 4HO4A 4NAKA 2ICXA 2VD4A 5EIYA 1OMZA 4FQWA 1VH3A 3V91A 3I0KA 2V0IA 4KC1A 4ECMA 4EEGA 4NANA 2Y7AA 2RJ0A 4FRPA 1SS9A 4Y7VA 5CMHA 3O3PA 4D0ZA 4Y7UA 1ZI5A 3I0FA 1V84A 3U2WA 2QGIA 1KWSA 1GQCA 2OEGA 2FYDB 4HCQA 5CQOA 3CU0A 1ON6A 2WAWA 2XMHA 4KC4A 5FU8A 3SX3A 4MNDA 3JTJA 1I52A 5CQPA 4NALA 1FZWA 2D0JA 5L6SA 1H7HA 2AE7A 4M28A 3SX8A 1QGSA 4D11C 5C4EA 3OC9A 1WT0A 4BMAA 1G23A 3I0JA 1G95A 1FG5N 2AGDA 1K4VA 4Y7FA 4EE4A 1H4DA 2QH5A 3N9WA 5DDVA 2W0WA 5IDTA 4B3UA 1LZJA 2P6WA 2YCMA 5C1HA 1FGGA 2YQCA 1H7GA 1TVYA 2Y4JA 3SXGA 1WVCA 1WSZA 3D8VA 1NF5B 2V0JA 3IOIA 1GX0A 1GWVA 1R7TA 1G9RA 3I0CA 2ICYA 2Y4LA 2A8WA 3SXBA 4AAWA 4EEOA 4EEMA 2YC3A 1S4NA 1R7UA 5C48A 1H5TA 3DUVA 5L6VA 4FREA 5FTVA 4UEGA 1NHEB 4LW6A 1JVGA 5C4DA 4K6RA 4IRPA 1O23B 1G93A 3OKRA 1ZJOA 4KRVA 1O7QA 5CMIA 4ZDQA 4P00A 5CQNX 5C4FA 5C38A 1WT1A 4B4MA 1OMXA 1ZI4A 5HS2A 1H7FA 1G1LA 1R82A 1YROB 2VSIA 2X65A 2Y4MA 1ZIZA 2O1GA 1XHBA 3DK5A 2RJ9A 3D5NA 4DDZA 4IRQA 3OAMA 5EJ1A 1YP4A 1HJJA 1VZTA 2VS3A 1FWYA 3QVBA 3ZGGA 3T7OA 4CJBA 4HO0A 1H5RA 3R3IA 3F1YA 5DDTA 3RMVA 1FR8A 1LL3A 4DE7A 5C3BA 1HM9A 2GGOA 1EYRA 2X5SA 1G3LA 1JV1A 2YQSA 4FRHA 4D0TA 4M2AA 3SX7A 5CMFX 4Y7GA 1S4PA 3SPTA 3NGWA 2OEFA 1ZDFA 2YQJA 4B2XA 4ARWA 3Q7UA 4E1KA 1ZDGA 1LZIA 2RJ5A 2V0KA 1ZCTA 3DJ4A 3OGZA 4LW3A 4FRDA 3JUJA 1G0RA 2AM5A 2UX8A 3CKVA 4G3SA 1LVWA 3OH0A 4CJ8A 1H7QA 2AESA 3I0HA 3U2XA 3U2TA 2D7IA 1V82A 4HO9A 3CKOA 1H4CA 1FR9A 2OI7A 2JCOA 3V0OA 4C2SA 2AM3A 2YC5A 1O7OA 4EE3A 3SXEA 4KC2A 3TZTA 4B2WA 4G3QA 2OI5A 1ON8A 1H5SA 1HM8A 1VZXA 3U2UA 4CJCA 3USQA 2XWNA 2XWLA 3ZLKA 2X5ZA 2I5EA 1R7YA 2VXMA 1TW1A 3OH3A 4HO8A 2I7BA 1V83A 2APCA 4JD0A 4Y63A 4FRLA 5C1GA 2WVMA 1FO9A 1ZCVA 3V90A 4B4GA 2RJ8A 4MYBA 3V0MA 1VM8A 1JVDA 2RITA 3I0IX 1FXOA 5IDSA 1OQMB 1HV9A 3CKNA 1GQ9A 3EE5A 5FTSA 3U0XA 1GA8A 1QG8A 1ZJ2A 2A8UA 2VXLA 4FRAA 4FCUA 4M4KA 3PKPA 3JUKA 5AJPA 1ZJPA 2XMEA 5C47A 2FY7A 2ZU7A 2Y6PA 3K8DA 1NQIB 2VS5A 2WE9A 2PGYA 3ZGFA 4GBPA 2ZU8A 2RJ6A 2V0HA 2PA4A 1ZI3A 4M2BA 1VH1A 1ZCUA 1GX4A 2AECA 4Y6NA 4FRQA 4KT7A 4Y7TA 5EJZA 5FYEA 4EEAA 1E5KA 1QGQA 1LZ0A 4AYLA 3CGXA 3IOHA 4KPZA 1IIMA 1VGUA 3KIAA 3PKQA 2Z87A 1TW5A 5AJNA 1H3MA 1VPAA 1EZIA 4D11A 5CQMX 2RJ4A 3HL3A 4Y64A 3CKQA 5FV9A 5C1LA 1TZFA 2Y4KA 5IFYA 4L41C 2FFUA 3I0LA 3SXAA 4EVWA 1HM0A 3BCVA 2I5KA 3SXDA 1FOAA 3I0GA 4KNRA 2YQHA 1VZUA 3GUEA 1G2VA 2FYCB 1NWGB 3IOJA 3V0QA 5I1FA 3SXCA 1VICA 1INJA 1LZ7A 2E8BA 1H5RB 1ZI1A 1O0RA 4HO5A 4HO3A 2BO8A 4KQLA 2RJ7A 4B5BA 2CU2A 3OH4A 1MP4A 4BQHA 2MZBA 1YP3A 4KXOA 4Y62A 4ASJA 1R7VA 2BO7A 4D48A 1NMMB 3U2VA 1QWJA 1W77A 1G97A 2XWMA 2FFVA 1MP5A 4KNXA 4FROA 2WVKA 2FYBA 2VSHA 2WGZA 4Y9XA 5FUHA 4FRBA 4R7PA 1PZTA 2AM4A 3E26A 5C4BA 2D7RA 1ZJ0A 1H7LA 2JCKA 3V0PA 3V8ZA 4J18A 4HG6A 4EE5A 2PX7A 2W0VA 4G3PA 3V0LA 5C36A 1R81A 1W57A 3I0EA 1ZJ3A 3SX5A 3LW6A 4AYJA 1YP2A 3U0YA 4NAIA 3Q4SA 5CQLX 5C3AA
chains in the Genus database with same CATH superfamily
1W55A 1FXJA 2O1FA 2AH9A 1JYLA 4CVHA 5C4CA 1MP3A 3I0DA 3USRA 1JV3A 4HO2A 2VFZA 1FO8A 2PGVA 3CKJA 4HOCA 4KPXA 1H5SB 2P72A 2BO6A 1VGTA 4B4BA 1MC3A 1ZJ1A 2BO4A 2OI6A 5C8RA 2O1HA 3D98A 4B42A 4HO6A 1ZCYA 1LL0A 3K8EA 3BRKX 3T7NA 1XZ6A 4G87A 5C49A 5BXCA 1S4OA 4JISA 1GWWA 5JQQA 4YS8A 1NKHB 2NXVA 1R80A 1HJLA 2V0LA 2JCJA 3RSBA 1IINA 3ZF8A 1H5SD 1R7XA 2WEEA 2WVLA 1WT3A 1H7TA 4MIXA 4XWIA 5J49A 1H5TB 1G8OA 3R2WA 1WT2A 1H4EA 2GGQA 1INIA 2E3DA 4FRMA 2FYAA 1FRWA 1FGXA 3V8YA 5AJOA 2VS4A 2Z86A 1Z90A 2RIYA 3Q80A 5C3DA 4P02A 1H5SC 2RJ1A 3F1CA 2RIXA 3FWWA 4Y6UA 5FU0A 1ZHJA 4ASYA 3TQDA 4AC3A 5CMGX 1JYKA 2YESA 3OH1A 5CMJA 3POLA 1H7EA 3FOQA 3ST8A 3T7MA 2DPWA 2QKXA 2RIZA 1VGZA 2X60A 2P73A 3V0NA 4DECA 3RMWA 3OH2A 4FCEA 2Q4JA 1LL2A 2JCLA 2ZU9A 3E25A 3PNNA 3ZLLA 1VGWA 1PZYB 4HO4A 4NAKA 2ICXA 2VD4A 5EIYA 1OMZA 4FQWA 1VH3A 3V91A 3I0KA 2V0IA 4KC1A 4ECMA 4EEGA 4NANA 2Y7AA 2RJ0A 4FRPA 1SS9A 4Y7VA 5CMHA 3O3PA 4D0ZA 4Y7UA 1ZI5A 3I0FA 1V84A 3U2WA 2QGIA 1KWSA 1GQCA 2OEGA 2FYDB 4HCQA 5CQOA 3CU0A 1ON6A 2WAWA 2XMHA 4KC4A 5FU8A 3SX3A 4MNDA 3JTJA 1I52A 5CQPA 4NALA 1FZWA 2D0JA 5L6SA 1H7HA 2AE7A 4M28A 3SX8A 1QGSA 4D11C 5C4EA 3OC9A 1WT0A 4BMAA 1G23A 3I0JA 2J0AA 1G95A 1FG5N 2AGDA 1K4VA 4Y7FA 4EE4A 1H4DA 2QH5A 3N9WA 5DDVA 2W0WA 5IDTA 4B3UA 1LZJA 2P6WA 2YCMA 5C1HA 1FGGA 2YQCA 1H7GA 1TVYA 2Y4JA 3SXGA 1WVCA 1WSZA 3D8VA 1NF5B 2V0JA 3IOIA 1GX0A 1GWVA 1R7TA 1G9RA 3I0CA 2ICYA 2Y4LA 2A8WA 4FIXA 3SXBA 4AAWA 4EEOA 4EEMA 2YC3A 1S4NA 1R7UA 5C48A 1H5TA 3DUVA 5L6VA 4FREA 5FTVA 4UEGA 1NHEB 4LW6A 1JVGA 5C4DA 4K6RA 4IRPA 1O23B 1G93A 3OKRA 1ZJOA 5D92A 4KRVA 1O7QA 5CMIA 2J0BA 4ZDQA 4P00A 5CQNX 5C4FA 5C38A 1WT1A 4B4MA 1OMXA 1ZI4A 5HS2A 1H7FA 1G1LA 1R82A 1YROB 2VSIA 2X65A 2Y4MA 1ZIZA 2O1GA 1XHBA 3DK5A 2RJ9A 3D5NA 4DDZA 4IRQA 3OAMA 5EJ1A 1YP4A 1HJJA 1VZTA 2VS3A 1FWYA 4O6NA 3QVBA 3ZGGA 3T7OA 4CJBA 4HO0A 1H5RA 3R3IA 3F1YA 5DDTA 3RMVA 1FR8A 1LL3A 4DE7A 5C3BA 1HM9A 2GGOA 1EYRA 2X5SA 1G3LA 1JV1A 2YQSA 4FRHA 4D0TA 4M2AA 3SX7A 5CMFX 4Y7GA 1S4PA 3SPTA 3NGWA 2OEFA 1ZDFA 2YQJA 4B2XA 4ARWA 3Q7UA 4E1KA 1ZDGA 1LZIA 2RJ5A 2V0KA 1ZCTA 3DJ4A 3OGZA 4LW3A 4FRDA 3JUJA 1G0RA 2AM5A 2UX8A 3CKVA 4G3SA 1LVWA 3OH0A 4CJ8A 1H7QA 2AESA 3I0HA 3U2XA 3U2TA 2D7IA 1V82A 4HO9A 3CKOA 1H4CA 1FR9A 2OI7A 2JCOA 3V0OA 4C2SA 2AM3A 2YC5A 1O7OA 4EE3A 3SXEA 4KC2A 3TZTA 4B2WA 4G3QA 2OI5A 1ON8A 1H5SA 1HM8A 1VZXA 3U2UA 4CJCA 3USQA 2XWNA 2XWLA 3ZLKA 2X5ZA 2I5EA 1R7YA 2VXMA 1TW1A 3OH3A 4HO8A 2I7BA 1V83A 2APCA 4JD0A 4Y63A 4FRLA 5C1GA 2WVMA 1FO9A 1ZCVA 3V90A 4B4GA 2RJ8A 4MYBA 3V0MA 1VM8A 1JVDA 2RITA 3I0IX 1FXOA 5IDSA 1OQMB 1HV9A 3CKNA 1GQ9A 3EE5A 5FTSA 3U0XA 1GA8A 1QG8A 1ZJ2A 2A8UA 2VXLA 4FRAA 4FCUA 4M4KA 3PKPA 3JUKA 5AJPA 1ZJPA 2XMEA 4FIYA 5C47A 2FY7A 2ZU7A 2Y6PA 3K8DA 1NQIB 2VS5A 2WE9A 2PGYA 3ZGFA 4GBPA 2ZU8A 2RJ6A 2V0HA 5D91A 2PA4A 1ZI3A 4M2BA 1VH1A 1ZCUA 1GX4A 2AECA 4Y6NA 4FRQA 4KT7A 4Y7TA 5EJZA 5FYEA 4EEAA 1E5KA 1QGQA 1LZ0A 4AYLA 3CGXA 3IOHA 4KPZA 1IIMA 1VGUA 3KIAA 3PKQA 2Z87A 1TW5A 5AJNA 1H3MA 1VPAA 1EZIA 4D11A 5CQMX 2RJ4A 3HL3A 4Y64A 3CKQA 5FV9A 5C1LA 1TZFA 2Y4KA 5IFYA 4L41C 4Q7CA 2FFUA 3I0LA 3SXAA 4EVWA 1HM0A 3BCVA 2I5KA 3SXDA 1FOAA 3I0GA 4KNRA 2YQHA 1VZUA 3GUEA 1G2VA 2FYCB 1NWGB 3IOJA 3V0QA 5I1FA 3SXCA 1VICA 1INJA 1LZ7A 2E8BA 1H5RB 1ZI1A 2C0NA 1O0RA 4HO5A 4HO3A 2BO8A 4KQLA 2RJ7A 4B5BA 2CU2A 3OH4A 1MP4A 4BQHA 2MZBA 1YP3A 4KXOA 4Y62A 4ASJA 1R7VA 2BO7A 4D48A 1NMMB 3U2VA 1QWJA 1W77A 1G97A 2XWMA 2FFVA 1MP5A 4KNXA 4FROA 2WVKA 2FYBA 2VSHA 2WGZA 4Y9XA 5FUHA 4FRBA 4R7PA 1PZTA 2AM4A 3E26A 5C4BA 2D7RA 1ZJ0A 4O6MA 1H7LA 2JCKA 3V0PA 3V8ZA 4J18A 4HG6A 4EE5A 2PX7A 2W0VA 4G3PA 3V0LA 5C36A 1R81A 1W57A 3I0EA 1ZJ3A 3SX5A 3LW6A 4AYJA 1YP2A 3U0YA 4NAIA 2VK9A 3Q4SA 5CQLX 5C3AA
chains in the Genus database with same CATH topology
1W55A 1FXJA 2O1FA 2AH9A 1JYLA 4CVHA 5C4CA 1MP3A 3I0DA 3USRA 1JV3A 4HO2A 2VFZA 1FO8A 2PGVA 3CKJA 4HOCA 4KPXA 1H5SB 2P72A 2BO6A 1VGTA 4B4BA 1MC3A 1ZJ1A 2BO4A 2OI6A 5C8RA 2O1HA 3D98A 4B42A 4HO6A 1ZCYA 1LL0A 3K8EA 3BRKX 3T7NA 1XZ6A 4G87A 5C49A 5BXCA 1S4OA 4JISA 1GWWA 5JQQA 4YS8A 1NKHB 2NXVA 1R80A 1HJLA 2V0LA 2JCJA 3RSBA 1IINA 3ZF8A 1H5SD 1R7XA 2WEEA 2WVLA 1WT3A 1H7TA 4MIXA 4XWIA 5J49A 1H5TB 1G8OA 3R2WA 1WT2A 1H4EA 2GGQA 1INIA 2E3DA 4FRMA 2FYAA 1FRWA 1FGXA 3V8YA 5AJOA 2VS4A 2Z86A 1Z90A 2RIYA 3Q80A 5C3DA 4P02A 1H5SC 2RJ1A 3F1CA 2RIXA 3FWWA 4Y6UA 5FU0A 1ZHJA 4ASYA 3TQDA 4AC3A 5CMGX 1JYKA 2YESA 3OH1A 5CMJA 3POLA 1H7EA 3FOQA 3ST8A 3T7MA 2DPWA 2QKXA 2RIZA 1VGZA 2X60A 2P73A 3V0NA 4DECA 3RMWA 3OH2A 4FCEA 2Q4JA 1LL2A 2JCLA 2ZU9A 3E25A 3PNNA 3ZLLA 1VGWA 1PZYB 4HO4A 4NAKA 2ICXA 2VD4A 5EIYA 1OMZA 4FQWA 1VH3A 3V91A 3I0KA 2V0IA 4KC1A 4ECMA 4EEGA 4NANA 2Y7AA 2RJ0A 4FRPA 1SS9A 4Y7VA 5CMHA 3O3PA 4D0ZA 4Y7UA 1ZI5A 3I0FA 1V84A 3U2WA 2QGIA 1KWSA 1GQCA 2OEGA 2FYDB 4HCQA 5CQOA 3CU0A 1ON6A 2WAWA 2XMHA 4KC4A 5FU8A 3SX3A 4MNDA 3JTJA 1I52A 5CQPA 4NALA 1FZWA 2D0JA 5L6SA 1H7HA 2AE7A 4M28A 3SX8A 1QGSA 4D11C 5C4EA 3OC9A 1WT0A 4BMAA 1G23A 3I0JA 2J0AA 1G95A 1FG5N 2AGDA 1K4VA 4Y7FA 4EE4A 1H4DA 2QH5A 3N9WA 5DDVA 2W0WA 5IDTA 4B3UA 1LZJA 2P6WA 2YCMA 5C1HA 1FGGA 2YQCA 1H7GA 1TVYA 2Y4JA 3SXGA 1WVCA 1WSZA 3D8VA 1NF5B 2V0JA 3IOIA 1GX0A 1GWVA 1R7TA 1G9RA 3I0CA 2ICYA 2Y4LA 2A8WA 4FIXA 3SXBA 4AAWA 4EEOA 4EEMA 2YC3A 1S4NA 1R7UA 5C48A 1H5TA 3DUVA 5L6VA 4FREA 5FTVA 4UEGA 1NHEB 4LW6A 1JVGA 5C4DA 4K6RA 4IRPA 1O23B 1G93A 3OKRA 1ZJOA 5D92A 4KRVA 1O7QA 5CMIA 2J0BA 4ZDQA 4P00A 5CQNX 5C4FA 5C38A 1WT1A 4B4MA 1OMXA 1ZI4A 5HS2A 1H7FA 1G1LA 1R82A 1YROB 2VSIA 2X65A 2Y4MA 1ZIZA 2O1GA 1XHBA 3DK5A 2RJ9A 3D5NA 4DDZA 4IRQA 3OAMA 5EJ1A 1YP4A 1HJJA 1VZTA 2VS3A 1FWYA 4O6NA 3QVBA 3ZGGA 3T7OA 4CJBA 4HO0A 1H5RA 3R3IA 3F1YA 5DDTA 3RMVA 1FR8A 1LL3A 4DE7A 5C3BA 1HM9A 2GGOA 1EYRA 2X5SA 1G3LA 1JV1A 2YQSA 4FRHA 4D0TA 4M2AA 3SX7A 5CMFX 4Y7GA 1S4PA 3SPTA 3NGWA 2OEFA 1ZDFA 2YQJA 4B2XA 4ARWA 3Q7UA 4E1KA 1ZDGA 1LZIA 2RJ5A 2V0KA 1ZCTA 3DJ4A 3OGZA 4LW3A 4FRDA 3JUJA 1G0RA 2AM5A 2UX8A 3CKVA 4G3SA 1LVWA 3OH0A 4CJ8A 1H7QA 2AESA 3I0HA 3U2XA 3U2TA 2D7IA 1V82A 4HO9A 3CKOA 1H4CA 1FR9A 2OI7A 2JCOA 3V0OA 4C2SA 2AM3A 2YC5A 1O7OA 4EE3A 3SXEA 4KC2A 3TZTA 4B2WA 4G3QA 2OI5A 1ON8A 1H5SA 1HM8A 1VZXA 3U2UA 4CJCA 3USQA 2XWNA 2XWLA 3ZLKA 2X5ZA 2I5EA 1R7YA 2VXMA 1TW1A 3OH3A 4HO8A 2I7BA 1V83A 2APCA 4JD0A 4Y63A 4FRLA 5C1GA 2WVMA 1FO9A 1ZCVA 3V90A 4B4GA 2RJ8A 4MYBA 3V0MA 1VM8A 1JVDA 2RITA 3I0IX 1FXOA 5IDSA 1OQMB 1HV9A 3CKNA 1GQ9A 3EE5A 5FTSA 3U0XA 1GA8A 1QG8A 1ZJ2A 2A8UA 2VXLA 4FRAA 4FCUA 4M4KA 3PKPA 3JUKA 5AJPA 1ZJPA 2XMEA 4FIYA 5C47A 2FY7A 2ZU7A 2Y6PA 3K8DA 1NQIB 2VS5A 2WE9A 2PGYA 3ZGFA 4GBPA 2ZU8A 2RJ6A 2V0HA 5D91A 2PA4A 1ZI3A 4M2BA 1VH1A 1ZCUA 1GX4A 2AECA 4Y6NA 4FRQA 4KT7A 4Y7TA 5EJZA 5FYEA 4EEAA 1E5KA 1QGQA 1LZ0A 4AYLA 3CGXA 3IOHA 4KPZA 1IIMA 1VGUA 3KIAA 3PKQA 2Z87A 1TW5A 5AJNA 1H3MA 1VPAA 1EZIA 4D11A 5CQMX 2RJ4A 3HL3A 4Y64A 3CKQA 5FV9A 5C1LA 1TZFA 2Y4KA 5IFYA 4L41C 4Q7CA 2FFUA 3I0LA 3SXAA 4EVWA 1HM0A 3BCVA 2I5KA 3SXDA 1FOAA 3I0GA 4KNRA 2YQHA 1VZUA 3GUEA 1G2VA 2FYCB 1NWGB 3IOJA 3V0QA 5I1FA 3SXCA 1VICA 1INJA 1LZ7A 2E8BA 1H5RB 1ZI1A 2C0NA 1O0RA 4HO5A 4HO3A 2BO8A 4KQLA 2RJ7A 4B5BA 2CU2A 3OH4A 1MP4A 4BQHA 2MZBA 1YP3A 4KXOA 4Y62A 4ASJA 1R7VA 2BO7A 4D48A 1NMMB 3U2VA 1QWJA 1W77A 1G97A 2XWMA 2FFVA 1MP5A 4KNXA 4FROA 2WVKA 2FYBA 2VSHA 2WGZA 4Y9XA 5FUHA 4FRBA 4R7PA 1PZTA 2AM4A 3E26A 5C4BA 2D7RA 1ZJ0A 4O6MA 1H7LA 2JCKA 3V0PA 3V8ZA 4J18A 4HG6A 4EE5A 2PX7A 2W0VA 4G3PA 3V0LA 5C36A 1R81A 1W57A 3I0EA 1ZJ3A 3SX5A 3LW6A 4AYJA 1YP2A 3U0YA 4NAIA 2VK9A 3Q4SA 5CQLX 5C3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W55 A;  1FXJ A;  2O1F A;  2AH9 A;  1JYL A;  4CVH A;  5C4C A;  1MP3 A;  3I0D A;  3USR A;  1JV3 A;  4HO2 A;  2VFZ A;  1FO8 A;  2PGV A;  3CKJ A;  4HOC A;  4KPX A;  1H5S B;  2P72 A;  2BO6 A;  1VGT A;  4B4B A;  1MC3 A;  1ZJ1 A;  2BO4 A;  2OI6 A;  5C8R A;  2O1H A;  3D98 A;  4B42 A;  4HO6 A;  1ZCY A;  1LL0 A;  3K8E A;  3BRK X;  3T7N A;  1XZ6 A;  4G87 A;  5C49 A;  5BXC A;  1S4O A;  4JIS A;  1GWW A;  5JQQ A;  4YS8 A;  1NKH B;  2NXV A;  1R80 A;  1HJL A;  2V0L A;  2JCJ A;  3RSB A;  1IIN A;  3ZF8 A;  1H5S D;  1R7X A;  2WEE A;  2WVL A;  1WT3 A;  1H7T A;  4XWI A;  5J49 A;  1H5T B;  1G8O A;  3R2W A;  1WT2 A;  1H4E A;  2GGQ A;  1INI A;  2E3D A;  4FRM A;  2FYA A;  1FRW A;  1FGX A;  3V8Y A;  5AJO A;  2VS4 A;  2Z86 A;  1Z90 A;  2RIY A;  3Q80 A;  5C3D A;  4P02 A;  1H5S C;  2RJ1 A;  3F1C A;  2RIX A;  3FWW A;  4Y6U A;  5FU0 A;  1ZHJ A;  4ASY A;  3TQD A;  4AC3 A;  5CMG X;  1JYK A;  2YES A;  3OH1 A;  5CMJ A;  3POL A;  1H7E A;  3FOQ A;  3ST8 A;  3T7M A;  2DPW A;  2QKX A;  2RIZ A;  1VGZ A;  2X60 A;  2P73 A;  3V0N A;  4DEC A;  3RMW A;  3OH2 A;  4FCE A;  2Q4J A;  1LL2 A;  2JCL A;  2ZU9 A;  3E25 A;  3PNN A;  3ZLL A;  1VGW A;  1PZY B;  4HO4 A;  4NAK A;  2ICX A;  2VD4 A;  5EIY A;  1OMZ A;  4FQW A;  1VH3 A;  3V91 A;  3I0K A;  2V0I A;  4KC1 A;  4ECM A;  4EEG A;  4NAN A;  2Y7A A;  2RJ0 A;  4FRP A;  1SS9 A;  4Y7V A;  5CMH A;  3O3P A;  4D0Z A;  4Y7U A;  1ZI5 A;  3I0F A;  1V84 A;  3U2W A;  2QGI A;  1KWS A;  1GQC A;  2OEG A;  2FYD B;  4HCQ A;  5CQO A;  3CU0 A;  1ON6 A;  2WAW A;  2XMH A;  4KC4 A;  5FU8 A;  3SX3 A;  4MND A;  3JTJ A;  1I52 A;  5CQP A;  4NAL A;  1FZW A;  2D0J A;  5L6S A;  1H7H A;  2AE7 A;  4M28 A;  3SX8 A;  1QGS A;  4D11 C;  5C4E A;  3OC9 A;  1WT0 A;  4BMA A;  1G23 A;  3I0J A;  1G95 A;  1FG5 N;  2AGD A;  1K4V A;  4Y7F A;  4EE4 A;  1H4D A;  2QH5 A;  3N9W A;  5DDV A;  2W0W A;  5IDT A;  4B3U A;  1LZJ A;  2P6W A;  2YCM A;  5C1H A;  1FGG A;  2YQC A;  1H7G A;  1TVY A;  2Y4J A;  3SXG A;  1WVC A;  1WSZ A;  3D8V A;  1NF5 B;  2V0J A;  3IOI A;  1GX0 A;  1GWV A;  1R7T A;  1G9R A;  3I0C A;  2ICY A;  2Y4L A;  2A8W A;  3SXB A;  4AAW A;  4EEO A;  4EEM A;  2YC3 A;  1S4N A;  1R7U A;  5C48 A;  1H5T A;  3DUV A;  5L6V A;  4FRE A;  5FTV A;  4UEG A;  1NHE B;  4LW6 A;  1JVG A;  5C4D A;  4K6R A;  4IRP A;  1O23 B;  1G93 A;  3OKR A;  1ZJO A;  4KRV A;  1O7Q A;  5CMI A;  4ZDQ A;  4P00 A;  5CQN X;  5C4F A;  5C38 A;  1WT1 A;  4B4M A;  1OMX A;  1ZI4 A;  5HS2 A;  1H7F A;  1G1L A;  1R82 A;  1YRO B;  2VSI A;  2X65 A;  2Y4M A;  1ZIZ A;  2O1G A;  1XHB A;  3DK5 A;  2RJ9 A;  3D5N A;  4DDZ A;  4IRQ A;  3OAM A;  5EJ1 A;  1YP4 A;  1HJJ A;  1VZT A;  2VS3 A;  1FWY A;  3QVB A;  3ZGG A;  3T7O A;  4CJB A;  4HO0 A;  1H5R A;  3R3I A;  3F1Y A;  5DDT A;  3RMV A;  1FR8 A;  1LL3 A;  4DE7 A;  5C3B A;  1HM9 A;  2GGO A;  1EYR A;  2X5S A;  1G3L A;  1JV1 A;  2YQS A;  4FRH A;  4D0T A;  4M2A A;  3SX7 A;  5CMF X;  4Y7G A;  1S4P A;  3SPT A;  3NGW A;  2OEF A;  1ZDF A;  2YQJ A;  4B2X A;  4ARW A;  3Q7U A;  4E1K A;  1ZDG A;  1LZI A;  2RJ5 A;  2V0K A;  1ZCT A;  3DJ4 A;  3OGZ A;  4LW3 A;  4FRD A;  3JUJ A;  1G0R A;  2AM5 A;  2UX8 A;  3CKV A;  4G3S A;  1LVW A;  3OH0 A;  4CJ8 A;  1H7Q A;  2AES A;  3I0H A;  3U2X A;  3U2T A;  2D7I A;  1V82 A;  4HO9 A;  3CKO A;  1H4C A;  1FR9 A;  2OI7 A;  2JCO A;  3V0O A;  4C2S A;  2AM3 A;  2YC5 A;  1O7O A;  4EE3 A;  3SXE A;  4KC2 A;  3TZT A;  4B2W A;  4G3Q A;  2OI5 A;  1ON8 A;  1H5S A;  1HM8 A;  1VZX A;  3U2U A;  4CJC A;  3USQ A;  2XWN A;  2XWL A;  3ZLK A;  2X5Z A;  2I5E A;  1R7Y A;  2VXM A;  1TW1 A;  3OH3 A;  4HO8 A;  2I7B A;  1V83 A;  2APC A;  4JD0 A;  4Y63 A;  4FRL A;  5C1G A;  2WVM A;  1FO9 A;  1ZCV A;  3V90 A;  4B4G A;  2RJ8 A;  4MYB A;  3V0M A;  1VM8 A;  1JVD A;  2RIT A;  3I0I X;  1FXO A;  5IDS A;  1OQM B;  1HV9 A;  3CKN A;  1GQ9 A;  3EE5 A;  5FTS A;  3U0X A;  1GA8 A;  1QG8 A;  1ZJ2 A;  2A8U A;  2VXL A;  4FRA A;  4FCU A;  4M4K A;  3PKP A;  3JUK A;  5AJP A;  1ZJP A;  2XME A;  5C47 A;  2FY7 A;  2ZU7 A;  2Y6P A;  3K8D A;  1NQI B;  2VS5 A;  2WE9 A;  2PGY A;  3ZGF A;  4GBP A;  2ZU8 A;  2RJ6 A;  2V0H A;  2PA4 A;  1ZI3 A;  4M2B A;  1VH1 A;  1ZCU A;  1GX4 A;  2AEC A;  4Y6N A;  4FRQ A;  4KT7 A;  4Y7T A;  5EJZ A;  5FYE A;  4EEA A;  1E5K A;  1QGQ A;  1LZ0 A;  4AYL A;  3CGX A;  3IOH A;  4KPZ A;  1IIM A;  1VGU A;  3KIA A;  3PKQ A;  2Z87 A;  1TW5 A;  5AJN A;  1H3M A;  1VPA A;  1EZI A;  4D11 A;  5CQM X;  2RJ4 A;  3HL3 A;  4Y64 A;  3CKQ A;  5FV9 A;  5C1L A;  1TZF A;  2Y4K A;  5IFY A;  4L41 C;  2FFU A;  3I0L A;  3SXA A;  4EVW A;  1HM0 A;  3BCV A;  2I5K A;  3SXD A;  1FOA A;  3I0G A;  4KNR A;  2YQH A;  1VZU A;  3GUE A;  1G2V A;  2FYC B;  1NWG B;  3IOJ A;  3V0Q A;  5I1F A;  3SXC A;  1VIC A;  1INJ A;  1LZ7 A;  2E8B A;  1H5R B;  1ZI1 A;  1O0R A;  4HO5 A;  4HO3 A;  2BO8 A;  4KQL A;  2RJ7 A;  4B5B A;  2CU2 A;  3OH4 A;  1MP4 A;  4BQH A;  2MZB A;  1YP3 A;  4KXO A;  4Y62 A;  4ASJ A;  1R7V A;  2BO7 A;  4D48 A;  1NMM B;  3U2V A;  1QWJ A;  1W77 A;  1G97 A;  2XWM A;  2FFV A;  1MP5 A;  4KNX A;  4FRO A;  2WVK A;  2FYB A;  2VSH A;  2WGZ A;  4Y9X A;  5FUH A;  4FRB A;  4R7P A;  1PZT A;  2AM4 A;  3E26 A;  5C4B A;  2D7R A;  1ZJ0 A;  1H7L A;  2JCK A;  3V0P A;  3V8Z A;  4J18 A;  4HG6 A;  4EE5 A;  2PX7 A;  2W0V A;  4G3P A;  3V0L A;  5C36 A;  1R81 A;  1W57 A;  3I0E A;  1ZJ3 A;  3SX5 A;  3LW6 A;  4AYJ A;  1YP2 A;  3U0Y A;  4NAI A;  3Q4S A;  5CQL X;  5C3A A; 
#chains in the Genus database with same CATH topology
 1W55 A;  1FXJ A;  2O1F A;  2AH9 A;  1JYL A;  4CVH A;  5C4C A;  1MP3 A;  3I0D A;  3USR A;  1JV3 A;  4HO2 A;  2VFZ A;  1FO8 A;  2PGV A;  3CKJ A;  4HOC A;  4KPX A;  1H5S B;  2P72 A;  2BO6 A;  1VGT A;  4B4B A;  1MC3 A;  1ZJ1 A;  2BO4 A;  2OI6 A;  5C8R A;  2O1H A;  3D98 A;  4B42 A;  4HO6 A;  1ZCY A;  1LL0 A;  3K8E A;  3BRK X;  3T7N A;  1XZ6 A;  4G87 A;  5C49 A;  5BXC A;  1S4O A;  4JIS A;  1GWW A;  5JQQ A;  4YS8 A;  1NKH B;  2NXV A;  1R80 A;  1HJL A;  2V0L A;  2JCJ A;  3RSB A;  1IIN A;  3ZF8 A;  1H5S D;  1R7X A;  2WEE A;  2WVL A;  1WT3 A;  1H7T A;  4MIX A;  4XWI A;  5J49 A;  1H5T B;  1G8O A;  3R2W A;  1WT2 A;  1H4E A;  2GGQ A;  1INI A;  2E3D A;  4FRM A;  2FYA A;  1FRW A;  1FGX A;  3V8Y A;  5AJO A;  2VS4 A;  2Z86 A;  1Z90 A;  2RIY A;  3Q80 A;  5C3D A;  4P02 A;  1H5S C;  2RJ1 A;  3F1C A;  2RIX A;  3FWW A;  4Y6U A;  5FU0 A;  1ZHJ A;  4ASY A;  3TQD A;  4AC3 A;  5CMG X;  1JYK A;  2YES A;  3OH1 A;  5CMJ A;  3POL A;  1H7E A;  3FOQ A;  3ST8 A;  3T7M A;  2DPW A;  2QKX A;  2RIZ A;  1VGZ A;  2X60 A;  2P73 A;  3V0N A;  4DEC A;  3RMW A;  3OH2 A;  4FCE A;  2Q4J A;  1LL2 A;  2JCL A;  2ZU9 A;  3E25 A;  3PNN A;  3ZLL A;  1VGW A;  1PZY B;  4HO4 A;  4NAK A;  2ICX A;  2VD4 A;  5EIY A;  1OMZ A;  4FQW A;  1VH3 A;  3V91 A;  3I0K A;  2V0I A;  4KC1 A;  4ECM A;  4EEG A;  4NAN A;  2Y7A A;  2RJ0 A;  4FRP A;  1SS9 A;  4Y7V A;  5CMH A;  3O3P A;  4D0Z A;  4Y7U A;  1ZI5 A;  3I0F A;  1V84 A;  3U2W A;  2QGI A;  1KWS A;  1GQC A;  2OEG A;  2FYD B;  4HCQ A;  5CQO A;  3CU0 A;  1ON6 A;  2WAW A;  2XMH A;  4KC4 A;  5FU8 A;  3SX3 A;  4MND A;  3JTJ A;  1I52 A;  5CQP A;  4NAL A;  1FZW A;  2D0J A;  5L6S A;  1H7H A;  2AE7 A;  4M28 A;  3SX8 A;  1QGS A;  4D11 C;  5C4E A;  3OC9 A;  1WT0 A;  4BMA A;  1G23 A;  3I0J A;  2J0A A;  1G95 A;  1FG5 N;  2AGD A;  1K4V A;  4Y7F A;  4EE4 A;  1H4D A;  2QH5 A;  3N9W A;  5DDV A;  2W0W A;  5IDT A;  4B3U A;  1LZJ A;  2P6W A;  2YCM A;  5C1H A;  1FGG A;  2YQC A;  1H7G A;  1TVY A;  2Y4J A;  3SXG A;  1WVC A;  1WSZ A;  3D8V A;  1NF5 B;  2V0J A;  3IOI A;  1GX0 A;  1GWV A;  1R7T A;  1G9R A;  3I0C A;  2ICY A;  2Y4L A;  2A8W A;  4FIX A;  3SXB A;  4AAW A;  4EEO A;  4EEM A;  2YC3 A;  1S4N A;  1R7U A;  5C48 A;  1H5T A;  3DUV A;  5L6V A;  4FRE A;  5FTV A;  4UEG A;  1NHE B;  4LW6 A;  1JVG A;  5C4D A;  4K6R A;  4IRP A;  1O23 B;  1G93 A;  3OKR A;  1ZJO A;  5D92 A;  4KRV A;  1O7Q A;  5CMI A;  2J0B A;  4ZDQ A;  4P00 A;  5CQN X;  5C4F A;  5C38 A;  1WT1 A;  4B4M A;  1OMX A;  1ZI4 A;  5HS2 A;  1H7F A;  1G1L A;  1R82 A;  1YRO B;  2VSI A;  2X65 A;  2Y4M A;  1ZIZ A;  2O1G A;  1XHB A;  3DK5 A;  2RJ9 A;  3D5N A;  4DDZ A;  4IRQ A;  3OAM A;  5EJ1 A;  1YP4 A;  1HJJ A;  1VZT A;  2VS3 A;  1FWY A;  4O6N A;  3QVB A;  3ZGG A;  3T7O A;  4CJB A;  4HO0 A;  1H5R A;  3R3I A;  3F1Y A;  5DDT A;  3RMV A;  1FR8 A;  1LL3 A;  4DE7 A;  5C3B A;  1HM9 A;  2GGO A;  1EYR A;  2X5S A;  1G3L A;  1JV1 A;  2YQS A;  4FRH A;  4D0T A;  4M2A A;  3SX7 A;  5CMF X;  4Y7G A;  1S4P A;  3SPT A;  3NGW A;  2OEF A;  1ZDF A;  2YQJ A;  4B2X A;  4ARW A;  3Q7U A;  4E1K A;  1ZDG A;  1LZI A;  2RJ5 A;  2V0K A;  1ZCT A;  3DJ4 A;  3OGZ A;  4LW3 A;  4FRD A;  3JUJ A;  1G0R A;  2AM5 A;  2UX8 A;  3CKV A;  4G3S A;  1LVW A;  3OH0 A;  4CJ8 A;  1H7Q A;  2AES A;  3I0H A;  3U2X A;  3U2T A;  2D7I A;  1V82 A;  4HO9 A;  3CKO A;  1H4C A;  1FR9 A;  2OI7 A;  2JCO A;  3V0O A;  4C2S A;  2AM3 A;  2YC5 A;  1O7O A;  4EE3 A;  3SXE A;  4KC2 A;  3TZT A;  4B2W A;  4G3Q A;  2OI5 A;  1ON8 A;  1H5S A;  1HM8 A;  1VZX A;  3U2U A;  4CJC A;  3USQ A;  2XWN A;  2XWL A;  3ZLK A;  2X5Z A;  2I5E A;  1R7Y A;  2VXM A;  1TW1 A;  3OH3 A;  4HO8 A;  2I7B A;  1V83 A;  2APC A;  4JD0 A;  4Y63 A;  4FRL A;  5C1G A;  2WVM A;  1FO9 A;  1ZCV A;  3V90 A;  4B4G A;  2RJ8 A;  4MYB A;  3V0M A;  1VM8 A;  1JVD A;  2RIT A;  3I0I X;  1FXO A;  5IDS A;  1OQM B;  1HV9 A;  3CKN A;  1GQ9 A;  3EE5 A;  5FTS A;  3U0X A;  1GA8 A;  1QG8 A;  1ZJ2 A;  2A8U A;  2VXL A;  4FRA A;  4FCU A;  4M4K A;  3PKP A;  3JUK A;  5AJP A;  1ZJP A;  2XME A;  4FIY A;  5C47 A;  2FY7 A;  2ZU7 A;  2Y6P A;  3K8D A;  1NQI B;  2VS5 A;  2WE9 A;  2PGY A;  3ZGF A;  4GBP A;  2ZU8 A;  2RJ6 A;  2V0H A;  5D91 A;  2PA4 A;  1ZI3 A;  4M2B A;  1VH1 A;  1ZCU A;  1GX4 A;  2AEC A;  4Y6N A;  4FRQ A;  4KT7 A;  4Y7T A;  5EJZ A;  5FYE A;  4EEA A;  1E5K A;  1QGQ A;  1LZ0 A;  4AYL A;  3CGX A;  3IOH A;  4KPZ A;  1IIM A;  1VGU A;  3KIA A;  3PKQ A;  2Z87 A;  1TW5 A;  5AJN A;  1H3M A;  1VPA A;  1EZI A;  4D11 A;  5CQM X;  2RJ4 A;  3HL3 A;  4Y64 A;  3CKQ A;  5FV9 A;  5C1L A;  1TZF A;  2Y4K A;  5IFY A;  4L41 C;  4Q7C A;  2FFU A;  3I0L A;  3SXA A;  4EVW A;  1HM0 A;  3BCV A;  2I5K A;  3SXD A;  1FOA A;  3I0G A;  4KNR A;  2YQH A;  1VZU A;  3GUE A;  1G2V A;  2FYC B;  1NWG B;  3IOJ A;  3V0Q A;  5I1F A;  3SXC A;  1VIC A;  1INJ A;  1LZ7 A;  2E8B A;  1H5R B;  1ZI1 A;  2C0N A;  1O0R A;  4HO5 A;  4HO3 A;  2BO8 A;  4KQL A;  2RJ7 A;  4B5B A;  2CU2 A;  3OH4 A;  1MP4 A;  4BQH A;  2MZB A;  1YP3 A;  4KXO A;  4Y62 A;  4ASJ A;  1R7V A;  2BO7 A;  4D48 A;  1NMM B;  3U2V A;  1QWJ A;  1W77 A;  1G97 A;  2XWM A;  2FFV A;  1MP5 A;  4KNX A;  4FRO A;  2WVK A;  2FYB A;  2VSH A;  2WGZ A;  4Y9X A;  5FUH A;  4FRB A;  4R7P A;  1PZT A;  2AM4 A;  3E26 A;  5C4B A;  2D7R A;  1ZJ0 A;  4O6M A;  1H7L A;  2JCK A;  3V0P A;  3V8Z A;  4J18 A;  4HG6 A;  4EE5 A;  2PX7 A;  2W0V A;  4G3P A;  3V0L A;  5C36 A;  1R81 A;  1W57 A;  3I0E A;  1ZJ3 A;  3SX5 A;  3LW6 A;  4AYJ A;  1YP2 A;  3U0Y A;  4NAI A;  2VK9 A;  3Q4S A;  5CQL X;  5C3A A; 
#chains in the Genus database with same CATH homology
 1W55 A;  1FXJ A;  2O1F A;  2AH9 A;  1JYL A;  4CVH A;  5C4C A;  1MP3 A;  3I0D A;  3USR A;  1JV3 A;  4HO2 A;  2VFZ A;  1FO8 A;  2PGV A;  3CKJ A;  4HOC A;  4KPX A;  1H5S B;  2P72 A;  2BO6 A;  1VGT A;  4B4B A;  1MC3 A;  1ZJ1 A;  2BO4 A;  2OI6 A;  5C8R A;  2O1H A;  3D98 A;  4B42 A;  4HO6 A;  1ZCY A;  1LL0 A;  3K8E A;  3BRK X;  3T7N A;  1XZ6 A;  4G87 A;  5C49 A;  5BXC A;  1S4O A;  4JIS A;  1GWW A;  5JQQ A;  4YS8 A;  1NKH B;  2NXV A;  1R80 A;  1HJL A;  2V0L A;  2JCJ A;  3RSB A;  1IIN A;  3ZF8 A;  1H5S D;  1R7X A;  2WEE A;  2WVL A;  1WT3 A;  1H7T A;  4MIX A;  4XWI A;  5J49 A;  1H5T B;  1G8O A;  3R2W A;  1WT2 A;  1H4E A;  2GGQ A;  1INI A;  2E3D A;  4FRM A;  2FYA A;  1FRW A;  1FGX A;  3V8Y A;  5AJO A;  2VS4 A;  2Z86 A;  1Z90 A;  2RIY A;  3Q80 A;  5C3D A;  4P02 A;  1H5S C;  2RJ1 A;  3F1C A;  2RIX A;  3FWW A;  4Y6U A;  5FU0 A;  1ZHJ A;  4ASY A;  3TQD A;  4AC3 A;  5CMG X;  1JYK A;  2YES A;  3OH1 A;  5CMJ A;  3POL A;  1H7E A;  3FOQ A;  3ST8 A;  3T7M A;  2DPW A;  2QKX A;  2RIZ A;  1VGZ A;  2X60 A;  2P73 A;  3V0N A;  4DEC A;  3RMW A;  3OH2 A;  4FCE A;  2Q4J A;  1LL2 A;  2JCL A;  2ZU9 A;  3E25 A;  3PNN A;  3ZLL A;  1VGW A;  1PZY B;  4HO4 A;  4NAK A;  2ICX A;  2VD4 A;  5EIY A;  1OMZ A;  4FQW A;  1VH3 A;  3V91 A;  3I0K A;  2V0I A;  4KC1 A;  4ECM A;  4EEG A;  4NAN A;  2Y7A A;  2RJ0 A;  4FRP A;  1SS9 A;  4Y7V A;  5CMH A;  3O3P A;  4D0Z A;  4Y7U A;  1ZI5 A;  3I0F A;  1V84 A;  3U2W A;  2QGI A;  1KWS A;  1GQC A;  2OEG A;  2FYD B;  4HCQ A;  5CQO A;  3CU0 A;  1ON6 A;  2WAW A;  2XMH A;  4KC4 A;  5FU8 A;  3SX3 A;  4MND A;  3JTJ A;  1I52 A;  5CQP A;  4NAL A;  1FZW A;  2D0J A;  5L6S A;  1H7H A;  2AE7 A;  4M28 A;  3SX8 A;  1QGS A;  4D11 C;  5C4E A;  3OC9 A;  1WT0 A;  4BMA A;  1G23 A;  3I0J A;  2J0A A;  1G95 A;  1FG5 N;  2AGD A;  1K4V A;  4Y7F A;  4EE4 A;  1H4D A;  2QH5 A;  3N9W A;  5DDV A;  2W0W A;  5IDT A;  4B3U A;  1LZJ A;  2P6W A;  2YCM A;  5C1H A;  1FGG A;  2YQC A;  1H7G A;  1TVY A;  2Y4J A;  3SXG A;  1WVC A;  1WSZ A;  3D8V A;  1NF5 B;  2V0J A;  3IOI A;  1GX0 A;  1GWV A;  1R7T A;  1G9R A;  3I0C A;  2ICY A;  2Y4L A;  2A8W A;  4FIX A;  3SXB A;  4AAW A;  4EEO A;  4EEM A;  2YC3 A;  1S4N A;  1R7U A;  5C48 A;  1H5T A;  3DUV A;  5L6V A;  4FRE A;  5FTV A;  4UEG A;  1NHE B;  4LW6 A;  1JVG A;  5C4D A;  4K6R A;  4IRP A;  1O23 B;  1G93 A;  3OKR A;  1ZJO A;  5D92 A;  4KRV A;  1O7Q A;  5CMI A;  2J0B A;  4ZDQ A;  4P00 A;  5CQN X;  5C4F A;  5C38 A;  1WT1 A;  4B4M A;  1OMX A;  1ZI4 A;  5HS2 A;  1H7F A;  1G1L A;  1R82 A;  1YRO B;  2VSI A;  2X65 A;  2Y4M A;  1ZIZ A;  2O1G A;  1XHB A;  3DK5 A;  2RJ9 A;  3D5N A;  4DDZ A;  4IRQ A;  3OAM A;  5EJ1 A;  1YP4 A;  1HJJ A;  1VZT A;  2VS3 A;  1FWY A;  4O6N A;  3QVB A;  3ZGG A;  3T7O A;  4CJB A;  4HO0 A;  1H5R A;  3R3I A;  3F1Y A;  5DDT A;  3RMV A;  1FR8 A;  1LL3 A;  4DE7 A;  5C3B A;  1HM9 A;  2GGO A;  1EYR A;  2X5S A;  1G3L A;  1JV1 A;  2YQS A;  4FRH A;  4D0T A;  4M2A A;  3SX7 A;  5CMF X;  4Y7G A;  1S4P A;  3SPT A;  3NGW A;  2OEF A;  1ZDF A;  2YQJ A;  4B2X A;  4ARW A;  3Q7U A;  4E1K A;  1ZDG A;  1LZI A;  2RJ5 A;  2V0K A;  1ZCT A;  3DJ4 A;  3OGZ A;  4LW3 A;  4FRD A;  3JUJ A;  1G0R A;  2AM5 A;  2UX8 A;  3CKV A;  4G3S A;  1LVW A;  3OH0 A;  4CJ8 A;  1H7Q A;  2AES A;  3I0H A;  3U2X A;  3U2T A;  2D7I A;  1V82 A;  4HO9 A;  3CKO A;  1H4C A;  1FR9 A;  2OI7 A;  2JCO A;  3V0O A;  4C2S A;  2AM3 A;  2YC5 A;  1O7O A;  4EE3 A;  3SXE A;  4KC2 A;  3TZT A;  4B2W A;  4G3Q A;  2OI5 A;  1ON8 A;  1H5S A;  1HM8 A;  1VZX A;  3U2U A;  4CJC A;  3USQ A;  2XWN A;  2XWL A;  3ZLK A;  2X5Z A;  2I5E A;  1R7Y A;  2VXM A;  1TW1 A;  3OH3 A;  4HO8 A;  2I7B A;  1V83 A;  2APC A;  4JD0 A;  4Y63 A;  4FRL A;  5C1G A;  2WVM A;  1FO9 A;  1ZCV A;  3V90 A;  4B4G A;  2RJ8 A;  4MYB A;  3V0M A;  1VM8 A;  1JVD A;  2RIT A;  3I0I X;  1FXO A;  5IDS A;  1OQM B;  1HV9 A;  3CKN A;  1GQ9 A;  3EE5 A;  5FTS A;  3U0X A;  1GA8 A;  1QG8 A;  1ZJ2 A;  2A8U A;  2VXL A;  4FRA A;  4FCU A;  4M4K A;  3PKP A;  3JUK A;  5AJP A;  1ZJP A;  2XME A;  4FIY A;  5C47 A;  2FY7 A;  2ZU7 A;  2Y6P A;  3K8D A;  1NQI B;  2VS5 A;  2WE9 A;  2PGY A;  3ZGF A;  4GBP A;  2ZU8 A;  2RJ6 A;  2V0H A;  5D91 A;  2PA4 A;  1ZI3 A;  4M2B A;  1VH1 A;  1ZCU A;  1GX4 A;  2AEC A;  4Y6N A;  4FRQ A;  4KT7 A;  4Y7T A;  5EJZ A;  5FYE A;  4EEA A;  1E5K A;  1QGQ A;  1LZ0 A;  4AYL A;  3CGX A;  3IOH A;  4KPZ A;  1IIM A;  1VGU A;  3KIA A;  3PKQ A;  2Z87 A;  1TW5 A;  5AJN A;  1H3M A;  1VPA A;  1EZI A;  4D11 A;  5CQM X;  2RJ4 A;  3HL3 A;  4Y64 A;  3CKQ A;  5FV9 A;  5C1L A;  1TZF A;  2Y4K A;  5IFY A;  4L41 C;  4Q7C A;  2FFU A;  3I0L A;  3SXA A;  4EVW A;  1HM0 A;  3BCV A;  2I5K A;  3SXD A;  1FOA A;  3I0G A;  4KNR A;  2YQH A;  1VZU A;  3GUE A;  1G2V A;  2FYC B;  1NWG B;  3IOJ A;  3V0Q A;  5I1F A;  3SXC A;  1VIC A;  1INJ A;  1LZ7 A;  2E8B A;  1H5R B;  1ZI1 A;  2C0N A;  1O0R A;  4HO5 A;  4HO3 A;  2BO8 A;  4KQL A;  2RJ7 A;  4B5B A;  2CU2 A;  3OH4 A;  1MP4 A;  4BQH A;  2MZB A;  1YP3 A;  4KXO A;  4Y62 A;  4ASJ A;  1R7V A;  2BO7 A;  4D48 A;  1NMM B;  3U2V A;  1QWJ A;  1W77 A;  1G97 A;  2XWM A;  2FFV A;  1MP5 A;  4KNX A;  4FRO A;  2WVK A;  2FYB A;  2VSH A;  2WGZ A;  4Y9X A;  5FUH A;  4FRB A;  4R7P A;  1PZT A;  2AM4 A;  3E26 A;  5C4B A;  2D7R A;  1ZJ0 A;  4O6M A;  1H7L A;  2JCK A;  3V0P A;  3V8Z A;  4J18 A;  4HG6 A;  4EE5 A;  2PX7 A;  2W0V A;  4G3P A;  3V0L A;  5C36 A;  1R81 A;  1W57 A;  3I0E A;  1ZJ3 A;  3SX5 A;  3LW6 A;  4AYJ A;  1YP2 A;  3U0Y A;  4NAI A;  2VK9 A;  3Q4S A;  5CQL X;  5C3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...