1G8TA

Sm endonuclease from seratia marcenscens at 1.1 a resolution
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
241
structure length
241
Chain Sequence
SIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGANAALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGTQKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPGVLPELMGCKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic structure of the Serratia marcescens endonuclease at 1.1 A resolution and the enzyme reaction mechanism.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
molecule keywords NUCLEASE SM2 ISOFORM
total genus 74
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature ec 3.1.30.2: Serratia marcescens nuclease.
pdb deposition date 2000-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01223 Endonuclease_NS DNA/RNA non-specific endonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.570.10 Alpha Beta 3-Layer(aba) Sandwich Extracellular Endonuclease; Chain A Extracellular Endonuclease, subunit A 1g8tA00
1SMNA 5INHA 5IJQA 4E3YA 1QL0A 2XR9A 3NKQA 5IJSA 1G8TA 3WAVA 3NKNA 5HRTA 4ZG9A 4GTYA 2XH3A 3NKPA 5L0BA 1ZM8A 5GKPA 4ZGAA 2XRGA 3NKRA 4QH0A 4B56A 2O3BA 4GTZA 4ZG6A 4GTWA 5LIAA 3WAWA 5DLWA 5LQQA 3NKMA 3NKOA 4ZG7A 3S5BA 4A1NA 5GKCA 3ISMA 5KXAA 5DLVA 5L0EA 1QAEA 5L0KA 3WAYA 2XGRA 3OWVA 4QGOA 5DLTA 3WAXA 4GTXA 4QN0A
chains in the Genus database with same CATH superfamily
1SMNA 5INHA 5IJQA 4E3YA 1QL0A 2XR9A 3NKQA 5IJSA 1G8TA 3WAVA 3NKNA 5HRTA 4ZG9A 4GTYA 2XH3A 3NKPA 5L0BA 1ZM8A 5GKPA 4ZGAA 2XRGA 3NKRA 4QH0A 4B56A 2O3BA 4GTZA 4ZG6A 4GTWA 5LIAA 3WAWA 5DLWA 5LQQA 3NKMA 3NKOA 4ZG7A 3S5BA 4A1NA 5GKCA 3ISMA 5KXAA 5DLVA 5L0EA 1QAEA 5L0KA 3WAYA 2XGRA 3OWVA 4QGOA 5DLTA 3WAXA 4GTXA 4QN0A
chains in the Genus database with same CATH topology
1SMNA 5INHA 5IJQA 4E3YA 1QL0A 2XR9A 3NKQA 5IJSA 1G8TA 3WAVA 3NKNA 5HRTA 4ZG9A 4GTYA 2XH3A 3NKPA 5L0BA 1ZM8A 5GKPA 4ZGAA 2XRGA 3NKRA 4QH0A 4B56A 2O3BA 4GTZA 4ZG6A 4GTWA 5LIAA 3WAWA 5DLWA 5LQQA 3NKMA 3NKOA 4ZG7A 3S5BA 4A1NA 5GKCA 3ISMA 5KXAA 5DLVA 5L0EA 1QAEA 5L0KA 3WAYA 2XGRA 3OWVA 4QGOA 5DLTA 3WAXA 4GTXA 4QN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SMN A;  5INH A;  5IJQ A;  4E3Y A;  1QL0 A;  2XR9 A;  3NKQ A;  5IJS A;  1G8T A;  3WAV A;  3NKN A;  5HRT A;  4ZG9 A;  4GTY A;  2XH3 A;  3NKP A;  5L0B A;  1ZM8 A;  5GKP A;  4ZGA A;  2XRG A;  3NKR A;  4QH0 A;  4B56 A;  2O3B A;  4GTZ A;  4ZG6 A;  4GTW A;  5LIA A;  3WAW A;  5DLW A;  5LQQ A;  3NKM A;  3NKO A;  4ZG7 A;  3S5B A;  4A1N A;  5GKC A;  3ISM A;  5KXA A;  5DLV A;  5L0E A;  1QAE A;  5L0K A;  3WAY A;  2XGR A;  3OWV A;  4QGO A;  5DLT A;  3WAX A;  4GTX A;  4QN0 A; 
#chains in the Genus database with same CATH topology
 1SMN A;  5INH A;  5IJQ A;  4E3Y A;  1QL0 A;  2XR9 A;  3NKQ A;  5IJS A;  1G8T A;  3WAV A;  3NKN A;  5HRT A;  4ZG9 A;  4GTY A;  2XH3 A;  3NKP A;  5L0B A;  1ZM8 A;  5GKP A;  4ZGA A;  2XRG A;  3NKR A;  4QH0 A;  4B56 A;  2O3B A;  4GTZ A;  4ZG6 A;  4GTW A;  5LIA A;  3WAW A;  5DLW A;  5LQQ A;  3NKM A;  3NKO A;  4ZG7 A;  3S5B A;  4A1N A;  5GKC A;  3ISM A;  5KXA A;  5DLV A;  5L0E A;  1QAE A;  5L0K A;  3WAY A;  2XGR A;  3OWV A;  4QGO A;  5DLT A;  3WAX A;  4GTX A;  4QN0 A; 
#chains in the Genus database with same CATH homology
 1SMN A;  5INH A;  5IJQ A;  4E3Y A;  1QL0 A;  2XR9 A;  3NKQ A;  5IJS A;  1G8T A;  3WAV A;  3NKN A;  5HRT A;  4ZG9 A;  4GTY A;  2XH3 A;  3NKP A;  5L0B A;  1ZM8 A;  5GKP A;  4ZGA A;  2XRG A;  3NKR A;  4QH0 A;  4B56 A;  2O3B A;  4GTZ A;  4ZG6 A;  4GTW A;  5LIA A;  3WAW A;  5DLW A;  5LQQ A;  3NKM A;  3NKO A;  4ZG7 A;  3S5B A;  4A1N A;  5GKC A;  3ISM A;  5KXA A;  5DLV A;  5L0E A;  1QAE A;  5L0K A;  3WAY A;  2XGR A;  3OWV A;  4QGO A;  5DLT A;  3WAX A;  4GTX A;  4QN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...