1G8WA

Improved structure of phytohemagglutinin-l from the kidney bean
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
233
structure length
233
Chain Sequence
SNDIYFNFQRFNETNLILQRDASVSSSGQLRLTNLNGNGEPRVGSLGRAFYSAPIQIWDNTTGTVASFATSFTFNIQVPNNAGPADGLAFALVPVGSQPKDKGGFLGLFDGSNSNFHTVAVEFDTLYNKDWDPTERHIGIDVNSIRSIKTTRWDFVNGENAEVLITYDSSTNLLVASLVYPSQKTSFIVSDTVDLKSVLPEWVSVGFSATTGINKGNVETNDVLSWSFASKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEUCOAGGLUTINATING PHYTOHEMAGGLUTININ
publication title Weak protein-protein interactions in lectins: the crystal structure of a vegetative lectin from the legume Dolichos biflorus.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 45
structure length 233
sequence length 233
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1g8wA00
1JW6A 1Y7BA 1Q8VA 1QDCA 1LOFA 3AYDA 3HN1A 3KM5A 2ZBJA 3OPZA 1I3HA 1O4ZA 3WUDA 2H0BA 4DRVA 2YROA 3IN9A 3IPVA 3FUQA 1V6JA 3AZXA 1S1AA 1V00A 2A3YA 4FOVA 4XJZA 5GLVA 1U0AA 4YGDA 2JDZA 3RMXA 3WHUA 1WLCA 1GNHA 1N3OA 2OVUA 2ZGMA 2FHRA 3AZWA 3JU9A 3M3EA 1IS4A 1ULEA 2CNAA 1FNZA 4Y20B 2ZAAA 1SCSA 4Q1RA 1DQ1A 1OKQA 1SLCA 3OY8A 2ZABA 2D3PA 5JOWA 1IS6A 1XQNA 1GBGA 3H0OA 4XIKA 5T5PA 5DUVA 1Z78A 3O0VA 5DUUA 4F83A 2VXRA 2JECA 3VKFC 1MS9A 1W6MA 4DQAA 1JHNA 1FNYA 1WCSA 3D6EA 4ASMB 3PJQA 4K21A 2A3WA 2A6WA 3WG4A 4FQ4A 2YY1A 4K1ZA 4YGEA 3MPPG 5IK5A 2JD4A 1DGLA 1W6QA 2P3JA 2W39A 4PQ9A 1AF9A 1FV2A 5HCFA 3ZSLA 1SFYA 5T5JA 5JLVA 1LTEA 2GNMA 2SLIA 1J1TA 4FVVA 1YRZA 2ZGTA 3POYA 1YXWA 2R0HA 2WLQA 5DUXA 2P34A 5CA6A 1W0OA 1QF3A 1S0EA 2LTNA 3ILNA 2A6ZA 5JOYA 3N36A 3LCPA 2GALA 1CESA 2ZKNA 4DFSA 2D3SA 3ENRA 1V6MA 1JYCA 2ZHLA 3UL2A 2NMOA 1N47A 2OUHA 4XJWA 4Y26A 3AK0A 2B7YA 4FPEA 1Q56A 1UKGA 1SLIA 4LBQA 4YGCA 3TAYA 4UW3A 3WZ1A 1ULCA 4U36A 1B09A 1LHUA 4FPJA 4YFWA 3B00A 3U4XA 1URXA 4ISRA 1MVEA 2ZHMA 4M3CB 5EXOA 2ZMNA 2OUJA 3N7JA 2R16A 4NO4A 2LALA 3RS6A 1QNWA 2AENA 2D6NA 1GSLA 3AXEA 4XDQA 3R4UA 3WDXA 4W65A 1CVNA 1S0GA 2AUYA 3AP7A 1YO8A 3AZZA 2A7AA 5GZFA 4GKXA 2GMPA 2ERFA 2PELA 3CNAA 3FLRA 4JC1A 5EYXA 1FX5A 2R1BA 2WT1A 4YGBA 4XJUA 1V6LA 4CTEA 2WQZC 1QMJA 1YIFA 1A8DA 1DIWA 3AP4A 1C4RA 1VIWB 1MS0A 5T55A 4Q2FA 2YMZA 3B9CA 3D4KA 4PF5A 4FPFA 1BKZA 5DXDA 4BLJA 3A0NA 2EXIA 4YM1A 2DVFA 2SBAA 3SH3A 2JE7A 4LBQD 4PCRA 1KJRA 1S0BA 3WDWA 2W08A 1GKBA 3M3CA 4FPLA 4M3CA 2ZA9A 4JRAA 1GV9A 3ASIA 3BIWE 4AGGA 3N3HA 2EXJA 3NV4A 1BJQA 4UW5A 1GZWA 2DTYA 4ATFA 2XG3A 3AYAA 1OQ1A 2ZMKA 2ZZJA 1UX6A 1SCRA 5GZDA 2VH9A 4YW3A 1LGBA 3ZSJA 2WKKA 3WNXA 4AWDA 1MR5A 1A3KA 4M3CE 1RIRA 5GJ6A 1UL9A 3GNEA 4FPOB 2PHWA 4YZ1A 1N1VA 1W6OA 3VKNA 1VLNA 3N7LA 3AJYA 3O12A 1CN1A 4JCKA 2E6VA 3MW4A 3GALA 2V5YA 3OBRA 3WDUA 2ENRA 1SLLA 3SNMA 4LBNA 2GNTA 2CL2A 2NM1A 4DRRA 2ZHKA 2ZGLA 1ULGA 3SH4A 3WCRA 4P9WA 5GZGA 3V64A 3M3OA 4ZXKA 3ZYRA 3B69A 4WVWA 1ENQA 1LU1A 2GMEA 3BODA 2DVBA 4GKYA 5JMCA 1KDKA 1ZM1A 2ZHNA 1NLSA 3W59A 4GWMA 3SISA 1DQ2A 4L8QA 1AJKA 4YM0A 3O0XA 2A6XA 3I8TA 1PZ7A 2NP0A 2ARBA 3SH5A 1G9FA 3AX4A 3ZXFA 2A70A 2D44A 4P14A 5E89A 2E7QA 1UPSA 2XB6C 1QOSA 4FP3A 4K1YA 4Y1ZA 1LHNA 3ZYPA 1C1FA 1JBCA 4DS0A 1RITA 2EALA 3POWA 3AYCA 3WG3A 1GICA 3FUOA 5DUWA 2V73A 1IS3A 1LOAA 3QCWA 4RA0A 3WDYA 2UWCA 3A4UA 2AREA 1DYPA 1W6PB 2GMMA 4Q1PA 4XOGA 4ITCA 1SBFA 4YZ4A 4FPKA 3WCSA 1LOBA 5IK8A 2ZGRA 2TEPA 2JE9A 2ZGQA 3MW3A 4U2AA 2CWMA 5IUQA 1APNA 2W68A 2ZGOA 5IT6A 2WJSA 1QU0A 4Y22B 1WW4A 1LHVA 4YG6A 1N3QA 2I2SA 2PHRA 1GZ9A 4FPCA 1MS1A 1AX0A 1QGLA 4XXAA 2DUOA 5DZEA 4BMEA 4Y20A 3NV1A 5EWSA 2WSVA 1QOOA 2VU9A 3AZVA 5F9TA 1DYKA 2G4IA 1W0PA 1G8WA 5KXCA 4XJ8A 4XJ9A 3VV1A 3PVNA 4FP2A 4CZSA 3OGGA 4K20A 5H9SA 3UJOA 3Q9OA 1JUIA 5GZEA 3V0BB 4XZPA 2KM2A 2CYFA 4Y1XA 4XTPA 5KXBA 1GZCA 2DU1A 4TYSA 2A71A 3B3QE 2EIGA 2D6MA 5HCBA 2W52A 4YG0A 2WNEA 4YW2A 3SLIA 5KXEA 1WBLA 4AGRA 1LHOA 1AXKA 4BMBA 1SBEA 3AXDA 2UWBA 3ILRA 1YI7A 1FYUA 1MS8A 1VALA 2JJ6A 2UU8A 2VW0A 2ZGPA 3N35A 4UW4A 4AYUA 4WZFA 1G9BA 2EF6A 5JVVA 1GLHA 1BXHA 3B01A 4XBNA 5H9QA 2VY0A 3USUB 3VUOA 2PHFA 1G86A 1F31A 1S0JA 2JKBA 1LESA 1UZZA 4FOQA 1HKDA 2FMDA 3IMNA 3V0AB 3ZXKA 5GZCA 1JN2P 1N1TA 3HR9A 4AGVA 2GNBA 4FPYA 2Z42A 1UAIA 2PHUA 2OW4A 2D6LX 4FOYA 1HLCA 3V65A 5KXDA 3JUUA 4M00A 1FV3A 3T2TA 2ZGUA 2PHXA 3LSDA 3PMEA 1JOJA 4IQPA 2A5ZA 3AYEA 4BOWA 4YZ2A 2BQPA 4LBLA 5GLZA 2EXKA 5BYNA 1H9WA 4XTMA 3ZXJA 3WV6A 4BLIA 3AZYA 1Q8QA 1S0DA 1N1SA 3AJZA 2YXSA 1IKPA 1AZDA 4GWNA 1D2SA 4XJAA 1S0CA 3IM0A 3FBYA 4GXLA 1MVQA 2UURA 4I30A 3RMYA 4Y1UA 4ATEA 3R05A 5T54A 3FLTA 4OZXA 5JOXA 3WG2A 2EAKA 2GN7A 1WD4A 1Z0HA 4Q27A 4Y1VA 3WVJA 5CNAA 5FRAA 1ENRA 1LU2A 2CY6A 4XIOA 4YM3A 3DGTA 1WW7A 4R9DA 3IPVB 1MZ6A 1WLWA 3POSA 2D3RA 5FREA 4FOWA 2DWRA 4XILA 5GALA 1DQ6A 3A0KA 1SBDA 2C5DA 2ZACA 4M3CF 3WDVA 1W6NB 5JOZA 2Q5TA 1FATA 5GM0A 1CR7A 1DFQA 3AP6A 4KBBA 1OFSA 4XHXA 1LODA 2E7TA 2VUAA 1SACA 3ZPYA 2WSUA 2WT2A 3M3QA 1JYIA 4ZKTB 4XMIA 5T50A 2D7FA 1PZ8A 1G7YA 1Q8PA 4YLZA 3UJQA 1YYNA 2R0FA 4Q8LA 3WUCA 1WD3A 1AXYA 5DG2A 1G9CA 1KQRA 1WLDA 2RHPA 3T1MA 2NN8A 5EYYA 2E51A 5GLWA 4XYXA 2D6OX 5CB7A 2VW1A 4BQ1A 1DBNA 5JDBA 4Z8BA 1W6QB 3WG1A 1WUVA 3MW2A 4TZDA 4Y1YA 5E88A 2CTVA 2WT0A 4LBKA 1LJ7A 1Q8SA 1G9AA 1W6NA 3ZVXA 5H9RA 3FLPA 4UW6A 1IOAA 3I4IA 3R4SA 4XMAA 1AVBA 1CPNA 1F5FA 5HCAA 2PHTA 1GANA 1KJLA 1AXZA 1C57A 4LBJA 4LBOA 3O5SA 4LBQB 4M01A 5DG1A 5LK5A 1KITA 3KQRA 3NV2A 4MYEA 1HQWA 3ZXEA 1ULDA 3QLQA 1EPWA 2AYHA 3WLUA 3LSEA 1LGCA 1V6NA 1H9PA 2DURA 4HL0A 4Q8KA 1C1LA 5T52A 4Q26A 1MS4A 3AP9A 5F5QA 3ILFA 4WV8A 5CAZA 2A75A 1IS5A 4LBMA 4WVVA 3WOGA 2R49A 1GNZA 1DZQA 1WW5A 3RRDA 3TB0A 4YW4A 1LGNA 4ISQA 1ONAA 2E53A 4Y24A 1BQPA 3D5OA 2DVGA 3T1LA 2DU0A 5T5OA 3VKMA 2UWAA 4YW1A 1W6PA 4GALA 3NV3A 2YV8A 3AFKA 2DYCA 5SV8A 1F9KA 5E8AA 1CPMA 1AJOA 3IKWA 4P9YA 3WDTA 2DUQA 2ZGNA 3VKOA 3OJBA 2D6KA 1SLAA 4CRQA 3N7MA 1UZYA 2A6VA 4Y22A 3UK9A 1CIWA 1JXNA 4FQZA 3FFZA 3OYWB 3ZXLA 1QKQA 3RQ0A 3WHTA 2YZ4A 3ZSKA 4AVVA 1DLLA 2P3KA 1DQ4A 3ZSMA 3PVOA 1LEMA 5GLTA 1BZWA 1CJPA 4XBQA 2HYKA 1O4YA 1WBFA 1A78A 1LULA 1SLBA 1CONA 2AR6A 3V0BA 4XXPA 1GYKA 5IK7A 2P2KA 1GZWB 3OBTA 1FAYA 4RL7A 4YW5A 1ULFA 4AVTA 3C2UA 1LOEA 2NZ9A 4R9BA 1RINA 4R9CA 5DZGA 2GNDA 3MEPA 1CQ9A 2ZMLA 1TEIA 1UMZA 3NWKA 3W58A 1DQ0A 1QOTA 2EXHA 4XE9A 2NYYA 1V6KA 3AP5A 4C1WA 2VW2A 1LEDA 2D43A 1W6OB 2CWSA 3L2YA 4SLIA 4BPZA 1H30A 2ZGSA 1NXD1 3HMYA 3INAA 1D0HA 1MACA 1V6OA 4NOTA 3USUA 4FPHA 2P37A 3RG0A 2DVAA 3APBA 1LHWA 1KDMA 2R1DA 4YZ5A 2NMNA 2GDFA 3OYWA 2P3IA 3V0AA 1LCLA 1V6IA 5L73A 2A6YA 4XHBA 1LOGA 1HQLA 1IKQA 2DUPA 4FPGA 1MS5A 1MS3A 1QNYA 3O0WA 3DUIA 3PVEA 2DVDA 3ATGA 3RSJA 1PZ9A 4H55A 1AX1A 5GLUA 3BOPA 4AVSA 1KRIA 1ZA4A 4PBPA 5T5LA 1VAVA 3VKLA 3N7KA 5H9PA 1BYHA 3SITA 4DPNA 1QDOA 3BTAA 2A3XA 1LOCA 1UN1A 3OY8B 2GN3A 2ARXA 1SLTA 1HDKA 2DV9A 1VAMA 2ZGKA 4PBOA 5CBLA 2AGSA 4HANA 4XBLA 4BM8A 1X50A 1N3PA 1R1ZA 2C9AA 1LECA 2AH2A 5AVAA 2D6PA 1MZ5A 1S0FA 1WW6A 4YFZA 1DHKB 1LOFC 5DZFA 3M2MA 2DTWA 2ES3A 1I1EA 4P9XA 4YM2A 1W6MB 5IK4A 1ENSA 4YG3A 1Q8OA 1DQ5A 3M1HA 4GA9A 4R9AA 1S0IA 1G9DA 1LENA 4C1XA 1N1YA 4YZ3A 1AX2A 4D69A
chains in the Genus database with same CATH superfamily
4E2SA 1JW6A 1W2UA 1LOFA 3AYDA 3HN1A 3KM5A 1RVF1 1GOHA 2XLGA 4LR4A 4LUKA 3GHMA 2H0BA 4I0WB 2QCSB 2XBO1 2YROA 3IN9A 3IPVA 3WSOA 5A3TA 1SQ4A 5LBBA 4FOVA 3MF6A 5GLVA 5FYUA 1RUH2 4YGDA 3WHUA 2OVUA 1BBT3 3PU8A 4BA6A 3AKPA 1W2TA 1ULEA 3ZR6A 3HN3A 1FNZA 2AACA 1YFXA 4UFMA 1IG3A 1SCSA 2XJSA 1F8VA 5FYCA 4GQ7A 4XQ4A 4OMCA 1PGL2 2BGPA 4GD4A 4AI3A 4PJYA 1QXPA 1ACCA 5DAVA 4QX2A 2K2SA 5T5PA 4BB3A 4Q0PA 1Z78A 3O0VA 5LZ6A 3E5XA 5DQ0A 4B8EA 4F83A 1W6MA 4XEZA 2WO2A 4G3YC 1LNSA 4IV1C 1WCSA 2W1SA 2N7GA 2A6WA 4PIYA 4FQ4A 2YY1A 2W47A 2RR11 3O7OA 1O4TA 3GGLA 4K1ZA 3VBHC 3MPPG 2P6HA 2VQ0A 4NPMA 4O9EA 3VBUB 1QQP1 4AHXA 3WEZA 1DGLA 2Y38A 3R4DB 1AF9A 1FV2A 4ARYA 1SFYA 4IV1A 3VBFB 1JYVA 2SLIA 4XFFA 1J1TA 4FVVA 5FXXA 3PVBB 2R0HA 2WLQA 1RC6A 3VBHA 2VNVA 1QF3A 1QJZA 1YI9A 2MEV3 3ILNA 3P3NA 2GC3A 3N36A 3NJVA 1CESA 2G1MA 1COV3 5FZ0A 4FFGA 5FP3A 2Y6GA 1JYCA 3LPFA 2NMOA 4Y5Z0 1N47A 1W8ZA 2LRPA 3RZKA 1MPXA 3AK0A 2VVEA 4Q4W3 1O3QA 3RJRA 1O8PA 5FLHA 4A3ZA 1FPN1 5FPVA 3FHQA 2B45X 3AM2A 4YGCA 3TAYA 3WY6A 1ULCA 1YCIA 2O8OA 1B09A 1IZ3A 4NE9A 4DXRA 5LK7B 1MVEA 4M3CB 2OUJA 3ZMNA 1PO22 1T6GC 2XWBB 5A7WB 3RS6A 1AYM3 5AFBA 1UX7A 2AENA 1QJY2 2K0GA 1QIQA 3WDXA 3AZZA 3GF6A 4B4RA 1OHFA 4MH0E 1JYTA 3MLJA 1ODMA 1OOPC 3J4UH 2HWE1 5HI0A 2ERFA 2PELA 3BN6A 5EYXA 2R1BA 1OH3A 2JG8C 4CCDA 2VUJA 3ZSEA 1FOD1 1OH4A 3KS7A 4CTEA 4DXZA 1O3TA 1BEV2 1DF0A 1YIFA 1DIWA 3AP4A 1LRHA 1C4RA 4HN1A 3CZUA 3GBGA 1OOPA 3DECA 3WW2A 3D4KA 4PF5A 1BKZA 3KV5A 5DXDA 4COVA 4XUOA 5HV0A 2JG8A 5LEJA 3ZIWA 2EXIA 4META 3LDRA 3SH3A 1K42A 4K9SA 2JDMA 2ZEYA 3M3CA 4FPLA 1BHGA 5FZ9A 2ZA9A 2QE3A 2VZOA 4AGGA 3J8F1 4MXWB 1GWKA 4BYYA 3UKNA 4E4HA 1HXS1 3N3HA 3NV4A 3VDCA 1ULOA 3ZFEB 3VDDB 1RMU2 4UW5A 2R072 4ATFA 3OGVA 3AYAA 1XNCA 4NAOA 1SFNA 4FFHA 1CAVB 1UX6A 1SCRA 3KT1A 4LJHA 1CGPA 1ZREA 3SEPA 4RS5C 2VH9A 1BVP1 4FTBA 2CGPA 4UFKA 1JOBA 1JZ3A 3ZYIB 3LB9A 3FL7A 4IGQA 2PLV2 4PLMA 5C70A 4YZ1A 1GOGA 1W6OA 3NL1A 3OF1A 3C7FA 1H1AA 4C8DA 2FDJA 1NCRB 2Z79A 3KCYA 2OZJA 3MW4A 1R64A 1QJU3 4OUMA 1PGW1 5IFPA 3UNPA 3RNSA 4P5YA 1SLLA 4DZGA 1UOFA 2W0XA 4FTSA 5LRRA 2BERA 1E5RA 2HWC3 2QZ2A 5FZLA 2CL2A 2QQVA 3H50A 3ITQA 4CCJA 4JDMA 1D4VB 2TBVA 1ZBA3 1NA1C 2VGDA 2DCZA 2BFUS 5LY1A 1ULGA 2VAUA 3SH4A 3SQOA 3WCRA 5GZGA 3TEYA 3LOBA 4B4PA 2X09A 4HK8A 2YBPA 3ZO0B 1LU1A 4H14A 2GMEA 2DVBA 3FN9A 2XHNA 5L36A 1NA1A 3SISA 3N9NA 4RYDA 2RS52 2P6CA 5FP4A 2PQSA 2WWSA 1LKNA 5FZIA 2ARBA 3SH5A 1W3XA 2J22A 1U5YA 5FQ0B 1W8HA 1RUI1 4K1YA 4CUAA 4Y1ZA 1UY0A 3B02A 2WFF2 1JBCA 4WVZA 3NAPB 1RUE2 1RITA 1VBB2 2J1UA 1VBE1 5KWRA 2Q8CA 4WM7A 3KMHA 3WG3A 1AL0G 1GICA 5DUWA 4B7EA 2V73A 4OMDA 1IS3A 4QB2A 4IEUA 2WZEA 4RA0A 3WQ1A 3WDYA 2UWCA 3A4UA 5CVRA 3GCXA 4Q1PA 4S2FA 1SBFA 2VMIA 4ZZ5A 2RDNA 1LOBA 1VMHA 4LA3A 2ZGQA 4U2AA 4EWAA 1ASJ2 3VL9A 4H2AA 5KC5A 2OPKA 2W68A 2ZGOA 2BNMA 4M4PA 3OOXA 3WNMA 3LD8A 1WW4A 1LHVA 2BWCA 5AC92 2I2SA 1GZ9A 5DZEA 1W9FA 4LNVA 1DDLA 1CAUB 5EWSA 1J83A 1QOOA 2UY9A 2LM3A 1RUF3 1DYKA 2VU9A 1FMD3 2YGLA 2YYOA 3BUCA 1CX1A 1UOBA 2VBBA 3UYJA 2WZR2 4K20A 3V0BB 3Q9OA 4XZPA 1TE1B 5LY2A 5KXBA 2HBUA 1UY3A 2RM21 4Z07A 5FJHA 2JWPA 2PA7A 5F5AA 2Y60A 1RHI2 5BNPC 2W52A 3IDCB 1UU5A 2PTMA 1YFYA 4NRPA 4YW2A 3SLIA 1XRUA 4DUVA 5D1IA 2V4VA 4HKLA 4BMBA 1BMV1 1SBEA 2WYFA 3H8UA 3ILRA 1YI7A 1UNBA 2JJ6A 1PNGA 5A3OA 4BU2A 3E6BA 5DDJ1 3FMGA 1UKRA 1G9BA 2EF6A 4QM9A 5JVVA 3PTYA 2VXJA 1BXHA 4QQOA 5BNPA 1OMIA 4XBNA 2FDFA 1TNRA 2IXKA 2JICA 2PHFA 5JIAA 1S0JA 2JKBA 4IV3B 3URFA 4ZPIA 1R1A1 3U10A 2RS13 3IMNA 4IE4A 1PM4A 4RGKA 4GB33 3EQEA 4EZHA 4FPYA 3O14A 2Z42A 1UAIA 2PHUA 2BRTA 3KVBA 4XCBA 2C9KA 2D6LX 5KXDA 2Y6LA 1AR81 4JAAA 4HMZA 2PHXA 3N9QA 2IC1A 4UXAA 4BOWA 1E5IA 4LBLA 1UYZA 4ZXEA 2QJVA 5FYSA 2UY8A 2W91A 2HWC1 2YXSA 4CUGA 3Q8BA 3WW3A 3LEKA 1RUJ3 3HQXA 3D8CA 3ZFFB 4OFGA 1S0CA 2QQWA 1R092 3ON7A 1DYOA 3IM0A 3LDBA 4QX7A 1PX4A 3ZYBA 1MVQA 2UURA 4JGZC 4ATEA 3FLTA 4OZXA 2ZXQA 3T2OA 4Q27A 2JEMA 2J1AA 3WVJA 1LU2A 2CY6A 4JVAA 1LR5A 1CAXA 5C3SA 2VOKA 4DXSA 5JWPA 3I3QA 1PO12 4QHBA 3HQRA 3POSA 3AKQA 3E97A 4JGZA 2D3RA 2R043 2B9VA 5FREA 4CSWA 4XILA 4LO8A 4PHZA 1HRI1 2ZACA 4CUCA 3O1OA 2EIBA 4IEOA 1K12A 4P9LA 1W6NB 5JOZA 4AZZA 2O14A 3MIEA 5C5UA 1PX3A 1DFQA 1NCQC 3G7DA 4IE6A 4OHXA 4A6SA 5JXHA 2ZOEB 3KZ4C 1LODA 2E7TA 4C0BA 4MXVA 1JZ2A 1OVSA 5A7NA 2VZVA 4P9JA 5CYYA 5DN2A 3P3PA 3PNAA 2D7FA 1ND3C 1PZ8A 3MZHA 1W9TA 4QHOA 5ABJA 3WUCA 1WD3A 5DG2A 5E16A 1UZWA 5C4WB 4KG0A 2YBKA 4YWAA 3LKJA 2QBXA 2EIDA 2NN8A 1ND3A 2JG9C 2WL1A 2JB8A 3POFA 5IVCA 3S0MA 2VW1A 1F2NA 1L3JA 4WM8C 2W92A 3FX3A 1W6QB 4GMP3 1MEC3 4NIIA 3G6JB 1ZBE3 4Q4X3 4MGIE 2CTVA 2WT0A 5ISLA 4G4FA 5A33B 1A6CA 2JG9A 2X5IA 5E6HA 4GWIA 4EWDA 4MLOA 5H9RA 1UMHA 4M0NA 1OQEA 4Y5TA 2XVGA 3FLPA 5C8CA 2D5FA 1IOAA 2I45A 3R4SA 2YBSA 3HPNA 4X8PA 4FT8A 4XMAA 5JCTA 2LW8A 2YGMA 4P08A 2PHTA 1VP6A 1GANA 1C5IA 1D7PM 1VB4A 2DCJA 4LKSA 3VBOC 3VD7A 4A44A 3O5SA 4DEVA 2WDBA 2CAUA 3DYPA 3NV2A 5JSRA 4QPGB 5EV7A 1VBA3 1HQWA 3ACGA 4C91A 2VZ3A 1ULDA 3OBZA 5FMOS 3THPA 4D3WA 1CZVA 3ETPA 3WLUA 1W8TA 2RS11 2VZTA 1VRH2 4ARXA 3VBOA 2DURA 4OI2A 2IZWA 2VZPA 2RJ2A 2JDHA 1H2LA 5A6ZA 5J98B 3ACHA 1DZTA 2A75A 4NPLA 4WVVA 1Z7S1 2RJKA 4FXGB 3WW1A 2D98A 2BBAA 4OQ9A 4LOSA 1NLQA 1RUD2 3TNPB 1DZQA 1WW5A 4JKMA 3O1TA 3TB0A 2PQQA 1LGNA 4ISQA 4YPJA 5C7GA 4YVWB 1RUG2 1QHDA 1C3HA 3JD71 1PIV2 5FWJA 1UZVA 2FCVA 2WYSA 1ZVFA 3C7HA 3ZDVA 3R0RA 1XYNA 4TLGA 2YV8A 2VZRA 5SV8A 3WQ0A 1CPMA 3MIFA 4P9YA 1AL21 4JGYC 3VKOA 1UCXA 1SLAA 5FPZA 4AEMA 1UZYA 3K4DA 4Y22A 3UK9A 1RXFA 3MIHA 1WGPA 3GHNA 5FOBB 2WWJA 1CIWA 1JXNA 4PLOA 3ZXLA 5A3PA 4UFLA 1SFPA 2EVXA 3WHTA 4CEYA 4XUNA 3S7EA 2P3KA 1DQ4A 1MZFA 4CU6A 3LQCA 1GMMA 4YW6A 4JGYA 2HYKA 1AR62 1B35C 1LULA 1OLMA 4YYOA 3H7JA 5J36A 2D40A 3RYPA 1GZWB 3OD0A 4N9IA 1AR72 1PHMA 2XQXA 3MF9A 3MLKA 4NWVA 3ZFGB 4DIQA 2PYTA 3VD4A 3WNNA 4QXKA 1B35A 2ZMLA 1K5MB 2ET7A 2QQLA 3VBSB 1HV0A 3Q8CA 4XE9A 3K4AA 3AP5A 3CBNA 3I3BA 3RPQA 3BALA 4P9IA 4INDA 2ILMA 3VL8A 1V6OA 1ULPA 4JZRA 2Q0AA 3PURA 1K3IA 3E6DA 3APBA 5ACA1 1KDMA 2QQIA 5FUNA 4OHVA 2NMNA 3MFCA 3OYWA 4AAPA 2G9GA 1LCLA 1V6IA 2A6YA 4XHBA 3NNFA 1IKQA 2DUPA 3VZMA 5J96B 2VCMA 4KBZA 2RE9A 3H1WA 4IE0A 3PVEA 2DVDA 3ATGA 3J7MA 5A6QA 4XFGA 1PZ9A 5GLUA 1UYYA 5FCCA 3ZPOA 1KRIA 2XMLA 5I8YA 3N7KA 3SITA 4DPNA 1EP0A 4NIHA 2A3XA 4PF1A 4DQAA 3C3VA 1SLTA 1HDKA 2DV9A 2YPJA 3IAPA 4UFJA 5IAXA 2I07B 2VNRA 1R1ZA 3DKWA 4W8JA 1MZ5A 4ZU4A 5A7SA 5AVPA 1PVC3 1EAH2 5FP8A 5G05L 2YUEA 5A6YA 1L7LA 5D2AA 2KA3A 3ACIA 4YM2A 5IK4A 1ENSA 4PDWC 1TQ5A 4URTA 1UW8A 2R061 1N1YA 4D69A 1TG7A 3KV9A 4XQDA 4D7TA 1VBA1 2XLFA 1Y7BA 2BZDA 2DFBA 3MHZA 1Q8VA 4Y3OA 3SCHA 1H4GA 5FZOB 1IQDC 1AYN1 3AKTA 3WUDA 4DRVA 1UXXX 4YSFA 2RV9A 3RZLA 1IPKA 3AMPA 3FUQA 2HLEA 1V6JA 4PDWA 1NY71 4XJZA 2XL9A 4Q4Y3 5JXIA 5LA0A 2JDZA 2PAEA 1WLCA 1GP6A 3JU9A 3HEIA 4M0HA 2MEV2 3PL0A 5EJ3A 4Y4YA 2G19A 4XVHA 3ELNA 2E9QA 1COV2 2ZAAA 1DQ1A 3FC0A 1SLCA 3E1F1 5A3LA 4XABA 3LFMA 5FXVA 3UKTA 5C3PA 1LAJA 1US2A 2QQKA 1S55A 2IFRA 3M7AA 3M70A 4XIKA 1HX6A 4LE3A 4FAHA 2RS51 3LIHA 4XFIA 4I2OA 3N9MA 1BK1A 2JECA 3S7IA 1MS9A 4GJYA 4KU7A 3VHPA 3THTA 3NO8A 1JI6A 4JHZA 4IUGA 1WCDJ 4O65A 4ASMB 1JZ7A 1RVF3 4KU8A 3WG4A 4ES9A 3WF2A 2PHLA 1AYM2 2XBO3 4YGEA 4J6GA 4RHV1 2HWD1 5FZ8A 5K0UB 3ZDSA 1JU4A 2JD4A 1X36A 4CCLA 2P3JA 2Y0IA 5HCFA 5FZMA 4ZU7A 4O7XA 1UXZA 4PLNA 4HT1T 3ZMOA 3U75A 2ZZQA 1MQTA 5FY5A 2J1TA 4MHRA 1Y9MA 1YXWA 1WCQA 1D2QA 2HWB3 2LTNA 1OF4A 3OD4A 1ASJ1 1DGRN 1OI6A 2A6ZA 3CO2A 2JIGA 4LUMA 4CDUC 3LCPA 5CISA 2GZWA 2ZKNA 1HV1A 4DUXA 3ENRA 3UL2A 2ATFA 2R30A 2ZHLA 3LOIA 3LE0A 2OUHA 4XJWA 4Y26A 4C0HA 1S4CA 1Q56A 3CDZB 5C33A 5BXXA 4LBQA 3VBUC 3HVDA 3BKZA 1I5PA 3H1MA 1WMFA 4CDUA 2XPJA 1EV11 4LORA 2RR13 1NOVA 5FV3A 5FZDA 4BHPA 4FPJA 4Q4V1 3B00A 3U1XA 3U4XA 2B9UA 1QQP3 2ZHMA 4MUVA 5C5TA 3K51A 3K75B 1QJX2 2LALA 3AL6A 3C7EA 4XDPA 1JZ4A 2D6NA 1GSLA 2YC2A 2Z69A 3RZZA 3VBUA 3LGRA 1CVNA 1S0GA 3CQOA 2EICA 3I2IA 4RQPB 4CPBA 2A7AA 3I59B 1DGWX 4XF4A 4FAGA 3NJYA 4CDQC 5GZFA 3VZNA 2GMPA 5FO9B 2WNUB 5JR7B 1XE7A 2CHHA 4BQ2A 5T3NA 2W1WA 4YGBA 5JI9A 1W39A 4XJUA 1V6LA 3T4HB 5IVVA 4AQTA 3OGJA 4TSVA 4GZ9A 5A3WA 4R52A 3AFGA 2WA3A 4BH9A 2IXCA 4CDQA 3I3MA 2DBIA 4EN0A 1FPN3 3X29B 1QJU2 2E33A 4D94A 5L9VA 1AR93 2VTXJ 4QXBA 3S5QA 3UESA 4YM1A 4ET7A 4LBQD 2E63A 1KJRA 4EROA 1ZBA2 3IT8A 1RYYA 1FI2A 1UY2A 4M3CA 1GV9A 5CFDB 5EIYB 4WBBA 1JUHA 1STMA 2XJTA 2EXJA 2AEZA 2HWE3 5LEKA 3LEMA 1ZZ6A 1VR3A 1L7QA 4NAMA 4DY5A 1OQ1A 4CPBD 4LT5A 2ZMKA 1FOD3 4F7ZA 3V56A 3LEIA 4L0PA 2GAUA 3M3IA 2RMU1 4C90A 2CDPA 3ZSJA 4AF9A 2WKKA 1D4M2 5JMOA 1MR5A 1A3KA 4RD7A 3KCXA 1N1VA 2VCBA 3N7LA 3AJYA 1HJGA 4LKDA 1CN1A 5D8AC 1EY2A 4IW3A 4QPIA 1A34A 3NMBA 2W46A 2V5YA 1DZRA 1OC1A 3WDUA 5HBAA 1ND2A 4JQRA 4UFIA 2RDQA 1FXZA 4AXOA 3J8F3 2J1RA 2NM1A 4GULA 2OYZA 1HXS3 5FY4A 3ZR5A 5C9AA 3LDKA 5CFCB 5F3CA 5J09A 5D8AA 3BTYA 4QXHA 4BZ4A 1ST8A 3B69A 2C26A 4GKYA 3UGHA 5JMCA 1ZM1A 4QPWA 3VD3A 5JAXA 3DPRB 3FBMA 3W59A 1RUF2 4B7KA 1NCRC 1FMD2 1JS9A 3N9PA 2HWB1 1AJKA 3O0XA 3MLLA 3RZJA 3NSTA 1X33A 3TWIA 3WQBA 4P00B 3ZYFA 4BQ5A 2A70A 5FIXA 2WQ4A 3HAGA 5FY8A 1UPSA 2XB6C 1HRV1 1QOSA 3LWCA 4FP3A 1PM7A 1KXGA 1W2AX 4H7MA 4N53B 1UOGA 3FFQA 4W4ZA 4LK6A 1QXRA 3AYCA 1REFA 3DYOA 4KWLA 4UOJA 4LLOA 5J7MA 1DYPA 1W6PB 2GMMA 4ITCA 4FPKA 3WCSA 3E6CC 1YLLA 4QKFA 4QDRA 2JX9A 5FPAA 3MW3A 2JE9A 1GZTA 1M06G 3KSCA 4YVSB 4QM8A 3VD5A 4CXYA 4D6SA 2ZX4A 3HIFA 4XF1A 4FXKB 1QGLA 5FLIA 1C8NA 1UO9A 4Y20A 4GB32 2WSVA 2G4IA 1O59A 1VAKA 1W0PA 3GZEA 5I8TA 1EUTA 2PXJA 5KXCA 1TME2 4XJ8A 1CAWB 1RUI3 3A21A 4CZSA 2GP5A 5H9SA 1DGRA 3T08A 1JUIA 3UJOA 2QFEA 4PI0A 3BU0A 2KM2A 5LWBA 3ZIXA 5FQ0A 1VBE3 1Y4WA 2H0VA 4AFAA 4LKEA 3PUAA 1AR91 2A71A 3B3QE 2EIGA 1ZRDA 5KHIA 4YG0A 1O5LA 4XW3A 1PVXA 1LHOA 1AXKA 1NKGA 5FZCA 3POBA 1RUJ2 1VALA 1FYUA 2VMHA 4UW4A 2UU8A 2ZGPA 3KVAA 3EYPA 1J58A 1XOYA 4AYUA 4BCUA 2VOXA 4ORFA 1OBNA 1GLHA 4NHLA 4LIUA 5LW9A 4RFT0 1G86A 1F31A 2W1UA 4HK9A 1UZZA 2FMDA 4CDXB 1VBD1 2OA2A 5GZCA 3HR9A 5FY9A 3RI9A 4OHYA 3NVCA 2L9LA 4WZCA 3ES1A 5FLJA 4CCOA 4OZOA 1KS5A 2R042 2RM23 4PIXA 4FOYA 3ZM8A 3V65A 3W21A 1W0NA 3JUUA 1FV3A 4MO3M 5FR3A 3WQ7A 2IWGB 1OD3A 3P6BA 5CKQA 2JENA 3PU3A 3GM8A 5C71A 3LSDA 5FO7B 4COWA 2A5ZA 1UU4A 3VGIA 2BQPA 2O0OA 2VBPA 5GLZA 3WR0A 2VVDA 5BYNA 5KR7A 3ZXJA 5DDJ3 1EPZA 5FWEA 4NPRA 4MGKE 1Q8QA 1XU1A 4FFIA 1IKPA 3H3ZA 2F17A 1C8M1 4ZS2A 1YQ6A 1JYXA 2YB7A 1OLME 2YFZA 5DAPA 4I30A 1R1A3 3RMYA 2HYXA 4Y1UA 2YC4A 3GXUA 5T54A 4EN6B 2IXJA 5JOXA 4MGQA 5I8SA 4UF0B 4Y1VA 1W28A 1ENRA 5BNQA 2FMYA 5A32B 2YHJA 3QACA 4AW7A 2UYAA 4OI4A 1ZBE2 3IPVB 1AR83 1WLWA 4Q4X2 3BIEA 5FYYA 3CZJA 3IDAA 2DWRA 1DQ6A 1WMEA 4RS5A 3TYJA 4QX5A 4CU9A 2Q5TA 1ZA7A 3PUQA 3H1YA 1OA2A 4Q5OA 1CR7A 4XHXA 5ANQA 4HONA 4TXWA 4AE2A 5KHGA 2WSUA 1JTZX 2ZCWA 1JYIA 4XMIA 2P5BA 3SMHA 4AQ6A 2WAOA 3SKVA 4YLZA 1WKYA 4LE4A 5FK8A 3PHMA 3UJQA 3WF1A 1S2BA 3J7LA 3J7NA 4LIVA 4AAXA 2HH9A 5HCHA 1KQRA 3K48A 1BVVA 1R081 4LK7A 2ZTNA 1WLDA 2RHPA 1SHWB 1EAH1 3FHIB 3T1MA 5F5IA 5EYYA 1I9RA 4XYXA 3IWZA 5CB7A 2VMFA 3OGSA 3ZN5A 1OF3A 2BP6A 2HWF1 1HRI3 4CCEA 4IV1B 4TZDA 5E88A 1GR3A 2WNVB 1H1IA 4HPKA 1ALYA 2Y26A 1Q8SA 3F2ZA 4A4AA 3W5NA 1W6NA 5FYIA 4DEQA 2I74A 3ZKUA 5M0TA 2OPWA 1CPNA 4S2GA 1KD7A 2XGXA 3POJA 1C57A 5FZEA 2XUEA 3UGGA 3SCGA 3T0DA 1Q43A 3KQRA 3T3YA 4DXTA 5A3MA 4E8DA 4AQ2A 5L7OB 5LA1A 4MGYE 1EPWA 4ASKA 3EJKA 1SZBA 2DCTA 2QDRA 5FTTC 4OQ8A 3O1MA 1X82A 3GZTB 5FYHA 2BPA2 5FBJA 1HB3A 3AP9A 3HOBA 3POIA 4AFCA 2CDOA 5K7PA 1IS5A 4LBMA 4YRDA 2QQMA 1U12A 4AEKA 4AL9A 4AFDA 3RRDA 4MOAA 5IVEA 1UD1A 1ONAA 3A23A 4LHSA 3D5OA 2DVGA 1VBC1 5T5OA 3CEWA 4LO5B 5IWFA 4YW1A 3VKMA 4DO0A 1Y3TA 4GALA 3NV3A 3MYXA 2Q1MA 3M8LA 4N43C 2LROA 4BK4A 1F9KA 4JQTA 3OJBA 2WRAA 4NIDA 1JYWA 4TWTA 3N7MA 3IB3A 1YC61 3JBG1 3FFZA 1QKQA 3ZSKA 2YZ4A 1DLLA 4N43A 1AHSA 4QQLA 3LA7A 3PVOA 1LEMA 4GWJA 1CJPA 4XBQA 1V9U2 3DEMA 2RS32 3RDIA 2P17A 1F5JA 1Z7S3 1SLBA 2AR6A 3LEGA 3RJ2X 2CV6A 2YU2A 4JTOA 1KEXA 2P2KA 2WA4A 1O3SA 1FAYA 1GQPA 1ULFA 5FZHA 4KWKA 2ADDA 3BVCA 4UAPA 1QJX1 3C2UA 3JD73 4H3WA 1LOEA 1J3RA 3IIAA 4OLLA 2GC2A 4AEDC 2GC0A 1RINA 5DZGA 2GNDA 5EHDA 5BNOB 1JZ8A 1POQA 5B4NA 1UMZA 3CIHA 1DQ0A 1QOTA 1AL23 2VQTA 1OPOA 1PVC2 3GBFA 4C1WA 1WCUA 1LEDA 2D43A 1W6OB 4KGGA 5FKBA 2QQJA 2QQNA 3PTRB 4QQHA 1NXD1 3AL5A 4AEDA 3HMYA 4JDOA 2BJSA 3HT1A 3USUA 1JMUB 1W06A 1O3RA 1LHWA 3IAQA 1NT0A 2GDFA 2P3IA 1VPHA 2HBTA 2VCAA 5CKMA 5L73A 3V0AA 4I0BA 1LOGA 1UIJA 3T0AA 3EMRA 3H9AA 2FCUA 4CXXA 3IBMA 1PO23 3RSJA 4Q4Y2 3CF6E 3U14A 1K5MC 1AX1A 1TMF1 3H7YA 3BOPA 4H55A 4MSVA 4PBPA 3LZZA 5T5LA 1HQNA 2K46A 3R6SA 2IFWA 3WXPA 2IVJA 4FSJA 1NA1B 1ODNA 2TNFA 1SPPA 3ES4A 4QX0A 4J1WA 1LOCA 3SEEA 3OY8B 2HEWF 3POEA 4PBOA 4DMIA 1K5MA 4HANA 5A1AA 3N4MA 4XBLA 4CA9A 4BM8A 1X50A 1WMDA 2QQUA 3F95A 2AH2A 1S0FA 1JZ5A 2W95A 2VM9A 3K46A 2JDKA 1NCQA 2ES3A 2WLPA 5ACA3 4P9XA 1D4M1 4F3JA 2Y6KA 5JI7A 2Y0OA 1E57A 4D6RA 4R9AA 1DQ5A 1RVF2 1HIXA 4WM7B 1LENA 4CP9A 3FZ3A 1CZTA 1YWKA 2XBO2 5ANNA 3BI3A 1O7FA 4K3UA 4E4ZA 3TN92 4Z2WA 3U37A 4CU7A 2W3JA 4DUWA 2ZBJA 5A80A 1O4ZA 2WS92 2FCTA 2WN2A 1RGSA 3AZXA 5BY5A 1JZ6A 1H4HA 4NIGA 2VQAA 2Q8OA 4E4DX 4CCKA 3RMXA 1GNHA 1N3OA 2ZGMA 3AZWA 4BQXA 4HKWA 3M3EA 4NHMA 4BQ4A 3P1IA 1J1LA 4WM8A 2QQPA 5F3GA 1RUH1 3QBQA 2ZEZA 4AG4A 5HXMA 2ZABA 3I2KA 3LIGA 1O5UA 5F37A 5FKCA 2D3PA 3OGRA 2ORZA 5FJKA 1POV0 1ENXA 1OD5A 2WZPP 3JB8A 1GBGA 2F4PA 3H0OA 4KMQA 3GZUC 4QDSA 4NHXA 2QNKA 5DUUA 5F32A 2ZEXA 1PGL1 2R063 5FP9A 3VKFC 2ET1A 2RR12 1ZRFA 1JHNA 1FNYA 4COZA 1QQP2 3PJQA 2A3WA 1AYN3 4OUSA 2WFPA 3KF5A 2DCKA 3J9SA 1NXMA 5IK5A 1YUDA 4JX0A 4N7UA 5KHJA 4IEZA 5FZOA 3MUY1 4PQ9A 4Q29A 1DCSA 4I09A 1XNBA 3WF3A 5BNPB 1PK6C 2GNMA 4AI9A 1H8TC 2VTXA 2VZQA 3KLSA 4E4SA 1NQJA 1YRZA 2ZGTA 2BVBA 3POYA 5BPXA 3RWNA 5CA6A 1IQAA 2P34A 4DY3A 1W0OA 4KNCA 5A7PA 2JDUA 4COYA 1UY1A 3O1UA 1JYNA 2WIIB 4LPLA 1PK6A 3HJRA 5FZAA 1FPN2 4CDWC 1H8TA 4AFBA 4QT6A 2D3SA 2RS53 2JDPA 4L9BA 4DFSA 3JQXA 4LO4B 1RUC2 4BXFA 3WP5A 4B4QA 2B7YA 4FPEA 5K0UC 4I02A 1EYBA 1WA6X 3T2PA 5BNNC 4UW3A 3WZ1A 3U07A 2QTWB 1K45A 4RHV3 2HWD3 4YFWA 4KWJA 1URXA 4ISRA 4I3PA 1H2NA 4CDWA 4E27A 2LS6A 2OKXA 4NO4A 1QNWA 2HWE2 2DFCA 4LHLA 4G9SB 3AXEA 1ZNPA 3R4UA 4XDQA 4W65A 5BNNA 3JB4C 1UIKA 3AP7A 1YO8A 1PO21 3VLBB 1FOD2 1GP5A 4GKXA 4IEWA 1ASJ3 1QJY1 3FE5A 2C1FA 1O6UA 2Q1FA 5FMBA 1FX5A 2GC1A 4IEQA 5A3NA 1A8DA 1CAXB 1HB2A 1NE6A 1VIWB 1QXJA 2PMWB 4CEWC 4JGZB 1BEV1 3IDEA 4BLJA 1EV13 2JE8A 3A0NA 4BIFA 2NQYA 4Q4V3 2EAAA 4NVPA 5CZKA 5CG9A 4WVMA 3W20A 2DVFA 4XFAA 2JE7A 2VJXA 3J8F2 2CAVA 1HXS2 2B8MA 2MPFA 4XUTA 3WDWA 2W08A 1GKBA 4HZFA 4CEWA 2FDHA 2VOWA 3U4SA 2G9ZA 2Y34A 5EFUA 3NJZA 5FUIA 4Y4RA 1BJQA 1BBT2 1XNKA 3WNPA 1G6NA 4GH4C 3THCA 5ABJB 2HEVF 3T30A 2XVKA 3TEXA 3QOPA 2B4KA 4W50A 5FYTA 1RMU1 2DDUA 2R071 1YNAA 1LGBA 1W8OA 1ND3B 1ZX5A 2B46X 2CGOA 3C7OA 5GJ6A 1RIRA 3H3UA 1UL9A 2VPVA 1PGW2 2JDAA 4FPOB 4GH4A 4RR3C 4FBFA 3VKNA 5A3UA 3O12A 1UZ0A 1ZZBA 5LBCA 2YG0A 3RGBA 3KQ4B 4UI9L 2E6VA 5CFDC 2VCCA 3GALA 1L7RA 2PLV1 2C6SA 2JG9B 3NKTA 5FY7A 3SNMA 4A6OA 2X5IB 4BQYA 2QVSB 2YDEA 2AEYA 3OEBA 5FUPA 2GNTA 3H3LA 4RR3A 3KCCA 3RWKX 5F6KA 5FMCA 5C8CB 3H8XA 1POV1 2VZ1A 3CJIC 1OSGA 4QXCA 5CFDA 3RYKA 3ECQA 1KFXL 3VBRC 3PUHA 3ZYRA 4D7YA 3AMQA 4B1MA 2XR4A 1R093 1RB8G 3BODA 4CP0A 2RMU3 5KC6A 1KDKA 3ALQA 3ZN6A 4GWMA 3CJIA 3HT2A 4P5HA 4AI1A 4O9GA 4L8QA 4YM0A 3LAGA 1H1MA 4GJZA 4V1PA 1NZIA 1RUI2 2ADEA 2GSYA 3KGLA 3VBOB 3VBRA 1PZ7A 3I2DA 2XJPA 4Q4W2 4A41A 2IUWA 1NG0A 3PUSA 5C8WA 3VDBA 3AX4A 4QD2A 2NP0A 1VBE2 4DOUA 3OUHA 1TZOA 4KGQA 2X29A 1C1FA 3OG2A 4XURA 3ZYPA 5GKAC 1XB9A 3BGAA 1XNDA 3AC0A 4IL7A 3POWA 2EALA 4DS0A 5A7OA 5BV6A 1V70A 3KGZA 3FUOA 4QQ2A 2R32A 2WFF1 3IZOA 1LOAA 4CVUA 4NN0A 5FZ6A 1RUE1 1QY4A 2HEYF 2Z2SB 1VBB1 2Z4FA 4N8MA 5EQUA 1OLRA 5FZGA 3W5MA 4A2UA 2ID4A 1QH6A 2TEPA 5IUQA 2CWMA 4FO9A 1APNA 2D93A 3AKRA 3I2JA 4LHKA 2Q8EA 3VN4A 5A6XA 2Y33A 4XACA 2E26A 4Y22B 4YG6A 5HXVA 2BGCA 4IEYA 1N3QA 2PHRA 4FFFA 1GP4A 4FPCA 1MS1A 5HV4A 2FZ1A 3BB6A 4CEYB 3WNKA 3H42B 5F9TA 1NZCA 4N53C 3SKJE 1UYXA 1Y9QA 1G8WA 4QAWA 5AC91 2XJVA 4JGYB 2IXIA 2RM22 3VV1A 1HRV3 4CCNA 3PVNA 2VD7A 4XC9A 2Q30A 4YARA 2XQRA 5E1RA 1GZCA 2DU1A 5AFEA 1BMV2 4TYSA 4A7ZA 2WZR1 4N53A 2VR4A 5HCBA 3VBFC 4BJ0A 4YNIA 2WNEA 5JIUA 5DDJ2 2W1QA 4AGRA 4YVSC 1B35B 1E5SA 5LB6A 3AXDA 3KT7A 2XJQA 1RHI1 3TBDA 5A1LA 3N35A 3CLPA 5FXWA 4WZFA 5FZ3A 3E5UA 4EWEA 4EN8B 4OUEA 3I3DA 3VBFA 4XFCA 3B01A 5H9QA 4NJ4A 4Z92B 4YVSA 1KGYA 4CXWA 1IHMA 4EJRA 3NNMA 2Q1ZB 3WX5A 1W99A 1HKDA 2R6QA 5L9BA 4URAA 3BU7A 3OTFA 3ZXKA 3TRSB 3I2HA 4LHNA 3MIDA 4AGVA 1XC6A 1AR82 3ZOIA 3N9LA 5DPNA 4M00A 4QB1A 4UBGA 4B1LA 5F3IA 2V09A 3DCQA 1V9U1 5JPMB 3PUIA 1IPSA 3PMEA 5IW0A 1JOJA 4IQPA 2HWC2 2ZS6B 4CCMA 4YZ2A 1ZZ8A 1VRBA 2EXKA 2Y6JA 4HSJA 1RUD3 1H9WA 5FO8B 4P9GA 4XTMA 1N1SA 5J37A 3MO4A 5A7WA 4A42A 4E2GA 1AZDA 4GWNA 4XUPA 3CJXA 1D2SA 2WO1A 4UYBA 1NUKA 5FPUA 3OEAA 2KD7A 2VMGA 5FBZA 4DNYA 3R05A 1R091 1VBD3 2GH8A 4LLFA 3T0BA 4AHZA 3I54A 4E8CA 3WG2A 5APAA 1NLRA 1Z0HA 5CNAA 3TEWA 4YM3A 1HW5A 1HRI2 2BYVE 3RVHA 3DGTA 1YQ8A 4ONUA 1MZ6A 3MBWA 2Q8DA 4BE3A 4PDWB 2VE1A 5FPXA 2P1BA 2VMEA 4FOWA 5GALA 2ORXA 4M3CF 3A0KA 3TOJA 2OIIA 3ZFEC 3HQUA 1PO11 3AMMA 3VDDC 3WDVA 4V2VA 5A7QA 3BCWA 5GM0A 5KHKA 2FZ2A 3AP6A 4AFMA 2JDNA 5IHRA 3HNBM 1C8M3 2VUAA 3VZJA 1SACA 1Y43B 2WT2A 2XUMA 3M3QA 3WNLA 5FZ7A 4ZKTB 3TEZA 4MXWA 3MGUA 3ZFEA 1G7YA 3VDDA 1YYNA 4OYUA 3NNGA 4Q8LA 4AVBA 1AXYA 1PMHX 3AB0A 3BPSA 2DCYA 4CE8A 1CAVA 2VQUA 4NMIA 2VNOA 3SCFA 3UGFA 3NJXA 2E51A 5GLWA 1WLTA 1XSQA 2BU9A 3T09A 4IEVA 4Z8BA 1X8EA 4CU8A 3E5QA 1RUNA 5IVFA 4QU1A 3MW2A 3DXTA 3TN91 1NCRA 3VB9A 4Y1YA 1MQTB 3WP4A 4LBKA 2VULA 5LASA 1H8VA 2OXBA 3K3OA 1LJ7A 2WS91 3AMHA 3A7QA 3ZVXA 4RGAA 2YFUA 1C5HA 4IEXA 1WA4A 4CUBA 1W8FA 3RYRA 1F5FA 2CU5A 5HCAA 2ZX1A 3VHNA 1KJLA 1AXZA 1R083 2XHKA 4JKLA 4NWWA 2W5FA 4W6XA 3SXWA 1OT5A 3S6PA 4LBQB 1EAH3 3I2FA 4M01A 2RS12 5FPLA 2VNGA 3MFAA 1F15A 5LK5A 4CDUB 4IEPA 4MYEA 4BQ3A 3B94A 3B93A 4IXLA 2WNVC 3NAPC 5EP9A 2HWF3 3LSEA 2VVFA 1V6NA 1H9PA 1Z7S2 2BGOA 5A32A 3DL3A 4OCTA 4Q8KA 4I3GA 3D82A 5T52A 2MNGA 1OXCA 1MS4A 1W03A 5F5QA 5CAZA 5IVJA 5JZGB 1VRH1 2JKXA 2ZX0A 2R49A 3JD72 2PAKA 3DN7A 4E9KA 2W2IA 2WNVA 3NAPA 5CEHA 3NNJA 2NPIA 2WN3A 2QKDA 4Y24A 4EE2A 2E32A 1SMVA 1QWRA 1AL22 1RUD1 2UWAA 3BTZA 3LA3A 5F2SA 5L7OC 1RUG1 2W87A 4L2NA 3AFKA 4CDQB 3AVRA 1PIV1 1GOFA 3ZYHA 3IKWA 1ZZ7A 2D6KA 2JIJA 2PN5A 1XSRA 2ZPXA 2PHDA 1RUC1 1T6BX 1CAUA 3ACLA 5IJRA 4PQQA 4A7KA 5L7OA 4EN7B 3ZSMA 4AEJA 4Y5SA 5GLTA 1OA3A 5CU1A 2GU9A 1WBFA 3S57A 1U5ZA 1HB1A 1VMJA 2J1VA 3HBZA 2CGNA 1W8WA 4AI0A 2VZSA 4XXPA 1YIPA 3QH6A 5K9YA 3V0BA 5IK7A 1ZRCA 3OBTA 4Z82A 1AR61 1SG3A 1T2XA 2YC0A 4QQPA 4XQWA 1NYWA 1VBC3 5TSWA 4JKKA 3GJBA 2VOTA 3MEPA 5EPAA 1CQ9A 2BNNA 1AR71 3NKGA 4IV3C 3WP6A 1XYOA 3ME2A 5K4LA 2EXHA 2NYYA 4YW7A 3I97A 4BPZA 5ACA2 2WQ8A 4R4XA 3JBG3 4LOTA 4QPIB 1D0HA 1MACA 4JV4A 4FPHA 4AK3A 2P37A 2FQPA 3RG0A 4AR2A 1ND2B 4I0AA 4IV3A 4LO7A 2B42B 4XF9A 4D0QA 4YZ5A 3JQWA 5DABA 4FI9A 4S2DA 1ZRRA 4KI5M 1HQLA 1MEC2 4O61A 1MS5A 1MS3A 4RSUA 4TN7A 5D8AB 5C9AB 5I0SA 5BNOC 3O0WA 1E5HA 4LKFA 3TNQA 1QJX3 5FZKA 3GDBA 5FZFA 1RTVA 1ZA4A 2QZ3A 4QB6A 3ZFFC 2WAAA 4NIAA 5H9PA 3DXUA 5I0DA 1BBT1 2A1XA 2VZUA 3BTAA 4P14A 1UN1A 5BNOA 2GN3A 2ARXA 2D5HA 5FXZA 5CBLA 5C3OA 4JRLA 1N3PA 4MX3A 5J48A 1LECA 2FBEA 4MVTA 3ZFFA 2D6PA 4CP2A 4FTEA 1WW6A 3D3AA 1UQXA 3MIGA 2R062 3M4FA 3PMSA 1I1EA 2ZJCA 1W6MB 3RZGA 1RL3A 1VBA2 5B4XA 2EIEA 1Q8OA 3M1HA 4GA9A 1AYN2 1S0IA 2NLRA 1AX2A 4Q0QA 1KS4A 1NY72 4EYUA 1QDCA 3JZVA 1TMF3 3OPZA 1I3HA 5JSPA 2JD9A 1S2KA 2MHFA 1LB2A 4KH9A 1XYPA 4OI1A 1F4HA 1S1AA 1V00A 2A3YA 2FDIA 2XJRA 4IGPA 3WT3A 2ZX2A 1OVPA 4XF0A 1U0AA 2XLAA 3HD8B 5JSOA 5FAXA 3VBHB 2FHRA 3ROUA 1IS4A 3K2OA 1OPMA 4BK5A 5C4WC 2CNAA 5LATA 4Y20B 4CCCA 2EA7A 5HPOA 4Q1RA 1ZZCA 2BWAA 1OKQA 2MEV1 1OLQA 3OY8A 4MZUA 4HOOA 4D7SA 1WWYA 1XE0A 4JHTA 4WM7C 3GYDA 5IAVA 3H8RA 3WF4A 5JOWA 2BV4A 1IS6A 1D4M3 1COV1 1XQNA 4P02B 3WF0A 1YHFA 4HVQA 5DUVA 5C4WA 1UWWA 1ZYBA 5DMYA 2VXRA 4QX8A 4XPVA 4Q4W1 4RHV2 2HWD2 2DBNA 2E31A 2C24A 3D6EA 4OHZA 1GWLA 4K21A 1W9SA 2YU1A 2AZ5A 2ARAA 4UT5A 1HJFA 4IE5A 5I91A 4W6WA 3K4ZA 4S2HA 1JOPA 1YJKA 1W6QA 2ARCA 5FOJB 2W39A 2WZ8A 2V5DA 3FHAA 4XAAA 3ZSLA 3U0ZA 1AYM1 5T5JA 5JLVA 1UPIA 1LTEA 1YFUA 2KXLA 4DINB 5F39A 1RUH3 3BOWA 1VE0A 2OX0A 3UV9A 1WCKA 5A33A 3OCPA 5DUXA 2ZEWA 1S0EA 4COUA 4L99A 2J7MA 1TNFA 2RDRA 2UYBA 3ZYJB 1JODA 5JOYA 3RZHA 1I5ZA 2BUKA 2GALA 1REDA 4M4RA 4QPGC 3IDBB 1OOPB 1PMIA 3KV4A 4QWNA 3HNYM 1HN0A 4BWOA 1V6MA 3POGA 1EV12 3CKHA 2ZKLA 1C28A 3ZN4A 2JG8B 4Q4V2 1UKGA 1SLIA 2VECA 2D97A 2JDYA 2IVIB 3LPGA 3U11A 4QPGA 4U36A 1LHUA 3OPTA 3GZAA 1XXNA 4ZHNA 1O91A 2OT7A 3O1RA 5LBFA 5CADA 1GQHA 1J3PA 1PNFA 2ZMNA 3N7JA 4XZUG 5EXOA 4YVWC 2R16A 4RFRB 5EJZB 3L9JT 4ZY9A 3DYMA 5K8SA 1W9YA 2GP3A 2J1EA 3GCWA 3MUZ1 2AUYA 3D0JA 4ES8A 2Y8KA 3HBKA 4UFHA 4AQSA 2V4AA 3CNAA 4JC1A 3FLRA 2VMCA 4V2WA 2WT1A 4YVWA 3Q8AA 4QGNA 2VMDA 1W2OA 2O1QA 2XVLA 4QU2A 5DAQA 2WQZC 4LMFA 3OSDA 1QMJA 5LA9A 3UT0A 3T4VA 3ZLIA 1X9PA 2JXAA 1MS0A 2IXLA 2VUDA 3DKQA 5FZ1A 1OUXA 5T55A 4Q2FA 2YMZA 3O1VA 1TME3 1JU3A 3B9CA 1W3VA 1WMXA 1YFWA 3GJAA 4FPFA 4H7LA 1YEWA 4RS5B 3LF7A 3USSA 1TVGA 4DB5A 3MPBA 2VUCA 3KB5A 3P5BA 3IMMA 2SBAA 4AOCA 1QJU1 1SDWA 2VO5A 4PCRA 2QUOA 2H6CA 1S0BA 3ZFGC 2BTVC 4XFBA 1OQDA 2OQ7A 4JRAA 3ASIA 3BIWE 4KWUA 2V72A 5B2GB 5DAWA 1OKOA 1ZBA1 3VBSC 4QDQA 4ASLA 1QJY3 3OBAA 1GZWA 2DTYA 3DV8A 2XG3A 2RMU2 1NQDA 2DF7A 2WWUA 2ZZJA 3ZFGA 4AHWA 5GZDA 2BFUL 2AC1A 1DLCA 4MGZE 3B7MA 4YW3A 3ZXDA 1SEFA 2GH2A 2RVAA 3B5LB 4N9HA 3WNXA 3VBSA 1JH5A 1F4AA 3WNOA 4AWDA 1NE4A 4M3CE 1BEV3 3GNEA 2PHWA 3LA2A 1VLNA 3ABZA 3KHCA 3RI8A 2VL4A 1H6YA 4JCKA 1OFNA 4HPKB 3VHOA 4Z2AA 5F6LB 1IGOA 4JTNA 5F8PA 3OBRA 2ENRA 1UU6A 2BOJA 4TTGA 4LBNA 5ABJC 4EQVA 4DRRA 4K8FA 2ZHKA 2ZGLA 1W04A 1UY4A 4K7JA 5LCWL 1CD3G 4QX3A 1UOJA 1XPWA 4MHUA 1X9TA 4P9WA 3V64A 3M3OA 4ZXKA 4ZZ8A 1Y9GA 1UF2C 3PIJA 5F3EA 4WVWA 1ENQA 1RMU3 2HWB2 2R073 3MV11 5DAXA 4GMP0 1YQ2A 2ZHNA 1NLSA 1VB2A 3KV6A 3OUIA 4K6BA 5C3RA 5A70A 1I6XA 2C0ZA 5F1RA 4ZONA 1DQ2A 3B9IA 4OI0A 4AI8A 2A6XA 1HRV2 3I8TA 4PIZA 4XETA 4MGTA 2B39A 2X5IC 4HSLA 2ZX3A 1RUF1 4B29A 4BIOA 1FMD1 1G9FA 3K77A 3ZXFA 1A8MA 2D44A 5E89A 5JXGA 2PLV3 5C8CC 2E7QA 2RJLA 3QH7A 1VJ2A 2HJIA 1LHNA 5C3QA 1M4WA 4R8HA 3CU7A 1POV3 3N9OA 3ZX7A 1RJ7A 1W05A 3QCWA 1F35A 4BDVB 4Q0VA 2AREA 3EXUA 4UBHA 4XOGA 1X8MA 4YZ4A 4CYDA 5IK8A 2ZGRA 5FY1A 3DF0A 3ZXAC 3WINE 5IT6A 1W8UA 2WJSA 1QU0A 5JXJA 3J26N 3MICA 3JXSA 4XXAA 1AX0A 2F6BA 4BMEA 2DUOA 3NV1A 1BLZA 4N43B 3AZVA 2ETEA 3PJYA 2P4EA 4XJ9A 1UYPA 3Q8FA 1AR92 4FP2A 4GAZA 3A22A 3OGGA 4GB31 1BCXA 5D21A 5GZEA 1U5IA 1H2KA 1WZXA 2BDRA 2CYFA 4Y1XA 1TME1 4XTPA 5A1FA 2BBVA 4TLFA 2WFF3 2D6MA 2E7AA 1RUE3 5KXEA 1H6XA 1VBB3 1WBLA 3AVSA 4I01A 5JPNB 3MIBA 5IFTA 2UWBA 1NAEA 2VW0A 1MS8A 4N7IA 5FYZA 5K0UA 3O1PA 1YQ5A 1J59A 4AVAA 1YJLA 2J42A 3VHRA 4CEYC 4JDNA 4OULA 1RUJ1 4AEDB 5FPBA 4BXSV 1VBD2 2VY0A 3EBRA 3NQHA 2WC2A 3USUB 1XE8A 3VUOA 3ORJA 1LESA 4LO6B 5AC93 4FOQA 3V0AB 1JN2P 1N1TA 1IPJA 4KG8A 2GNBA 2OZ6A 5J3UA 4AI2A 2BVVA 2BW8A 2OW4A 4QGLA 1HLCA 2WZR3 4LXLA 1K5JA 5LBEA 3T2TA 3RZMA 3S5AA 1GWMA 2ZGUA 2R041 4RQPC 3AYEA 5EJ1B 1H2MA 1W9WA 1OUSA 4OVEA 1RHI3 4QGMA 1SPPB 1C8M2 3T2QA 2WNUC 4LITA 4EN9B 4BLIA 5FZBA 4QKNA 2KR2A 2QDNA 3AZYA 3WV6A 1S0DA 3AJZA 5C6CA 4D8MA 2C4XA 2X10A 5KHHA 2O8QA 5L9RA 4XJAA 1J84A 1OA4A 1ZRIA 3FBYA 2K9ZA 4RQPA 4GXLA 3I59A 1NCQB 3I49A 1S2EA 4K40A 2FD8A 3AMNA 5FDBA 2WNUA 4Y33A 3GBWA 4E2QA 4CP9B 4A45A 5JUVA 2EAKA 2GN7A 1XU2A 1WD4A 5F7UA 5CG8A 2VG9A 3KHBA 4QHZA 3I3EA 2X53S 5FRAA 3ST7A 1XBFA 4XIOA 3WP3A 2VOVA 2Z5WA 3KT4A 1WW7A 4R9DA 4Z1VA 3OUJA 1V9U3 2R7EB 3KWVA 2RS33 2Q4SA 4LQRA 3PDQA 3VD9A 1HB4A 4K8RB 5I93A 1SBDA 2C5DA 2W94A 1MEC1 4GMP1 1ZBE1 4HETA 2J1SA 4NUBA 4Q4X1 4CRQA 2PAMA 1FATA 4WM8B 2RG4A 5ERLA 1BK0A 1DG6A 4KBBA 1OFSA 2WR9A 1V0AA 4LA2A 2WBKA 2YPDA 2BOIA 3ZPYA 5F5CA 4NROA 5FK7A 4LEJA 5SV5A 5T50A 1R082 2FDKA 1OURA 1Q8PA 1XNAA 3BTXA 4J25A 2XXZA 2R0FA 1DGWA 3S30A 3VZOA 4NR1A 1RXGA 4J1XA 1EUUA 5FMDA 3QD6A 3JCIA 5FY0A 1X7NA 2XKOA 3K3NA 3MDPA 4LTAA 3UETA 4QX1A 1U5XA 2HWF2 5IVBA 5IYYA 1AUYA 5LRSA 1JHJA 3SHRA 2XL7A 2VTFA 2D6OX 2XONA 4QKDA 5FFOC 1DBNA 5FYBA 4XF3A 4X6RB 5FYMA 4BQ1A 4ZS3A 3NNLA 5J1XA 5JDBA 1IG0A 1WUVA 4RGGA 3WG1A 3J7HA 5CFCC 1PO13 3EHKA 1ZZ9A 3WW4A 3THDA 3ACFA 1Q5OA 4A3XA 5EZWA 3CHXA 3I2OA 2WINB 5FMOL 5IVYA 4BQWA 2JB4A 1G9AA 3SC7X 4BISA 1DP0A 5JR2A 4L11A 1VMFA 3C7GA 2W9XA 5FP7A 4IDZA 3AKSA 3VZLA 4HFSA 4UW6A 5BUVA 3DPRC 1US3A 3I4IA 5CFCA 1CJDA 1PK6B 1AVBA 4W6YA 1J3QA 1H8TB 4QKBA 3RFRA 3C8XA 3ZYGA 1RJ8A 1GQGA 4LBJA 4LBOA 3HNMA 1P8JA 2F4LA 4KQ7A 4XDOA 3UKVA 4EV0A 2FDGA 5DG1A 2Y6HA 1KITA 1CZSA 1KFUL 3DPRA 5I0RA 3NW4A 3ZXEA 2BNOA 2CSGA 3QLQA 1MQTC 2VBDA 2AYHA 4IERA 4CDWB 3IIIA 1W8NA 4GIQA 4HLTA 1GNYA 1LGCA 4RN5A 4XAEA 5I0UA 4HL0A 5CKNA 4NHYA 1C1LA 1UMIA 3TN93 3MI8A 4Q26A 2PFWA 5BNNB 2P3YA 2Y6FA 3ILFA 3ETQA 3PLQA 2XJUA 4MADA 1QJFA 4NRQA 4NRMA 4WV8A 2ZAHA 2WS93 4LULA 2LUWA 3WOGA 4EZ4A 1VBC2 2XKPA 3EO6A 1W90A 2OQ6A 2XWJB 1MZEA 3OB8A 4R4ZA 1GNZA 4HKOA 4L97A 1PGSA 2Y64A 4YW4A 3W9AA 2E53A 1XNTA 2IXHA 1BQPA 4KL1A 4PI2A 5LA2A 2DU0A 3I2GA 3T1LA 4HXCA 2XH6A 1O8SA 2A73B 5I0TA 1W6PA 4XUQA 2DYCA 3JBG2 2XOMA 5E8AA 1R1A2 1AJOA 1GU3A 3WDTA 2DUQA 2ZGNA 4FCAA 2WO3A 1Q3EA 4QMAA 2TUNA 2A6VA 1QH7A 2WNOA 3FJSA 2WO7A 4WVMB 4FQZA 1SDDB 3OYWB 5CIRA 5JZGC 3RQ0A 1H0BA 4AVVA 2B5HA 4HVOA 4IE7A 2OS2A 4CEWB 1W2NA 2BEOA 1BZWA 3HWJA 4MG2A 1O4YA 4PT6A 1CAWA 1VRH3 4ZU5A 2WABA 1A78A 1CONA 1D0GA 3BPZA 3BYWA 3VDAA 5KBFA 1GYKA 3ZXGA 1CX4A 1GUIA 1GFF2 4YW5A 4F8AA 3H8OA 2RS31 4RL7A 3D0SA 4XFHA 4D6QA 5JZGA 5L19A 4AVTA 2VC9A 2NZ9A 3Q8EA 4R9BA 4R9CA 3MV01 4HN0A 1PMJX 5F2WA 1HN1A 1RUG3 3WD5A 1CIYA 1TEIA 3NWKA 1PIV3 3W58A 4QPYA 4MGSA 3KD4A 4GH4B 1V6KA 4CDXC 2VW2A 3L2YA 3O1SA 4XCAA 2CWSA 3OPWA 4SLIA 4Q0SA 4IGOA 4A7YA 1H30A 2ZGSA 2WUHA 3LFIA 3INAA 4NOTA 1PVC1 1RUC3 2X05A 2RDSA 2DVAA 1FT9A 2R1DA 4L92A 3CMGA 4CDXA 4RR3B 3VZKA 1TMF2 3NRUA 1RUOA 4FPGA 1QNYA 4X8NA 1DU3D 4B3NA 1YQCA 3DUIA 1AR63 4HG6B 3KF3A 2X8KA 5IATA 1XJAA 1REEA 1QEXA 5G04L 4AVSA 3I7DA 5FYVA 4IESA 3U78A 2QQOA 1VAVA 3VKLA 3L2HA 4HVRA 4AVCA 1AR73 4N90A 4Q4Y1 1BYHA 3ZKYA 3EB7A 2G9FA 3ZN6B 4HBNA 3CJIB 1QDOA 4QPIC 1G9CA 3PIGA 2HKXA 2ZGKA 1VAMA 1QJEA 2H6BA 3FWEA 2AGSA 4Q0UA 1ND2C 4UWDA 3VBRB 4AHYA 2C9AA 2XDVA 4IETA 4X6QB 5AVAA 5FZ4A 4YFZA 1DHKB 1LOFC 4MV2A 5DZFA 4OHWA 3M2MA 2DTWA 5C9AC 1NX9A 4NHKA 4YG3A 1G9DA 1CWPA 4SBVA 4C1XA 4YZ3A 3CL1A 4UF0A 4CP1A
chains in the Genus database with same CATH topology
4E2SA 1JW6A 1W2UA 1LOFA 3AYDA 3HN1A 3KM5A 1RVF1 2XLGA 4LR4A 4LUKA 5A32A 3GHMA 2H0BA 4I0WB 2QCSB 2XBO1 2YROA 3IN9A 3IPVA 1SQ4A 4FOVA 3MF6A 5GLVA 1RUH2 4YGDA 3WHUA 2OVUA 1BBT3 4BA6A 3AKPA 1ULEA 1FNZA 1YFXA 1SCSA 2XJSA 1F8VA 4GQ7A 4XQ4A 1PGL2 4AI3A 4PJYA 1QXPA 2K2SA 5T5PA 4Q0PA 1Z78A 3O0VA 3E5XA 4B8EA 4F83A 1W6MA 4XEZA 4IV1C 4G3YC 1WCSA 2N7GA 2A6WA 4PIYA 4FQ4A 2YY1A 3O7OA 2RR11 4K1ZA 1O4TA 3VBHC 3MPPG 2VQ0A 4O9EA 3VBUB 1QQP1 4AHXA 1DGLA 2Y38A 3R4DB 1AF9A 1FV2A 1SFYA 4IV1A 3VBFB 2SLIA 4XFFA 1J1TA 4FVVA 3PVBB 2R0HA 2WLQA 1RC6A 3VBHA 1QF3A 1QJZA 1YI9A 2MEV3 3ILNA 3P3NA 2GC3A 3N36A 1CESA 1COV3 1JYCA 2NMOA 4Y5Z0 1N47A 1O3QA 4Q4W3 3AK0A 2VVEA 3RJRA 5FLHA 1FPN1 2B45X 3AM2A 4YGCA 3TAYA 3WY6A 1ULCA 1YCIA 2O8OA 1B09A 1IZ3A 5LK7B 1MVEA 4M3CB 2OUJA 3ZMNA 1PO22 1T6GC 2XWBB 3RS6A 1AYM3 5AFBA 2AENA 1QJY2 2K0GA 3WDXA 3AZZA 3GF6A 4B4RA 1OHFA 4MH0E 3MLJA 1OOPC 3J4UH 2HWE1 5HI0A 2ERFA 2PELA 5EYXA 2R1BA 2JG8C 2VUJA 3ZSEA 1FOD1 3KS7A 4CTEA 4DXZA 1O3TA 1BEV2 1DF0A 1YIFA 1DIWA 3AP4A 1LRHA 1C4RA 4HN1A 3GBGA 1OOPA 3WW2A 3D4KA 4PF5A 1BKZA 5DXDA 4COVA 2JG8A 5LEJA 3ZIWA 2EXIA 4META 3SH3A 4K9SA 3M3CA 4FPLA 2ZA9A 2QE3A 4AGGA 3J8F1 4MXWB 4BYYA 3UKNA 1HXS1 3N3HA 3NV4A 3ZFEB 3VDDB 1RMU2 4UW5A 2R072 4ATFA 3AYAA 1XNCA 1SFNA 1CAVB 1UX6A 1SCRA 3KT1A 1CGPA 1ZREA 4RS5C 2VH9A 1BVP1 4FTBA 2CGPA 3ZYIB 3LB9A 2PLV2 4PLMA 4YZ1A 3OF1A 1W6OA 3NL1A 1H1AA 1NCRB 2Z79A 3KCYA 2OZJA 3MW4A 4OUMA 1QJU3 1PGW1 3RNSA 1SLLA 4DZGA 2W0XA 4FTSA 5LRRA 2HWC3 2QZ2A 2CL2A 3H50A 4JDMA 1D4VB 2TBVA 1ZBA3 1NA1C 2VGDA 2DCZA 2BFUS 1ULGA 3SH4A 3WCRA 5GZGA 3LOBA 4B4PA 4HK8A 3ZO0B 1LU1A 4H14A 2GMEA 2DVBA 5L36A 1NA1A 3SISA 2RS52 2WWSA 1LKNA 2ARBA 3SH5A 1U5YA 5FQ0B 1RUI1 4K1YA 4Y1ZA 3B02A 2WFF2 1JBCA 4WVZA 3NAPB 1RUE2 1RITA 1VBB2 5KWRA 1VBE1 3WG3A 4WM7A 3KMHA 1AL0G 1GICA 5DUWA 4B7EA 2V73A 1IS3A 4IEUA 4RA0A 3WQ1A 3WDYA 2UWCA 3A4UA 5CVRA 4Q1PA 4S2FA 1SBFA 2VMIA 1LOBA 4LA3A 2ZGQA 4U2AA 4EWAA 1ASJ2 3VL9A 5KC5A 2OPKA 2W68A 2ZGOA 2BNMA 1WW4A 1LHVA 2BWCA 5AC92 2I2SA 1GZ9A 5DZEA 4LNVA 1DDLA 1CAUB 5EWSA 2VU9A 2UY9A 1QOOA 2LM3A 1RUF3 1DYKA 1FMD3 2YGLA 2YYOA 2WZR2 4K20A 3V0BB 3Q9OA 4XZPA 1TE1B 5KXBA 2RM21 4Z07A 2PA7A 5BNPC 1RHI2 2W52A 3IDCB 1UU5A 2PTMA 1YFYA 4YW2A 3SLIA 1XRUA 5D1IA 4HKLA 1BMV1 4BMBA 1SBEA 3H8UA 3ILRA 1YI7A 2JJ6A 1PNGA 3E6BA 5DDJ1 3FMGA 1UKRA 1G9BA 2EF6A 4QM9A 5JVVA 3PTYA 4QQOA 1BXHA 5BNPA 1OMIA 4XBNA 1TNRA 2IXKA 2JICA 2PHFA 5JIAA 1S0JA 2JKBA 4IV3B 3URFA 1R1A1 3U10A 2RS13 3IMNA 4GB33 3EQEA 4FPYA 3O14A 2Z42A 1UAIA 2PHUA 2D6LX 5KXDA 1AR81 4JAAA 4HMZA 2PHXA 2IC1A 4UXAA 4BOWA 4LBLA 2QJVA 2UY8A 2HWC1 2YXSA 3WW3A 1RUJ3 3HQXA 3D8CA 3ZFFB 4OFGA 1S0CA 1R092 3IM0A 1MVQA 2UURA 4JGZC 4ATEA 3FLTA 4OZXA 4Q27A 2JEMA 3WVJA 1LU2A 2CY6A 4JVAA 1LR5A 1CAXA 2VOKA 5JWPA 1PO12 4QHBA 3POSA 3AKQA 3E97A 4JGZA 2D3RA 2R043 5FREA 4XILA 4LO8A 1HRI1 2ZACA 4IEOA 4P9LA 1W6NB 5JOZA 3MIEA 1DFQA 1NCQC 3G7DA 4OHXA 2ZOEB 3KZ4C 1LODA 2E7TA 4C0BA 4MXVA 4P9JA 3P3PA 3PNAA 2D7FA 1ND3C 1PZ8A 3MZHA 5ABJA 3WUCA 1WD3A 5DG2A 5E16A 5C4WB 4KG0A 3LKJA 2NN8A 1ND3A 2JG9C 2WL1A 3S0MA 2VW1A 1F2NA 1L3JA 4WM8C 3FX3A 1W6QB 4GMP3 1MEC3 3G6JB 1ZBE3 4Q4X3 4MGIE 2CTVA 2WT0A 4G4FA 5A33B 1A6CA 2JG9A 2X5IA 4EWDA 4MLOA 5H9RA 4M0NA 1OQEA 2XVGA 3FLPA 5C8CA 2D5FA 1IOAA 2I45A 3R4SA 4X8PA 4FT8A 4XMAA 5JCTA 2YGMA 2PHTA 1GANA 1C5IA 1VP6A 1VB4A 2DCJA 3VBOC 3O5SA 2CAUA 3NV2A 5JSRA 4QPGB 5EV7A 1VBA3 1HQWA 4C91A 1ULDA 3THPA 5FMOS 4D3WA 3WLUA 2RS11 1VRH2 3VBOA 2DURA 4OI2A 2IZWA 1H2LA 5J98B 1DZTA 2A75A 4WVVA 1Z7S1 2RJKA 4FXGB 3WW1A 2D98A 3TNPB 1RUD2 1DZQA 1WW5A 3TB0A 2PQQA 1LGNA 4ISQA 4YVWB 1RUG2 1QHDA 1C3HA 3JD71 1PIV2 1ZVFA 3R0RA 1XYNA 3WQ0A 2YV8A 5SV8A 1CPMA 3MIFA 4P9YA 1AL21 4JGYC 3VKOA 1UCXA 1SLAA 5FPZA 4AEMA 1UZYA 4Y22A 3UK9A 4CRQA 3MIHA 5FOBB 1WGPA 3GHNA 1CIWA 1JXNA 4PLOA 3ZXLA 2EVXA 3WHTA 4CEYA 3S7EA 2P3KA 1DQ4A 1MZFA 4JGYA 2HYKA 1AR62 1B35C 1LULA 4YYOA 3H7JA 5J36A 2D40A 3RYPA 1GZWB 3OD0A 4N9IA 1AR72 1PHMA 3MF9A 3MLKA 4NWVA 3ZFGB 2PYTA 4QXKA 1B35A 2ZMLA 1K5MB 2ET7A 3VBSB 1HV0A 4XE9A 3AP5A 3RPQA 3BALA 4P9IA 4INDA 2ILMA 3VL8A 1V6OA 2Q0AA 3E6DA 3APBA 5ACA1 1KDMA 4OHVA 2NMNA 3MFCA 3OYWA 2G9GA 1LCLA 1V6IA 2A6YA 4XHBA 1IKQA 2DUPA 3VZMA 5J96B 2RE9A 3H1WA 3PVEA 2DVDA 3ATGA 4XFGA 1PZ9A 5GLUA 5FCCA 1KRIA 5I8YA 3N7KA 3SITA 4DPNA 1EP0A 2A3XA 4DQAA 3C3VA 2YPJA 1SLTA 1HDKA 2DV9A 2I07B 2VNRA 1R1ZA 3DKWA 1MZ5A 4ZU4A 5AVPA 1PVC3 1EAH2 2YUEA 2KA3A 4YM2A 5IK4A 1ENSA 4PDWC 1TQ5A 4URTA 1UW8A 2R061 1N1YA 4D69A 4XQDA 4D7TA 1VBA1 2XLFA 1Y7BA 2DFBA 3SCHA 1Q8VA 1H4GA 1AYN1 3AKTA 3WUDA 4DRVA 4YSFA 1IPKA 3AMPA 3FUQA 1V6JA 4PDWA 1NY71 4XJZA 2XL9A 4Q4Y3 2JDZA 2PAEA 1WLCA 3JU9A 4M0HA 2MEV2 5EJ3A 4Y4YA 3ELNA 2E9QA 1COV2 2ZAAA 1DQ1A 3FC0A 1SLCA 5A3LA 3UKTA 1S55A 2IFRA 3M7AA 3M70A 4XIKA 1HX6A 4LE3A 4FAHA 2RS51 4XFIA 4I2OA 1BK1A 2JECA 3S7IA 1MS9A 4KU7A 3VHPA 3THTA 3NO8A 4ASMB 1WCDJ 1RVF3 4KU8A 3WG4A 4ES9A 2PHLA 1AYM2 2XBO3 4YGEA 4J6GA 4RHV1 2HWD1 5K0UB 3ZDSA 2JD4A 1X36A 2P3JA 2Y0IA 5HCFA 4ZU7A 4PLNA 4HT1T 3ZMOA 2ZZQA 1MQTA 1YXWA 1D2QA 2HWB3 2LTNA 3OD4A 1ASJ1 1DGRN 1OI6A 2A6ZA 3CO2A 4LUMA 4CDUC 3LCPA 2GZWA 2ZKNA 1HV1A 3ENRA 3UL2A 2ATFA 2R30A 2ZHLA 3LOIA 2OUHA 4XJWA 4Y26A 4C0HA 1Q56A 5C33A 5BXXA 4LBQA 3VBUC 3H1MA 1WMFA 4CDUA 2XPJA 1EV11 2RR13 1NOVA 4BHPA 4FPJA 4Q4V1 3B00A 3U4XA 2B9UA 1QQP3 2ZHMA 4MUVA 3K51A 1QJX2 2LALA 2D6NA 1GSLA 2Z69A 3RZZA 3VBUA 3LGRA 1CVNA 1S0GA 4RQPB 4FAGA 2A7AA 3I59B 1DGWX 4XF4A 4CDQC 5GZFA 3VZNA 2GMPA 5FO9B 2WNUB 5JR7B 1XE7A 5T3NA 4YGBA 5JI9A 1W39A 4XJUA 1V6LA 4AQTA 3OGJA 4TSVA 4R52A 3AFGA 2WA3A 4BH9A 2IXCA 4CDQA 4EN0A 1FPN3 3X29B 1QJU2 4D94A 1AR93 4YM1A 4LBQD 2E63A 1KJRA 4EROA 1ZBA2 3IT8A 1FI2A 4M3CA 1GV9A 5CFDB 4WBBA 1JUHA 2XJTA 2EXJA 2HWE3 5LEKA 1ZZ6A 1VR3A 4DY5A 1OQ1A 4LT5A 2ZMKA 1FOD3 4F7ZA 3V56A 2GAUA 3M3IA 2RMU1 4C90A 3ZSJA 4AF9A 2WKKA 1D4M2 1MR5A 1A3KA 4RD7A 3KCXA 1N1VA 3N7LA 3AJYA 1CN1A 5D8AC 1EY2A 4QPIA 2V5YA 1DZRA 3WDUA 5HBAA 1ND2A 4JQRA 1FXZA 4AXOA 3J8F3 4GULA 2NM1A 2OYZA 4OHYA 1HXS3 5CFCB 5C9AA 5J09A 5D8AA 4BZ4A 3B69A 4GKYA 5JMCA 1ZM1A 5JAXA 3DPRB 3FBMA 3W59A 1RUF2 4B7KA 1NCRC 1FMD2 2HWB1 1AJKA 3O0XA 3MLLA 3NSTA 1X33A 3TWIA 2A70A 2WQ4A 3HAGA 1UPSA 2XB6C 1HRV1 1QOSA 3LWCA 4FP3A 1PM7A 1KXGA 4H7MA 4N53B 3FFQA 1QXRA 3AYCA 1REFA 4KWLA 4LLOA 5J7MA 1DYPA 1W6PB 2GMMA 4ITCA 4FPKA 3WCSA 3E6CC 1YLLA 2JX9A 3MW3A 2JE9A 1M06G 3KSCA 4YVSB 4QM8A 2ZX4A 3HIFA 4XF1A 4FXKB 1QGLA 5FLIA 1C8NA 4Y20A 4GB32 2WSVA 2G4IA 1VAKA 1W0PA 5I8TA 5KXCA 1TME2 4XJ8A 1CAWB 1RUI3 4CZSA 5H9SA 1DGRA 3UJOA 1JUIA 2QFEA 2KM2A 3ZIXA 5FQ0A 1VBE3 2H0VA 4AFAA 1AR91 2A71A 3B3QE 2EIGA 1ZRDA 5KHIA 4YG0A 1O5LA 4XW3A 1PVXA 1LHOA 1AXKA 1RUJ2 1VALA 1FYUA 2VMHA 4UW4A 2UU8A 2ZGPA 4AYUA 4BCUA 1J58A 2VOXA 4ORFA 1GLHA 4NHLA 4RFT0 1G86A 1F31A 4HK9A 1UZZA 2FMDA 4CDXB 1VBD1 2OA2A 5GZCA 3HR9A 3RI9A 3NVCA 4WZCA 3ES1A 5FLJA 1KS5A 2R042 2RM23 4PIXA 4FOYA 3V65A 3JUUA 1FV3A 3WQ7A 2IWGB 2JENA 3LSDA 5FO7B 4COWA 2A5ZA 1UU4A 3VGIA 2BQPA 2O0OA 5GLZA 3WR0A 2VVDA 5BYNA 3ZXJA 5DDJ3 1EPZA 4NPRA 4MGKE 1Q8QA 1XU1A 1IKPA 3H3ZA 1C8M1 4I30A 1R1A3 3RMYA 4Y1UA 5T54A 4EN6B 2IXJA 5JOXA 5I8SA 4Y1VA 1ENRA 5BNQA 2FMYA 5A32B 2YHJA 3QACA 4AW7A 2UYAA 4OI4A 1ZBE2 3IPVB 1AR83 1WLWA 4Q4X2 2DWRA 1DQ6A 1WMEA 4RS5A 3TYJA 4QX5A 2Q5TA 3H1YA 1OA2A 1CR7A 4XHXA 4AE2A 5KHGA 2WSUA 1JTZX 2ZCWA 1JYIA 4XMIA 3SMHA 4AQ6A 4YLZA 4LE4A 3UJQA 3PHMA 1S2BA 1KQRA 3K48A 1BVVA 1R081 2ZTNA 1WLDA 2RHPA 1EAH1 3FHIB 3T1MA 5EYYA 1I9RA 4XYXA 3IWZA 5CB7A 3ZN5A 2HWF1 1HRI3 4IV1B 4TZDA 5E88A 1GR3A 2WNVB 1H1IA 4HPKA 1ALYA 2Y26A 1Q8SA 1W6NA 2I74A 1CPNA 4S2GA 1KD7A 2XGXA 1C57A 3SCGA 1Q43A 3KQRA 5A3MA 4AQ2A 5L7OB 4MGYE 1EPWA 3EJKA 2DCTA 2QDRA 5FTTC 2BPA2 1X82A 3GZTB 3AP9A 4AFCA 5K7PA 1IS5A 4LBMA 4YRDA 1U12A 4AEKA 4AFDA 3RRDA 1UD1A 1ONAA 3D5OA 2DVGA 1VBC1 5T5OA 3CEWA 4LO5B 3VKMA