1G8WA

Improved structure of phytohemagglutinin-l from the kidney bean
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
233
structure length
233
Chain Sequence
SNDIYFNFQRFNETNLILQRDASVSSSGQLRLTNLNGNGEPRVGSLGRAFYSAPIQIWDNTTGTVASFATSFTFNIQVPNNAGPADGLAFALVPVGSQPKDKGGFLGLFDGSNSNFHTVAVEFDTLYNKDWDPTERHIGIDVNSIRSIKTTRWDFVNGENAEVLITYDSSTNLLVASLVYPSQKTSFIVSDTVDLKSVLPEWVSVGFSATTGINKGNVETNDVLSWSFASKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEUCOAGGLUTINATING PHYTOHEMAGGLUTININ
publication title Weak protein-protein interactions in lectins: the crystal structure of a vegetative lectin from the legume Dolichos biflorus.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 45
structure length 233
sequence length 233
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1g8wA00
3AP7A 1WW5A 2DUPA 1I1EA 1HQLA 3VKFC 4FPGA 1AZDA 1WBFA 2DYCA 5T50A 1V6KA 1X50A 3AYEA 1RIRA 2ZGLA 2ZBJA 1SLLA 3RQ0A 1GNHA 4FPKA 4LBQA 4C1WA 1IS6A 4GALA 1W6OB 3HN1A 1QKQA 3WZ1A 2ZGPA 3DGTA 2B7YA 4Z8BA 2D44A 3M3QA 1KDMA 1ONAA 1UMZA 3OY8A 5CAZA 3BTAA 2NYYA 4Y1YA 1JXNA 5GZCA 4Y20A 2LTNA 2ERFA 3OGGA 1A78A 1HQWA 5DUXA 1MS8A 4WV8A 3WCSA 2A75A 2LALA 3WDXA 1GZWA 1RINA 2ENRA 2A6VA 4DRRA 1GNZA 4FPFA 2OW4A 3AJYA 1N1SA 2ES3A 3CNAA 2WKKA 3BIWE 4XJAA 2PHTA 3MW2A 2CWSA 1ENQA 2ZHMA 3AZVA 3N3HA 3AX4A 5DG2A 2UU8A 2ZMLA 2ZGNA 4FPCA 2CWMA 4RA0A 4PCRA 2D3SA 5GLTA 5GM0A 1S0EA 2OUHA 3U4XA 1DQ0A 3IMNA 3V64A 1DGLA 3WG1A 4BMBA 3WDTA 4DRVA 1N1VA 1N1YA 1NLSA 1FV2A 3ENRA 4AGGA 3SH4A 3A4UA 4FPLA 1SFYA 5FRAA 1WLCA 1LHVA 1FATA 1HDKA 2H0BA 1MACA 2DVDA 2ZA9A 1S0FA 5T5PA 5F9TA 3POYA 3AZYA 1ZM1A 4CRQA 1ENSA 1SLAA 4GA9A 3WG2A 1KJRA 1OQ1A 2DU1A 3ZXLA 5IK7A 3RSJA 4AVSA 2ZGSA 1YI7A 1S1AA 2NP0A 4M3CB 1LTEA 5JOYA 4ASMB 3C2UA 1AX0A 4YGEA 2JE9A 3UK9A 3SNMA 4Y22B 1NXD1 2WT0A 1SBEA 3ILFA 4YFWA 1Q8SA 4RL7A 2GDFA 1SLIA 1AJOA 2GNBA 3POSA 4AGRA 1Q8PA 4Y1UA 1MS0A 1O4YA 1LEDA 1LOCA 1W6OA 2AGSA 4P9XA 4XBQA 1Q56A 4MYEA 4ATEA 2V73A 1YRZA 5E8AA 2YXSA 2ZABA 3N7LA 3H0OA 2RHPA 1R1ZA 2W39A 5H9RA 4Q26A 3ZSMA 2UURA 4LBMA 3NV3A 4IQPA 4XZPA 3ASIA 1DYPA 3RS6A 3NV1A 3O0WA 4ISQA 2E53A 3NV2A 1CQ9A 4XIOA 3OY8B 4YZ2A 3WG3A 1CN1A 5IK8A 1KQRA 2P37A 2VW1A 2CY6A 1LHWA 1LGBA 3UJQA 3WHTA 4YZ4A 2D3RA 1APNA 1QOTA 3LSDA 1S0IA 2YZ4A 5FREA 4ITCA 4GKXA 3M2MA 2ZGMA 3B3QE 5E89A 3V0AB 1QNYA 4JC1A 1FX5A 1HLCA 2ZHNA 1FNZA 2P34A 3AFKA 4FPHA 2DVGA 3ATGA 3PVEA 4YW5A 4Q27A 4R9AA 4PBOA 2PHWA 2ZKNA 2DTWA 4LBJA 1VAMA 4ATFA 1IS3A 2A3YA 2UWBA 3WLUA 1KJLA 4UW3A 3UL2A 1WLWA 2R1BA 1VALA 2D6OX 1LCLA 1UPSA 2DVAA 1QDCA 2W68A 3IKWA 3R4UA 4Y1ZA 4YW2A 3WDWA 2DUOA 4FQ4A 1N3QA 1LGNA 4AGVA 4R9CA 4YZ1A 4XMAA 5DG1A 5KXEA 4XTMA 1ULGA 4AVVA 3T2TA 2A3WA 4WVWA 1CJPA 1MVEA 3BOPA 1FAYA 1N47A 4BMEA 3ZSKA 2E51A 1W0OA 3O5SA 4JRAA 5HCAA 2WT1A 3OJBA 1DYKA 1YYNA 2CTVA 3MPPG 1AF9A 4Y22A 4YG0A 3NWKA 1AX2A 1DQ5A 2JKBA 5CNAA 1C57A 2VXRA 3GALA 1LHUA 3OBTA 1BXHA 1SBFA 1O4ZA 1UKGA 5HCBA 2UWAA 2E7QA 4M3CE 2D3PA 4YW1A 3SISA 4F83A 3T1MA 1GZCA 3MW4A 2NZ9A 4L8QA 1JHNA 2VU9A 2CL2A 4DPNA 3RRDA 1MR5A 3PVNA 3OYWB 2PHXA 4KBBA 3WUCA 1MS5A 1UAIA 4XJ8A 3A0NA 3RG0A 1S0DA 2EAKA 3NV4A 1FYUA 1GANA 4W65A 2YROA 4R9DA 3T1LA 1LU2A 5JDBA 2GMEA 2BQPA 4XDQA 3FUQA 1ENRA 1GV9A 1SLBA 1ULFA 4FP2A 3VV1A 4XBNA 3V0AA 4YM3A 1JYIA 1AXKA 3WV6A 1CR7A 2FMDA 1WBLA 3APBA 1AXYA 1LOFC 5DUWA 4WZFA 4M3CF 3FFZA 3FLRA 3SH3A 5DZFA 1V00A 4XHBA 1CVNA 2GN7A 3W58A 2ZACA 1JW6A 3M3EA 4GXLA 4FPJA 1G9CA 2R49A 1IS5A 1GKBA 3AP4A 2CYFA 3D6EA 1ULCA 4YZ3A 5CA6A 2JE7A 2P3KA 4UW4A 1V6OA 4K1YA 4GWMA 2VW2A 1QDOA 4NO4A 2D6PA 4FP3A 5EYYA 1U0AA 1IOAA 1B09A 1YIFA 4HANA 4DFSA 1Q8VA 3WUDA 2ARBA 3OPZA 1QNWA 1SBDA 1LEMA 5L73A 1IKPA 4PBPA 3ZSJA 4YLZA 5EWSA 1VLNA 3ZXFA 2AENA 3MEPA 5CB7A 1DQ4A 4Q2FA 5GZGA 1LOAA 3Q9OA 3N7MA 3AP5A 4LBLA 1N1TA 2EXHA 1W6NA 1GLHA 1LENA 1SLCA 2NN8A 2NMOA 3AZZA 1LOBA 4FPYA 4HL0A 5IK4A 1D2SA 4FPOB 1JYCA 3N35A 3O12A 1S0BA 5GZFA 1VIWB 1AXZA 3O0VA 1W6QA 3AXDA 4UW6A 3AK0A 3V65A 1G9AA 4WVVA 4C1XA 4FOWA 1XQNA 3I8TA 2ZMKA 1MZ5A 3OYWA 5GLWA 2WT2A 3IN9A 1IKQA 2NM1A 1GSLA 4M01A 4YFZA 2EXKA 4XJUA 5H9PA 5BYNA 2DURA 3WDYA 4AYUA 1CPNA 3B00A 2GNTA 1UZYA 4SLIA 1EPWA 3AYDA 1KDKA 2DU0A 5GLUA 1KRIA 2R0FA 4YZ5A 3N36A 2R1DA 4I30A 4YGDA 2ZGUA 2NMNA 3VKNA 3VUOA 1Z0HA 5LK5A 1JN2P 4YM0A 3M3CA 2VY0A 1QOOA 2AREA 2YY1A 4LBOA 5EXOA 2GN3A 1PZ9A 4YG6A 1CONA 1FNYA 3ZXJA 2D6KA 3BODA 4LBNA 4BM8A 1G7YA 2SLIA 3RMXA 4BLIA 3INAA 1OFSA 3PMEA 1SCRA 1BKZA 2A5ZA 1KITA 4FOYA 4U36A 5H9SA 3RMYA 4GWNA 5DZEA 4GKYA 3LCPA 1N3PA 1V6IA 2R16A 5GLZA 4BLJA 1H9PA 3HR9A 2W08A 2DUQA 4K20A 2WSUA 4FOVA 3TB0A 3SITA 1LODA 4Q1RA 4DS0A 5E88A 2EF6A 5GZDA 3N7JA 3DUIA 2I2SA 4ISRA 1G9DA 1UZZA 1ZA4A 1W6PA 2DVBA 3KM5A 1WUVA 3QLQA 2DV9A 1Q8OA 1V6JA 5CBLA 1HKDA 4XTPA 4ZXKA 5H9QA 5DXDA 2A6ZA 3VKLA 3WVJA 5JMCA 5JOZA 3WOGA 2PELA 1GYKA 1YO8A 5IT6A 1WD3A 1G8WA 2Q5TA 4TYSA 4U2AA 2D6LX 2XB6C 2GNDA 4YW3A 5KXBA 2ZZJA 3IM0A 2ZHLA 3O0XA 4YM2A 4Y1XA 2FHRA 3MW3A 1PZ7A 2GMPA 3AXEA 2VUAA 4ZKTB 1V6LA 1BZWA 4OZXA 1JUIA 2DVFA 4XJWA 2JJ6A 3AYCA 1W6NB 3L2YA 3LSEA 2EXJA 1W6MB 2CNAA 5JVVA 2P3JA 4Y24A 1W6QB 5T5JA 1ULDA 1OKQA 2ZMNA 1PZ8A 3AP6A 3I4IA 3VKOA 5IK5A 2UWCA 2AR6A 1LU1A 3USUA 3WNXA 1H30A 2WLQA 4AWDA 1QU0A 5JOXA 1AJKA 1LGCA 2PHFA 3V0BB 4LBKA 5T5OA 1MS4A 1LESA 1CPMA 1QF3A 3OBRA 4PF5A 5T54A 3UJOA 1G9FA 1LECA 3GNEA 4D69A 4XMIA 1YXWA 1WLDA 2PHRA 1BJQA 5DUUA 1AVBA 4XXAA 1S0CA 2TEPA 3SLIA 4NOTA 2WQZC 4K21A 4YW4A 4M00A 1IS4A 4DQAA 2VW0A 2ZGOA 4AVTA 5AVAA 1URXA 4Q8KA 2A6YA 4R9BA 1BYHA 1LOGA 1DBNA 2D7FA 1SCSA 2GALA 5HCFA 4K1ZA 1GBGA 1UX6A 2GMMA 5GALA 1CIWA 1F5FA 2P3IA 4Y1VA 2P2KA 2OVUA 2PHUA 1GICA 3POWA 1JOJA 1DLLA 2GNMA 3B9CA 2HYKA 3R4SA 5T5LA 1BQPA 1WW6A 1DHKB 3A0KA 1G9BA 1G86A 2XG3A 1LOFA 4H55A 1S0JA 5DZGA 1GZ9A 4CTEA 2D6NA 2AUYA 3AP9A 5GLVA 1J1TA 1ULEA 1W6PB 1H9WA 3ILRA 2R0HA 3ZXEA 1MS3A 1W0PA 3TAYA 1QOSA 1DQ2A 5GJ6A 1MZ6A 3M1HA 4YM1A 4YGBA 5F5QA 2ZGRA 5GZEA 1JBCA 2OUJA 3KQRA 3VKMA 1N3OA 3PJQA 3IPVB 4XYXA 2EXIA 3D4KA 4XHXA 4Q8LA 1SACA 2A7AA 1W6MA 3N7KA 3M3OA 2WJSA 1Q8QA 3AYAA 4P14A 4XOGA 2JDZA 1DFQA 1VAVA 2AYHA 2DWRA 3ZYRA 1DQ6A 4XBLA 2W52A 3FBYA 1QMJA 2JD4A 4LBQD 2YV8A 1D0HA 1UN1A 2A70A 1WD4A 5IUQA 3V0BA 2A6WA 1DZQA 4YGCA 4Y26A 3ZYPA 3ZPYA 3USUB 4XJZA 2DTYA 2VH9A 4BQ1A 1MS1A 3FUOA 2ARXA 2C5DA 2EALA 3B01A 3ZSLA 3W59A 3D5OA 3WCRA 3ZXKA 3FLTA 4P9YA 5EYXA 2ZAAA 1S0GA 1MVQA 4XXPA 3B69A 3SH5A 3WG4A 2E7TA 3AZXA 5JOWA 4LBQB 1LJ7A 3AZWA 2E6VA 3HMYA 1A3KA 1Z78A 4YG3A 1Y7BA 4JCKA 2ZGKA 4TZDA 1LHOA 1FV3A 4FVVA 2A3XA 2D6MA 2ZHKA 4BPZA 2JECA 4XE9A 4Y20B 4FOQA 1SLTA 5KXCA 5KXDA 2AH2A 2A71A 2ZGTA 3AJZA 2G4IA 4XJ9A 1WW4A 3QCWA 1C4RA 4XIKA 1LOEA 3PVOA 1QGLA 4FPEA 1LHNA 4BOWA 1GZWB 1WW7A 2WSVA 3JUUA 4Q1PA 2ZGQA 5JLVA 1MS9A 3IPVA 3WDVA 1LULA 2A6XA 4P9WA 3ZVXA 1A8DA 2KM2A 2EIGA 2YMZA 4UW5A 1V6NA 5T52A 5SV8A 1AX1A 2C9AA 1CESA 1C1LA 1WCSA 1I3HA 4M3CA 1F9KA 2Z42A 3JU9A 5T55A 2V5YA 3R05A 2D43A 3WDUA 1V6MA 1TEIA 1DIWA 3FLPA 2WNEA 3WHUA 1C1FA 1UL9A 1DQ1A 4FQZA 4PQ9A 2SBAA 1F31A 4XILA 1RITA 5DUVA 4CZSA 3ILNA
chains in the Genus database with same CATH superfamily
3RZKA 4CCKA 4FPGA 1WBFA 3VZJA 1QJZA 4R52A 3OEAA 4R8HA 5CFCB 1RIRA 2AEYA 2GC3A 3HQXA 2BPA2 1GNHA 1UNBA 1NCQA 2Y34A 4XFGA 4DB5A 3DGTA 2Q8DA 2CV6A 4A44A 4BIOA 3T08A 2XL9A 4LT5A 3U11A 1UMZA 2RJLA 3VBHA 3BTAA 1SPPB 5C7GA 1KFXL 1UY4A 5FZMA 4CUBA 3OD0A 1V9U2 4INDA 1XSQA 3VBRC 1TQ5A 2LTNA 2ERFA 1RMU3 3OGGA 1GOHA 1U5ZA 3WD5A 1YQ6A 3NNFA 5DQ0A 2ENRA 2A6VA 4DRRA 3MICA 1GNZA 2HWE2 2OW4A 1N1SA 2ES3A 3ZX7A 2E33A 4RGGA 3K3OA 4ES8A 2VBBA 3MW2A 4KWUA 1IG3A 1ENQA 1RUC1 2ARCA 2UU8A 2VCCA 4IE6A 2Q8EA 5LK7B 2BYVE 3T09A 1ZNPA 4E8CA 1XNAA 4A7YA 2D3SA 2BVBA 5GM0A 3WT3A 1BK1A 1DGLA 2Z5WA 2W1WA 3FX3A 1N1VA 4BK4A 2X53S 5A7PA 2BFUS 2J1UA 5L19A 2XMLA 4Q4W2 1LHVA 2O0OA 1FATA 1KEXA 2R062 4Q4X1 1MACA 2XVLA 2DVDA 2VECA 4NRMA 1NY72 1OLRA 5G05L 1NZIA 5T5PA 5F9TA 3KF5A 4JRLA 4OI2A 4Q0VA 3SKJE 1VR3A 4CRQA 2RS11 1ENSA 1SLAA 4OQ9A 3HJRA 3OSDA 2IC1A 5LA0A 3H1WA 4PHZA 2R043 5JOYA 4LTAA 2ET7A 3FFQA 4MGKE 1PNFA 1NE4A 1ZZBA 3M7AA 4YGEA 4X6RB 3WX5A 1J3RA 5T3NA 1NXD1 1TVGA 4RS5B 2WYFA 4CCDA 4MX3A 3O1TA 3H8UA 3AKSA 2C6SA 2ZPXA 2BBVA 2FDJA 1NUKA 2FDFA 3THDA 1SLIA 3VBOB 2X5IC 1QJY3 4Y1UA 4UBHA 2K46A 1AR91 1UY2A 3SMHA 2AGSA 2XVGA 4XW3A 1ZBE3 1NKGA 4N43A 5F3GA 1UOFA 2HWD2 2V73A 2XUEA 2RHPA 2W39A 1JZ7A 3NV3A 4GB32 3ASIA 4IEPA 3QH7A 3C7FA 3O0WA 2FDHA 2IFWA 1OI6A 1DG6A 1QHDA 4BJ0A 3LD8A 1US2A 4YZ2A 5JZGC 2VTXJ 3HBKA 2R063 4DXSA 1RYYA 4BH9A 2CY6A 1F4AA 2F6BA 4A3XA 5FYIA 2VNGA 1AR61 4JKKA 4WM8B 3USSA 3LSDA 3TBDA 1FPN3 1RUE2 2ZGMA 4DMIA 1PM7A 3HOBA 4Q4V2 3FE5A 1OHFA 4CU6A 3RZJA 2V09A 1W2UA 5FPBA 2WWJA 3VL9A 4YW5A 1IPJA 4Q27A 2WFPA 4PBOA 1UOGA 1VRH2 1YNAA 1X36A 2VBPA 2OS2A 1KJLA 3KSCA 4UW3A 3UL2A 3IKWA 1VALA 4ZU4A 2P6CA 3VBRB 4Y1ZA 4BK5A 3RZMA 4IEYA 3WDWA 1I9RA 2J7MA 4UF0B 3ZN6B 3ZO0B 1NX9A 4XMAA 1RHI3 2ZX3A 2J1AA 4EWDA 3N9NA 3VLBB 3T2TA 1AYN2 3OUJA 2A3WA 5FO7B 4M0NA 4DUXA 1XU1A 2G9GA 4FFIA 1FAYA 1KS5A 4F7ZA 2CSGA 5LW9A 3I3EA 1PO22 3SCFA 3TEXA 4LO4B 1HV0A 1POV1 1OKOA 1CAVB 4QU1A 3MPPG 4KWKA 1UF2C 4WZCA 1U5XA 1EV12 5IFPA 4COUA 1HB1A 2CAUA 1AX2A 4D7YA 3MUY1 3NAPC 5CNAA 2YDEA 2VXRA 3WW3A 3ZYFA 1TZOA 1BXHA 2WFF1 5I8SA 2ETEA 1UKGA 2QQIA 4XDPA 5B2GB 3B93A 1RMU1 1AR71 2E7QA 3KD4A 4MGIE 4ZONA 4QQPA 5BNOB 1CGPA 2Q1FA 1FOD2 1Y3TA 2D3PA 2PXJA 3OGRA 5K0UA 5FR3A 3T1MA 4Q0UA 1VRH3 2NZ9A 4AQTA 1COV1 4KU7A 3RRDA 4AHWA 3W21A 1PGW1 3WUCA 3MIGA 3ZDSA 3MDPA 4ARYA 1M4WA 1PMHX 3ZMOA 2EAKA 3S57A 4CCMA 2JKXA 1GQPA 2DCTA 2BNNA 2XWJB 2YROA 1LU2A 4IEUA 5GKAC 4K8FA 2DCJA 3JBG1 4B7KA 2OT7A 3LIHA 4QQLA 2B42B 2G9FA 2MPFA 4LOTA 1GV9A 3RVHA 2MNGA 3I59A 3VV1A 1ZYBA 4CDUC 4XBNA 4KG8A 3ZN5A 5IFTA 4Z1VA 4KU8A 1JI6A 2FMDA 3APBA 1AXYA 5F5AA 1WGPA 3LA3A 4M3CF 1BBT2 5FZ0A 3SH3A 2BDRA 5DZFA 1V00A 4CEYB 1A34A 3JZVA 1CVNA 4N53C 3M3EA 2DF7A 1US3A 5FYTA 1S2KA 1V9U1 4I01A 1W9WA 4TXWA 4R4ZA 4P5YA 3AP4A 2R041 2KA3A 3WQ7A 1RUD2 3LB9A 1XSRA 3PUQA 4LHNA 4YZ3A 2P3KA 4UW4A 2VZ3A 3JD73 2QCSB 4W4ZA 4GWMA 5C70A 1LAJA 3WY6A 1CZSA 4BXSV 2GH2A 4LR4A 2HWE1 4DFSA 5IVEA 1Q3EA 3WUDA 4DIQA 3OPZA 2JDYA 4N7IA 3LOBA 5L73A 4URAA 1Y9QA 4PBPA 4YLZA 4ZU5A 5EWSA 5DPNA 1VBA3 4C91A 1LOAA 5GZGA 3N7MA 5A32A 1GP4A 2DCZA 1LENA 1SLCA 2NN8A 2Q0AA 3AZZA 4GMP1 3U07A 5FO9B 1D2SA 1D4M3 1ASJ2 2JENA 4FPOB 3BALA 3AMQA 4Q4W1 2ZX4A 1MQTC 2R061 4AL9A 1HRI2 3PU8A 2RG4A 3AB0A 3AK0A 2WNVB 5FMOS 4C1XA 2IWGB 1W03A 2XLFA 4FOWA 3OBAA 5A6ZA 1MZ5A 3IN9A 4RQPC 1FPN1 2B46X 1AL22 2I45A 2RMU2 1RUD3 3E1F1 3I2KA 4JGZA 4KG0A 4N43C 5FPAA 3VD5A 1GUIA 5BYNA 2XUMA 4FXKB 2ATFA 3WDYA 1QH6A 1CPNA 3AMMA 3D3AA 4BCUA 1W9YA 1JYNA 3NAPB 1KRIA 1REDA 2WZR2 3VBSC 1HX6A 2P5BA 1JN2P 1W2TA 2BP6A 1UIJA 1WMXA 2CDPA 3CBNA 4QXCA 4WM7C 5G04L 1RHI1 3QOPA 1OA2A 2C0ZA 4GWIA 5KHIA 2JDHA 4HBNA 2SLIA 4BLIA 2JXAA 1K5JA 4FOYA 4GB31 5H9SA 4AI1A 2DCKA 4GWNA 2HWC3 1BEV2 4NIGA 2P17A 2R16A 4V1PA 5FTTC 3KLSA 3TN92 4D8MA 2HWF2 3HR9A 1RUJ3 4XQ4A 1BLZA 4K20A 5E6HA 3S0MA 1AR83 4LEJA 1LODA 3IMMA 2EIEA 3BU7A 1HB3A 4JKMA 3CO2A 4CDUB 2E31A 1OF3A 3JCIA 4HONA 4Y5Z0 1RUE1 4M0HA 3SXWA 1UZZA 1WMDA 5FLHA 2DVBA 3KM5A 3QLQA 4L99A 5FZFA 1HKDA 2IXLA 1ND3C 2A6ZA 3WVJA 4TTGA 5FYYA 4CXWA 4TN7A 1ND2A 3HWJA 1OF4A 2Q5TA 4N53B 4S2GA 1VRH1 2D6LX 4U2AA 3VDAA 1PK6B 2XB6C 4QKNA 1G6NA 2XHKA 3L2HA 3TEZA 3K4AA 1F2NA 3H8RA 3MW3A 3NNMA 3J8F2 1BK0A 1UMHA 3RPQA 4A4AA 1POQA 3AMPA 4YVWA 2XBO3 4XCAA 2BFUL 2LROA 2ZKLA 3AYCA 1W6NB 4LORA 4Y4RA 5I0SA 1GU3A 1RJ7A 2EXJA 2PAKA 3ABZA 3POFA 5FPZA 5FWEA 3I3DA 1PO21 3MI8A 3TNPB 1ULDA 1OKQA 3VKOA 1PZ8A 3I2JA 3K75B 4NWWA 5K0UC 2UWCA 2AR6A 1EV11 1MEC2 2Y8KA 4IEXA 3U10A 5FZEA 3USUA 2CAVA 3ES4A 4AWDA 4P9LA 1DYOA 3N9OA 4QMAA 4J6GA 5I0RA 1AJKA 1LGCA 2PHFA 4BA6A 5ABJC 1A8MA 4CSWA 1MS4A 1LESA 5CKQA 2WZEA 2W47A 3OF1A 1MQTB 4IERA 3ZIXA 1LECA 2ZTNA 4HFSA 4OUMA 4D69A 4OMCA 1YXWA 1O3SA 1WLDA 1O7FA 1YCIA 2HEVF 2OQ6A 2RS52 1OPMA 1VBD2 5FZOB 4H14A 4AFMA 2Y26A 5KWRA 5LCWL 2RM23 5FZDA 1WCKA 4LKFA 4YW4A 2ZGOA 1Z7S2 1URXA 1YC61 2XQRA 4R9BA 3WQ0A 1DBNA 1RUG3 1ODMA 1SCSA 2GALA 1JOPA 2GMMA 2VQTA 1PO12 4Y1VA 2PHUA 5FP9A 1H0BA 3BI3A 3PIGA 2YU2A 3ST7A 1DLLA 1PVC2 2GNMA 1QJX2 4XURA 3BOWA 5T5LA 3RYRA 3RWNA 3VBSB 1VRBA 5FO8B 1G86A 4H55A 4R4XA 3FHAA 1HN0A 1JZ3A 5DZGA 3CDZB 2WNUC 2AUYA 1BBT1 1GZTA 1TE1B 2Z2SB 2WWUA 4LOSA 3ILRA 2ZX0A 1MS3A 4HKWA 1J84A 4YGBA 1UO9A 1EUTA 2CHHA 5GZEA 1RUD1 4UI9L 3KQRA 3AKTA 3SKVA 4MXWB 1ULOA 3AVSA 4MV2A 2VMFA 1R1A2 3PJQA 4XYXA 5SV5A 4NIDA 4GWJA 2W9XA 5BV6A 2QQPA 5AFBA 4MVTA 3LA2A 1J58A 4NHXA 2BNMA 3RFRA 2WO2A 4AI2A 5IWFA 4ZZ8A 1O3RA 1WD4A 3V0BA 4EROA 1TME3 1DZQA 4I0WB 2HWC1 1KXGA 2B39A 4COZA 1ASJ1 1TMF3 4IV3A 3CJIB 2R072 4H7LA 2VH9A 1CAXB 1HRI1 1AR81 4BISA 2X05A 5CFCA 2Q8CA 2V5DA 3ZSLA 4FFFA 3WCRA 4UWDA 4IV1C 2VMCA 1VMHA 1AL21 5F2SA 4HZFA 2ZAAA 5A7WA 4YYOA 1MVQA 1GNYA 2IXKA 5JOWA 1CWPA 1LJ7A 3GDBA 2E6VA 2TUNA 1Z78A 4LKSA 2XKPA 3KCXA 4QGMA 2ZGKA 1YFUA 2E32A 5K9YA 2G9ZA 1FV3A 2WZR1 2A3XA 3ACFA 3W5MA 3PLQA 3PUHA 1ZRRA 4XE9A 3ZFEC 3U4SA 5KBFA 5KXDA 4Y33A 1C8M3 4AI0A 4XIKA 3PVOA 2JDMA 5ERLA 4KWLA 4AOCA 1GZWB 1WW7A 4DUVA 1BEV1 1C8NA 2ZGQA 5LBBA 5JLVA 2R073 5CFDA 1PM4A 1REEA 2E9QA 2VOWA 3IPVA 4D6RA 3LQCA 4HPKB 1VP6A 1OURA 3I7DA 3H3UA 2AEZA 3VDDC 1J59A 5DABA 3D8CA 2BOJA 2CDOA 4MGSA 5DN2A 5A3MA 3WNNA 1XOYA 1ST8A 3PUSA 1V6NA 5SV8A 2WNUB 3ACHA 3GJAA 1AX1A 3OTFA 4PI2A 5BNPC 1Q43A 2C9AA 3HPNA 4COWA 5LZ6A 1VE0A 1W05A 1WA6X 1WCSA 3KMHA 1F9KA 1NYWA 1WCQA 2Z42A 2I74A 4JV4A 4NAOA 3ZOIA 5J96B 1JHJA 4CU8A 3J8F1 2VQAA 5AC92 2RR12 1RUG1 3DECA 3B94A 1UL9A 1DZTA 1OLQA 1TNFA 4LJHA 4PQ9A 5FYMA 4CZSA 3ILNA 2JG8C 3I3QA 2YHJA 5ACA2 1NCRA 3AP7A 1WW5A 3VKFC 5FXZA 2QZ2A 5FMOL 2QDRA 3KS7A 4FT8A 2ZBJA 1SLLA 1S55A 3RQ0A 4LBQA 5IVYA 2YUEA 4XABA 2LW8A 1W6OB 2X10A 3OB8A 5LATA 1MEC1 4DEVA 2VXJA 4A6OA 3DL3A 4HT1T 1GP6A 1KDMA 3SHRA 1NLRA 4TWTA 5CAZA 2JG9A 2WL1A 4KWJA 1CAUB 2VOXA 4LMFA 5CEHA 1A78A 5DUXA 4B3NA 4PQQA 4WV8A 2YGLA 1GOGA 4Z07A 2RS51 1VBD1 1VBE3 3ALQA 3VHOA 1R092 4CXYA 4RR3A 1IHMA 4IV1B 3WDXA 4AHZA 5FZKA 1SMVA 4FPFA 4IUGA 1Z7S1 2YC2A 4XJAA 5F5CA 2PHTA 5JSPA 3AZVA 3N3HA 4QD2A 3AX4A 3PUAA 4Z2AA 2BUKA 2JX9A 2ZGNA 2CWMA 5I8TA 3NKGA 2FZ2A 1PVC1 1QJX1 1TME1 2PMWB 3U4XA 1DQ0A 1H2NA 3WG1A 3ZFEB 4DRVA 4ET7A 1FV2A 1FMD2 3ENRA 4CCCA 4FXGB 3A4UA 3T2OA 1UX7A 2X8KA 1DF0A 1BMV2 1WLCA 3WW1A 2B4KA 1JUHA 4MADA 1AYM2 1HDKA 1CZTA 1S0FA 5EP9A 1CX1A 2AZ5A 1NG0A 3AZYA 3IZOA 4DZGA 4P02B 2WBKA 4XCBA 4FSJA 1KJRA 1R082 3ZXLA 3HNBM 1W2OA 1YI7A 2GC1A 1QJU3 4P9IA 3UESA 4MGZE 5FXXA 4CXXA 5C4WB 3PURA 2BGCA 5C33A 1RTVA 2MHFA 4E4SA 1R1A1 1GMMA 2JE9A 1H4HA 2LUWA 1JU3A 3KV4A 4JGYC 3SNMA 3OGSA 2WT0A 1SBEA 4AAPA 3ILFA 2PLV2 4YFWA 3VDDB 3ZFGB 1Q8SA 2DBNA 4RL7A 4NWVA 2GDFA 4XUPA 5BNOA 4YW6A 1YLLA 4S2FA 5A3WA 1MS0A 1O4YA 1LEDA 2NLRA 2W1SA 3BN6A 4QB2A 4XBQA 1YUDA 1Q56A 1C8M1 5FZ9A 5DDJ3 1YRZA 4YVSA 2YXSA 2ZABA 4TLFA 5H9RA 4Q26A 5A3UA 4IE4A 4IQPA 4QX0A 3CHXA 1SG3A 5BUVA 3WQ1A 2VM9A 3AC0A 4YWAA 3NV2A 1CQ9A 4Z82A 2R071 3FL7A 3OY8B 1AYM3 1CN1A 4YNIA 4FAGA 2VW1A 2JG8B 1DLCA 3ZYHA 1LGBA 1AR93 5LBFA 3C8XA 4IEQA 4YZ4A 5BPXA 2VQUA 2UYAA 4HMZA 2IXIA 1VBB2 4FTEA 4ITCA 5F37A 3I3MA 3M2MA 3PTYA 1ODNA 4CEYA 3I3BA 1QNYA 3J4UH 3V0AB 4BHPA 5FP8A 1FNZA 2P34A 2VZUA 4AFDA 5A80A 3PVEA 3ME2A 2HEWF 3SC7X 2XJTA 3CEWA 2IZWA 2DBIA 2O1QA 3JB4C 2PLV3 4M4PA 4PLOA 3VZKA 2ZKNA 2DTWA 1UD1A 1VAMA 5CKMA 3ELNA 4BIFA 5FDBA 2EVXA 2UWBA 1RVF3 3WLUA 4UYBA 2BVVA 2R1BA 2D6OX 4YW2A 1AR63 1QDCA 4EV0A 4E2QA 4AG4A 1N3QA 2QVSB 3BPSA 4YZ1A 4ZZ5A 3IAQA 4XF4A 2QNKA 3BU0A 2N7GA 4XTMA 3RJRA 3ROUA 4AVVA 2XVKA 4UFJA 4CUGA 3CQOA 5CKNA 1I6XA 4JAAA 4WVWA 1XBFA 1MVEA 1H8TA 4GD4A 1GP5A 5BNNA 1N47A 3GF6A 1FXZA 2IVIB 5FWJA 2E51A 1DGWX 3O5SA 5DAXA 2WT1A 1DYKA 4QPYA 4Y22A 1AF9A 1D2QA 4ASLA 3H42B 1E57A 4HVOA 2HWB2 4J25A 4X8NA 4NHYA 4FBFA 1OOPC 1UOBA 2Y38A 4MGQA 4JX0A 4AEDA 1PX3A 3NNGA 1RXGA 4W50A 1VBE1 3ZN4A 1H6XA 4BWOA 1POV3 3K4ZA 3MW4A 3ZXAC 1JHNA 2VU9A 3MPBA 4CCEA 4CU9A 4DPNA 1ACCA 2DDUA 1MR5A 2WAOA 5FUPA 2PHXA 5FZ7A 4AI3A 4OHYA 4DINB 2VZ1A 4ZPIA 3HEIA 3H7JA 3VDBA 2XKOA 3O7OA 1GANA 4JGYB 1EAH2 2WFF3 4JTNA 4W8JA 5ACA1 4IXLA 2GMEA 2XL7A 3CJXA 4PI0A 4C0HA 1AR73 4UFIA 3W5NA 1IG0A 4FP2A 2FDGA 4YM3A 1JYIA 3WV6A 1RJ8A 4RYDA 2VZPA 1COV3 4WZFA 2OZ6A 3NRUA 3WP6A 3FLRA 4GH4B 5FK8A 1YEWA 2GN7A 3KCCA 2OX0A 1RUH2 1JW6A 3KT4A 5F5IA 4GAZA 1L7LA 4FPJA 1G9CA 1QJU1 3JBG3 4PLMA 3D6EA 1JOBA 2JE7A 1STMA 4K1YA 2D5HA 1QXPA 4HN0A 2YG0A 1QDOA 4FP3A 3VZLA 1W9TA 2YC0A 1U0AA 1W8OA 2V72A 1YIFA 2UYBA 5IVBA 4HANA 4X6QB 4XF0A 4CP9A 5A3PA 2CGPA 1Q8VA 1K5MA 4IGQA 4Z2WA 3CIHA 3TWIA 1QNWA 1SBDA 4XUTA 3K4DA 1LKNA 4OHWA 4CDWA 1V9U3 3WNPA 5DDJ1 5BXXA 2XONA 2QJVA 3JQXA 3MEPA 3AFGA 5CB7A 1YQ8A 4LBLA 1XE7A 2MEV2 2PFWA 1OD3A 1W6NA 1FMD1 1GLHA 1O5UA 2NMOA 2Y0IA 3KVBA 1BMV1 4OYUA 3VD3A 1JYCA 1NXMA 2WIIB 1S0BA 3O12A 1AYM1 2HWE3 3IDCB 1VIWB 4UW6A 4PT6A 2WRAA 3VGIA 4QHOA 4JDOA 3I8TA 2RDRA 1R081 3R0RA 3OYWA 3AM2A 2EA7A 3AVRA 4KGQA 4QPIC 3GHMA 2NM1A 4L2NA 2VTXA 4QPGC 1AUYA 2H6BA 2BRTA 4XJUA 2OPWA 1XJAA 4Y4YA 2QQJA 3GZAA 3DKWA 3ZFFC 1JZ4A 4GMP3 1K3IA 1B35A 4A45A 2FD8A 1UZYA 2PLV1 3AYDA 4SLIA 1KDKA 3LIGA 4Q4W3 5GLUA 2R0FA 4AQ2A 5DMYA 4YZ5A 1H1MA 3N36A 1RVF1 1YQCA 4FO9A 1OOPB 4RQPB 2NMNA 5FZHA 3VKNA 5L7OB 2RJKA 3NJVA 5FZOA 3W9AA 2Y6FA 4CPBD 2VY0A 4I0BA 1YFYA 4LBOA 2GN3A 4CP2A 1FNYA 2D6KA 4BYYA 3BODA 3VZNA 3WNKA 3GGLA 3POIA 4LBNA 3DKQA 4XEZA 3WSOA 4B1LA 5A1AA 4EN0A 5CU1A 5C8WA 1OFSA 5FJKA 1SCRA 1BKZA 2VZVA 3RMYA 3T4HB 2J1TA 5DZEA 4XC9A 5FQ0A 2WUHA 3GZTB 3LCPA 1V6IA 1NA1C 4CUCA 2GAUA 5LRRA 1RUF2 3LPFA 1OH3A 3B02A 5DAWA 3VD7A 2J22A 1HRV2 4RD7A 3TB0A 4BB3A 2Z69A 2GP5A 5E88A 4JTOA 3N7JA 5L9BA 2PQQA 2I2SA 2HWD3 3GZEA 3SCGA 4BQ5A 1ZA4A 5HPOA 3PVBB 4GB33 5FPLA 5J3UA 4ZXKA 4JKLA 2FDIA 3VKLA 3TEWA 5JOZA 2PTMA 5JMCA 2Z4FA 1GYKA 1YO8A 5IT6A 5BNNC 2VUDA 1RUI2 4MXWA 4RFRB 2QBXA 3KF3A 3DCQA 1HW5A 5FP3A 1RL3A 1BVVA 2FHRA 4A6SA 1POV0 3AXEA 1V6LA 3RYKA 1BZWA 1E5IA 1RUE3 3JXSA 1JUIA 2DVFA 4XJWA 1JS9A 2JJ6A 5C8CC 4AK3A 4XAAA 4Q4V3 1XE8A 4B4PA 4NPLA 3IDBB 5FLIA 1W6MB 3N9MA 1W0NA 2WNOA 2P3JA 1ZRDA 4K40A 4AEDC 3IDEA 2ORZA 1L7RA 2VAUA 4QB1A 3AP6A 1HRV3 5IK5A 5LEKA 1NCQC 2J1SA 1GQGA 1LU1A 1BHGA 3NVCA 1E5SA 1H30A 1I5PA 2HWB1 3EBRA 3CJIA 4PDWA 1HV1A 1CAXA 3VBHC 4LBKA 3UYJA 3ZSEA 3KHBA 1AYN3 3OBRA 4Q0PA 3UJOA 5D8AA 3RI9A 3FJSA 1G9FA 3WP3A 5BY5A 1K45A 2OQ7A 3OG2A 2X5IB 3UKTA 1J3QA 1GQHA 1NQJA 4META 1PO23 2QTWB 2XGXA 3POGA 4NVPA 4OHVA 4XXAA 5FXVA 4RHV2 4Q4Y2 3SLIA 3KGLA 4NOTA 1O59A 1EV13 1WKYA 4HKLA 4M00A 4K8RB 1ZZ7A 4E4ZA 1WA4A 2VW0A 4LQRA 3N9QA 4QPGB 3H8XA 4LO8A 5FYUA 1BYHA 5HXMA 3MIFA 2D7FA 3HQRA 4CDQA 3ZFFB 1OLME 1YIPA 2WN2A 2VD7A 3KT1A 4K1ZA 3SCHA 4EYUA 5A3LA 3K3NA 1CIWA 1F5FA 1O8SA 3CZJA 3EMRA 3VBFA 5JZGB 3B5LB 1GICA 3POWA 1FOD3 2QQOA 3B9CA 3R4SA 5JMOA 4FTSA 4CEWA 1BQPA 5FOBB 2VOVA 2BJSA 2XG3A 1LOFA 3UKVA 1GZ9A 3WQBA 1XC6A 1YJLA 3OPTA 1H9WA 2YPJA 1RUH1 3URFA 3TAYA 1QOSA 1UKRA 1XYPA 2YC4A 3LEMA 4O65A 4YM1A 2BGOA 1UYXA 1NA1B 4MOAA 1JODA 3MIDA 3T3YA 2D93A 3X29B 1F5JA 1X8MA 5FZ8A 1W3XA 2QE3A 4XHXA 4Q8LA 4HKOA 4OI1A 2RVAA 4XPVA 3SEPA 3I2FA 3ZXGA 1BBT3 3PIJA 4BQYA 2WJSA 4GMP0 3VHPA 1NY71 1Q8QA 3AYAA 1W8ZA 4KMQA 1Y4WA 3ZYRA 4XBLA 1JZ5A 1QMJA 4XVHA 2VUJA 1D0HA 1UN1A 1EP0A 1OMIA 2A70A 4QM9A 4CCJA 2WQ8A 3OUHA 5LBCA 3THPA 3EHKA 5JXIA 2VCMA 4OHZA 1W8HA 2JDAA 2ZX1A 3E5QA 1C28A 3GCXA 4GJZA 3MLLA 2XJRA 3FUOA 4AI9A 2ARXA 1VMJA 3POEA 4NIHA 1W06A 3QBQA 3F95A 2KXLA 2HWD1 4L11A 4UFKA 3ZXKA 1W28A 3FLTA 2XOMA 4P9YA 2XJUA 5KC5A 1S0GA 2WDBA 2VQ0A 2EICA 2E7TA 4HVRA 4KBZA 4XUOA 1A3KA 3OEBA 1DGRN 1ASJ3 1Y7BA 3LEGA 5FMCA 4KH9A 2QQMA 4TZDA 1HRI3 4FVVA 3WW2A 2D6MA 3GBFA 5LY1A 4H2AA 3D82A 1JZ8A 4FOQA 1SLTA 2ZAHA 5IAVA 2W94A 1UOJA 2A71A 2B9VA 2G4IA 1AL23 3AJZA 4XJ9A 2YBPA 3RWKX 1WW4A 2RMU3 3QCWA 4Q4V1 3U78A 1PGL2 3MLJA 2XLGA 2WSVA 3C7OA 4CDXA 4B4QA 4LIUA 1W3VA 1MS9A 2TBVA 3UT0A 2WZR3 5FZLA 2J1EA 1HRV1 1WCDJ 2RDNA 4AZZA 3WDVA 4BZ4A 3E5XA 2VMEA 5IATA 1IPSA 5JSOA 2WAAA 4WVMA 4AF9A 1X33A 3ZMNA 5JXGA 3A21A 1AYN1 1QJFA 2EIGA 2NPIA 2YMZA 4UW5A 4XUNA 5T52A 3UGHA 5EPAA 1AHSA 1SQ4A 1XNKA 3M4FA 4E2SA 1OSGA 1H2KA 4UFMA 1BEV3 4MHRA 1H2LA 5FZ4A 1C1LA 1CIYA 1I3HA 3DEMA 3TN93 5C4WA 4IEWA 2HWF3 5KHJA 4A2UA 1RUI1 2BEOA 2EIBA 5D1IA 5T55A 3R05A 3DF0A 1HB2A 4UFHA 4K3UA 1KFUL 3GM8A 1DIWA 1Y43B 2WNEA 4GZ9A 1TG7A 1ZREA 5D21A 1UQXA 3ZFGA 3WNMA 4XILA 1H6YA 2OXBA 4JDMA 1F31A 3MIEA 5DUVA 5A33A 3O1UA 1F15A 4N9HA 1GWKA 4DY3A 2DUPA 1I1EA 1HQLA 3MV11 1AZDA 1FOD1 1L3JA 2DYCA 1XU2A 4C0BA 5AFEA 1XE0A 4NMIA 5IAXA 4EWEA 2ZGLA 4QX3A 1E5HA 4FPKA 4C1WA 1YFXA 1ZRIA 2FCVA 3RI8A 3WZ1A 2B7YA 1CAWA 4W6WA 4Z8BA 3J8F3 4N43B 3M3QA 1W8WA 1C5HA 2RE9A 1NOVA 3M8LA 4QHZA 3ZYJB 1YJKA 3OY8A 4GJYA 2W5FA 3D0SA 1ENXA 4GIQA 4Y20A 5JPMB 1ZX5A 3H1MA 3GZUC 4TSVA 3LOIA 4CP1A 4ZS3A 1HQWA 4P5HA 4O7XA 1T2XA 1VMFA 5KC6A 4D6SA 3WP4A 4DNYA 4RHV1 3WCSA 3K46A 4WM7B 2A75A 2LALA 3DPRA 3NNJA 3WXPA 1RGSA 1MEC3 1VBC2 2QQLA 3GCWA 4Q0QA 4YW7A 1VB2A 3SQOA 4UOJA 2WKKA 5A3NA 1O4TA 1NAEA 2R32A 3PU3A 2FDKA 2VE1A 2ZHMA 3MIBA 3VBUA 5C3PA 4FPCA 1C5IA 1LNSA 1S0EA 3DYPA 4FFGA 4BMBA 2RS53 1VBD3 3GXUA 3WDTA 1N1YA 4AGGA 1UZ0A 4FPLA 4KI5M 5FRAA 3ZKUA 1Z7S3 5J09A 4P08A 3KGZA 3POYA 1ZM1A 1ND3B 4LO6B 2VMIA 2C24A 2W95A 2P6HA 3LA7A 5FYVA 4D3WA 2HJIA 1PO13 3RSJA 2NP0A 1IPKA 1JU4A 1S1AA 4OI4A 2PA7A 1LTEA 3DXUA 4IW3A 4M3CB 5ANNA 1PVC3 2BWAA 1QJX3 2YBSA 3IIAA 4FTBA 3S7EA 4JGZC 5CISA 3ZM8A 5C9AA 2JICA 3HD8B 1OD5A 2TNFA 2Y6KA 4BXFA 5LA1A 5CG8A 2YBKA 2Y0OA 1AJOA 2GNBA 3PNAA 4AGRA 1Q8PA 3RZHA 3IBMA 4AFCA 2W1UA 4UBGA 3IDAA 4P9XA 4S2DA 4MYEA 4ATEA 2RMU1 4OCTA 4RN5A 4EN8B 5CG9A 3N7LA 5K0UB 3H0OA 1SPPA 3ZSMA 1R1A3 1X9PA 2P3YA 3NV1A 5CZKA 2VZTA 5A7OA 2E53A 1K42A 4JDNA 4NR1A 5JSRA 1ZBA2 2JIJA 2VL4A 5ABJB 3WG3A 5IJRA 1KQRA 2P37A 4DXTA 4E2GA 4IE7A 1NT0A 3WHTA 4LKEA 1OC1A 1APNA 3RYPA 1QXJA 4UFLA 4CP0A 3HNMA 4BQ4A 1SDDB 1WZXA 5FFOC 5FREA 4F8AA 4GH4A 3I59B 1L7QA 1YHFA 3B3QE 2J1RA 2Q1MA 4L9BA 3UV9A 4W6XA 1HLCA 3P3PA 2ZHNA 4MZUA 3WF2A 1JH5A 3AFKA 1LR5A 4FPHA 3ATGA 2K0GA 1NLQA 3TN91 2HWF1 4ATFA 1ND2C 3OOXA 4LBJA 5TSWA 1E5RA 4X8PA 4LHKA 2XXZA 3R4UA 4MGYE 1LCLA 1UPSA 2DVAA 2VGDA 2W68A 2OKXA 1W8TA 2VCAA 1ZRFA 3O1PA 1LGNA 1PIV2 4R9CA 2G19A 1PGL1 4YVWC 4XFHA 5A6XA 4O9GA 4AXOA 1O5LA 1VPHA 3BOPA 5FBJA 5E1RA 3I2OA 5FZ6A 3ZSKA 1PVXA 1W0OA 1XB9A 4WVZA 3EYPA 1YYNA 3AKQA 4YG0A 2H6CA 4RS5A 4YSFA 5FP4A 1SEFA 3NWKA 5EJ3A 1YQ5A 2VC9A 2XQXA 2JKBA 2AACA 4RSUA 3VBOA 1NZCA 3OBTA 5A32B 3I54A 2YU1A 1O4ZA 2BBAA 1D7PM 2B45X 1RUOA 3VZMA 4NIAA 1GZCA 2DFBA 2CL2A 2RS32 3E97A 4KBBA 4QGNA 1UU4A 1MS5A 4XJ8A 5EHDA 3A0NA 4EJRA 5EFUA 4Y5TA 4EN7B 2F17A 3NV4A 1FYUA 3UGGA 2DFCA 4RQPA 4W65A 4R9DA 3T1LA 2QFEA 1OA4A 3CL1A 3NJZA 2BQPA 4WM8A 1ENRA 4JQRA 1SLBA 1ULFA 2Y6HA 1NQDA 5FYHA 2R30A 5F6LB 1AXKA 2W46A 5AVPA 2JB4A 3KV6A 2AC1A 4NN0A 3WP5A 5AC93 5EJ1B 2RR13 4TLGA 4V2VA 4PIZA 3W58A 2ZACA 4GXLA 1PO11 1RUC2 2ZXQA 3P5BA 4IL7A 3VBRA 5ACA3 1IS5A 4QQHA 4DXRA 4Q8KA 4UF0A 4IGOA 5FCCA 3ZN6A 2BTVC 1V6OA 5FY9A 3U1XA 3WR0A 4QAWA 2VW2A 4J1WA 4NO4A 1BCXA 4W6YA 3KHCA 1KD7A 1QQP2 1VBC1 1IOAA 1B09A 4B4RA 1UXZA 1JYVA 1OUSA 4OULA 3S6PA 3LGRA 3A23A 4Q4X2 1V0AA 3N9PA 1OUXA 1CAVA 4QX7A 4C90A 1IKPA 2EIDA 2RS12 3U75A 1GFF2 1VLNA 1ND2B 5JI7A 2AENA 4EN6B 1W90A 5JPNB 3QD6A 4Q2FA 4LUMA 2IXJA 3AP5A 1N1TA 2P4EA 5JCTA 1R093 1MZEA 4FPYA 2WC2A 3TYJA 4K7JA 5IK4A 3N35A 3ETQA 5LWBA 5GZFA 3POJA 4GQ7A 4IV3C 4YVWB 5C3QA 3AXDA 4L97A 4I3GA 4LHLA 5BNPB 2RDQA 3OD4A 4OHXA 5CFCC 2ZMKA 4B1MA 2C9KA 2IUWA 3T2QA 2JWPA 2WT2A 3ECQA 4D7SA 2Y6GA 4NRQA 4KL1A 4I0AA 1GSLA 4M01A 2EXKA 3FN9A 3PMSA 4LLOA 4M4RA 2DURA 3ZYGA 2VBDA 3GYDA 1FMD3 4AYUA 4DUWA 4LPLA 2GNTA 4XZUG 4EN9B 1EPWA 1YWKA 2DU0A 2X5IA 4NHMA 4EWAA 2R1DA 4I30A 4YGDA 5A7NA 4I2OA 3VUOA 1Z0HA 5LK5A 3M3CA 3V56A 2AREA 2IXHA 1R083 2YY1A 5EXOA 5I91A 2VOKA 3HBZA 1PZ9A 3ZXJA 1Y9MA 1X9TA 2BU9A 5CIRA 4BM8A 4ASKA 1G7YA 5FPVA 3C7EA 3INAA 1W9SA 3PMEA 4U36A 5J48A 2A5ZA 2GU9A 4MLOA 4HLTA 4XF1A 1ZZ6A 2K9ZA 1ZBA1 3UETA 2Q8OA 3KQ4B 5JZGA 2QKDA 5GLZA 3CMGA 1H9PA 4BLJA 4HSJA 2VZOA 3O14A 2FMYA 4FOVA 2XJVA 3SITA 5CFDC 4Q1RA 1ZVFA 4DS0A 4ORFA 2KD7A 2WYSA 5J36A 4KGGA 3T30A 3DUIA 1XYOA 4AW7A 2OA2A 1G9DA 4QX2A 5A6YA 4DOUA 1V6JA 4I02A 5CBLA 4CU7A 3LEKA 5H9QA 3RNSA 5DXDA 4XF9A 3WOGA 1UMIA 3P3NA 1G8WA 1DU3D 1VB4A 4TYSA 2Y60A 5FYBA 3WNOA 1HQNA 5A7QA 3J7LA 4YW3A 1XNBA 2ZZJA 2ZHLA 3O0XA 4YM2A 5I93A 1PZ7A 2GMPA 1XXNA 2VUAA 1PHMA 3ACIA 1VBB3 3E6BA 4OZXA 4N9IA 2OIIA 2VR4A 3NQHA 2HBUA 2WNVA 3BTZA 3KCYA 5FZ3A 3BYWA 4IETA 5EIYB 3L2YA 4NROA 3ZYIB 4P9JA 1NCRC 1RMU2 3BCWA 3KWVA 1W6QB 3ACGA 1OXCA 3LKJA 5T5JA 3S5QA 4A42A 5JUVA 1OQDA 1J83A 2ZMNA 3I4IA 5HCHA 3VD4A 4NE9A 5AC91 3J9SA 2KR2A 2QQNA 3NAPA 2RR11 4KQ7A 2Q1ZB 2ET1A 3VHRA 5A3TA 2PHDA 2WABA 3MYXA 3V0BB 5HXVA 4B29A 1OLMA 2JG9C 5T5OA 5A7SA 1QF3A 4PF5A 3I2GA 2ADDA 2FQPA 4QGLA 4IV3B 4XFCA 5CVRA 1XNTA 1ZA7A 2PHRA 4WM8C 3SEEA 1BJQA 1KGYA 5DUUA 4EZ4A 3AL5A 3PJYA 4NHKA 2TEPA 5FPXA 5I0DA 3O1OA 2W91A 2WS92 2RS31 2WQZC 2YPDA 4RR3C 2IFRA 3L9JT 2HWB3 2K2SA 5A1LA 5A7WB 1J1LA 1LOGA 2PYTA 3MV01 3OUIA 3UNPA 3BUCA 5HCFA 1T6GC 5FZGA 2WO7A 3HAGA 5GALA 4CDUA 2P2KA 2OVUA 3TNQA 4CCLA 2R042 4OUSA 1JOJA 4OLLA 4HG6B 5LA2A 1DHKB 1R091 3A0KA 1SFPA 3T0BA 1S0JA 3T2PA 2FCUA 2D6NA 1PX4A 1Y9GA 2J42A 3AP9A 5GLVA 3WF3A 1J1TA 2B5HA 2FZ1A 4N53A 5FY7A 1ULEA 1W6PB 4AAXA 5F2WA 1PK6A 1QJY2 2VMDA 4XFAA 3ZR5A 2R0HA 4E4DX 1W0PA 2ZJCA 1EAH3 2H0VA 2D5FA 3NO8A 1MZ6A 3M1HA 2DCYA 3OBZA 5KHHA 1ZBE2 2ZGRA 1JBCA 4QWNA 2OUJA 2WINB 4XFBA 3UGFA 3VKMA 4LKDA 2OYZA 5CFDB 3ON7A 1N3OA 2D97A 3IPVB 2I07B 3D4KA 3GBGA 3IB3A 1UZVA 1SACA 3J26N 3MUZ1 1QQP1 4HK8A 2WS93 3M3OA 3VDCA 4P14A 5BNOC 3K77A 4P00B 1VAVA 2DWRA 1RUH3 2B9UA 2GSYA 2ZEZA 3G6JB 2WZPP 5J37A 4A7ZA 4HSLA 3FBYA 4FFHA 1EYBA 3IIIA 4AVAA 2JD4A 4LBQD 2YV8A 5FY1A 3OCPA 3KZ4C 1FPN2 1W8FA 4YVSC 5DAVA 5IUQA 2D40A 3G7DA 3QACA 2A6WA 1OVSA 3LZZA 4V2WA 4YGCA 4Y26A 3ZYPA 3ZPYA 1MQTA 4XJZA 2DTYA 3K51A 4Q5OA 2ZCWA 3D0JA 5IHRA 4ES9A 1MS1A 1D0GA 4QQOA 5F3CA 3B01A 4C8DA 4AVCA 3W59A 3BB6A 1NCRB 3O1MA 4OFGA 3GBWA 1W04A 2JDUA 2VUCA 1M06G 1RHI2 2Q4SA 4SBVA 1FT9A 3JQWA 3WG4A 3AZXA 2E7AA 2MEV3 1X8EA 4LBQB 4CEYC 1JTZX 1S4CA 3HMYA 2VZRA 4QQ2A 2VVEA 5FMDA 4XFIA 5JR7B 3CZUA 2RDSA 4BQ2A 5ISLA 3VHNA 1LHOA 1U12A 2JG9B 3VBSA 5FXWA 5D2AA 4WM7A 5KXCA 1VBB1 3DV8A 3DYOA 3OGVA 2ZGTA 1GWMA 3H50A 1H4GA 1QGLA 3T4VA 1LHNA 4YARA 5L9VA 3O1VA 4IE5A 4RR3B 5FZIA 1SFNA 3CU7A 4QKDA 3MFCA 4Q1PA 1H8TC 2ID4A 3ES1A 5F6KA 4MXVA 3Q8EA 1W2NA 5C6CA 2BW8A 3POBA 2GZWA 4S2HA 1LULA 1JZ6A 5LBEA 5C3SA 5F39A 3K2OA 3E6CC 5FUNA 4DO0A 4Z92B 1UYPA 3RDIA 2VOTA 2VCBA 1ND3A 2VNVA 2WNVC 2QDNA 3GJBA 1H1IA 4HOOA 3ZKYA 4M3CA 4H3WA 1RUF3 1O8PA 3I2IA 3NJXA 2X09A 5LA9A 4EZHA 1V6MA 1TEIA 3MBWA 4PIYA 3EQEA 2XHNA 1UU6A 5FKCA 5FK7A 4QDSA 4OI0A 1C1FA 3LDKA 4FQZA 1QY4A 4COVA 2SBAA 2UY8A 1F35A 3FZ3A 2RJ2A 3W20A 5HBAA 4UXAA 1O3TA 1DGRA 5T50A 1V6KA 4GULA 1X50A 3FC0A 3AYEA 3PHMA 3JD72 1RUI3 1IS6A 4GALA 3HN1A 4QPIB 1QKQA 5M0TA 2ZGPA 5LY2A 4B8EA 3HN3A 2D44A 2QZ3A 1GR3A 4YVSB 5HI0A 5FJHA 1XYNA 4D94A 1ONAA 2O14A 3M3IA 4LLFA 5ABJA 1EAH1 2NYYA 4Y1YA 5FV3A 3ZXDA 1JXNA 5GZCA 2BWCA 2Y6LA 5FPUA 1VBA2 3S30A 5L9RA 4QB6A 2CGNA 2QQWA 1MS8A 2D98A 1I5ZA 3C7HA 3FHQA 4QU2A 5KHKA 2WS91 2WQ4A 2VPVA 1GZWA 1D4M2 1RINA 4XAEA 2LRPA 2VZQA 2V4VA 3AJYA 3CNAA 4LHSA 4D0QA 3BIWE 3QH6A 2CWSA 3LFIA 2EAAA 1TNRA 1K5MC 2WLPA 3NSTA 4A7KA 4XQDA 4HPKA 1PK6C 2ZMLA 4FI9A 5DG2A 5I8YA 5I0TA 4CDWC 5A1FA 4FCAA 4RA0A 2FCTA 4PCRA 5F3EA 5GLTA 4ZU7A 2OUHA 3I2DA 3IMNA 2BERA 3V64A 1W2AX 5F8PA 1JZ2A 4RHV3 4Q4Y3 1NLSA 4HK9A 2CGOA 4Y3OA 2WNUA 1UY1A 2Y33A 5ANQA 3SH4A 1SFYA 1W99A 3NNLA 2XDVA 3R4DB 2H0BA 4CUAA 2ZA9A 5J1XA 1QJY1 4G9SB 3HT1A 1HXS2 2VULA 4IE0A 3ZR6A 4GA9A 5FYSA 5FZAA 1VAKA 1OQ1A 3WG2A 2DU1A 2XR4A 5IK7A 3MZHA 1H8TB 1PGSA 1ZBE1 2ZGSA 4AVSA 5BNNB 3PTRB 1CZVA 1Q5OA 1RC6A 2ADEA 4QM8A 2C1FA 4ASMB 3C2UA 1AX0A 2MEV1 3BTYA 3C3VA 3UK9A 5C3OA 2PQSA 4Y22B 5EJZB 4ARXA 2XPJA 1SHWB 2HWC2 1B35C 1UYYA 3H3LA 1O6UA 5C8CB 3A22A 4ONUA 4CCOA 1RUJ2 3POSA 4LNVA 3O1SA 5FZBA 1AR82 4LIVA 4MUVA 4MG2A 1LOCA 1W6OA 4H7MA 3TRSB 4AEDB 5E8AA 1K12A 1R1ZA 4LA3A 4OVEA 2UURA 1NCQB 4L0PA 4LBMA 3KB5A 4XZPA 1DYPA 5I0UA 3RS6A 1CAUA 4DXZA 4ISQA 4LO7A 2HBTA 1HJFA 4LUKA 4MO3M 4XIOA 2FBEA 3WINE 4E27A 3VBHB 1XNCA 2BOIA 5LASA 4DY5A 2VO5A 5IK8A 5KR7A 3DXTA 1LHWA 3UJQA 1QXRA 1HXS3 1QIQA 4MSVA 2D3RA 1VJ2A 3ITQA 4IV1A 4QX5A 1JYTA 1QOTA 3H3ZA 3PL0A 1S0IA 2YZ4A 3Q8FA 4GKXA 4QHBA 1XRUA 2XBO2 4QKFA 5E89A 4JC1A 1FX5A 3Q8AA 2YFZA 3I2HA 1UY3A 3ORJA 4ZXEA 1W9FA 2DVGA 2JDPA 1OQEA 5JXJA 4R9AA 2QUOA 1RUF1 4AEJA 2PHWA 4HXCA 2JDKA 3LEIA 4K9SA 2A1XA 1IS3A 3TEYA 2RV9A 2A3YA 1IGOA 3ZFEA 2VTFA 1JYXA 1WLWA 1H1AA 3C7GA 4OZOA 2VNOA 2VVFA 2DUOA 2F4PA 5FUIA 2WR9A 3Q8CA 3F2ZA 3LPGA 4FQ4A 2IVJA 4MH0E 4AGVA 4PF1A 5DG1A 2HH9A 2JDNA 4J1XA 5FY0A 3UKNA 5F7UA 5KXEA 1MPXA 1ULGA 1UXXX 2C26A 2B8MA 2C4XA 4G4FA 1W8NA 2BZDA 1HN1A 4A41A 4A3ZA 5FMBA 1CJPA 2YYOA 2VMHA 4XUQA 4BMEA 5F3IA 4CP9B 1K5MB 4JRAA 3LF7A 5HCAA 3OJBA 4BDVB 1ZZCA 2CTVA 2CU5A 2RM22 3KT7A 2ZEWA 4CDWB 3MIHA 4CYDA 3VDDA 1DDLA 3DYMA 1DQ5A 4FAHA 3ZDVA 3WW4A 5A70A 3RJ2X 3FWEA 1C57A 1RUG2 3CJIC 1LHUA 3GALA 4PDWC 4RGKA 1SBFA 5HCBA 1WLTA 5BNPA 4XDOA 4IEOA 2UWAA 5D8AC 3BGAA 2PN5A 2WA4A 4M3CE 4YW1A 3SISA 4F83A 3H9AA 5FP7A 4L8QA 5IVCA 4NPMA 2GC0A 5IVJA 1CJDA 1PMIA 4LK6A 3PVNA 3OYWB 4LXLA 4AFAA 1UAIA 3RG0A 4CCNA 1S0DA 2JG8A 2W0XA 3VN4A 2GH8A 1C3HA 4CDQC 5JDBA 3AKPA 1B35B 4OUEA 4QKBA 4XDQA 3FUQA 4WBBA 4XFFA 5FBZA 3U14A 3VBFC 3CKHA 3V0AA 1QEXA 4Q4Y1 3JD71 2PHLA 1W39A 4CEWC 1CR7A 4LE3A 4COYA 1WBLA 1LOFC 4O61A 2BNOA 5DUWA 1IZ3A 4NAMA 2YGMA 3FFZA 3THTA 5K8SA 1ZZ9A 4XHBA 5IVVA 3WF1A 1REFA 3TOJA 5LB6A 2O8QA 1GWLA 2R49A 1GKBA 2L9LA 4OMDA 5FQ0B 2CYFA 1VBA1 1ULCA 5K4LA 5F32A 5FIXA 5CA6A 1OA3A 2W92A 1TME2 5FOJB 4F3JA 4AHXA 2D6PA 1UIKA 5EYYA 1YQ2A 5FKBA 1D4M1 4MGTA 1TMF2 2ILMA 2QQVA 1PNGA 3LFMA 1QH7A 3BIEA 1DP0A 1D4VB 4MHUA 4HETA 2ARBA 1S2BA 1YFWA 3AL6A 1LEMA 5B4XA 4QXKA 1OPOA 3ZSJA 3E6DA 5EQUA 4JZRA 1DCSA 4IDZA 3ZXFA 3NMBA 2JE8A 4B7EA 3T0DA 1DQ4A 1UZWA 3Q9OA 4JVAA 1OT5A 2EXHA 3AMNA 2R7EB 4QX8A 3MHZA 4YPJA 1LOBA 4HL0A 1VBC3 4NJ4A 4URTA 4EQVA 3NW4A 3A7QA 1UYZA 3LDRA 1AXZA 3O0VA 1W6QA 1UPIA 3T0AA 3V65A 5JXHA 1G9AA 1HXS1 3NJYA 4WVVA 1XQNA 3BVCA 1P8JA 5GLWA 4PJYA 1IKQA 1C8M2 4YFZA 5H9PA 3BTXA 4JGYA 2PAEA 1JMUB 4CE8A 3B00A 3BKZA 2WWSA 3LWCA 1DGWA 4O9EA 3H8OA 1RB8G 2ORXA 2YFUA 4PDWB 4L92A 1RUJ1 4I09A 2ZGUA 2HEYF 2Q30A 2P1BA 4LULA 2OZJA 2A73B 2WZ8A 3B7MA 4YM0A 1QOOA 5D8AB 4YG6A 1CONA 5C71A 3OPWA 2YB7A 4QXHA 4N8MA 1S2EA 3NKTA 5KHGA 3RMXA 2XJSA 1OBNA 1XPWA 1KITA 5LRSA 1ALYA 1UU5A 2LM3A 2WO1A 3HQUA 4GKYA 2WA3A 2O8OA 1ZRCA 1N3PA 4CDXC 4KNCA 1V70A 2W08A 4PIXA 5K7PA 2DUQA 2WSUA 3FBMA 4CDQB 4P9GA 1DZRA 4PLNA 2EF6A 5CYYA 5GZDA 3KVAA 2J1VA 3VBFB 4QXBA 4XF3A 3S7IA 4ISRA 2XBO1 3E5UA 2ZOEB 1O91A 1W6PA 3HT2A 1WUVA 3J7HA 4CEWB 4D7TA 2DV9A 2PAMA 1Q8OA 4NUBA 4XTPA 3THCA 1RUNA 1MZFA 2PELA 1ZBA3 4RGAA 4UAPA 1WD3A 1HJGA 3HNYM 5EV7A 3IT8A 1LRHA 2W2IA 2XWBB 4G3YC 2GNDA 4LO5B 5KXBA 3IM0A 1NE6A 3ACLA 5C4WC 4Y1XA 2IXCA 2X29A 5IYYA 2LS6A 3EXUA 4Y5SA 5B4NA 4DEQA 1XNDA 5A3OA 4AHYA 4ZKTB 3JBG2 2VVDA 3H1YA 3ZYBA 1EPZA 4IEZA 3ZFGC 3H7YA 3LSEA 2CNAA 2VNRA 5JVVA 3BPZA 1J3PA 4Y24A 2GC2A 1X7NA 2F4LA 1WCUA 2HLEA 1O3QA 1VBE2 2VMGA 2RM21 3MF9A 3GHNA 5JIAA 5FZ1A 3WNXA 3HVDA 5DAQA 5IVFA 2WLQA 5JR2A 4I3PA 4JGZB 2E63A 1CD3G 1PIV3 1QU0A 3KV5A 1AL0G 5JOXA 3O1RA 1OOPA 5L7OA 1IQDC 5FYCA 5J98B 1FI2A 1QWRA 1CPMA 5T54A 2ZS6B 4YRDA 3GNEA 4RFT0 4QPWA 4XMIA 3RGBA 4AR2A 1AVBA 1EUUA 1S0CA 4K21A 4Q29A 1HIXA 3DPRC 4QDRA 1IS4A 3WF4A 4DQAA 1EY2A 4NPRA 4AVTA 1SZBA 1CX4A 3MGUA 3OGJA 2A6YA 5AVAA 2VZSA 3RZZA 3B9IA 3RZGA 3NL1A 1OVPA 3LDBA 3DN7A 1GBGA 1UX6A 2NQYA 3VBUC 2P3IA 2W1QA 1QJU2 4LK7A 3ZPOA 3AMHA 3I49A 5FLJA 1JYWA 2HYKA 4NHLA 4AI8A 4CPBA 1WW6A 3J7NA 5IW0A 2XH6A 1G9BA 3EB7A 4HVQA 1HB4A 4HN1A 1U5IA 4NRPA 4CTEA 2RS33 3N4MA 5BNQA 3IWZA 3P1IA 3N9LA 2ZEXA 3WF0A 5JI9A 3RZLA 3K48A 3PUIA 3HIFA 4LA2A 1H8VA 3ZXEA 3J7MA 4XETA 5J7MA 2W3JA 1DQ2A 5E16A 5EZWA 5GJ6A 3S5AA 5F5QA 3EO6A 1IQAA 5FYZA 4E9KA 5DDJ2 4CDXB 5L36A 5LEJA 3VD9A 3LE0A 4NIIA 2EXIA 2Z79A 4E4HA 5C3RA 2A7AA 4N7UA 3ZIWA 3P6BA 1W6MA 5C9AC 3N7KA 1TMF1 3AKRA 1T6BX 4JQTA 1U5YA 4WVMB 4XOGA 1PMJX 3WEZA 2JDZA 1DFQA 2AYHA 1AR92 2E26A 5JAXA 1DQ6A 2ZEYA 3JB8A 1RUC3 2W52A 4JHZA 3ETPA 3MF6A 1ZZ8A 4OQ8A 1W8UA 1WWYA 5CADA 3R6SA 2G1MA 2XJPA 5HV4A 4D6QA 1OFNA 4LE4A 3CLPA 2HKXA 3USUB 1QQP3 4AFBA 3I97A 5A6QA 2BGPA 4BQ1A 4BQXA 4QX1A 1LB2A 1OH4A 1H2MA 2R6QA 4Q4X3 2C5DA 1RVF2 3MLKA 2EALA 5A33B 3D5OA 1AR62 5FY8A 4AEMA 2RS13 4QPIA 3FHIB 4QPGA 5EYXA 4XXPA 3B69A 2HYXA 4GH4C 1R64A 3SH5A 3ZFFA 4IESA 4BE3A 4BU2A 3Q8BA 3AZWA 2Y6JA 3VB9A 4AQ6A 5JWPA 4N90A 1RXFA 4ZHNA 4IGPA 1CAWB 4YG3A 3PDQA 4JCKA 1BVP1 2QQKA 2ZHKA 4K6BA 4AEKA 4BPZA 3ZLIA 5C5UA 2ARAA 1X82A 2JECA 3M70A 4XACA 2OPKA 4Y20B 3U0ZA 2JD9A 2XJQA 2AH2A 2ZX2A 2JB8A 5FY4A 1C4RA 1LOEA 5JIUA 2JIGA 4E8DA 3MO4A 4FPEA 5APAA 2ZZQA 4BOWA 4AQSA 4ZS2A 1UCXA 3DPRB 4CA9A 2VJXA 1NA1A 3JUUA 3VL8A 2V4AA 5C5TA 2VG9A 1UY0A 4IEVA 3VBUB 2A6XA 1WMFA 5DAPA 4XQWA 5F1RA 2WN3A 4RS5C 1PIV1 4P9WA 3LAGA 3ZVXA 1A8DA 2BV4A 2GP3A 2KM2A 4AVBA 3VZOA 4QT6A 1UW8A 2WFF2 3VBOC 3CF6E 5FZCA 1KS4A 1F8VA 4ZY9A 3WNLA 3EJKA 1ULPA 1AR72 3U37A 4LITA 5FY5A 1CESA 4QDQA 4UT5A 2W87A 3MFAA 2UY9A 3JU9A 1WMEA 2QQUA 2V5YA 2D43A 3WDUA 1COV2 2WO3A 2JEMA 4AE2A 3FMGA 5HV0A 1YI9A 1PGW2 3FLPA 4JHTA 1F4HA 2XLAA 1SDWA 1UWWA 3WHUA 4BQ3A 1A6CA 5FAXA 4CVUA 5C8CA 1GOFA 3IAPA 1DQ1A 4Q0SA 1RITA 4EE2A 4BQWA 1QJEA 5C9AB 3KV9A 5L7OC 2Y64A
chains in the Genus database with same CATH topology
4FPGA 1WBFA 3VZJA 1QJZA 4R52A 4R8HA 5CFCB 1RIRA 2GC3A 3HQXA 2BPA2 1GNHA 1NCQA 4XFGA 4DB5A 3DGTA 2CV6A 4BIOA 2XL9A 4LT5A 3U11A 1UMZA 2RJLA 3VBHA 3BTAA 1KFXL 3OD0A 1V9U2 4INDA 3VBRC 1TQ5A 2LTNA 2ERFA 1RMU3 3OGGA 1U5ZA 3WD5A 2ENRA 2A6VA 4DRRA 3MICA 1GNZA 2HWE2 2OW4A 1N1SA 2ES3A 3ZX7A 4RGGA 4ES8A 3MW2A 1ENQA 1RUC1 2UU8A 5LK7B 2BYVE 1ZNPA 4A7YA 2D3SA 2BVBA 5GM0A 3WT3A 1BK1A 1DGLA 2Z5WA 3FX3A 1N1VA 2X53S 2BFUS 5L19A 4Q4W2 1LHVA 2O0OA 1FATA 2R062 4Q4X1 1MACA 2XVLA 2DVDA 2VECA 5T5PA 1NY72 1OLRA 5F9TA 4Q0VA 4JRLA 4OI2A 4CRQA 1VR3A 2RS11 1ENSA 1SLAA 2IC1A 3H1WA 2R043 5JOYA 4LTAA 2ET7A 3FFQA 4MGKE 1PNFA 1NE4A 1ZZBA 3M7AA 4YGEA 4X6RB 3WX5A 1J3RA 5T3NA 1NXD1 4RS5B 4MX3A 3H8UA 3AKSA 2ZPXA 2BBVA 1SLIA 3VBOB 2X5IC 1QJY3 4Y1UA 4UBHA 1AR91 3SMHA 2AGSA 2XVGA 4XW3A 1ZBE3 4N43A 2HWD2 2V73A 2RHPA 2W39A 3NV3A 4GB32 3ASIA 4IEPA 3QH7A 3O0WA 2IFWA 1OI6A 1DG6A 1QHDA 4YZ2A 5JZGC 2R063 4BH9A 2CY6A 2F6BA 4A3XA 2VNGA 1AR61 4WM8B 3USSA 3LSDA 3TBDA 1FPN3 1RUE2 2ZGMA 4DMIA 1PM7A 4Q4V2 3FE5A 1OHFA 2V09A 1W2UA 3VL9A 4YW5A 1IPJA 4Q27A 2WFPA 4PBOA 1YNAA 1VRH2 1X36A 1KJLA 3KSCA 4UW3A 3UL2A 3IKWA 1VALA 4ZU4A 3VBRB 4Y1ZA 4IEYA 3WDWA 1I9RA 3ZN6B 3ZO0B 4XMAA 1RHI3 2ZX3A 4EWDA 3VLBB 3T2TA 1AYN2 2A3WA 5FO7B 4M0NA 1XU1A 2G9GA 1FAYA 1KS5A 4F7ZA 1PO22 3SCFA 4LO4B 1HV0A 1POV1 1CAVB 3MPPG 4KWKA 1UF2C 4WZCA 1U5XA 1EV12 4COUA 2CAUA 1AX2A 4D7YA 3NAPC 5CNAA 2YDEA 2VXRA 3WW3A 2WFF1 1BXHA 5I8SA 2ETEA 1UKGA 5B2GB 3B93A 1RMU1 1AR71 2E7QA 3KD4A 4MGIE 5BNOB 4QQPA 1CGPA 1FOD2 1Y3TA 2D3PA 5K0UA 3T1MA 4Q0UA 1VRH3 2NZ9A 4AQTA 1COV1 4KU7A 3RRDA 4AHWA 1PGW1 3WUCA 3MIGA 3ZDSA 3MDPA 1M4WA 3ZMOA 2EAKA 2DCTA 2YROA 2BNNA 2XWJB 1LU2A 4IEUA 5GKAC 4K8FA 2DCJA 3JBG1 4B7KA 4QQLA 2B42B 2G9FA 2MPFA 1GV9A 4CDUC 2MNGA 3I59A 3VV1A 1ZYBA 4XBNA 4KG8A 3ZN5A 4Z1VA 4KU8A 2FMDA 3APBA 1AXYA 1WGPA 3LA3A 4M3CF 1BBT2 3SH3A 5DZFA 1V00A 4CEYB 3JZVA 1CVNA 4N53C 3M3EA 2DF7A 1S2KA 1V9U1 4I01A 4R4ZA 3AP4A 2R041 2KA3A 3WQ7A 1RUD2 3LB9A 4YZ3A 4LHNA 2P3KA 4UW4A 3JD73 2QCSB 4GWMA 3WY6A 2GH2A 4LR4A 2HWE1 4DFSA 1Q3EA 3WUDA 3OPZA 4N7IA 3LOBA 5L73A 1Y9QA 4PBPA 4YLZA 4ZU5A 5EWSA 1VBA3 4C91A 1LOAA 5GZGA 3N7MA 5A32A 2DCZA 1LENA 2Q0AA 1SLCA 2NN8A 3AZZA 4GMP1 3U07A 5FO9B 1D2SA 1D4M3 1ASJ2 2JENA 4FPOB 3BALA 3AMQA 4Q4W1 2ZX4A 1MQTC 2R061 1HRI2 3AB0A 3AK0A 2WNVB 5FMOS 4C1XA 2IWGB 4FOWA 2XLFA 1MZ5A 3IN9A 1FPN1 2B46X 1AL22 2I45A 2RMU2 1RUD3 4JGZA 4KG0A 4N43C 5BYNA 2XUMA 4FXKB 2ATFA 3WDYA 1QH6A 1CPNA 3AMMA 4BCUA 3NAPB 1KRIA 1REDA 2WZR2 3VBSC 1HX6A 1JN2P 1UIJA 4WM7C 1RHI1 3QOPA 1OA2A 2C0ZA 5KHIA 4HBNA 2SLIA 4BLIA 2JXAA 5H9SA 4FOYA 4GB31 4AI1A 2DCKA 4GWNA 2HWC3 1BEV2 2P17A 2R16A 4V1PA 5FTTC 3KLSA 3TN92 2HWF2 3HR9A 1RUJ3 4XQ4A 3S0MA 4K20A 1AR83 4LEJA 1LODA 3BU7A 3CO2A 4CDUB 3JCIA 4Y5Z0 1RUE1 4M0HA 3SXWA 1UZZA 1WMDA 5FLHA 2DVBA 3KM5A 3QLQA 4L99A 1HKDA 2IXLA 1ND3C 2A6ZA 3WVJA 1ND2A 3HWJA 2Q5TA 4N53B 4S2GA 1VRH1 2D6LX 4U2AA 1PK6B 2XB6C 1G6NA 2XHKA 3L2HA 1F2NA 3MW3A 3J8F2 3RPQA 3AMPA 4YVWA 2XBO3 2BFUL 2ZKLA 3AYCA 1W6NB 5I0SA 1RJ7A 2EXJA 2PAKA 5FPZA 1PO21 3MI8A 3TNPB 1ULDA 1OKQA 3VKOA 1PZ8A 5K0UC 4NWWA 2UWCA 2AR6A 1EV11 1MEC2 4IEXA 3U10A 3USUA 2CAVA 3ES4A 4AWDA 4P9LA 4QMAA 5I0RA 4J6GA 1AJKA 1LGCA 2PHFA 4BA6A 5ABJC 1A8MA 1MS4A 1LESA 3OF1A 1MQTB 4IERA 3ZIXA 1LECA 2ZTNA 4HFSA 4OUMA 4D69A 1YXWA 1O3SA 1WLDA 1O7FA 1YCIA 2HEVF 2RS52 1OPMA 1VBD2 4AFMA 4H14A 2Y26A 5KWRA 2RM23 1WCKA 4YW4A 2ZGOA 1Z7S2 1URXA 4R9BA 3WQ0A 1DBNA 1RUG3 1SCSA 2GALA 2GMMA 1PO12 4Y1VA 2PHUA 1H0BA 3ST7A 1DLLA 1PVC2 2GNMA 1QJX2 5T5LA 3BOWA 3RYRA 3RWNA 3VBSB 5FO8B 1G86A 4H55A 4R4XA 5DZGA 2WNUC 2AUYA 1BBT1 1TE1B 2Z2SB 3ILRA 2ZX0A 1MS3A 4HKWA 4YGBA 5GZEA 1RUD1 3KQRA 3AKTA 4MXWB 4MV2A 1R1A2 3PJQA 4XYXA 5SV5A 5BV6A 2QQPA 5AFBA 4MVTA 3LA2A 1J58A 2BNMA 4AI2A 1O3RA 1WD4A 3V0BA 4EROA 1TME3 1DZQA 4I0WB 2HWC1 1KXGA 2B39A 4COZA 1ASJ1 1TMF3 4IV3A 3CJIB 2R072 4H7LA 2VH9A 1CAXB 1HRI1 1AR81 5CFCA 3ZSLA 3WCRA 4IV1C 1AL21 4HZFA 2ZAAA 4YYOA 1MVQA 2IXKA 5JOWA 1LJ7A 2E6VA 2TUNA 1Z78A 2XKPA 3KCXA 4QGMA 2ZGKA 1YFUA 5K9YA 1FV3A 2WZR1 2A3XA 3PLQA 1ZRRA 4XE9A 3ZFEC 5KBFA 5KXDA 1C8M3 4AI0A 4XIKA 3PVOA 4KWLA 1GZWB 1WW7A 1BEV1 1C8NA 2ZGQA 5JLVA 2R073 5CFDA 1REEA 2E9QA 2VOWA 3IPVA 4HPKB 1VP6A 3I7DA 3H3UA 3VDDC 1J59A 3D8CA 5A3MA 1V6NA 5SV8A 2WNUB 4Z92B 1AX1A 3OTFA 5BNPC 1Q43A 2C9AA 4COWA 3KMHA 1WCSA 1F9KA 1NYWA 2Z42A 2I74A 4JV4A 5J96B 3J8F1 2VQAA 5AC92 2RR12 1RUG1 3B94A 1UL9A 1DZTA 1OLQA 1TNFA 4PQ9A 4CZSA 3ILNA 2JG8C 2YHJA 5ACA2 1NCRA 3AP7A 1WW5A 3VKFC 2QZ2A 5FMOL 2QDRA 3KS7A 4FT8A 2ZBJA 1SLLA 1S55A 3RQ0A 4LBQA 2YUEA 1W6OB 1MEC1 3DL3A 4HT1T 1KDMA 3SHRA 1NLRA 4TWTA 5CAZA 2JG9A 2WL1A 4KWJA 1CAUB 2VOXA 1A78A 5DUXA 4B3NA 4WV8A 2YGLA 4Z07A 2RS51 1VBD1 1VBE3 3ALQA 3VHOA 1R092 4RR3A 1IHMA 4IV1B 3WDXA 4AHZA 1SMVA 4FPFA 1Z7S1 4XJAA 2PHTA 5JSPA 3AZVA 3N3HA 4QD2A 3AX4A 2BUKA 2JX9A 2ZGNA 2CWMA 5I8TA 3NKGA 2FZ2A 1PVC1 1QJX1 1TME1 3U4XA 1DQ0A 1H2NA 3WG1A 3ZFEB 4DRVA 1FV2A 1FMD2 3ENRA 4FXGB 3A4UA 2X8KA 1DF0A 1BMV2 1WLCA 3WW1A 1JUHA 1AYM2 1HDKA 1S0FA 2AZ5A 1NG0A 3AZYA 4DZGA 4FSJA 1KJRA 1R082 3ZXLA 1YI7A 2GC1A 1QJU3 4P9IA 4MGZE 5C4WB 2BGCA 5C33A 1RTVA 2MHFA 4E4SA 1R1A1 2JE9A 1H4HA 2LUWA 3SNMA 4JGYC 2WT0A 1SBEA 3ILFA 2PLV2 4YFWA 3VDDB 3ZFGB 1Q8SA 5BNOA 4RL7A 4NWVA 2GDFA 1YLLA 4S2FA 1MS0A 1O4YA 1LEDA 2NLRA 4XBQA 1YUDA 1Q56A 1C8M1 5DDJ3 1YRZA 4YVSA 2YXSA 2ZABA 4TLFA 5H9RA 4Q26A 4IQPA 5BUVA 3WQ1A 3NV2A 1CQ9A 4Z82A 2R071 3OY8B 1AYM3 1CN1A 4YNIA 4FAGA 2VW1A 2JG8B 1LGBA 1AR93 4IEQA 4YZ4A 5BPXA 2UYAA 4HMZA 2IXIA 1VBB2 4FTEA 4ITCA 3M2MA 3PTYA 4CEYA 3V0AB 1QNYA 3J4UH 4BHPA 1FNZA 2P34A 4AFDA 3PVEA 3ME2A 2HEWF 2XJTA 3CEWA 2IZWA 4PLOA 2O1QA 3JB4C 2PLV3 3VZKA 4BE3A 2ZKNA 2DTWA 1UD1A 1VAMA 4BIFA 3ELNA 5FDBA 2EVXA 2UWBA 1RVF3 3WLUA 2BVVA 2R1BA 2D6OX 4YW2A 1AR63 1QDCA 4EV0A 4E2QA 4AG4A 1N3QA 2QVSB 4YZ1A 4XF4A 2QNKA 2N7GA 4XTMA 3RJRA 3ROUA 4AVVA 2XVKA 1I6XA 4JAAA 4WVWA 1MVEA 1H8TA 5BNNA 1N47A 3GF6A 1FXZA 2E51A 1DGWX 3O5SA 2WT1A 1DYKA 4QPYA 4Y22A 1AF9A 1D2QA 4ASLA 1E57A 4HVOA 2HWB2 4X8NA 4FBFA 1OOPC 2Y38A 4AEDA 1VBE1 3ZN4A 4BWOA 1POV3 3MW4A 3ZXAC 1JHNA 2VU9A 3MPBA 4DPNA 1MR5A 2PHXA 4AI3A 4OHYA 4DINB 3H7JA 2XKOA 3O7OA 1GANA 4JGYB 1EAH2 2WFF3 4JTNA 5ACA1 4IXLA 2GMEA 2XL7A 3CJXA 4C0HA 1AR73 4FP2A 4YM3A 1JYIA 3WV6A 1RJ8A 1COV3 4WZFA 2OZ6A 3WP6A 3FLRA 4GH4B 3KCCA 2GN7A 1RUH2 1JW6A 3KT4A 4FPJA 1G9CA 1QJU1 3JBG3 4PLMA 3D6EA 2JE7A 4K1YA 2D5HA 1QXPA 4HN0A 1QDOA 4FP3A 3VZLA 2YC0A 1U0AA 1YIFA 2UYBA 4HANA 4X6QB 4XF0A 2CGPA 1Q8VA 1K5MA 4Z2WA 3TWIA 1QNWA 1SBDA 1LKNA 4OHWA 4CDWA 1V9U3 5DDJ1 5BXXA 2QJVA 3JQXA 3MEPA 3AFGA 5CB7A 4LBLA 1XE7A 2MEV2 2PFWA 1W6NA 1FMD1 1GLHA 1O5UA 2NMOA 2Y0IA 1BMV1 1JYCA 1NXMA 2WIIB 1S0BA 3O12A 1AYM1 2HWE3 3IDCB 1VIWB 4UW6A 3VGIA 4JDOA 3I8TA 1R081 3R0RA 3OYWA 3AM2A 2EA7A 4KGQA 4QPIC 3GHMA 2NM1A 4L2NA 4QPGC 1AUYA 2H6BA 4XJUA 4Y4YA 3GZAA 3DKWA 3ZFFC 4GMP3 1B35A 1UZYA 2PLV1 3AYDA 4SLIA 1KDKA 4Q4W3 5GLUA 4AQ2A 2R0FA 4YZ5A 1H1MA 3N36A 1RVF1 4FO9A 1OOPB 4RQPB 2NMNA 3VKNA 5L7OB 2RJKA 3W9AA 2VY0A 4I0BA 1YFYA 4LBOA 2GN3A 4CP2A 1FNYA 2D6KA 4BYYA 3BODA 3VZNA 4LBNA 5C8WA 4XEZA 4EN0A 5CU1A 1OFSA 3RMYA 1SCRA 1BKZA 5DZEA 5FQ0A 3LCPA 3GZTB 1V6IA 1NA1C 2GAUA 5LRRA 1RUF2 3B02A 1HRV2 4RD7A 3TB0A 2Z69A 5E88A 4JTOA 3N7JA 2PQQA 2I2SA 2HWD3 3SCGA 1ZA4A 3PVBB 4GB33 5J3UA 4ZXKA 3VKLA 5JOZA 2PTMA 5JMCA 1GYKA 1YO8A 5IT6A 5BNNC 1RUI2 4MXWA 1HW5A 1RL3A 1BVVA 2FHRA 1POV0 3AXEA 1V6LA 3RYKA 1BZWA 1RUE3 1JUIA 2DVFA 4XJWA 2JJ6A 5C8CC 4AK3A 4Q4V3 1XE8A 4B4PA 3IDBB 5FLIA 1W6MB 2P3JA 1ZRDA 4K40A 4AEDC 3IDEA 3AP6A 1HRV3 5IK5A 5LEKA 1NCQC 1GQGA 1LU1A 3NVCA 1H30A 2HWB1 3EBRA 3CJIA 4PDWA 1HV1A 1CAXA 3VBHC 4LBKA 3ZSEA 3UJOA 1AYN3 3OBRA 4Q0PA 5D8AA 3RI9A 3FJSA 1G9FA 3WP3A 5BY5A 2X5IB 3UKTA 1J3QA 1GQHA 1NQJA 4META 1PO23 4NVPA 2XGXA 4OHVA 4XXAA 4RHV2 4Q4Y2 3SLIA