1G8YA

Crystal structure of the hexameric replicative helicase repa of plasmid rsf1010
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
262
structure length
242
Chain Sequence
ATHKPINILEAFAAAPPPLDYVLPNMVAGTVGALVSPGGAGKSMLALQLAAQIAGGPDLLEVGELPTGPVIYLPAEDPPTAIHHRLHALGAHLSAEERQAVADGLLIQPLIGSLPNIMAPEWFDGLKRAAEGRRLMVLDTLRRFHIEEENASGPMAQVIGRMEAIAADTGCSIVFLHHAVLVDNIRWQSYLSSMTSAEAEEWGVDDDQRRFFVRFGVSKANYGAPFADRWFRRHDGGVLKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the hexameric replicative helicase RepA of plasmid RSF1010.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords REGULATORY PROTEIN REPA
total genus 70
structure length 242
sequence length 262
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2000-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13481 AAA_25 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g8yA00
1NBME 2AN9A 2IW3A 4IVPA 5AR1A 2WWIA 2Q3MA 1Z2CA 4C0JA 2G83A 1G6OA 2A5JA 2PT5A 3CNNA 3VR1A 4DDWA 3P4XA 4M9XA 4P4UA 1LS1A 2RGDA 2ZSEA 3OEEA 5LBIA 3LW8A 1E1RA 1G8HA 2NO1A 1RJ9B 2VQSA 3ZZTA 1F60A 1LNZA 2GZHA 1QHXA 2FWRA 4QJ3A 2GWHA 2BVNA 1CTQA 4PC1A 5EXTA 3UWKA 1SXJE 3THYA 1Q57A 5M04A 2VP5A 4DLUA 4X8MA 1JAIA 3L2OB 4Q19A 3Q85A 5EQTA 5KDLA 2ATXA 3IQWA 4BECA 1I4LD 1GL7A 3H0KA 3THWA 2V4ZA 1ZBDA 2BDTA 2RB4A 1D2EA 2ZR9A 3CWZA 4UNNA 1E2FA 2FX3A 4R98A 2EQBA 1N5LA 4F38A 2AX4A 4HDCA 1IONA 4C7OA 5D3MA 1C1YA 5SZJA 1XEXA 2GJSA 5JEDA 4ZKDA 3TSZA 3O8CA 3KXIA 3T35A 4LYHA 4V0KA 2IXFA 1FZQA 2GKSA 1E1RD 4XSGA 3I1FA 4HUQA 5DGXA 1XTSA 2R8RA 1NJGA 1VPLA 3TUZC 5TXGA 4QOSA 3CNOA 4ZCIA 2FG5A 4BQSA 2E1RA 1BO6A 3BRWD 3ZQ6A 4KFSA 1XTKA 3V9PA 4HLQB 4BFUA 4BUJA 1GAJA 1GDDA 1GL9B 1M7BA 1AS2A 1IXRC 2HLDA 2QP9X 5AK0A 4DWJA 4XJXA 1MOZA 1Z63A 2CHGA 2ZAOA 2PMKA 4LHXA 2WWYA 5IF9A 1E79A 1RRFA 2Z6VA 3QUSA 2FNAA 1QHIA 1UEJA 2C9OA 3LBHA 2A5GA 1N6PA 4MYHA 3OFNA 4FMCF 4FN5A 1OF1A 5DHAA 4YQFA 3FMPB 2VPPA 3KFXA 2WWFA 1G4UR 3THXB 3Q5EA 4RJLA 2WJHA 3M0EA 5HZHA 1RFLA 5TVKA 2OILA 4HAVA 5HZKA 5JLJA 1CJKC 1UKZA 4GOXA 4L16A 1QHSA 1IN7A 3OEHA 1G5TA 4ZI2A 3KQHA 3SR0A 3K09A 1OYYA 2ZI4A 5G53C 4QNMA 3TQCA 3ZDQA 4CIDA 4HLUA 4C0LA 4DCVA 5CK5A 3DL0A 1KI8A 3K0FB 4OI0A 3WYGA 4C0AC 4RCZA 4DJTA 5KU1A 4LPSA 3VAAA 1X1SA 1WQ1R 4FXPA 1SKQA 3OF5A 2AFHE 5EP1A 1E79D 4B71A 3U4QB 2AR7A 4M1TA 4LC1A 1ZW6A 1BYIA 4E5UA 1NN1A 1UDXA 4XWOA 2IYZA 2ODWA 3SBEA 2CL7X 2HV8A 3CZQA 2ZE5A 1U99A 1ZJ6A 4PHHA 5B30A 3RDPA 1JJ7A 2R44A 4UNSA 2BHRA 4B3XA 1PZNA 1NVXQ 1E1QD 4G01B 3OE7A 1Q1ZA 3P1JA 2Z0MA 4KVAA 2O0KA 1KSHA 3QVUA 2O8BA 2VTKA 3DM5A 3B13B 5IRCD 1N0WA 2OT3B 4JIMA 1P2SA 4BLTA 4BE7B 2Z83A 2Y8EA 1VYTA 4A0HA 3K09C 5IK2A 4U7DA 1FQJA 2V8OA 3VR6A 2XSZA 1TUEA 3I61A 4KFRA 2C5LA 1RIFA 1OKKD 1N6RA 2KI5A 4ESHA 1TF2A 1HT1E 2BBSA 3NC1C 2OFXA 2QSYA 4IDNA 5FR2A 3AGQA 3MJRA 1L8QA 4Q1DA 2O52A 2ZRIA 1EFCA 1NJFA 1NVVR 4HYYA 3W6OA 2PZGA 4G5RA 3GLFE 1W48A 1P73A 1WRBA 1T8UA 1P60A 4A2PA 4KYUA 5J4VA 1TQ2A 4KJZA 2V1UA 1GOTA 3QBTA 2ORVA 3B9QA 1YJ5A 3LLMA 1US8B 2C99A 3K70B 3RAPR 1ODFA 1CJVC 5K8IA 1QDEA 3EC1A 1U9IA 3KKMA 4QGAA 3SBDA 2IEYA 2L0XA 4Q01A 1C4OA 4C9BA 3KXKA 2F43B 3SNHA 3DO6A 2H18A 3KTAA 3M4YA 4TL9A 3TKLA 5BWMA 1DG3A 4YMUA 4DVGA 4KV9A 1I4DD 1Z29A 2BEKA 4DLZA 4B32A 2F1RA 3TNFA 1NG1A 2RGXA 1QZXA 4RCYA 1EFUA 3CRMA 1EFTA 1P9NA 4Q7MB 2ZJ5A 3RS7A 1W0JD 4TYNA 3ZJYA 3TQFA 3O8RA 1KDTA 1GIAA 3T15A 4HUTA 4CVNA 2HCJB 3GP8A 4DRZA 3LBIA 4KVGA 2FSHA 2EW1A 1VTKA 3REGA 5TV2A 3W8NA 1ZRHA 5CIQA 3F8TA 1FP6A 5FUWA 4PQRA 4JLMA 2KBEA 3AF0A 4W5HA 4C0SA 1JEDA 5HE9A 4C0QC 4TZ6A 4LHZA 4TLCA 2G9NA 2P5TB 3PJRA 4US2R 2CL6X 3F5FA 3IPYA 1XTIA 4BLRA 2V1XA 1QHHB 1CR1A 1VHLA 3B8HA 1KKLA 5FOUA 1G8PA 4UKDA 1KSGA 5IHPA 1W46A 5HTKA 2A5DA 3LA6A 1LF0A 3LWNA 4D80A 5D3QA 3KUDA 4A0RA 3L8YA 2FSIA 2ZPTX 3IQXA 4B74A 2YOHA 2UZIR 2FMXA 4DCUA 1RZ3A 2W6JA 1XEXB 1ZP6A 4JLBA 1AZSC 2GVDC 5BXQC 3CF0A 4XVUA 4JLVA 3U7EB 3ZQJA 5AWFC 3RWOA 3U7GA 1DAMA 2BCGY 5DNYB 4MQBA 1NY6A 1UJ2A 3KQKA 1IQPA 1LS6A 2EWVA 1P61B 3THWB 4ASUD 5CDFE 3C7KA 4Q48A 4NDZA 4JZKA 3BWDD 2JDIA 5F2EA 3FDIA 1FX0A 2HEIA 4B75A 4R2IA 4A6XA 5JI3E 3QXHA 2GETA 1HH4A 1KO4A 2C9YA 4EPTA 5J4LA 3ADKA 1R2QA 4MRRA 5A4JA 1DOAA 2QMHA 3KKNA 1G20E 2JJ2A 4Y0VA 3EA0A 3AF3A 1XWIA 1S3GA 3G0HA 3GD7A 4B35A 3NDBB 4UXJA 1QHNA 1YRBA 4GOKA 1TQDA 1W4RA 2W6JD 4DDTA 3PVSA 4QHSA 4RZ3A 2F9LA 3CR7A 3NBZC 1G1MA 1COWA 2J3EA 4M1OA 4EQ6B 3C15C 3EIEA 2ATVA 2O8EB 1DARA 3LD9A 3NBFA 4IDOA 1U90A 4FMDB 4LY6A 1WP9A 2LWIA 4GPTA 3QG1A 1P5ZB 3GLHA 3MWYW 1X8JA 2IYTA 5FBLB 1NVUQ 4KU4A 2QAGA 4I1OA 3TW8B 2C8VA 3X2SA 1DAIA 2VYFA 1YR7A 3IIMA 1NG9A 4AI6A 3BORA 3IIKA 1WBDA 1J90A 2IX3A 3RS5A 4NH0A 2D62A 1U2RA 2H7VA 4WAUA 2ZRLA 3QI2A 5FI0B 4RD6A 1J2JA 1H8HD 2ZR0A 5DYGA 1CU1A 2WZQA 4LWZA 4CDGA 4Z51A 2QPAA 1CJMA 1H65A 2ZE8A 4TMTA 1CULC 3TRFA 2OLJA 4NONA 1UFQA 4ITRC 1TEXA 2ZXUA 1E69A 2C98A 2OE2A 3DMNA 2J1LA 2V7QD 2FN4A 3BBPA 4KODA 1XPRA 3QKUA 2FU5C 2ZJBA 2J41A 1XCPA 1Z6YA 4TMWA 1LW7A 2KWIA 1SKYB 3R8FA 4D82A 1L7VC 1AGPA 4M22A 2W2TA 2GK7A 2FSFA 5DLQC 1FFHA 3B60A 1IN4A 1R10A 4CEJA 3I32A 3JZAA 4TN1A 1XX6A 4XH9B 2LKDA 2XX3A 2WHXA 3N2EA 5FPYA 4QXAA 4LK2A 3GLGE 2EFDB 3TIFA 5FPHA 5B58C 1G7CA 4M0LA 3R7WB 4CZ2A 2BEJA 1MR3F 3AF1A 2ZE6A 2AKYA 2QGNA 2FZ4A 1IOZA 1HURA 1U8ZA 1VG0B 3GEEA 4XD7A 2XGJA 3EARA 2ZJOA 4NMMA 2QAGC 5K8LA 1FL9A 2Z4SA 4FW9A 4R9UC 1SXJC 2IYSA 5FOVA 3U5ZB 2G3YA 1EFRA 1Z6XA 3EZ7A 4QHTA 2VHCA 3AF4A 3CR8A 4Q7KA 3AKEA 2GNOA 3H4MA 2JLQA 2FV8A 5G40A 2EVWX 2H16A 2XOKD 2HUPA 3SYNA 1W4CA 1MRSA 4XOIA 3GMTA 2IUSA 3IHWA 2GBLC 3X1ZA 4AK9A 3THOA 2Q3HA 5DN6D 3PV0A 4GRAA 4HZUA 4LUCA 4JLNA 3U3OA 1D9XA 4OQFA 2J0QA 3CW2A 4P0TA 3CLVA 3NEJA 1QVAA 2P3SA 4MKFA 2YWHA 1XD2A 4JVSB 3EWAA 3UIEA 2A2ZA 3WHLA 4B3CA 1UDWA 3CPEA 3PQCA 3A4MA 1JJVA 3G82C 4BGDA 2ZI5A 4G3XA 2NZ8A 3CZPA 2FGJA 2CJWA 1UBEA 1GM5A 1Z0IA 4XWKA 5JSZB 3IGFA 1BH2A 3QEJA 3BB1A 1CS4C 1ZNZA 4Q4HA 1NN3A 4TT3A 4B2LA 2JASA 4AKGA 1PUJA 2W58A 3W6PA 2IF0A 2PLFA 4BZQA 4EPVA 1MO6A 4JYBA 2ZJ8A 4JLKA 1OB5A 2REBA 5HR5A 2QRNA 3LFUA 3CF6R 5CM9C 2HYIC 1F3OA 4DEXA 4E22A 4QBIA 1NBMD 3BOSA 3CWQA 4YONB 4B2IA 1OV4A 3LH5A 3OAAD 2CJWB 2ZU6A 1RRGA 3LVRE 4IOKA 3BIFA 3GEHA 5BW8A 4RSGA 4PSAA 4C2TA 4IHQA 5IDVA 3BFXA 4WIAA 4G0NA 3U7FB 5HKKA 1E4YA 2HLDD 2ERXA 4BLQA 1M8PA 5AUPB 2REOA 5SZKB 3DEFA 1LB1B 1W44A 2IUTA 4MYCA 3K70D 1XNJA 2GJ9A 1PLKA 2IYYA 4PHFA 221PA 3LAWA 4DHEA 3L0IB 3A6PC 1AM4D 4KCGA 1ELOA 1A4RA 2GZDA 2B21A 3IBYA 2QM8A 3CNLA 5FTMA 2CCKA 1EFRD 3K0AB 3O47A 3VNVA 1KMQA 1I4TD 2BV3A 3RSLA 3QQ5A 5DI3B 2WVJA 1KI6A 1IN5A 1GTVA 1X8KA 4BRUA 1NVWQ 2GTPA 3I92A 2VP2A 2JLZA 2VP6A 3RSOA 2JJ1A 1GVNB 4RD4A 4RKEA 2ECKA 3P26A 4II7A 1VCOA 2GZAA 1JR3E 1S2MA 1HY3A 2AFIE 3HDTA 2ZM5A 4KBGA 4CEHB 5L3RA 1Q20A 2QT0A 3MG9A 4L5BA 3EAQA 1UPTA 2ZRMA 3AV0B 4TLEA 2DHRA 1PLJA 2C95A 3X1DA 4PZZA 4F91B 4I4LA 1E9FA 4TTPA 1M6NA 3GLIE 2DFTA 2AL7A 2LCFA 2DFKB 1YZTA 2EFHB 3GLFA 1II9A 2ZETA 4LBWA 3WNDA 5DISB 4TYQA 1KJYA 4QM7A 4TQAA 1P2UA 5EP2A 4MYTA 4QL3A 3MJHA 3R9IA 1P9WA 4M1MA 4JVNA 521PA 5KOYA 2XZOA 1VCIA 1G7TA 1DTSA 5ELXA 4IDHA 2A30A 4D26A 3ADCA 3U44A 3L8ZA 3FMFA 3F0TA 4LJYA 3GPLA 4RD0A 1KTVA 2ZI7A 2ZS7A 3QPWA 1E1QA 4LBZA 3K8YA 4MDEA 5EE0A 3OE7D 2N46A 3ZZ0A 2FEMA 3GEIA 4ERNA 2OXRA 3IO3A 4BLPA 1E2PA 4PPNA 1E32A 1VG1A 1N6LA 3AEZA 1KMHA 4PPQA 2XITA 1ZYUA 4LGMA 4B73A 1G8GA 3AVWA 2CK3D 4JT4A 2ZSAA 2NO9A 4CEHA 5FOWA 4CEIB 4TQUS 1CR0A 2IF2A 1KO7A 1G291 1NBMA 4US0R 1MABA 2P0EA 1P9RA 1VG8A 5C46F 2DWQA 2DYKA 5FTJA 2FA9A 1KI2A 1Z6GA 2RGAA 2PT7A 4KFTA 4MGIR 3JVVA 4I1UA 2C78A 4B6EA 1XRJA 4MUAA 2VO1A 4NCIA 3ND9A 3GLGB 4EPRA 1JR6A 1IJEA 2ZJAA 4EFNA 2F3TA 3CRRA 3MAAC 3AVQA 4HAUA 4M8NE 3KQUA 1HUQA 1UBGA 2UVQA 4A9AA 5DSZA 1E6CA 3NH6A 3CIOA 1EXMA 1QRAA 2VH5R 4Q18A 2IWHA 2H17A 5AJWA 1XTRA 2IYWA 2QPTA 3BXZA 3A4NA 2P6RA 2V7QA 1SQ5A 3V00A 3CRW1 3AUXA 4FINA 4Q9LA 2RGGA 1DAEA 3GJ6A 3WMFA 1ZMXA 2D4HA 2YWGA 3GJ7A 4KITB 2ODEA 3KKPA 3Q72A 1GRRA 2J7KA 3MFYA 3REFA 2VEDA 2FFAA 1YRAA 4OYHA 2R62A 4MA4A 4KO8A 1F2UB 2FPKA 3VMFA 1NLZA 4PAOA 1CRQA 5L3QB 4HLDA 4J0QA 4B2PA 1KI4A 2BBOA 1FQKA 1NKSA 1YHNA 4ON9A 3ND8A 4F92B 3FHTA 4JVMA 5E95A 2VBCA 5K8TA 3U6KA 4Z8YA 3FKSA 1GRNA 3TW4A 5E7IA 3KKOA 2V6IA 4IFEA 1JNYA 2PL3A 4H1UA 2R6FA 5CM8B 1Z22A 4MYUA 1YZKA 2Q9AA 1EX7A 1US8A 2J9RA 3OIWA 4IVQA 2FJUA 4IOJA 5FTNA 4LJ5A 2YNMA 1CIPA 2GCPA 1HYQA 4HUQB 3G5UA 1KK2A 1QF9A 3C41J 1II8B 3EZ2A 4GMXA 4YMVA 4PC3A 2A5YB 3RNLA 1FTSA 5JRJA 5LD2B 3AVVA 4L15A 1K5GA 3BS4A 2NO7A 1IN6A 1FPMA 3BAFA 3WRYC 2R6CA 2D7DA 4HLCA 4NYIR 2F3RA 2O0JA 1JR3D 2YKGA 5DIFA 1JBKA 3RRYA 4YXWA 2QTFA 3P27A 3Q3JB 1Q44A 1FUUA 1KGDA 2QZ4A 2R6GA 4OK3A 5EE3A 3KUCA 4S2EA 2CL0X 4BZXA 2VIIA 5TARA 5GVSA 1SVLA 2QMUA 3A1WA 3MMPA 3Q8XB 3EX7C 2C03A 1AA9A 1WE2A 1FNMA 1XJ0A 1LF5A 3NKVA 4URUR 4MRPA 4DB2A 4H9GA 5GJWC 5FOXA 4B3BA 5LDDC 2YJTD 1UKEA 1V5WA 4DZZA 4C0HA 2HF8A 2ZRBA 1G9XA 4GZLA 3ZVMA 3EA5A 2ORWA 4TL8A 2OBLA 1OLOA 4TQ9A 2W6ID 3QNUA 3A1SA 4NCJA 4POAA 4UJ5A 2NZJA 4MGZR 1OJLA 4AG5A 2AWOA 3SQWA 4C0KA 3GFOA 4ZI3A 2EFEB 1J7KA 1Y3AA 2KE5A 4KFUA 3RVBA 1RW4A 4JL6A 1X6VA 1KYIA 2Z5FA 4I99A 1G8FA 2VSXA 3N2IA 3VU9A 4PSKA 3GQBA 2J7PD 2RKOA 4P32A 2AD5A 2G6BA 2GHIA 2NGRA 4Q7LA 5GVRA 1OFUX 3VR4A 4O25A 4CT5A 2IS1A 2ZUCA 5F3WB 4IKEA 3H2YA 4I1SA 5FL7A 4GDFA 3I5XA 5TDHA 2OCPA 5KDDA 1TTTA 4WXRA 4R71A 2HCBA 2IHYA 4DCTA 1GFIA 1M1YE 1T0HB 1N5JA 4CT4B 1E2QA 2FF7A 4U02A 1GKYA 2GXQA 4N0EA 2V6JA 3QVVA 3NDPA 1OXVA 3SS8A 2WBLC 4D4JA 4CGZA 1YZNA 1TUIA 4YMSA 4N1AA 4JLPA 4L9SA 1XMIA 2RCNA 4GOJA 1AN0A 4M9SA 3VKWA 1X3SA 3W9YA 5DYIA 1KSJA 3IEVA 1OFTA 2QI9C 4M21A 1ANKA 1RYFA 4JLOA 1Q3HA 1OH6A 3FE2A 2ZANA 5AUQA 4XVRA 2ZRKA 3K9NA 4AYTA 1KK3A 5FFMA 1K5DA 4K46A 5KO2A 1FMJA 1MRNA 1ZUHA 1OH8A 2OXCA 1M7GA 4QBFA 1R8SA 2OSBA 2ZSDA 3PEUA 2I1VB 1DBSA 2EU8A 4TYWA 3KB2A 1LV7A 1SVKA 4RD1A 4HLUC 4TMXA 2B8WA 2R6AA 1W5SA 2CCJA 2WM9B 3UMFA 4JKYA 5FPSA 2R2AA 3NG1A 4HDQB 2XTZA 5CB6A 5JECA 4A6PA 1NVVQ 1ZM3A 5KNBA 1T3HA 4BPBA 2H92A 1AIPA 4YXWD 3NIBA 2IS6A 2HF9A 4NL4H 3VX4A 4C7OB 4LCBA 2OV2A 5H8WA 1JQLB 4HSEA 2ZROA 4TYPA 1N0VC 1UF9A 2QE7A 3QF4A 2XEXA 3QF7A 4NPHA 1BMFA 1VCMA 3PEVA 2O8BB 4OQNA 3T1QA 4PFSA 4EJSB 3MSXA 1NLFA 1UADA 3AVPA 3EZ9A 1G3UA 4AWXA 2AD1A 4MDFA 3PFIA 3PG5A 3ZD7A 5J4YA 2A3RA 1TQ6A 4DUGD 4M1WA 1N6HA 2BKUA 3QF4B 3ZD6A 1QG2A 1CR4A 1KI3A 2HJVA 4FI3C 5EE9A 4AYWA 1XZPA 3AVTA 1JI0A 1RJ9A 2YZ2A 4Q1CA 5P21A 1KK1A 3AF2A 3MWJA 4IXMA 1S3SA 1IHUA 2XJ9A 4V02A 5AJVB 4PX9A 4GP7A 2ZQ5A 1ZINA 4Q1BA 3W34A 1WB9A 2ZUDA 3W5IA 2PLRA 1CP2A 1LY1A 5H1YA 3K0FA 2CE2X 2EYQA 4PSVA 5EXPA 1W49A 5CIWA 1XEFA 3U2QA 2X1VA 1W5TA 3B1WA 4IFBA 3TBKA 1E9BA 1G5PA 3AP1A 3I8XA 3EG5A 1GP2A 1W0KA 1M34E 1TNDA 4TZ0A 4LV5B 4DLRA 3JZMA 3KB1A 3VFDA 3KJIA 2PEZA 5CK4A 4GBMA 4NCNA 5EE1A 4PC6A 2W83A 4A92A 5KSYA 1P6XA 1QBKC 3RRMA 3F3YA 4HB3A 4O2RA 1GITA 1ONBA 3AVXA 1QHYA 1U8AA 3NBXX 1I2DA 2AXNA 5E7MA 1N25A 1ZC4A 1Q3TA 2VA8A 2V9PA 1Z07A 3U3KA 2X2EA 4E09A 4URWR 2XTMA 2JLUA 3KQLA 1OKKA 4LYJA 1HV8A 5KTYA 2G0TA 2RMKA 1Z2AA 2WV9A 2WKRA 3HR8A 4KHZA 4NYJQ 4DCSA 1XMJA 2P65A 3KJHA 4ZIRB 3PENA 2OESA 3QXSA 4D0GA 1KI7A 1TF7A 2J0SA 2JEOA 4QRHA 5L3SB 1E96A 1S1CA 2QORA 3QXCA 4ZO4A 4EQ6A 1NSTA 1YKSA 1IAQA 1D2NA 1KO1A 1T6NA 3LXRA 4ARZB 4L4UA 4IVRA 1O87A 5J4HA 3VR3A 3RS3A 3V4FA 3AVOA 3I8SA 2RHDA 4CEJB 4RFVA 1W36D 2VHQA 3B9PA 2JAQA 4WZBE 1Z0AA 1VMAA 4ILEA 5LPNA 5EXSA 4HAZA 1MO5A 3T5DA 1EG7A 3UG7A 1ZM4A 3W3ZB 1KO5A 1BIFA 1ZCAA 4UNQA 2WJYA 3GLGA 4Q4JA 3W3AA 3TVTA 4JKIA 4DLXA 1GKIA 1KY2A 4D6PA 2PJZA 3GLHB 4BFSA 2WJIA 1S0UA 4V0LA 1LTQA 1SXJB 1NP6A 2ZS8A 3RLFA 1KDRA 3FOZA 1SXJA 4TSFA 2RGEA 1G3QA 1XMSA 4KBFA 3TK1A 1SHKA 2BMJA 4HEJA 1Z28A 1E2LA 2ZRHA 3T12A 1E94E 2XB2A 3TSOA 3QE0A 1GNRA 3QIAA 2HT1A 4BEBA 3LY5A 1E0AA 3FHCB 3ZS9A 4QKQA 1BYUA 1F6BA 2QN6A 2J59A 4HI0E 5C4GB 1D6JA 1ZIPA 2WPDD 4BZPA 4MUBA 4MITA 4DLTA 5J47A 2WIBA 2VHTA 2X19A 2RH5A 3PUZA 3OIYA 4HB2A 3UXMA 4B44A 4BFYA 2WAYA 3QKRA 1JAHA 3FFBA 3X1YA 2HYDA 3MLEA 3C5HA 2PZEA 2V3CC 4A0FA 3SJZA 4NTZA 1KAOA 1KAGA 4OBEA 3E2IA 4Z1MD 2QMOA 4OQLA 4TSFD 1XTJA 4C3ZA 2V55B 3GJ3A 2O8FA 2O8DB 1Q1QA 1K6MA 5FBRB 1PUIA 2Z43A 1G19A 4P4TA 4A0GA 1W4BA 3PUYA 2G88A 3FYHA 3LBNA 4E03A 4PAQA 1DO2A 2QRZA 1Q22A 5LB2A 3U61B 2IEZA 1R8QA 1RVDA 2DY1A 2A7QA 1TADA 3NEYA 3MUFA 5C4MA 2O0HA 5CJPA 4KSCA 2F1IA 4PZYA 4XWAA 4JVLA 5SZIA 5CLLA 3TVDA 1G18A 4KSBA 2F1JA 2OLKA 1DAFA 3QG5A 4GNKA 2WAXA 1Z6AA 4TT3D 5FBQB 4IRUB 2BBTA 3CPHA 2VHJA 4PO1A 5BQ5A 2OCAA 2ZTSA 5EP3A 4DKXA 4D4LA 1F2UA 1G21E 3OHMA 2YV5A 2D2FA 3P32A 4OI4A 2XB4A 2KSQA 4P4SB 3U3JA 1XJQA 4DLSA 5K8UA 1JXOA 3CRVA 4DT1B 1ZU4A 1R0ZA 1JQJC 5JWOA 2AK2A 1KDOA 4LDJA 4QHYA 1E99A 2VF7A 4R2HA 5CJ2A 3NTUA 2GEVA 1O3YA 4TLBA 2I1QA 2CLCX 3TSWA 2C77A 3WBJA 4S35A 4UNRA 3BE4A 3IEUA 3B78A 4OJKA 3I4LA 4TTQA 1FUKA 4JBXA 2WTUA 1Z0JA 4R7ZA 5AJZA 4GSYA 1OFHA 4UXIA 5JJLA 1ESMA 3UANA 4BFTA 1E9SA 2AKAB 1SKYE 2WKQA 1YZUA 1KHTA 4DLYA 3J81k 3AVYA 5JHHB 3TR0A 2J45A 4A36A 4NU0A 2C96A 4ARZA 5F9HA 5GJCA 5FH9A 3B1YA 1AS3A 2BOVA 1W47A 3RC8A 4YMWA 4Q9JA 3C16C 3LVQE 4KLZA 5JWRA 2IYXA 3ZGXA 3BFVA 3SHWA 3GJ0A 2VLIA 1T9HA 2BMEA 3C4JA 3HR7A 3VHXA 4XIGS 1NNEA 2XZLA 1U8YA 4TLDA 4EAQA 3UKDA 1A1VA 4ZDWA 4YLGA 4LJ6A 5KSOA 4FCTA 4B3DA 3RS0A 1BKDR 1KK0A 3EZ6A 2AK3A 2JIZA 3GCGA 5JBQA 2J0VA 1VYVA 1GILA 2DFLA 1SVWA 3E1SA 3P20A 3T1OA 2G77B 3GLHE 1VKJA 5FTKA 3EIQA 4B3GA 1JR3A 1ZD8A 2FZLA 2D06A 1DS6A 3EC2A 3AP2A 4Q21A 3GLFB 4WBSA 1JXMA 1L4YA 2GCNA 2YINC 2P6UA 2XNDD 3RABA 4Q03A 2ZR7A 3GJ4A 1YR6A 3QKSB 3FVQA 1OXTA 4Q7JB 2MMCA 1HE8B 5EUQB 3TGPA 4URVR 1E2MA 1E2HA 4L9WA 5CITA 2W00A 4PO9A 1AQYA 2QP3A 4Q4AA 1DAKA 2JLWA 1JPNA 3AKYA 4WOPA 2BJVA 3ADBA 3ICQB 3UK6A 1NN5A 3RWMB 3EW9A 4PPFA 1AJEA 1H8EA 2PBRA 3WHKA 2NTYC 2VL7A 3S1AA 1BS1A 3CH5A 3GFPA 2IS2A 4LJ4A 3AP3A 3W90A 4NYMQ 1KI1A 4MRNA 1J99A 1VG9B 4JS0A 3PUXA 4PZLA 2GXSA 3D8BA 3K0CA 1AQUA 1HQYE 3O8DA 3PIRA 1XTQA 1ZD1A 3AQ4A 2BJWA 4ZCLA 3HJNA 4JT2A 5L3QA 2WSSD 3L0PA 2WICA 3PR1A 4XVQA 2VP4A 4MKGA 4NYJR 2QM7A 1PLLA 4IDPA 3AVUA 3DM9B 3WXMA 5E3HA 2JDID 3IO5A 1PJRA 3D31A 2Q9CA 4QGFA 4Q9IA 4DSTA 1OIVA 1W0JA 3T61A 2YC4C 4JYCA 2NMVA 5DI9A 2ZRFA 4OHVA 3SE0A 4N3NA 4AC9A 3KL4A 2D3WA 4CRWB 1E3MA 5G3ZA 1VIYA 1XPUA 2XAUA 4FIDA 2VP0A 3IKJA 2CVFA 1N3BA 5JHGB 1A2BA 2JJ2D 3QXXA 1U98A 3A1TA 4OKSA 4X8LA 2YHSA 4P4SA 4DIDA 1ZUNB 3U6BA 2Q9BA 4A2QA 1YR9A 2CHQA 1SGWA 2I4IA 2RGNA 3DPUA 3L43A 1IXZA 4N0DA 3OIVA 3ZYCA 1HA3A 1R0XA 3TAUA 3K0CC 1NRJB 2DWPA 3HU1A 5IK2D 1UAAA 4DDVA 3CUEF 4EJSC 1Q0UA 4AD8A 1N6IA 2GEDA 1WBBA 1HT2E 1WCV1 3ASZA 5EZ5A 2XTNA 5F9FA 5JJKA 3HP1A 1JEEA 2IS4A 1G16A 5JEEA 5DH9A 4O3MA 2OAQ1 1EWRA 3A37A 2GK6A 3GLIB 1A82A 4JLJA 2QROA 2Z4RA 5C1BA 1NI3A 2A78A 4I81A 2FGKA 1XD8A 2GRJA 4IEEA 3BJIC 5FOSA 2UZ3A 2YOGA 2QG6A 1N5KA 3HPRA 4QNRA 5JJIA 4PO8A 3FFAA 1OH5A 2D7CA 3B2EA 2DBYA 2HDNB 3L0SA 2B8TA 1CEEA 4XTCS 4F93B 4MGKR 5BN4A 5LD2C 2ZE7A 1XD9A 2OZEA 1FNNA 3GJ5A 2ZYVX 3LRPA 3Q9LA 5FUVA 1H8ED 1XEWY 4HDOB 2CXXA 3MWKA 3RHFA 4DUGA 1RPZA 5L8VA 1XMVA 4EPWA 3SEAA 2GXUA 5EXXA 2NO0A 2R9VA 1KJWA 4ACAA 2F1HA 4ACBA 3M1IA 1Z8FA 4Q02A 2IYQA 4A8JB 3IILA 4IEIA 4NYMR 2ONJA 4HB4A 3NWJA 5CLQA 1DELA 1S1MA 2ZYUX 2WSSA 1FX0B 4ZDJA 4AKIA 3FWYA 2XSZD 4CEIA 1RRCA 2B7CA 1NY5A 3ASYA 3ZIAA 4Q4HB 2FFHA 3RANA 1TF5A 1SZPA 1E0JA 1Z0FA 4Q00A 1D9ZA 3ZS8A 4BLSA 3AM1A 2ZRDA 4Q5IA 8OHMA 3T34A 5L3VA 1T4GA 3TE6A 1FOEB 1G7SA 4M9ZA 4UJ3A 1LVGA 4OQXA 4YC7A 4HB0A 4Q1FA 1T8TA 3SDZA 1KJZA 1EFHA 1W2HA 1S8FA 4OJQA 2ZYTX 3SJBA 3ONWA 2AXPA 3GJXC 2JLVA 5HPYB 2C9CA 2WIAA 4NCKA 3U4QA 3U44B 2CCGA 4NKRA 2WWXA 4EFMA 2QBYB 5KYKA 3CM0A 1DADA 1GL6A 1NKTA 3FB4A 3CRQA 4JBYA 3WYAA 4F4JA 2FFBA 4LX0A 4BFWA 4DSNA 1DPFA 3VQTA 1D5CA 4GL2A 1WA5A 2XXAA 3SU8A 4PTLA 4PR0A 2JATA 1U0JA 2FFQA 4ZKEA 4KAXA 2WKPA 3TMKA 1KKMA 2JLXA 5B64A 2H8KA 2P67A 4DLVA 2H57A 3EZFA 5CYPA 2G1JA 3H1TA 2JLRA 4JLAA 2QPOA 5FL7D 5B57C 2A5FA 4A15A 3EIHA 3D3QA 4M1YA 5EE5B 821PA 2O8DA 2ZREA 1Z0DA 2IK8A 3CONA 5E4FA 4MRSA 4JJZA 1T3LA 5DE3A 2DR3A 4PQYA 1KI6B 3C8UA 1KIMA 2CLSA 3X1WA 1J8YF 1XJCA 1D2MA 1VECA 1P4SA 4LSGA 1X8LA 3KFVA 3KXLA 3U3MA 1WXQA 1CR2A 1VDZA 1OT3A 2NG1A 5FBVB 1EWQA 1G7RA 1R5NA 4URXR 3IBGA 3H84A 2GXAA 3SJAA 2ZU0C 3A58B 1IM2A 5JCPA 2BBWA 3L0OA 4Z54A 2QP4A 1CJUC 1VYUA 5C2JB 1E2KA 5L3SA 4B43A 3DZDA 3VR5A 4PQFA 4RZXA 5FPTA 3M6AA 4LOAA 5LB4A 2WWHA 1Z08A 4BRWA 2ONKA 4W5JA 4OI1A 2OO7A 3QJYA 3TH5A 1P2TA 4QG7A 2QGZA 2EFGA 1M2OB 1ZAKA 3I73A 3OEHD 4LZZA 4NZYA 2MSDB 2W2VA 2GBLA 2MSCB 3W5JA 3C5CA 3K0SA 3B1XA 1G6HA 3PXGA 4DT1A 2CE7A 1C9KA 4WA7A 2PX3A 4DSUA 4FMDF 4W9MC 2JLYA 2QBYA 1R7RA 4D0LB 2CEAA 2FE4A 4JL5A 2FDCA 4KYIB 1CJTC 5KDOA 4C4PA 2PCJA 1XP8A 3SFZA 1K8RA 2ZRJA 3U7HB 4AURA 4HAXA 2RGCA 2OEPA 1UKVY 3LQRA 2CDNA 1E9CA 4NP6A 1P62B 3HYRA 5JS8A 1P7CA 1IY1A 2WPDA 4IOLA 4PAMA 4OHYA 4FCWA 1T5LA 2JJ1D 5TMPA 4GI7A 5A5GA 5JSZA 2HT6A 3VKHA 3WNCA 4MH0R 1E2JA 2ZRNA 2MSEB 5DHFA 5GJBA 3MD0A 2NO6A 2ORIA 2BKEA 4K81B 2REXB 2ZJ2A 3HPQA 1ZD9A 1P75A 2OUKA 2ZEJA 1SULA 1XD2B 1YE8A 3ZZUA 5F98A 2CBZA 4IJMA 4YMTA 2ZSBA 2JJ8A 4TMZA 2WSMA 5JI2E 4LJAA 1DE0A 1KY3A 1II8A 3ECCA 3D7MA 4V0OA 3SC3A 2DB3A 3JVUA 5AUNB 4XD7D 4WZAE 1ESNA 1NMZA 3WMGA 3OAAA 3I3SR 4KLNA 1E9AA 1OW3B 3O8BA 5KSZA 4FMCB 1Q1EA 2ANBA 2ZI3A 5CB8A 1Z06A 4EDHA 3E5HA 1G17A 4US1R 2ERYA 3RS2A 2C04A 3ADDA 1H8HA 1MKYA 3K9LA 1CF4A 3AUYA 1EGAA 3C14C 3FGNA 1DVRA 3U60B 2F43A 4IDQA 4RY2A 1EK0A 4LC0A 1J70A 4DCNA 3LO5A 2PMDA 1XCGB 3SHFA 1U0LA 2FSGA 4MKIA 3RYTC 4CF7A 1G4AE 4HATA 3TLXA 2F55A 1E4VA 2P2LA 3WY9A 2ZI6A 1Z83A 3OESA 1TX4B 1QG4A 1N2CE 1I2MA 3GJ8A 1A5TA 2J5XA 4QGGA 1DG1G 3BFKA 1KZGB 1XCMA 2QSZA 4NHOA 4QJ5A 2WWWA 2G0NA 4K8OA 4D25A 4JSTA 1F48A 1XXHE 2J87A 4AG6A 2ZVQX 3PEWA 3VHLB 4A1FA 2GDJA 2IYRA 1IY0A 3A1VA 1XU4A 2XJ4A 4LJ9A 5H70A 2K5UA 3B7GA 4M1SA 4NBSA 1Z6TA 1ZNYA 2QL6A 1E2IA 1XDBA 4TTRA 1W36C 3CX7A 3TUIC 2QQEA 1JALA 2X8AA 2W0SA 4V0ME 2QNRA 2E9SA 3DKVA 1L2TA 4TL6A 2RHMA 3CB4A 3ICEA 4AKHA 1ZM7A 3WYFA 1RC8A 4PC7A 1OPXA 1KOFA 3QKTA 3T06B 4MGYR 3DDCA 1R6BX 2YC2C 2QAJA 3N5CA 4V0MA 4JSYA 1DO0A 4EJSA 4OI2A 4Y0AA 5EP4A 2GJ8A 4KXFB 1CXZA 1W2GA 3EWSA 4TYYA 3DKPA 3KQNA 1AZTA 4NCHA 3I62A 1PV4A 4EIWA 3VNUA 4ZDKA 1II0A 2B92A 2ZSFA 4PPGA 1E2EA 1R5BA 2OFOA 1ZC3A 2VP9A 1G64A 2BM1A 5FBWB 3X1XA 2MMGA 4C0BA 4ASUA 1SVMA 1NF3A 1OHHD 4LHWA 5JFGA 1P3JA 4LRWA 1R5OA 1VCNA 2FPLA 3NC0C 5KSPA 3S1AB 3D6TB 5HCIA 2O8EA 4HZIA 3B85A 3L82B 3QOFA 5JS7A 1KDPA 1OIWA 2NQ2C 4TMKA 5KHOC 3CKLA 4M2LA 4GFDA 2J0UB 1KNXA 1SHZA 3SFVA 1FTNA 1VHTA 4DC9A 1XPOA 4DSOA 4AY2A 4Z8XA 1QHHA 4WZ6A 1GNPA 2E87A 2GJKA 2UKDA 4URYR 4UXHA 4B34A 1NMYA 1OB2A 2FOLA 2ZRPA 5ANRB 1ZU5A 2IC5A 1UEIA 1NSFA 4MRVA 3TUJC 2YOFA 1X86B 5IT5A 1GNQA 4LJ8A 4P3YA 3VU9B 2EYUA 1BOFA 4BASA 4LV8B 4TMVA 3DOFA 3CO5A 4AYXA 1ZNWA 1Z5ZA 1QHGA 1COWD 4IW3B 4M4SA 3EPLA 4H1VA 1N6NA 2KBFA 1MO3A 2SHKA 4A2WA 2IL1A 3T1TA 4TWZA 5H68A 1U0HC 3U3RA 2V54A 4OQMA 3FPAA 4HAYA 1G8YA 2QA5A 3SYKA 3UATA 3IHLA 2DWOA 3BD9A 5FI1B 3THXA 4NYIQ 4JJKA 4A82A 1G3MA 5KNDA 5JWHA 4X8HA 4QGHA 1E9RA 3R20A 4D2IA 4LYAA 4AKEA 3K9HA 3Q5DA 3BB3A 3BH0A 1IJFA 3FHOA 1YZGA 1P72A 4KI0A 4RFSB 2IUUA 2AHOA 4B33A 2XXAB 3QPUA 1IBRA 3QKSA 1RRPA 5AJXA 3QENA 2GF9A 1Z0KA 1Z47A 3LW7A 5AUOB 4G5SA 2IYLD 2QENA 3FKSD 2W6IA 4EUNA 2OG2A 4ZV4A 2WMOB 3FTQA 2ZITA 5UKDA 4A4DA 4DDUA 1NL3A 1WF3A 2GF0A 3FMOB 1A7JA 1U9IC 3ETLA 3ZLJA 3SQXA 4LV6A 3K70C 2WMNB 2ZJYA 3FMIA 1JPJA 4GZMA 3RRNA 3UMSA 5BYJA 3CPJB 1CRPA 3AKCA 2IYVA 1TL7C 4B76A 3HU2A 1TPZA 3KDSE 5EZ6B 3EXAA 2H1LA 2IYUA 3A4LA 4BFXA 1OXSC 1TU3A 2BCJQ 4A8JC 1F2TB 1ZM9A 2DFNA 4Q9HA 4P33A 3I72A 3ZVRA 2ZRGA 4Q66C 1NIJA 1NLYA 1Z3IX 1MH1A 4QFMA 1HEIA 1KI9A 1ZNXA 4C2UA 4FCVA 2KB0A 1GUAA 4JBWA 3WMEA 4XTRA 1JB1A 2IHBA 4YDHB 3ZVNA 5KPDA 3K0EA 4OK5A 1SVSA 2LKCA 4RVCA 1W1WA 3NHAA 2GCOB 1ZVQA 1EX6A 1U81A 2KJQA 4JLDA 4D4KA 2QAGB 2XOKA 1E9EA 4F7WA 4TL7A 2HXYA 2VSOA 2PCLA 1ZIOA 2WWGA 2OCYC 2IWRA 3MWLA 3CX8A 1RKBA 4HZUB 4U5XA 4RZ2A 1N5IA 5DN6A 3W8RA 2RGBA 2JIZD 2CK3A 2CMKA 3SI7A 4NE2A 4EFLA 1G3IA 4BWYA 2X2FA 1GZSA 1TEVA 3CX6A 5E7JA 3V4RA 2QMEA 1UBCA 1DAGA 2H5EA 2ZRAA 4WXPA 2C2HA 5EJEA 4RD2A 2ZYWX 3A36A 2RAPA 1GSIA 1R0YA 4ZPXA 2XNDA 3A8TA 3GLIA 3SZRA 3NBYC 3PCRB 4FD2A 3HWSA 3CH4B 4O0MA 2GCOA 3LQQA 3KX2A 4LPKA 5CDFA 3SJCA 4V03A 3AGPA 4WVFA 5FR1A 2PJRA 2D2EA 2B7BA 3TR5A 3CBQA 1WMSA 4QM6A 4QBHA 3R7WA 1F5NA 5KPJA 4LBVA 4EPXA 3NXSA 1Q21A 1OYWA 4OL0A 1E0KA 5A0FA 3EPJA 2QU8A 621PA 4Q4LA 2Q0HA 4M1KA 3OIUA 2CHVA 3VKGA 2IXGA 2IA5A 1GKUB 1KZ7B 2F9MA 3B82A 4B6FA 4F4IA 4PHGA 4X8OA 3FKQA 2GESA 3KJGA 1R0WA 3ZH9B 1W7AA 2YVUA 3DHWC 4V0NA 3IPXA 2B6HA 3BERA 2JA1A 2R65A 2Q21A 4B47A 4GP6A 4RFSA 3UPUA 1IN8A 2NPIA 3OEED 4G5GA 3Q7PA 4ZDIA 2GILA 4DIEA 2XZPA 4RD3A 2ZS9A 3CF2A 3AKDA 4D4MA 3B6EA 4C30A 3QY0A 4HAWA 4OHXA 2VSFA 3RC3A 4M53A 3K53A 5HKKD 4DBLC 4JL8A 1MABB 1ZM2A 4BLOA 3ZVLA 2BC9A 1XZQA 5TB5A 6Q21A 1KO8A 3DMDA 5KUTA 2GVZC 3EPKA 1TMKA 4EPYA 4FWTA 2ZVPX 2CVHA 4BEJA 2ZIAA 4BFZA 4LYFA 1W4AA 4DXAA 2QQ0A 2PZFA 2QY9A 3KTAB 5JZVA 2XNSA 2A9KA 1PVOA 3AH8A 1ZUIA 2VRWA 1E9DA 4F4CA 2ODBA 1S9HA 3LLUA 2DCUA 5J40A 3KJEA 2ASEA 2R6DA 3SOPA 3I5YA 4P31A 1F2TA 4IXNA 1N0UA 1UBFA 2J7PA 4E07A 2ZRCA 3EASA 2Q6TA 3NH9A 1CLUA 2WJVA 2CLDX 2VHUA 2O8CA 1HE1C 1S96A 2JCSA 3LNCA 4LBYA 1P2VA 2PEYA 5JMTA 4OHWA 3GFTA 4IOMA 1RE0A 4JMPA 1IXSB 2ZUBA 1E98A 1TQ4A 3QKRB 1QVRA 421PA 1KMHB 3T5GA 1OHHA 1OH7A 2Q3FA 4OHZA 2BMDA 4DLWA 1DAHA 2PX0A 1XXHB 1WDTA 3Q7QA 1G5RA 2OHFA 2P6NA 3VTKA 121PA 5G3YA 5KNCA 3P4YA 3PUVA 4GT1A 1NN0A 1T0JB 3B1VA 1UKYA 1XFAA 4Q1AA 5HE8A 3LDAA 1YQTA 3K1JA 2PH1A 3MGCA 1W0KD 1G3RA 4M9QA 2GA8A 1FMLA 2WJJA 3EPHA 2YWFA 1N6KA 1TU4A 4LI0A 5AJYA 1FW6A 2I3BA 3B1ZA 1DEKA 4UNPA 3K0AA 2O5VA 4G1UC 2BMFA 3QPVA 4I1VA 1XB2A 4LHVA 2ZI9A 3RS4A 4B3FX 3VR2A 4URZR 1T5IA 1MT0A 1XEWX 4A8JA 5EUMA 1XXHA 1E2GA 3BC1A 5C18A 1Q1BA 1X1RA 1E0SA 1E2DA 3IIJA 2AWNA 4WW0A 4Q4JB 2W2XA 2DPXA 1S4QA 1SXJD 1SVIA 1AKEA 4Q1EA 4PXAA 3IUYA 2BM0A 1M74A 1TAGA 5FTLA 2P5SA 4B48A 3LV8A 2WOOA 5FUXA 4MKHA 2WOJA 3UWOA 3ZIAD 4PC2A 2QEQA 5DI3A 721PA 1J8MF 4GMDA 4DB4A 2TMKA 1T3SA 4ZCMA 2OFWA 3QSYA 4LHYA 3TJZA 3E70C 3QXJA 4TLAA 4Q4AB 2QUZA 1OXUA 2BIFA 2IBMA 2GJAA 3AB3A 5J5CA 2W0MA 2GAAA 5GADl 4RKFA 1CKEA 2J0UA 1OXXK 3MCAA 1B0UA 1LFDB 5D3MB 1W36B 3R8CA 4PHTA 2OBNA 2ODNA 1XF9A 1YU9A 1HQCA 3UMRA 3WP1B 4EKDA 4G5QA 3NVAA 3KZ1E 4Q47A 1YZQA 2VF8A 4LJ7A 1GG2A 1NMXA 1YZLA 1ETUA 1MV5A 3QEOA 1UM8A 2OAP1 3B5JA 3HU3A 4D0NA 4Z1MA 1SVOA 3VX3A 1M7HA 2JGNA 3PEYA 1AK2A 2D74A 3PITA 1B23P 4QJ4A 3BH7A 4Q9KA 4AIIA 4PANA 1AS0A 1OFIA 5B2ZA 5FL3A 4ABYA 2NOAA 1EESA 1YR8A 3HYTA 3LX8A 3BH6A 4FWIB 2GEUA 3WBKA 4W5WA 1E2NA 4RZUA 3WRXC 2O8FB 2BWJA 1OSNA 4YDSA 4QC2A 3N70A 1KNQA 3NHBA 5J4KA 2JLSA 4O2LA 2QTHA 1Y63A 1OIXA 5TY0A 1VIAA 1V43A 4CYMA 1OE0A 4U00A 2QE7D 3KKQA 4ESVA 4L8GA 1BMFD 3PUWA 3RRZA 4BFVA 1A2KC 3TAHA 3MRSA 1S9DA 2CNWD 2FH5B 1GWNA 1RYHA 1T91A 3BK7A 1D8TA 3IDQA 1ZCBA 3SN6A 4QBGB 1HTWA 1KSFX 1AKYA 1IY2A 2O8CB 2YYZA 1CBUA 1G41A 2EFCB 3A1UA 3K9GA 2OBMA 2IXEA 5SZHB 3WNBA 1JECA 4D81A 4ZIRA 2OM2A 2NPFA 4DEYA 3THYB 2FPMA 3LX5A 1GRQA 5HCNA 2IT1A 2QTVB 3LXXA 3BB4A 2J46A 5FPKA 2N1BA 1N6OA 3T1VA 3DVLA 1Q12A 4FMBB 3H86A 2HXSA 1U94A 2OCBA 4UQOA 5GJVC 1AGRA 1MO4A 3R9WA 2GAOA 3UG6A 2HJGA 2G1KA 5FOTA 3QBVA 2NIPA 2FEOA 1YVDA 3WP0A 1FP7A 5JRZA 2ZJZA 2CNWA 4OK6A 2N42A 4G5OA 4XSHA 2EWWA 2F6RA 1R4AA 3BGWA 5JCZA 2QT1A 2ZAMA 3R9XA 2X77A 3DZ8A 3OFND 4CW7A 3SYLA 2YWEA 2RGNC 4W7SA 5CYOA 5G41A 2F7SA 2ANCA 5DO9A 5BN3A 1XBTA 2WJGA 5FUYA 3W6NA 1NIPA 3OZXA 3DOEA 5BN5A 1L4UA 5BYKA
chains in the Genus database with same CATH superfamily
1NBME 1UMBA 3F96A 3SBOA 4Q15A 1A4IA 1QFYA 2AN9A 2OV3A 3EMBA 4FDAA 4HCJA 4WZAA 4ID3A 3EGOA 3BGDA 1QH8A 5M29A 4E1BA 1JQEA 2A5JA 2FUKA 4ISCA 2YJNA 4L5YA 2OAEA 1W25A 2J9XB 4P4UA 3ZDFA 1LS1A 1PZFA 2PGAA 2J3HA 2AVDA 3U4DA 1HOTA 2W6MA 4JP2A 5M34A 4UMFA 1G8HA 1C2YA 2NO1A 4J49A 4OTZA 2VI5A 2QTRA 4GQIA 3R0XA 1TO6A 1LNZA 5REQA 3AY6A 1WF6A 4ZJUA 2FWRA 4AKSA 4IIJA 4KAAA 4WA8A 5EFOA 3FGPA 4QJ3A 1F2VA 1UXKA 1CTQA 1MPTA 3WICA 4PC1A 2H4ZA 2P2YA 4DBLE 2G5PA 4KWIA 3PHBE 1UP6A 2BEVB 3DOJA 1Q57A 3IODA 4CLXA 2IZZA 3THYA 4R1PA 2VP5A 4DLUA 1TLFA 1QUFA 3I53A 1UAYA 4FFDA 4G2TA 3WR5A 4D3DA 4WBNB 4BTEA 5C51B 3Q85A 3OZSA 3QVWA 3JCZA 3P52A 4UU7A 5K3CA 5LZ8A 3VJKA 1OZGA 4PLPA 2V4ZA 1ZBDA 2RB4A 4UMVA 5A1TA 3C6KA 2WDPA 3LKZA 5CCEA 1LQ2A 2C5BA 4L28A 2I6GA 1DQRA 2VNIA 1GAWA 4QUIA 4EHBA 1EINA 2INGX 4IIXA 1LI7A 5DCLA 2UZ1A 2GD2A 4GAEA 4HDCA 4OV6B 5LA6F 2BFBA 2OPHA 2MIIA 5AI9A 3RF7A 1SIBE 5D3MA 1XEXA 2HBYA 4ZKDA 1XLWA 4LKRA 1F06A 4JCCA 4GLLA 4UU8A 1JN0A 2X8JA 2X3UA 4BS9A 1MA0A 3RARA 2FQXA 1USGA 1OX6A 1EUDB 1RP7A 1Y48E 1Y3CE 2GKSA 2RI6A 3F6CA 3H4TA 3M6WA 4S0XA 4TVKA 3WHPA 4IQ0A 3CEPB 4H77A 3S2SA 2HSDA 3NU1A 3MLAA 1AKUA 1NR1A 3O8OB 2IDJA 1S8NA 3BGSA 4KUEA 2BFCB 3CNOA 1KYTA 1V39A 1E3LA 4G23A 5HM8A 5KHLB 3AI7A 3BRWD 3UY4A 1UP7A 4KFSA 1WMFA 2NAPA 4GE3A 1E3TA 4NOMA 2C1XA 1GAJA 4PSDA 4F8JA 1GDDA 1M7BA 1K6EA 4DKJA 1TCVA 3HY4A 1NU8A 2HLDA 2QRQA 4XJXA 1Z63A 1O9GA 3NHPA 3TIXB 4HUJA 1NBOA 3DZGA 3AU8A 3NALA 4LDPA 3ZJ5A 1LTKA 2Z6VA 1GFWA 5JBIA 4YJHB 3S7TA 1H2RS 1QHIA 3K8ZA 3OCVA 4N18A 2GZ2A 4FXOA 1NR5A 4ZU6X 3W2EA 4FMCF 1JILA 4QDOA 1QYWA 1SKBA 3EVNA 3D4PA 3KKKA 3KPWA 3KFXA 3KLBA 4YJ3B 1G4UR 2FUG6 4FW8A 4CQLA 3Q5EA 4P83A 5KYTA 2PXHA 2BFWA 1PJTA 2BGJA 1ZL2A 2ID9A 5HZHA 4DM3A 3EH2A 4HAVA 1RZRA 3SQLA 1X2BA 3EK2A 3FJOA 4E5DA 1YV9A 5A9SB 2VJLA 1CFJA 4LY3A 1QK4A 4RH1A 1P31A 3SR0A 4CIDA 5J4YA 1UDCA 4UTRA 2AZXA 4HLUA 1XPJA 1VSTA 1PUXA 4GC5A 3UK1A 3W77A 3K0FB 4JZYA 3ZCQA 2VTBA 1JMKC 4FFRA 1ADGA 4BWFB 4ZGBA 4KG7A 1F6DA 5BOSA 1RXUA 4B71A 4C4RA 2WTAA 4WXMA 5IJWA 3IEMA 3QP9A 1SEPA 2PJDA 1ZW6A 2BTEA 2QVCA 1M2HA 4WMLA 4X20B 4OLAA 2ODWA 4JA0A 5IT9A 2HV8A 5JC8A 3HUEA 2FQYA 4G4GA 3ZJUA 5JMOA 4YI5A 1OCEA 1A9QA 2P79A 1U0OC 4Z9YA 1JJ7A 3ZHQA 1G98A 3MT7A 4I66A 4KQKA 5KTSA 1W76A 4CU2A 4IUCS 1Q1ZA 2JRCA 3P1JA 1A0OA 2A8YA 1KSHA 1LLQA 4XKJA 3W06A 4FX5A 4DL9A 5EJ6A 2VTKA 4J43A 2OT3B 5CH8A 1IL0A 1W6RA 4KRXA 4BLTA 4BE7B 1LXCA 2B7LA 3V8VA 1XZFA 3UZUA 3MQ4A 1A95A 4BC1A 4Y6QA 5AO9A 1J97A 2WQ7A 3RK0A 1FP1D 1V45E 2XSZA 4ZWNA 3SSAA 5A5DA 3I9FA 4DARA 1P29A 4NG4A 1U9ZA 1HT1E 3NC1C 3NHSA 3PUKA 1HLPA 2QSYA 3BBLA 3AGQA 2BHSA 4D8XA 4D9HA 4U7FA 5F7JA 2ZRIA 1EFCA 1NJFA 1NVVR 1SCQA 1CHDA 2JBWA 4G5RA 4JOCA 3WGYA 2IEIA 4QDZA 5FKJA 5FLXA 5A7GA 1PJ3A 3AU9A 4JWTA 1T3GA 2P9FA 3KM0A 1PEYA 1TQ2A 3HL4A 3D4NA 3HVKA 4KJZA 3O9ZA 3QBTA 4EO7A 4LF9B 4H35A 4O5AA 4RK1A 1YJ5A 3MILA 3W1VA 3K70B 1ODFA 3KYCB 4AWAA 3U1TA 3KKMA 5ITZA 3C24A 3SMQA 1JDJA 3TG8A 4NATA 3R7DA 3E84A 3KXKA 3SNHA 4R2MA 1Y80A 4DNFA 3KTAA 4H3VA 4BGUA 3TKLA 4RX1A 2FPWA 1DG3A 4YMUA 3UHJA 4BNXA 2FFRA 4C7XA 3OD1A 3OFKA 1S4MA 4B32A 2VOEA 4MWGA 3HCWA 2RK4A 3CG4A 3E3LA 1U6KA 3VR0A 2RGXA 1SC9A 1OWMA 1EFTA 2Y4OA 4Q7MB 5HMLA 5E6SB 2J4FA 5ALVA 1W0JD 4TYNA 1Y8QB 5BQPA 4X85A 3ZJYA 4KQXA 4BO8A 1T4CA 4QU9A 3O8RA 1PFGA 3NHYA 1GIAA 1WUKS 1EAMA 1NJ5A 4FYKA 4MRMB 1XA4A 2QD4A 4OYRA 2P9EA 1NF2A 1XMXA 3E27A 2H51A 4PR3A 2RHRA 3LBIA 4JI1B 5JAIA 2SECE 2VPTA 1QIGA 1SPBS 3I9LA 5KYNA 1QE3A 3CVXA 1FRVA 3REGA 4MZXA 5TV2A 3WB0A 4ZOCA 3RVDA 1CYEA 3SYTA 5AXCA 1ZA1A 5FTWA 5FUWA 2PK3A 4PQRA 1CHNA 4JLMA 1EFVA 4P5DA 5JU6A 5CTJA 3AF0A 2Y1CA 5AYVA 2ZTLA 3UJNA 1OZAA 2WAMA 2J6CA 5CCXA 2E4YA 5HKAA 4TLCA 1E66A 2PLAA 3VKVA 1UC4B 1PRYA 1IZ8A 3F5FA 2Q9UA 4GUDA 4BLRA 2N9UA 5H83A 2Y2VA 5CPFA 1VHLA 1AC5A 3QKIA 5FOUA 1JEAA 1KDVA 1G9SA 2E4WA 4UKDA 1JFRA 5HTKA 2A5DA 2RHGB 3LA6A 8ATCA 2XUQA 3LWNA 4NDAA 3BRSA 4O0LA 4C88A 4E08A 2XCUA 2FSIA 5AT1A 4FT4A 2UZIR 4Z9BA 3IHKA 2W6JA 1XDGA 1E6UA 5DHUA 1NXXA 1CRWG 2GVDC 3ZWDA 3CF0A 4K2HA 1FB5A 4EB6A 1LLFA 1ZUD1 2PIAA 3IRUA 3E0QA 2QYSA 2SKDA 3EMDA 2GFIA 3EZLA 1AKVA 3KQKA 4HEQA 1E61A 2EWVA 2P2DA 1P61B 4U2FA 3SG0A 1QFMA 4MA0A 4AJ9A 3C7KA 3IP1A 3R23A 2FSSA 4PRZA 2O5CA 3IJEB 3BWDD 4WNIA 5B1YA 2QM0A 4QVIA 3L93A 4PG6A 3W3AH 4DV3B 1BFKA 2NUBA 1COZA 3GL9A 2ID4A 1HLDA 4HN2A 4R1SA 1L5WA 1XQWA 4PCLA 1U3FA 2LCQA 1Z6ZA 2GETA 2WJ6A 1VBMA 1KO4A 2CJFA 3ZQ4A 1AU9A 2C9YA 4A1OA 4JBLA 2OCKA 4OXYA 4EVIA 3GVPA 3FNFA 1DOAA 2QMHA 2W7TA 3KQWA 3W05A 2JGMA 1Z4OA 2JJ2A 3MTAA 3EA0A 2A86A 2IPMA 2QVBA 3AF3A 3ENWA 1XWIA 5F4BA 3G0HA 3FWKA 3DMPA 4UXJA 1YRBA 4GOKA 4TXLA 5AVKA 5HS6A 3HVUA 1TJ4A 4Y7CA 3SNKA 1GA6A 3UHFA 1ADBA 1M34A 2O1SA 3GLTA 1E1DA 2F9LA 4I9HA 4OBXA 5H0IA 5ITSA 3AK4A 4IILA 1V96A 5CDUA 1G1MA 1COWA 1ZS9A 3PDJA 2WIDA 1HFKA 2ATVA 3OETA 2GM9A 3LD9A 3GVHA 1NVAA 4B6SA 1W4LA 3MXOA 5J23A 2CC2A 3WWEA 2G76A 3GDFA 5T4EA 1WKVA 3VOTA 1XZGA 2LWIA 3FOCA 4XW2A 4FBGA 4RA6B 2ZUTA 3W04A 4F3KA 5MGBA 4GPTA 1P5ZB 2IYTA 4YK7A 4ZEOA 1LBSA 1IQUA 4I1OA 4Z9FA 5AVJA 2JEYA 5TVGA 3TW8B 2PUTA 1DAIA 4FQ7A 3INYA 3X2SA 1O0CA 3EVZA 5DBFA 3BORA 2C83A 2YN2A 1FQOA 4JJ4A 2R86A 1VE3A 4MULA 4NH0A 2D62A 4QLAA 2D5IA 4EYQA 3S6JA 3DE6X 1RPTA 1YVUA 1ABEA 3SC4A 3UA3A 2H7VA 2GN2A 3QI2A 1NUUA 4KIGA 5FI0B 5JCXA 3FCUB 2B4YA 3EGEA 4YH1A 4B6OA 1H8HD 2A1TR 1XTZA 3I6ZA 3B6MA 3T9DA 5DYGA 1CU1A 4Z0HO 3L06A 4CDGA 4Z51A 2QPAA 1CJMA 1H65A 1SXIA 4LWQA 3AB7A 3H2KA 1CULC 3OU6A 3I52A 3F1LA 5A5FA 4LOHA 4UBIA 4YCNA 2EQ5A 5LOVF 5T41A 2ZAIA 4ZXPA 2JI9A 2ZWAA 3T3GA 3WLKX 2ZXUA 1I0LA 2TMDA 3UYKA 3CLHA 3O82A 2F4VB 2V65A 1P2FA 4RF2A 2VYND 2Q5IA 3Q8WA 1IM8A 3M6UA 3CYFA 3B6IA 2DBZA 3NAQA 4EW3A 2JBHA 3BK2A 4G4JA 1Z6YA 3ROXA 4C04A 1PGOA 2HLHA 3HB1A 4E51A 2WYWA 1JT2A 5JUWA 1FU8A 4FR2A 1D2CA 4V2IA 4IKOA 4BVKA 4DHWA 1G6Q1 2X15A 4S1PA 1K5PA 1BOOA 2QG4A 4Z6KA 4H59A 4UHHA 4TN1A 4MQEA 4RYDA 2UUCB 2Z04A 3I8OA 5HQJA 5LSAA 2WHXA 5IJZA 3QZUA 5ALHA 1VSBA 1FSZA 2CB0A 1X77A 5BSFA 1T4BA 2AF3C 4CZ2A 4EI9A 1MR3F 4GLBA 4IXWA 2V4UA 3AF1A 2BSXA 3AEKA 1IOZA 5A6SA 4XD7A 1U8ZA 1F3LA 3GEEA 2R8XA 1CUSA 3I5AA 4CQJA 3L4JA 4JX9A 4A7PA 2XUKA 5FA6A 1D4FA 1LJUA 5DEIA 3U5ZB 1ZQ9A 2GTIA 4Z5XA 1LW6E 4N8SA 5KNLA 1Z6XA 2XKAA 2VATA 2XUAA 2OV1A 3MW8A 1DB3A 4UE3S 3I28A 4I0WB 1E1NA 4Q7KA 3Q1KA 1EKXA 2EIXA 1X9HA 2ISCA 3OURA 2NSHA 4B3IA 4IX1A 5IJ0B 3DL4A 2LV8A 3AEKB 4FM9A 3OCWA 2FV8A 2QY6A 4NFSA 4G86A 5G40A 1M73E 2WIFA 2PHZA 2I66A 2HUPA 5AKEA 3SYNA 5I4CA 4WQMA 4OU5A 4PZCA 4XOIA 2IUSA 1HWYA 2GBLC 3IHWA 4TTJA 2GM4A 4KXYA 4FOOA 5H5JA 5IPFA 2VUHB 3PV0A 2BFMA 3TXAA 2E37A 3IB6A 1D9XA 3OQJA 4YRGA 3ZV4A 2B69A 4PSUA 1DDOA 1DRJA 1XVIA 2POQX 2GOYA 1RKUA 2JZNA 3CLVA 2P3SA 3FCSB 2WAOA 4FDMA 4D3YA 1IDOA 4U7TB 4Z7OB 4FZRA 4BMVA 4BO9A 1XD2A 4R9NA 2QJFA 2Q7XA 3MHPA 4FFPA 1FYEA 1JBQA 3F47A 1S02A 5CNMA 3UIEA 3CPEA 1Z45A 3G2QA 3KOZA 2J9FA 3PQCA 3I01M 3DHVA 4DLLA 2EDCA 1OTXA 3CLTD 5LJIA 1Q0ZA 3PPWA 3MF4A 3WJ1A 3CZPA 1JNXX 3KR0A 1UBEA 1MLDA 2WUEA 2XVMA 3NS7A 3VO2A 1Z0IA 1UXGA 3HCAA 4YPFA 3LQ2A 1XZJA 2DQ4A 2W5UA 3A32A 4BVAA 3FVRA 4FU0A 3QEJA 3BB1A 1YWGO 4Q4HA 1NN3A 4R3NA 2HC9A 3GCXA 4TT3A 3ZIDA 1PW5A 5GIOE 2WF9A 2XV1A 3OBIA 3ZX4A 3W6PA 2IF0A 4G2NA 1GV0A 4PICA 4GEKA 3OPQA 5DGDA 1BDIA 2GLUA 4I4TA 3WHIA 4JYBA 1K7XB 2YY7A 2Q4OA 3F5QA 1J7JA 1GZDA 1OB5A 3IIEA 4D9BA 4HDRA 4F6LA 2CHEA 2QOEA 3OEWA 4GYYA 2QRNA 1MJNA 5BUQA 3IP9A 1RAGA 2X41A 1TA4A 3AFNA 3CF6R 3MUEA 2KQUA 5DPMA 3RTDA 4BO3A 1OFGA 3SEFA 1EDDA 4Z49A 4FJ0A 5ALYA 2J9ZB 4OQEA 4B45A 4EYKA 4IQGA 1OV4A 3FAKA 2MU1A 3OAAD 3ZTTA 4EG4A 2CVOA 2ZU6A 3HBFA 3AJAA 3AI1A 4WFIA 3FNBA 4B3TB 4S3MA 3MK31 2IYNA 4IOKA 1CS0A 5JSYA 3BTOA 4J0CA 4PLZA 5B37A 1FXUA 5CLHA 1T0PA 3V8EA 4LKOA 3PIDA 3WK8A 2BZGA 2OOSA 1PT8A 4G0NA 4EZIA 1E4YA 5A4FS 5G4KA 4BLQA 5BNZA 2REOA 1L4KA 3DEFA 1BWPA 1PKXA 3C8ZA 3Q0EA 3QTLA 3OU2A 1YMVA 4ZVKA 4RTLA 3C7AA 3QVLA 3K70D 4PHFA 4R41A 1PLKA 4LTDA 1S3FA 4XVHA 4ZT4A 5FNVF 1KTIA 4CKCA 2OXEA 5K0FA 3U56A 4K26A 3SR4A 3M2PA 4BVGA 3K0AB 1NXTA 3I2HA 3HDQA 2RHJA 3CVYA 3VNVA 3MS4A 4KQ1A 1YT5A 1GTVA 1UBKS 1NVWQ 2CLEB 2JG3A 4MZDA 2IEGA 3NEAA 1VL6A 1G2PA 4YLYA 1Q77A 2FMUA 1SOMA 2ECKA 3EDQA 3LVBA 1VCOA 2GZAA 3P26A 4M3NA 4DIKA 4DG5A 1S2MA 1Z8DA 4RA9B 2ZM5A 3QELB 4E14A 3MG9A 4WJLA 3AERB 3EAQA 3AV0B 2O19A 3X1DA 3LT2A 4RHEA 1GGVA 4I4LA 4F91B 3HG7A 1N1GA 4CMCA 2AL7A 3GLIE 2LCFA 2C5FA 2FYTA 3M6MD 3WXBA 4EKYA 2ZETA 4UATA 3IP5A 3JWPA 4QM7A 1M1YA 3A25A 1P2UA 3T7JA 1OUMA 4M1MA 4Q1VA 5I9MA 1Y82A 1G7TA 4MWCA 1CCWA 2OHGA 4OIMA 5BRNA 1N4AA 3P2IA 5DW0A 3ZDCA 4O4JA 4I1RA 2H1VA 3G2HA 3SC2B 3OY2A 5JH7B 4D26A 1XFDA 3L8ZA 1NPTO 3FMFA 1PQ4A 4M8IA 4UNIA 3TTYA 3G89A 4ZYVA 5ENDA 1MOQA 4RD0A 1FLAA 3N2NA 3FI0A 4X1YB 1YFLA 1QFZA 2ZI7A 1AGYA 3BM5A 3BA6A 3QPWA 1E1QA 1WNTA 4HTFB 4NX2A 1H94A 2HHJA 4L4SA 4ERNA 5EWLB 4WNAB 4EUKA 3FM9A 3PGKA 2Q49A 2RARA 4XPIB 5HKLA 2HMUA 1FJ2A 1E7SA 1WW8A 3IBFA 3F7MA 2XCLA 4LGMA 4RSMA 4Z9AA 4CMKA 3AVWA 1O1YA 2BGIA 2CK3D 3L4BC 1JSCA 4FYWA 4TZTA 2BHLA 3CISA 2FR1A 5FOWA 3ILSA 2Q5JA 2IF2A 5E9AA 3ZCRA 1B15A 1I5OA 2Z98A 3DCNA 5CVCA 4US0R 5LQKA 5LZ7A 3BMNB 4OUDB 4RHFA 1XMQB 3K5WA 1R6UA 2DYKA 2AN3A 2QWXA 2Y93A 4N5NA 5FTJA 1JVSA 1KI2A 4YT2A 3EGCA 3SKYA 3A14A 4MGIR 1RLJA 2CXSA 3PE4A 5CHEA 4YJHA 4NOLA 3WGQA 4B6EA 4NCIA 3DXFA 2EAUA 1G20B 3MAAC 3CVOA 3ZNPA 2H8GA 2C84A 1UBGA 3ZDAA 2ONZA 2VHZA 3UXHA 5KYGA 3PFWO 4MP8A 1WHSA 1T26A 2W4QA 1E6CA 4J16C 3CIOA 1QRAA 1OTYA 3G1UA 3LOQA 2A9FA 2VH5R 2WK1A 4I2NA 5CNIA 5DX0A 4Q18A 3ZGOA 4DMFA 3ROPA 7ABPA 3LUKA 2KM1A 1Q3KA 2IYWA 1ML4A 2QPTA 3GD5A 1SQ5A 1WDKA 1E8MA 5AK6A 2XZDA 3CRW1 3KE9A 4FINA 2H1IA 4Q9LA 2GS9A 2RGGA 5EIBD 2H2FA 3EIOA 1ZMXA 2ZTVA 4IDEA 1EUZA 1QZZA 1RRMA 3MFYA 5LLDA 1M2GA 1QH0A 2JIRA 2QW1A 1JQKA 3DE0X 1N7IA 3O6VA 2VEDA 1CQPA 5ESWA 2EL9A 4B84A 2VQEB 1LC0A 3O1LA 1EVZA 3AW8A 3QFTA 4AL4A 1CRQA 2JB9A 2IJGX 3L18A 4LOKA 4LTMA 3KLMX 2VZEA 4YUYA 1J0CA 4HLDA 5A9RA 3MELA 3GQVA 3OOSA 4B2PA 4KGDA 3BQ9A 3I9MA 3QLUA 3FHTA 5EXDA 5CGZA 5E95A 2VBCA 4EUHA 4WCVA 4YRBA 5LWQA 1TI7A 3DBRA 1LDMA 3FKSA 1X38A 1XKQA 5E7IA 3KKOA 1C4WA 1T8PA 2C7GA 2EBUA 4MIEA 2V6IA 4CT0A 4JBHA 4IFEA 2J67A 2J3LA 1WLYA 2PL3A 2R0QC 4PTYA 3JTEA 1Z22A 1U0FA 4U39A 1YZKA 2DQKA 3TSAA 2HJHA 1ORWA 1RMQA 1CUYA 1QRTA 1V35A 5AKYA 4LJ5A 1TUBA 1HYQA 3F78A 4QQ8A 5EMJA 3G5UA 4DV1B 1KK2A 1QF9A 1YIAA 1II8B 4YMVA 2DULA 3RNLA 4IRMA 5JRJA 3N28A 4FK8A 4LDQA 3PI6A 2R97A 3A6GA 3BSFA 1AXRA 3H7AA 1IN6A 1FPMA 1PV2A 3BAFA 4KLRA 4KNWA 2RHWA 3WRYC 1N9GB 4HQOA 3JQFA 4P7KA 3L1JA 1DV1A 2IU6A 4NYIR 2F3RA 4I46A 2O0JA 4UEJA 2I33A 1O4VA 2AFIB 4DXDA 1JBKA 4QDXA 4ND3A 5AM0A 2WSYB 4OK3A 1NQAO 2IGTA 3HN2A 2XOEA 3H6GA 2CL0X 2VH2A 1H6DA 4AZVA 4C0XA 2CUZA 3AR6A 3NWOA 2AMFA 1L5VA 5TARA 2QMUA 4B3CA 2Z2JA 4JC4A 4F4FA 3GO4A 3GUCA 3PNPA 4Z7JA 1F1BA 1LF5A 1NBHA 1W29A 4GR4A 4NAUA 4URUR 3OE1A 5FOXA 3IR7A 2X14A 4DZZA 1ZRSA 5BW6B 1R8YA 4KDFA 4HFNA 1G9XA 2X9NA 3TX6A 1I3LA 2YW9A 3LHKA 2V0GA 3IXLA 3LX4A 4E5PA 1OLOA 3IOYA 5BUSA 1YGYA 1RLMA 3SR3A 3QNUA 4UJ5A 4NCJA 3O83A 5E1OA 1A9RA 2RAUA 1BJRE 2IX9A 1J7KA 1Y3AA 2KE5A 4UCWA 1CZUA 3A7EA 3D5EA 4RV5A 3FNQA 1JKXA 3LXUX 3FUVA 2WKSA 4E2XA 1YJXA 2VSXA 4PSKA 1PP4A 3S7ZA 2O2EA 2R7AA 4OH1A 2EZ9A 3T7RA 1NZJA 2GHIA 3G13A 4Q7LA 4LXXA 2P2ZA 2EFJA 2ZUCA 5F3WB 4IKEA 2CHFA 3H2YA 5A3JA 3I5XA 4TT8A 5TDHA 2RH9B 4MR7A 2Y4NA 2Q5HA 2C7BA 2Z2YA 4XDGA 3WMWA 1TPYA 4RZHA 5LFAA 2O9JA 4XXHA 3AT1A 4TX1A 2Q3LA 4LC9A 2V6JA 3QVVA 3RBVA 3EXHC 3QW4B 1JWAB 4K8RB 1TUIA 2Z56A 4YAIA 4E2YA 4COOA 4Z2YA 3CCBA 5IH3A 2OA0A 4GOJA 3GFQA 3LL7A 1ACJA 2Q5LA 4JVOA 4L08A 2P6PA 5DYIA 3AEQA 3IEVA 1OFTA 2QI9C 1XYVA 5TNXA 5HHTA 2AJTA 3CE6A 1PR3A 2EJTA 2DHCA 1M54A 3UOGA 2OZLB 1RYFA 2VDNB 4TN5A 1X7WA 3FE2A 3Q98A 2ZKIA 4N40A 2UUPA 3AUFA 1EEHA 5AUQA 4XVRA 3ZG6A 1ZR2A 1EHCA 1UBJS 2ZRKA 3T4UA 4POOA 5FFMA 2P62A 1MX5A 3OCYA 3OG9A 2DEUA 1MRNA 4BQNA 2CLFB 2OXCA 3IH5A 3MVEA 4W8OA 1OH8A 3CN9A 1V4BA 3L4EA 4QBFA 1PJAA 4WE3A 3DTTA 4R51A 3QHAA 5HS4A 1LV7A 1SVKA 3QYJA 4DLKA 5LQDA 2R6AA 4C4YA 2Z58A 1ESCA 2WM9B 1JIVA 4JKYA 1K7YA 2DTDA 2ID7A 4OMDA 4TVSA 1RVV1 4HDQB 1R88A 1UK6A 3BSYA 3PSAA 3ELWA 2H0QA 2V7GA 3OJLA 1VFPA 4FIZA 3DKKA 1CUZA 3P0JA 4MPPA 3SS7X 2XQGA 2DBVO 3VX4A 4C7OB 4LCBA 3GHYA 3GK3A 1RJDA 3FNHA 5GOTA 1C3JA 3GG2A 1RYMA 4HSEA 2ZROA 1N0VC 1UF9A 2I7TA 3QF4A 2XEXA 3S81A 1HR0B 3QF7A 4NPHA 2CSUA 1PWYE 5C80A 3UCEA 3AG5A 3PEVA 2O8BB 4NJOA 2HA6A 3TIGA 1ZL0A 1QLHA 3OJXA 1M6YA 2VC2B 2G82A 1UADA 2C82A 3EZ9A 1YU6A 1G3UA 4PS0A 1DFHA 3SKVA 1KH1A 1ZBQA 3LUCA 1WU8A 2ONYA 2DWCA 1F8GA 4CIWA 5KQPA 4M1WA 5TC4A 3N0VA 3QF4B 4X62B 2HJVA 1CR4A 2ETVA 3EZNA 2AN4A 5EE9A 3HCPA 3RUIA 3AVTA 1D6SA 4WCDA 2W6ZA 1JI0A 1RJ9A 2I4OA 2XWPA 4IMJB 4OBBA 4Q1CA 4ZPJA 4AJKA 3JTMA 3DF9A 4C6TA 1EA5A 2HH9A 3DUFA 3HHPA 3HJFA 4KGVA 3S2UA 1ODLA 5T57A 1D1PA 1PDWA 1WPRA 3AESA 1ZINA 3W34A 1ORVA 4AN4A 2X1LA 2BLLA 1M1XB 3NM4A 1K0UA 1CP2A 2EYQA 2Z2KA 3G7SA 5CIWA 1SU8A 1ZI8A 1XEFA 2DQZA 3DBOB 3F9CA 4LTNA 4RGVA 5LNK6 3E15A 1W5TA 3B1WA 2HWKA 4UAGA 4P0QB 1ZOPA 1PX0A 2X8WA 3PF8A 4TS9A 1YZ3A 5C1OA 1ABBA 3ZGZA 1H2AS 4MWZA 4X1KA 7REQA 1G5PA 2VJYA 2F1OA 3OQMA 4HQKA 1W0KA 1HGXA 1M34E 1NW4A 3IQGX 3KWMA 3IPRA 1XUOA 4HNQA 2CXTA 3M7IA 4LV5B 3ZNQA 1IMJA 5AVQA 4JP5A 5IUJC 3MB5A 4P2BA 5CK4A 2ZBVA 3K96A 4NARA 3ZWOA 5DX1A 1P6XA 3VSCA 1J21A 2RE8A 1JHMA 1GU7A 3HCBA 3QGMA 4LFBB 1PYOA 2BUBA 2G25A 2VTBB 2PH3A 1OBCA 2XDWA 3LFTA 4HB3A 3S29A 2J9GA 3P0HA 4JQYA 4TTTS 4UBLA 1QHYA 3GPBA 1Y3FE 1DEOA 1U1DA 4RMHA 4W63A 3QMVA 3QXGA 1KDZA 1N25A 2OCLA 3V46A 2O20A 3RC2A 1SXGA 4ADSG 7ADHA 2H7XA 3F2VA 3U3KA 3UC5A 2C4TA 3WO1A 5EFZA 1QIIA 2XTMA 3ECSA 4IZ6A 1BDMA 1FQWA 1OKKA 5AOBA 3KQLA 4Z4GA 4EBBA 4LEIA 1J39A 3OUTA 5DK6A 4YAGA 1UK7A 2RMKA 3A6LA 2VK4A 4DMHA 4W6QA 2XCRB 2QPLA 4NYJQ 5G1PA 5CURA 3TQRA 1J1IA 2P65A 3FBGA 3JX9A 4NENA 4UMDA 4F2DA 1P81A 4F2HA 3EIWA 1Z2EA 3HDVA 2Q5QA 4JI3B 3O94A 4AF7A 2J0SA 4XGKA 2E49A 2LIPA 2ST1A 1NQUA 3F3SA 2Q41A 3IV6A 1U4OA 1HQDA 1S2OA 3QXCA 3D7NA 3CKYA 5GWXA 1NSTA 4AJNA 3RQIA 1KO1A 1DBIA 1MRZA 1CDOA 5BSHA 2Z4TA 1R9GA 3RSCA 1LI4A 1S8OA 5J4HA 1C80A 4LCJA 4G1CA 4CKBB 3VR3A 3I8SA 4RVGA 2RHDA 3PVCA 4MAMA 1DCTA 4WZBE 2ZUSA 1L5KA 1WHSB 1Z0AA 1MGOA 5BNTA 1S2NA 5KOIA 3DT9A 1VMAA 4ILEA 4HAZA 3T5DA 1EG7A 2JVJA 3HB4X 3RIGA 3UG7A 1BE1A 4JDUA 3W3ZB 3LPCA 3H11B 3QVTA 2YN4A 4IHJB 4KQ9A 4NFHA 2WJYA 4WOKA 5ECGC 4CTMA 5EIEA 2ZBDA 3W3AA 4LQ4A 1VA5A 1ND6A 4UREA 4R7GA 3OPYA 4DLXA 5K03A 1GKIA 1KY2A 1UM9A 4DVJA 3ETJA 1P1KA 2PJZA 3AY3A 3DZCA 1S0UA 4QQKA 2RHBA 5AJUA 1Q92A 1E5LA 2EJUA 4V0LA 1SXJB 4WZZA 5HBRA 4XPZA 2CFRA 5U1PA 3RLFA 5JJCA 5CYFA 5HFNA 1WL8A 5CM2Z 3FOZA 2ZZNA 4U63A 5E4YA 5HTOA 5A5VA 5IVKA 2HPZA 1ONOA 3I0ZA 1G3QA 2IYAA 3H17A 4F9FA 4F84A 1WHTA 3LHDA 4IDBA 5ALIA 1OBVA 5T67A 3GBSA 4RK0A 3D3NA 2JK1A 3P9PA 1GL3A 2O2XA 4XPIA 2HA5A 1IFXA 3K1ZA 2X0FA 1Z0SA 4BEBA 1HNWB 1TC1A 3QUCA 1PDVA 2OKCA 4OP2A 3ZS9A 5INTA 4JXZA 1Z0ZA 3IEXA 5EYPB 1BYUA 1MEEA 3IBTA 2JFOA 1U65A 3F3MA 4IV8A 2WU4A 1BRMA 2XODA 4B8WA 4KH0A 2E18A 1QR6A 3CMMA 4CV3A 3BE5A 5J47A 4D6XA 4OFWA 3TBFA 3PNOA 4PF1A 1UWLA 4Y0NA 3SQOA 3OVMA 3WQRA 3ZNNA 1JAHA 4YBRA 4DIOA 4E5NA 1IZYA 1S89A 1SCDA 1RR6A 2EZTA 4HPXB 1ISSA 1QNLA 2PZEA 1U7OA 4KJXA 4EA7A 4GH5A 3BSWA 4HBZA 4QXQA 2MYTA 2VUSA 1N3LA 4OBEA 3E2IA 4M6WA 3OX3A 5BWLA 1REQB 3UF0A 2C3UA 3CMCO 1P5JA 4XARA 1F6WA 4MI9A 4QTZA 5EIWA 5FBRB 1PUIA 3OJEA 1G19A 4P4TA 3HGQA 1LZLA 2VHYA 3MCZA 3LBNA 3F5DA 4EL0A 2X0KA 3K6JA 4PPYA 2HCTA 3O9MA 1NSYA 2XRYA 3B53X 3P9SA 4YJ2A 3WIVA 3HJGA 3HKCA 3WG9A 5B3KA 4E94A 1P45A 1LVUA 3KT8A 5HIKA 1FP4B 4FFMA 1K0FA 4N6OA 2J6HA 2HUNA 4X7RA 4JVLA 4XWAA 4MNTA 4NCXA 1SZJG 5SZIA 1G18A 1IEXA 1DAFA 1QLWA 1RQ2A 3QG5A 4YWJA 1YCHA 3VRHA 4RENA 3TR6A 2WAXA 1TCBA 2Z8XA 2WB2A 4ZRMA 1KJ9A 3TZCA 3W5BA 2HF7A 3KU4A 3SOZA 2XE8A 3TX2A 4DLSA 2XB4A 3A9RA 3HGMA 2HMSA 2HRCA 1I6KA 1T1GA 4P5PA 5CA1B 2Q2NA 2DPMA 1PJLA 1NYLA 1GNLA 2JGEA 2AK2A 4LQCA 4R2HA 4JNCA 5CJ2A 2HA2A 1GTG1 4EQZA 1Y37A 3H11A 4R83A 2O14A 3NAGA 3O7MA 3PQ5A 4CLDA 4J7UA 3IEUA 5IYZB 1K86A 4OJKA 3RYCB 1I2AA 3I4LA 2YV1A 2REQB 4Q3BA 5KJ6A 3UGJA 1EDEA 3IUQA 3G7NA 2F62A 4B4WA 5IVPA 4DR4B 3S99A 4BO6A 3UANA 2X7XA 1Z7YA 2AE2A 1SKYE 4Z0NA 2WKQA 2ZBEA 2IV2X 1QM5A 1KHTA 2PKCA 4QOHA 3G0IA 4DLYA 4YAKA 1E4EA 5EMHA 3KTFA 4FE7A 4BB0A 5BSKA 3HB7A 4ZQBA 2AKEA 4I9UA 2R7MA 4YQEA 4DQDA 5L51A 1TK2A 4QFDA 2BLNA 1G2IA 4JU8A 3ANYB 4HFRA 3WZLA 4AMUA 2ET6A 3MMNA 3INNA 4OAOA 2QKYA 4QYXA 3WB1A 4BMYA 2WIGA 3LVQE 4MUFA 1WW2A 2XCIA 4DUPA 4CQNA 1PGNA 5CXQA 4YRIA 4OQZA 4JBIA 4WOBA 3VHXA 4Y6GB 1L4EA 4XIGS 1NNEA 4FNAA 4RPKA 3P0EA 1K7CA 4EMTA 3UKDA 1J00A 1SKAA 3LHFA 4MUHA 3UJPA 3MFQA 4Y2RA 3DE3X 4JXKA 3GGDA 4K6CA 1TMGE 3FUWA 3EZ6A 4EGJA 3FCCA 4JYMA 1VYVA 1WCIB 1ZGJA 3T1OA 5ARBA 1L3BA 4JUIA 4HY3A 2C8JA 2QR2A 3ITNA 3TEFA 5AVSA 3EIQA 5BSVA 5BN5B 1ZD8A 4X97A 1A97A 1W87A 1NUPA 3AFGA 4RHYA 2ZBUA 1CSEE 1L4YA 1UJMA 1ZCZA 2GCNA 2GF2A 5B3JA 1Y4SA 2X23A 3GJ4A 3R3ZA 1NWCA 5AKLA 1YR6A 4EVRA 5EKDA 2VWHA 1NASA 1XZIA 1YIDA 3CRNA 3JAMA 1NTRA 1MC5A 1MT3A 1E2HA 3PYMA 4ER7A 5CITA 1PZHA 3B2NA 3FCYA 5ICEA 4Q4AA 3Q11A 3HWRA 4QLOA 1JPNA 1ECBA 2NUPA 4KZPA 3UK6A 3RWMB 4IH9A 3I39X 3C1TA 3EZGA 3ZW9A 5F23A 1YJ8A 2OHOA 3LUPA 3IP8A 5K8VA 3L8MA 4LJ4A 4NMXB 5HXAA 1ZR4A 5CLJA 1KI1A 3PUXA 1VCHA 4UCQA 2DY0A 2O4CA 1HQYE 1Q7GA 5IKOA 3TOSA 1XTQA 1ZD1A 2PUEA 2BJWA 3R0VA 4U9IS 1KZ9A 3P71T 5EGSA 1SBNE 2WICA 5ED0A 2AJBA 3RAEC 1F8FA 4XVQA 3NDJA 3PC3A 3AHHA 2VP4A 1H3FA 4MKGA 5CAEB 3BCUA 2QM7A 1PLLA 3AOEA 4KRFA 1C7QA 1CP3A 3VR4D 5E3HA 3QMMA 4RK4A 1W5FA 3T94A 4CKEB 3AVUA 4AS2A 2Q9CA 3SIPA 2OGZA 5IKEA 2VN8A 1USVA 3T61A 3LYHA 2YC4C 4JYCA 4L73A 3IAXA 2ZPUA 3OZGA 4BJ1A 2WT9A 1GU0A 3E8XA 4XZ3A 1E3MA 4JUCA 1B0PA 2J3IA 5G3ZA 1M10A 1VIYA 5C7LO 3AFMA 3GRFA 4FIDA 4GD3Q 4DR7B 3ZKWB 2X6QA 3FCAA 3JW8A 5EPEA 4CTKA 4P4SA 3MTGA 4GGOA 2M6LA 1ZUNB 2JEZA 3N0TA 4DBZA 1M6WA 3CJQA 1SQFA 1U2ZA 2CHQA 4ZHQB 3A9VA 3L43A 5G0SA 5AVWA 4PIPA 3SBXA 1IXZA 3OIVA 4NBNA 1MD9A 5TT0A 5B55A 1WEHA 4J4BA 1NRJB 3T9EA 5JTUA 2HMWA 2DWPA 4DDVA