1G9HA

Ternary complex between psychrophilic alpha-amylase, comii (pseudo tri-saccharide from bayer) and tris (2-amino-2-hydroxymethyl-propane-1,3-diol)
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
448
structure length
448
Chain Sequence
b'TPTTFVHLFEWNWQDVAQECEQYLGPKGYAAVQVSPPNEHITGSQWWTRYQPVSYELQSRGGNRAQFIDMVNRCSAAGVDIYVDTLINHMAAGSGTGTAGNSFGNKSFPIYSPQDFHESCTINNSDYGNDRYRVQNCELVGLADLDTASNYVQNTIAAYINDLQAIGVKGFRFDASKHVAASDIQSLMAKVNGSPVVFQEVIDQGGEAVGASEYLSTGLVTEFKYSTELGNTFRNGSLAWLSNFGEGWGFMPSSSAVVFVDNHDNQRGHGGAGNVITFEDGRLYDLANVFMLAYPYGYPKVMSSYDFHGDTDAGGPNVPVHNNGNLECFASNWKCEHRWSYIAGGVDFRNNTADNWAVTNWWDNTNNQISFGRGSSGHMAINKEDSTLTATVQTDMASGQYCNVLKGELSADAKSCSGEVITVNSDGTINLNIGAWDAMAIHKNAKLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE
publication title Crystallographic evidence of a transglycosylation reaction: ternary complexes of a psychrophilic alpha-amylase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 157
structure length 448
sequence length 448
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2000-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1g9hA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1g9hA01
2WVVB 1UZ1A 4IPLA 1QHZA 3GBEA 2XGBA 3B9DA 3WEMA 3SCTA 1CGTA 2WHMA 5A2AA 3MUIA 1E56A 2WBGA 2XVLA 3MU7A 3TTOA 2WKLA 1ZS2A 1GONA 1C8QA 1H49A 1HJWA 1F4AA 4TX8A 5CGTA 3NJ3A 4JAWA 2OYLA 2ZXAA 5LA0A 1JFHA 5I0DA 1MFVA 5A94A 1OIFA 1HF6A 3GXTA 3ZT7A 3TONA 1UA3A 6TAAA 3A47A 2YA0A 1PBGA 4IUGA 1QI0A 1QW9A 3SCQA 1FOBA 4U33A 3NSXA 1CXHA 4UFMA 4U31A 2UY4A 2VRQA 4F9DA 4ZXLA 1MW0A 2Y24A 3MANA 3PZUA 2F7QA 3SUWA 2MANA 2VURA 1VFFA 2WB5A 1EQPA 2X0HA 2VT0A 2VRKA 3WN6A 5BCAA 1ZBCA 2OSXA 1YHTA 3BSGA 1KBKA 4GKLA 4ZE4A 1K6AA 4MDPA 1CXEA 3NDZA 4NRRA 2YFOA 2XYLA 5JIWA 5I2UA 3ARYA 3VO0A 2ZX7A 3EJPA 2NT0A 2O9OA 4E4PA 2UY5A 3MI6A 3KL5A 1MW2A 4A3HA 3VIMA 1JYNA 3TTQA 1R7AA 3GXNA 5GPRA 5IDIA 4JCMA 3VD7A 2XFFA 1CXIA 3KZSA 1CWYA 4YPJA 4U5KA 4CCCA 3VM5A 4JKMA 1GNXA 3VM7A 3AQUA 1LQ0A 2VO5A 1Q6DA 3RJYA 3WNKA 1UR1A 1J0KA 4J3VA 5JBFA 2X0YA 3AIUA 1B1YA 3OGSA 5A6JA 4HZ8A 1E1FA 3VGBA 3HMCA 2GJXA 4GXPA 4H41A 2J74A 5ABFA 4HPHA 4FK9A 4CGTA 3ZT6A 1UR0A 1GOOA 2XGIA 1ISXA 5GNZA 2EPLX 2XSBA 1PIFA 1V0KA 2J7GA 1UOKA 4ZEPA 1BG9A 1EOMA 5AYIA 2FHBA 1K9TA 4D6FA 3VMPA 3EYPA 1MXGA 1HJUA 3SCOA 2VX5A 1QVBA 4JZ5A 3A4AA 1UKQA 4MDOA 1O7AA 4V27A 2V38A 3OBAA 4UFIA 3LPPA 5E6YA 1HVQA 3VX0A 2YL8A 4UOZA 3CTTA 5I6SA 2CETA 4C7FA 3ARRA 1E55A 3KL3A 5DMYA 4Z2IA 1ZJAA 1J0ZA 1E6ZA 3CC1A 3MS8A 1QW8A 1PPIA 2YL6A 3CIVA 1BF2A 4UFHA 1TR1A 4FLQA 1ECEA 2X8RA 3G6LA 1EDQA 3L2MA 1HKJA 4PSPA 3E1F1 2VQUA 1KR0A 2ZIDA 3WNPA 1EIBA 1UR8A 3HG5A 3S5YA 2WXDM 4F66A 4MPKA 5GNYA 2YL5A 3AMGA 2WHKA 2ZWZA 4MADA 4YHEA 2XVPA 1MXDA 2PBOA 2YBUA 4NZCA 2ZUVA 3AXHA 4DUXA 3TOPA 3OA5A 2GDVA 4MB4A 4KH2A 2WPGA 1W9PA 1M7XA 3AS0A 3QHMA 4PCSA 3VVGA 4NZJA 3WUGA 2J78A 4W5ZA 4CU8A 5A6MA 2CPUA 3RM8A 4MNLA 2WMKA 3WDRA 3SURA 1GOMA 2XIBA 3PTKA 4FLSA 2J7DA 1ZJBA 1UWQA 4QLJA 1E40A 4W7WA 3VGDA 1TFVA 1CXLA 2J7EA 3FAWA 3GZAA 2DSKA 2Y8VA 2C0HA 3M7SA 3WQ5A 5LYRA 3PZVA 3AROA 1B31A 4W8BA 1NQ6A 3N18A 4FLRA 4JKLA 2ZE0A 4UCFA 3IJ7A 1XC6A 4XV0A 1WZAA 4M80A 2W92A 4D6EA 2OWXA 2JEQA 4JFTA 1E43A 1AQMA 1X6LA 4ZXOA 2VC9A 3GH4A 2WVTA 1PAMA 4GINA 3PHAA 4P8WA 3BAYA 4UFLA 1V3MA 4UZSA 3DX1A 2GFTA 1CIUA 2BFGA 3PZQA 1QI4A 3AICA 1W9XA 1WZLA 2VZTA 3L4UA 3T08A 4H8HA 3KEHA 1BLIA 3W38A 4E8DA 2Y8KA 2Z1SA 3BXWA 4PN2A 1CXKA 1W9VA 5DFAA 1QNPA 2PWHA 3GNOA 4WIWA 7CGTA 1JYXA 3SIMA 3FHQA 1TVNA 1UG6A 2YLAA 2DT1A 2DH3A 1XD1A 5IFTA 5BXTA 3AZTA 4AD1A 1CGUA 2E8ZA 2J8GA 1XRVA 1UD6A 1UZ4A 4CN6A 1UD4A 1E0WA 2WW5A 2WHJA 1JZ2A 3WH5A 3HN3A 2PWEA 2CKRA 3DECA 1DWGM 4HTYA 3WF4A 2J7FA 5M03A 1EA9C 3N04A 4PTMA 4A3YA 1HWWA 2Y2WA 1GQIA 1HXKA 1V3LA 5HPOA 3F5KA 1R75A 2UWFA 1UKPA 3SCVA 3D51A 1GORA 3VUPA 2X1IA 4LYPA 4GI6A 4LPCA 1A3HA 2DEPA 1UD3A 4H8UA 3ARVA 5JBEA 1O7DC 1JF5A 2BHUA 5JBDA 3VSVA 2XVGA 1VEMA 5E0FA 1KWKA 4W8LA 3LPFA 3VGEA 3A21A 3D50A 2DIEA 3VPLA 3WQ4A 3JUGA 4M24A 3CO4A 4DWSD 4JFWA 3SCRA 2BY3A 4QP0A 3UETA 1ODUA 4JFUA 1TQSA 2CHOA 4CCDA 1OM0A 1G0CA 1HP4A 1J18A 1OCQA 2EBNA 4EKJA 1JZ4A 1C3FA 2DT2A 3BVUA 1BYCA 1J0IA 3BMVA 2G3JA 4BA0A 2DT3A 2WCGA 3MUZ1 2J7BA 2BHZA 1BSIA 4CD6A 1PZ2A 2TAAA 3IAQA 4YHGA 1V6XA 1UWUA 2NT1A 3BAIA 3WL0A 2ZICA 3GH7A 2FH6A 1NM9A 4XZBA 3MO4A 3VSTA 4UOQA 3W24A 2CERA 1HVXA 2QMKA 4KMQA 4D72A 4P7LA 4QDMA 5FIPA 1BYAA 3VIFA 3AHXA 5EFFA 4Z2GA 4QLLA 3N9KA 5GQBA 2GJPA 3W29A 1C8XA 1EH9A 4ACZB 4GI9A 1ZBWA 2FGZA 5BXPA 3EDJA 1N82A 1B3WA 2IXUA 3AI0A 1H0GA 4TVUA 1HJQA 3WY3A 4KRUA 1XYZA 1MQQA 3CHDA 4DUVA 1SFSA 4P8VA 1GVIA 1MQPA 3IGUA 2WLZA 2FDMA 2ZX9A 5AY7A 1YQ2A 3KWXA 1QOXA 3EJQA 1JD7A 2F1BA 3VDAA 1OB0A 3K8KA 1E73M 2OW6A 2W67A 2EJ1A 4UFKA 2X05A 2G3MA 1Y7VA 1QNOA 1E0VA 3WQ8A 4J28A 5HPCA 1FA2A 2VOTA 3AHYA 1ZBVA 1W91A 1JYWA 2WMIA 1KXQA 3LRMA 4BQ5A 4UQEA 3UESA 1US3A 1S46A 3AMDA 1CPUA 2BY0A 2ZUWA 4OGZA 5ABEA 2GJXB 4UZUA 4AD0A 3M46A 5ABFB 2DGAA 1J0JA 3WDHA 1VB9A 1DWAM 3L4YA 2EPNA 2FHCA 1RP9A 4JL2A 4QCEA 3DHUA 1I75A 3WBAA 4UQAA 5A1AA 3POCA 1X1NA 4CD7A 3UEQA 1UHVA 1H1NA 3CUIA 1O6IA 2YOCA 3CMGA 3BLKA 6A3HA 3O2LA 2G8ZA 4R27A 3GTNA 4Z2JA 1B0IA 1KGWA 1DTUA 2X2HA 5M17A 1U33A 1TVPA 2WC7A 3W25A 3CZJA 3U5UA 3CZGA 1E4IA 1JYVA 1B9ZA 2J7HA 2J4GA 4U3CA 3TP4A 5A95A 1C90A 3WDQA 1CNVA 3ZSSA 3T09A 3O6AA 1BGAA 5A8NA 1ISZA 1QI5A 2X2YA 3AOFA 2BS9A 1LL4A 1W32A 4AZBA 1AVAA 4HOZA 2EXOA 1GJWA 4J3XA 5BWFA 4CD8A 1PZ3A 1EQCA 4NXSA 5IFPA 2GJRA 2CIPA 4K68A 3W0KA 2YKKA 4HP5A 2OWWA 4IPNB 1XD0A 4AYGA 1HJSA 3ARTA 3OB8A 2YL9A 4CN1A 1VAHA 1J12A 3WH7A 4AIOA 1JD9A 1E72M 4PSRA 1JDCA 3AMCA 3HJEA 2F7RA 1KR1A 1UA7A 4AMXA 3IJ9A 2XHYA 3AS1A 3QHOA 3MKKA 1WZKA 1KBBA 3I3DA 1R85A 3CUFA 1K9DA 3AS3A 2XFRA 4AZHA 1W3JA 5HDRA 1H3GA 2FGLA 4TVDA 1CEOA 4AZGA 1ISYA 1M53A 2F18A 4FNSA 4N42A 3BUIA 4PBGA 3L4WA 3WBEA 1GOKA 2WHLA 3GXPA 4FNRA 3BGAA 2XM1A 3W82A 1SR0A 2VUYA 1W1VA 4PMXA 3K8MA 1OT1A 4GZIA 4UQ9A 4RL3A 3LXAA 1FH7A 4CVUA 3BAJA 3EJRA 1U30A 3D52A 5I79A 1KQZA 3CGTA 2WVUA 1DP0A 1C93A 4J27A 2ZOXA 4OUEA 2DPEA 2D23A 2YJQA 1KTCA 1NOUA 3OIHA 1C91A 1W1TA 8A3HA 2WYSA 3AIBA 3OG2A 1V02E 2W4XA 3ARZA 3CUHA 4D6GA 1QNRA 1CTNA 1JDAA 3AIRA 3FNDA 4W5UA 1DWHM 2DH2A 1B2YA 2XWEA 3WL1A 3AIVA 3VMOA 1IT0A 2YA1A 3HG2A 4M8UA 1I1XA 4C7DA 4QAWA 1UKOA 2D24A 1HL9A 4D71A 2XN1A 1XSIA 4P7OA 1PX8A 5A8OA 1EO5A 4HA4A 2CBJA 1XV8A 1NARA 1M01A 1QBAA 3QOKA 3OLDA 3PZ9A 5DO8A 3BC9A 1XH0A 3DDGA 3ZO9A 2C8NA 1R7OA 2AAAA 3G6MA 1JZ3A 4W85A 3L4VA 3TA9A 1NP2A 1TG7A 4Y7EA 1AQHA 1NP0A 3SUTA 2ALWA 3WELA 2PBGA 1E4MM 3THDA 1JG9A 1JI2A 1JXKA 3UR7A 1UWSA 1UWRA 4B15A 1ZB5A 3HG4A 4FNUA 1WNOA 2J79A 4GO8A 1UR4A 2F61A 4CU7A 2XN0A 5E6ZA 4M56A 5EB8A 4AEFA 5ECUA 4D6IA 1AMYA 4DWSA 1IZJA 3VDBA 4OOZA 1GUVA 1NWRA 4CUCA 5I24A 1SMAA 3AJ7A 1OIMA 2ZUUA 3II1A 4AXNA 2WANA 4D6JA 4DO4A 2ZUTA 3VNZA 2EQDA 3EMQA 3WFLA 2JEPA 2VCAA 3FW6A 2WNWA 5D9PA 1GCYA 4KGJA 4UQDA 3ZT5A 1E6NA 2F2HA 2XG9A 2PB1A 3BLBA 1KQYA 1JGIA 2BV9A 2VCCA 1VFUA 4DUWA 1W1PA 2XSAA 1E3ZA 4MTVA 3RPMA 2DT0A 4ML4A 3F5LA 2PF0A 1J11A 4M82A 5E1QA 3ARXA 4FMVA 5C8BB 2JE8A 4TOQA 4MB1A 3VD5A 5EBAA 4UFJA 2CCRA 2CXGA 1CENA 4P7QA 5E9AA 3A4XA 3LRKA 1H0IA 3BCDA 1FFQA 3MMDA 2QLYA 3DDFA 2GSJA 3CHCA 2CHNA 3EDFA 5AC4A 1LF1A 2E3ZA 4NSBA 1B3ZA 3LPOA 5I23A 3ARUA 3VKKA 5D9NA 3WY4A 5CGMA 4R5EA 3S5ZA 4AZIA 3WQVA 1DWIM 3A4WA 4PMYA 2YDQA 3WUBA 3BVVA 1E6PA 2WMHA 4W84A 2PWGA 3N17A 2Y5EA 3GNRA 4MJ4A 5BXRA 2F7PA 2C7FA 3EDEA 2NW0A 4LYQA 3FN9A 5LA1A 3ZSTA 1FP9A 1PJ9A 3BAKA 1DWFM 4B9YA 4AW7A 2G3IA 3M6DA 3WQ6A 1JDDA 3VOCA 3AIWA 3ZR5A 2XIIA 2WMIB 2YDRA 1CBGA 1Q6GA 3VIHA 1UH2A 4PMZA 4IM4A 2ZUNA 1UH4A 2EACA 1E5NA 3RM4A 3K46A 5FL1A 3GXDA 3S2CA 1R33A 4OBRA 4XB3A 4Z2HA 2O9PA 1OBAA 4NF7A 2V5CA 4P7NA 4KWUA 1Q4NX 4PUEA 3WD1A 1C7TA 3W6MA 3WMBA 1KGXA 1OD8A 3O9NA 2D0GA 1Z32X 1MWOA 3SCUA 2VNCA 4WKHA 5CPQA 4FNQA 1V6YA 2W63A 3PZGA 5KEZA 2WCSA 2RGLA 3BAXA 3GXIA 2E8YA 4FNPA 3RO8A 3AYRA 3F5JA 1VENA 2CNCA 1HKKA 1UWIA 3OLGA 4UTFA 1CXFA 3W37A 3UG3A 1BFNA 3WDJA 2DSZA 3WF1A 1GVYA 5KZ6A 1ISVA 1WDPA 3LX9A 3AISA 4PTWA 3WKZA 2W66A 3WNMA 2VI0A 3EMCA 1EXPA 1XH1A 1EDTA 1R86A 1UR9A 2BXYA 3BUPA 1BGGA 3W81A 2XVNA 4CVWA 1V3HA 2QF8A 3OZOA 4CN4A 3WH9A 4AZCA 4GQQA 4Q22A 4GQRA 1M04A 3EJSA 3U5YA 4URIA 1L0PA 4DO6A 1V6VA 1JZ8A 4M81A 4BF7A 1TMQA 3A23A 4PMRA 1QBBA 1JZ5A 3VD4A 3WUFA 4TX6A 4B16A 2DSWA 2D3NA 3K4AA 5M3WA 4CU6A 1G9HA 1XSJA 3PZTA 2WK2A 5CLTA 4W88A 4C7GA 1GHRA 5C71A 4FLOA 2J75A 3S6TA 3MMWA 4HU0A 3EDKA 1HP5A 3W53A 3ARQA 5HOSA 4OIFA 2ZXDA 2BXZA 1R87A 3A24A 1CGYA 1JZ6A 1VRXA 3F4VA 3CZSA 1LG2A 2BVDA 3GBDA 3WQWA 4LX4A 4B3LA 3NDYA 3WH6A 1HIZA 1GZJA 2JF7A 2YLLA 1EHNA 2V3GA 3U7BA 1V0NA 3MMUA 1WP6A 1BYBA 4P7RA 4MAVA 1ODZA 2D1ZA 2JFEX 4DWSC 4MNJA 4J3UA 4XUYA 4AMCA 2YDSA 5E70A 2E9MA 1UUQA 4D1JA 5F7UA 1GPFA 4S3JA 3WENA 3SUVA 4MNMA 4V28A 4P8XA 4HMDA 3WNLA 3MV01 1H41A 1GQKA 2BY2A 3CH9A 2XPKA 2XUCA 4HU8A 1BPLB 1QI3A 2GVYA 2ZX5A 1FH8A 3K4DA 5GNXA 2YIHA 3L2LA 1BVNP 2XWDA 2X09A 3W28A 1L8NA 3VIJA 1OGSA 4AY1A 2FH8A 2VVSA 1RD6A 1C8YA 2VMFA 3HG3A 1HXJA 1W9UA 2CBUA 4AWEA 1HL8A 4L4PA 1CDGA 1MFUA 4WSKA 3MV11 1BQCA 4Z2KA 2WWDA 3CZLA 1Q6FA 2O9RA 3ZJ7A 1E4NA 2OSWA 1VBUA 1MQRA 3CLWA 1LG1A 3TTYA 3ZOAA 4AISA 3WD4A 5CQ1A 5I3DA 1B90A 3U57A 3CZKA 3FXYA 2DIJA 1H09A 2BY1A 1RPKA 3AHTA 4U2YA 3DYPA 3ZJKA 4EAMA 3AIEA 4DWSB 4AIUA 3GM8A 3VIGA 4RE2A 4NRSA 1HNYA 2VZSA 4WLCA 4J7RA 3BCFA 1Q6CA 9CGTA 3UR8A 3QR3A 3RCNA 3PZMA 2WLYA 1CLVA 4RE4A 3K1DA 2NSXA 4H7VA 4MNKA 2W61A 3AXXA 2CKSA 2BVTA 2D3LA 1M03A 4PMVA 3WSUA 5BYWA 3WFZA 3D5HA 5ABGA 1E6QM 1V03A 3CZEA 3D4ZA 3VIPA 3ARPA 4J3WA 8CGTA 1HX0A 1EO7A 2OLHA 2ZX8A 1EHAA 3OZPA 3T0AA 1KWGA 4MAZA 3AS2A 2PWFA 2VZUA 5FKYA 3UG4A 1UQYA 4MB3A 1BG4A 3RILA 4UR9A 4A4AA 3AMLA 1E15A 5A6BD 5D8ZA 3RIKA 4PTVA 1KCLA 1R47A 3CHEA 2PC8A 2FE0A 3BVWA 4WKAA 5A2BA 1PX4A 3AXIA 4ZENA 1BVZA 1WCGA 2EEXA 2Q8XA 3DC0A 4PMNA 3A22A 1E70M 1TA3A 5DEZA 3WDPP 4ACYA 4JFSA 3M07A 4HA1A 2JALA 4H8VA 2RGMA 2VTFA 2E0PA 3NYDA 5IHSA 2QMJA 3BUBA 5A6SA 3T2PA 2VX7A 1E5JA 2D0HA 2EO7A 2EAEA 1CZ1A 3VTRA 3ARWA 1VF8A 3D4YA 3RM9A 1PX3A 3UG5A 1GOWA 2CITA 4BQ4A 2VL4A 1AQ0A 4PMDA 3GNPA 2HVMA 5CSUA 2VR4A 1C7SA 4GZJA 1VBRA 2W62A 4AZ7A 1UD8A 1B30A 3WD2A 1FH9A 2DSUA 2UY3A 4HMEA 4OZOA 1E1EA 3T2QA 3SCNA 2CESA 4QCFA 3AHZA 4FF5A 4AMWA 4D6CA 3AYSA 1XHGA 3SUUA 1V3KA 1V02A 5FOOA 3N15A 1TE1A 4XX6A 2O92A 1G1YA 4E8CA 1E6XM 2IXVA 2XM2A 1UWTA 3EJUA 1WDQA 1ZBKA 4WKFA 3BMWA 4WSJA 2ZX6A 4AYSA 1CGWA 2A3AA 2A3HA 1OGGA 5FD0A 1HKIA 1IV8A 1U2YA 1V0MA 1E6SM 1E6RA 3VNYA 2VZOA 5BXSA 3AHVA 4LQ1A 1XH2A 1KXVA 1ZU8A 1JAEA 3DYOA 3A6OA 1W3LA 1HT6A 2ZUMA 5JIPA 2XTKA 4ACZA 4AZ6A 3MSDA 1UYQA 5M5DA 2E9LA 2WCAA 1NOFA 3BVTA 1TZ7A 3IJ8A 3VMNA 3QHNA 1X6NA 5IHRA 2WC4A 1TUXA 1LWHA 3W27A 3ALFA 5FCZA 4WK9A 4JIEA 2ZUSA 2XFYA 3TV8A 1JXJA 4BZYA 4WJXA 1NWSA 2D22A 2J77A 4TTGA 3KLLA 1QWNA 4DO5A 3B9AA 3WF3A 2IUZA 2G41A 2VJXA 5HBFA 3VGHA 5BROA 2A3CA 5EMYA 3ZIZA 4AZCB 4FNTA 4PRWA 1I1WA 2IGTA 5D4YA 4F79A 2J7CA 2WMJA 1A47A 3H53A 3GDBA 1WO2A 3CPUA 1OWQA 2ZXBA 1KB3A 3CZ8A 2VZVA 2G4FA 1UQZA 1QX1A 2XVKA 3WD0A 3D3AA 1RP8A 3T0BA 1R34A 5A6AA 1CYGA 5EFDA 3SCWA 3RDKA 1IZKA 2WC3A 3VD3A 1W3HA 4F9JA 7A3HA 2B31A 2CBVA 3DX4A 1HTYA 1FHDA 1G94A 1HJXA 1VJSA 4WF7A 1E3XA 3I3EA 5D9MA 2OYMA 2D20A 3AFBA 2XN2A 1R8LA 2D0FA 4DM1A 1E9LA 4BQ3A 3ZR6A 5A8MA 4LXFA 1QNSA 4KGLA 3MUAA 1JI1A 1QPKA 4W7UA 1QI2A 3ZJ6A 3T0DA 1CECA 3WDIA 4UQBA 1V3IA 5A8PA 3PTQA 2ZXQA 4JHZA 1R46A 3DYMA 3EJTA 2DQXA 5CSYA 1JZ7A 5CPTA 2BVYA 5D8WA 3BUDA 3DX2A 1QHPA 2F7OA 1XCXA 2A3EA 3VSUA 3WNOA 2WVSA 4L4OA 1OSEA 4RE3A 4P8UA 7TAAA 3VGGA 4Z2LA 3LXBA 1DEDA 2BNJA 3PN8A 1ESWA 4W8AA 3WEZA 1LJYA 3PBGA 4Q7NA 4W89A 2GK1A 5AYBA 3VD9A 1SYTA 3DX3A 4YN5A 4UOJA 5LA2A 1K9EA 1OGBA 4CCEA 4S3KA 6CGTA 1JL8A 4J3SA 4LYRA 3DX0A 3A3HA 2OWCA 2J47A 1XYFA 3ECQA 3UERA 5FL0A 1LL7A 1VJZA 4GPNA 2WVVA 4J3TA 3L4XA 1G01A 2V3DA 4W7VA 1P6WA 5CZKA 2X2JA 3WUEA 2UY2A 4NI3A 1KFWA 1VEPA 3N1AA 4TXEA 3MSGA 2OW7A 1B3YA 4UQCA 4M29A 3W6LA 4AD4A 1KGUA 1QHOA 4W86A 2V5DA 2WZIA 4PTXA 3WY2A 1KCKA 1CGVA 3SCSA 4IISA 4NX0A 3RJXA 2D2OA 2FHFA 1J10A 1JNEA 3PZIA 2WZHA 2PWDA 3GXMA 3POHA 4CKQA 4HOWA 1UKTA 2QPUA 1KXTA 2YFNA 2E4TA 1QNQA 3T2OA 4PMQA 3WIJA 2CBIA 3EBVA 3ZJ8A 4PMOA 1BAGA 4JL1A 3IAPA 5AC5A 3HU7A 3VX1A 4GIAA 3EMZA 4UNIA 3QOMA 3B8SA 1CGXA 3KLKA 1W2VA 4PEEA 3WF0A 4AD5A 3GXFA 1GOQA 3FHAA 3CV5A 2JIWA 3AMKA 1MVYA 3ZMRA 2PI6A 3N11A 4EANA 4QFUA 4PYSA 3TTSA 1GW1A 2CYGA 5I77A 4AC1X 1XCWA 1JNDA 3VU2A 4W87A 5A6BA 1J01A 2O9TA 3H55A 1PEZA 3SEPA 1ITCA 4GO9A 2YA2A 1GQLA 1RH9A 2F8QA 3J7HA 1ITXA 3VIIA 4ZFMA 4CD4A 1TQVA 2ESCA 1W1YA 1PS3A 1E71M 3PZNA 1SMDA 1NOWA 5CJ5A 2V3EA 1K9FA 2BHYA 4OOUA 1W2PA 2XJ7A 2DSVA 5CG0A 3VINA 3WNNA 1VFOA 2VR5A 4HOXA 3ZM8A 1KTBA 1FFRA 4AD3A 4W93A 2DDXA 1J0YA 1J0HA 2V3FA 1MYRA 1TA3B 3L4TA 3VDHA 3BH4A 1VEOA 4X0NA 2J8FA 1QWUA 1GQJA 3W4RA 3WH8A 3IK2A 3HZ3A 3LMYA 2QHAA 4BCEA 1D7FA 3NCOA 2ZWYA 1WDSA 4V2XA 5TD4A 4PMUA 3ZQ9A 5A2CA 4U3AA 3WMSA 3AZSA 3I3BA 4TTUA 2WMGA 1WZMA 4F8XA 4M1RA 1OT2A 4TUFA 3A5VA 5BRPA 1GHSA 1DWJM 4HMCA 1WPCA 3NSNA 3U7VA 4E2OA 2EPMX 3ARSA 2WBKA 1D2KA 3CUGA 3GYCA 3UCQA 2E9BA 2E40A 1W3KA 3KL0A 3VDCA 1ISWA 3VILA 1E0XA 1UD5A 4AD2A 3W26A 4QLKA 2A3BA 2GUYA 2J62A 2WM0A 4ATDA 3CZNA 1BTCA 1HN1A 1OINA 5A3HA 2D73A 3QGVA 4D6DA 2VCBA 4ZE5A 4GZEA 1ZL1A 1W9DM 2QV4A 1LWJA 4NZFA 3BSHA 3SUSA 1V0LA 5HXMA 1VFMA 5DT5A 5IXEA 2Y4SA 3BLPX 2VVNA 4DM2A 4JFVA 4N0RA 3AIQA 3NIYA 1TQUA 1D3CA 1WB0A 2OYKA 3MUY1 3THCA 4ATLA 4HA3A 2OSYA 3WF2A 3VGFA 2EPKX 4H2CA 1OD0A 3FY1A 1WDRA 4JCLA 1MW1A 3IANA 4CD5A 5JUVA 2WMFA 4XZWA 1SZNA 1V6UA 2VX4A 1TQTA 1J9YA 4HPGA 4NXKA 1PIGA 1JF6A 4U2ZA 3WEOA 4MJ2A 1T0OA 1US2A 4TVCA 3OLIA 4JKKA 4LGXA 4U5IA 1CLXA 3RMEA 4OJYA 5CPSA 4ATWA 1BHGA 3LXCA 1F4HA 2W5FA 2FYVA 2QPSA 3DHPA 4AZ5A 2AMGA 1E4LA 1EGZA 1WAWA 2J25A 4PUDA 4BQ2A 4HZ6A 1JFXA 3BAWA 5E09A 4X9YA 1UKSA 3OGRA 3SCPA 3CBWA 3LPGA 1NWTA 1NWUA 1G5AA 2WSPA 1UR2A 1V08A 1DHKA 3OGVA 4MB5A 5HNNA 1HJVA 3WY1A 4H04A 3ALGA 5A69A 3CHFA 5BRQA 1MW3A 4EK7A 5CLWA 2WZEA 2W91A 3GH5A 4AEEA 5DF0A 3NUKA 1Q6EA 2AOSA 4B3KA 2EADA 1EDGA 5I78A 3BVXA 2JF6A 2EPOA 1TQWA 5DT7A 2HISA 2WWCA 5A6LA 1UASA 4BS0A 2G3NA 5CXPA 1W9BM 1XGZA 4AIEA 1JIBA 1FHLA 3H54A 1H2JA 3AZRA 4JHOA 3CMJA 4OKDA 1LLOA 2VQTA 5I5RA 3N13A 3LRLA 2X2IA 3BUQA 1GJUA 1NH6A 3L4ZA 3N12A 4OBSA 5E0CA 1LL6A 1C92A 3APGA 3FAXA 1XSKA 1WKYA 1V6WA 2WAGA 3PZOA 2JIEA 1UD2A 1EOKA 3WMCA 3CUJA 2VX6A 4B9ZA 2EABA 3KE0A 4HZ7A 2F1AA 3OLEA 3EDDA 4KRTA 5ABHA 1HKMA 2WSKA 5D9OA 2GDUA 1H5VA 3WD3A 1KXHA 1H4PA 3PTMA 5A6KA 5C70A 2GK1B 3NSMA 4D6HA 5A8QA 1TCMA 2VRJA 1JAKA 4D1IA 1VIWA 4EE9A 2Z1KA 3K8LA 1BYDA 2YBTA 1H11A 2WKGA 3B9EA 1UH3A 1B3XA 2CEQA 1GOIA 1V3JA 4X0VA 1B3VA 4PCTA 4GI8A 3VIOA 3VIKA 1FP8A 1WE5A
chains in the Genus database with same CATH superfamily
2WVVB 5T1DL 1HH6A 2WSRA 3P93A 3ABZA 3CWNA 1A6UL 5D37A 3MU7A 4A6YH 1K02A 2CM6A 5MEQB 5EU7E 1ZIAA 2WJ5A 4TX8A 3L5AA 1BYNA 2OYLA 3E0GA 1RBOB 3GHTA 2A6DB 3FZUD 5GGRY 1VGAA 3MRNB 2ED7A 2HS6A 4HJGA 1WS7A 4XPGL 3PJTA 4WEMB 2E47A 4H1LB 1BWVA 1Q1PA 1CQYA 1N9PA 2VT0A 1CD1A 4PRNA 3NQVA 5ETUB 2BVPB 4LDOB 4X5QA 5HVHC 4Q9QL 1IGJA 3GZKA 5I2UA 2DW5A 3F6IA 1XXFC 1WISA 2UY5A 1RPXA 3WK3A 4A7TA 3GXNA 1CXIA 4NGHH 4ZOBA 4MA8H 1SJHA 4X4ZA 3UADA 3HAEG 1LE9A 1J0KA 1EEZB 1BA9A 3ESVF 3J07A 3B3BA 4GVFA 1MF2H 2XGIA 5FK9A 2CM5A 5C7XL 1T3FB 1OPGH 4G5AA 4K3DH 4XC3H 5CSSA 4C6NA 2TRYA 4QPEA 3LS5H 4F80A 4E9SA 3EO1A 2V38A 3OBAA 3CAKA 2A0LC 3N85H 3V10A 4XTIA 3FCPA 5DMYA 5AALA 4XZMX 4GI4A 4MDIA 4JN6A 1EJRC 2X8RA 2IH3A 2CLMA 3TXAA 2OQYA 3W7EA 1O6SB 3E1F1 5EOQH 5I5IA 5D6CA 4MMWA 4HT1L 4POYA 4NAQA 3Q94A 1KC7A 2BX7A 1A6TA 2NNCA 2CIIB 1XLLA 4MADA 3DO7B 5L4FA 4YDJA 5D33A 1TSIA 3O8XC 3O41A 3W5MA 4JN1H 5CEXB 3MCYA 1QAWA 5CPMA 4RAUB 1VERA 3GSQB 3FH5A 4MNLA 2WMKA 5DZVA 4NP4L 4XD4A 3LM7A 4Y9BA 4KZCA 4O50A 4W7WA 2BTMA 4J3OH 2DDQH 3LBOA 3IPWA 3GX9A 1GZPA 4H25A 1YN7B 3VG0H 2FR4B 1HEJC 3V4VB 4ZS7H 2H90A 1TO3A 3T65B 2XG4B 1MCFA 5IMMA 3H7LA 4D6EA 2HZGA 4UT9A 2HJLA 2YSWA 4Z95L 4L8BA 3OVGA 4ZTEA 1I7UB 1CIUA 2JKNA 1KCRH 4FG6D 4MXVF 2NY2D 3CBJB 3TF4A 3AWEA 3Q5YA 1ZCCA 1NCHA 3MXWL 4GRLD 1Q63A 1XDLA 2MKLC 4HMNA 3R1GH 3VFSB 2QJNA 2ZKWA 2A74B 4DIAA 4LP8A 3QW3A 5FW8A 5CEZE 3NFNB 1TKWA 1NDVA 1XD1A 1RULH 5J11B 4PUJA 2QGHA 4NAJA 4DGVH 4UTWA 1Z0MA 1WAPA 3AWFA 2CUAA 2DI8A 4P2YA 1OFQA 4E41E 2WXGA 3SCVA 4L37B 5T8GA 5I18H 1OAUH 4YUEH 4WDTA 4JZJA 1WBXA 1IE4A 3ARVA 4PJDB 3TA3B 4FL4C 1HHIA 3DOPA 5DMIH 5F21B 5GSRA 1DQMH 3D50A 3QRFM 2NYZA 5F1VA 4OLXH 3UETA 1BQKA 2RGSA 1TZIA 2VXQA 2EBNA 4TSAH 3HHMA 1DIEA 3GIZL 1BYCA 2LW3A 1XB3A 1CFMA 1Z7AA 1JCTA 2OZ8A 3V2AR 3LNPA 3KPRE 5BMFH 3EGSB 1MFAL 2RCSH 5L9DL 5FWQA 3WL0A 1OAYH 1T6WA 2QDEA 4MM1A 5I6NA 2R15A 1S3HA 2Z64C 5D1XB 2LE9A 4IRSD 4FXRA 4MXWH 3RWIA 4P46C 3B7UX 2I07A 1MUJA 2E27H 1O9VA 4LEXH 5D7HA 3L3DA 1TWWA 2W88A 1TZ9A 4U0RB 3US1A 3Q1SH 2B5IC 4I2XB 3FT2A 5FFLA 4J8RA 5BZXA 4M9OA 3HPFA 4WTZG 4QJ4B 5HWJA 1FA2A 3AHYA 3UNTA 1UFGA 1W91A 2BOEX 4N8VB 4UT6A 3LZ3A 4WO4C 4AGOA 2BY0A 5I82A 2X1OA 4LU0A 4W81A 3BRDA 3POCA 4M43L 1H1NA 2YOCA 4O02L 1S5NA 3ZTNL 4FZ8L 1YX1A 3O2LA 1Q5MA 5ISZA 1RXLA 4TV5A 5ENWA 3LH2L 3OBEA 1LK2B 1JYVA 4AV0A 1FY6A 1CBJA 4TIMA 4PCFA 3CCHA 2PYEB 4X5WB 4JANA 2O6CA 5DBTA 3O6AA 3BQUC 4X5PA 3IFOA 4AYFA 5TQ2H 3LD8C 3UWEA 1H63A 4M51A 1AW2A 4FX6M 1R6WA 1FV1B 3FCUB 5BWFA 4OAWB 4NXSA 1OXYA 3BDXA 3FFCE 4ZMLA 4H26B 4MJIE 1A02N 2PDNA 3BZ4B 4LCIH 1CU4H 3MV9D 3D3VE 4NLHA 1JGLH 1MCPH 3OXRB 3FB8B 3O3EB 3TEZA 4RPQA 3WE6A 4D7PA 5KETA 3V6OE 4HJFA 4ZD3L 1XMWA 1ZANH 2BP5M 1IJ9A 2YGVA 5T9BG 4XZNX 4YHML 1HNFA 4YSAA 5EBMB 1M53A 2K9UA 4NO5A 4RGOH 5ESAB 3WBEA 1GOKA 4J35A 1BVOA 4Z78A 3ISWA 1QLEB 4PGBB 3CK0L 4BFJA 1WDDA 4LDCA 3V0WH 3BK0A 4QKTA 1UWFA 3CLFH 4J27A 5CFAA 1UM5H 4C56D 1NOUA 4U1HA 8A3HA 3PL6B 2P46B 4GRLA 2W4XA 4BWUA 1JHKL 1H50A 1RD5A 5K2ZA 4G7QB 3SECA 2XWEA 1F5ZA 4LBAA 1T0PB 3HG2A 4F3FA 2O5YL 1ZEAL 2X1WL 4JHAH 4X80L 4MNGA 3LKSA 2X7LA 1RK0A 4QRUA 3MRGB 2G2PA 3K6DA 4JM4H 5E94A 2NZIA 1IGTA 4AQ1C 4TX9A 3SUTA 1K70A 4OU1A 2YPKB 1JI2A 5HYEA 4JJ5B 1T5KA 4LVAA 4NLAA 5T3XH 4P5UA 3OMZA 12E8L 5A6IA 3WLJA 5LIYX 4JQVA 4ZVJA 1NGWB 2H47C 4C60A 4F2UA 2KZHA 4JO8A 4HV8B 3ZTJH 1TJ2A 4C58B 1KIUA 1UW9A 1J1PH 3EOBB 2C7UA 2Z26A 3EMQA 2I85A 4YNYA 3TBYA 2PO6D 4O13A 3DAQA 1EAQA 1KDJA 3WN5B 3W85A 3ECVA 4M93B 1JGIA 1VFUA 3BRGC 3DX5A 4XP6H 2XZAH 1XLHA 4IRSA 3ZWTA 1MZHA 4DP0X 6FABL 1CR9L 1RZKL 2Z65C 4FN0A 4NZRL 4X5XB 1I0BA 1OTSD 2ZVRA 1DBML 5LZLA 2XZQH 1SUHA 3BHBB 3S5ZA 1XT5A 3EOTH 5B38B 5I16B 3HBQA 2F15A 2XT1B 4F27A 3FK3A 3P9LB 1Q90A 1I9RL 3FYIB 1G6VK 3NQGA 4B9YA 4DHGA 3U4FA 4AQLA 2VM4A 5GJSL 2QQQA 3WJXA 5FECB 1KTDB 3R79A 3JR2A 4NNCA 4E9TA 3KRZA 4A8IA 2V5LA 4EDWL 5GGRA 4KJPC 2DRUA 2Y0FA 4FXKA 4AKQA 2NY1B 4LW7A 3P9WB 3GI9L 1KG0A 5DYOA 1MWOA 2CWNA 1EUTA 4WKHA 3V7AE 3P74A 3BZJA 5KEZA 1FBIH 5CBAA 2J8HA 2KMWA 5E00B 1N59B 1AHWC 1NOAA 2GAZA 5E4AA 5FKPB 3RJDA 1N0XL 4X7TA 3MV9A 1ALDA 2EKGA 1EDTA 1PFCA 1IM3D 2DQTL 4B9GA 3UGVA 4BBWA 1QATA 1SO4A 1UC5A 4JS7A 4KXZI 5GGQH 5K39A 4PMRA 5LHEA 1SF3A 4Z5RA 2PE4A 3BT0A 3G8RA 3WFAA 4MG4A 4AY7A 1FWIC 4WUIA 2X4PA 2C9AA 5GS0C 2UWEA 3QJQB 3RIAK 1M71B 3T8VA 3TXZA 3A24A 4C56A 2XV0A 3UZEA 4F5CE 1EWDA 1M2VA 2G2RB 2XQ0A 1CF8L 5JORB 1HIZA 3VRLF 1XGUB 1IUZA 4NKIL 2PW1B 5DBUA 1AFSA 5K1VA 5JO5A 2Z7UA 1J1XH 4WHTB 4YDKL 3WJMB 5D1ZI 4HWZB 1NMAL 3LPWA 1YY9C 2D4FA 1FQ9C 1X8CA 5F9WC 3D2TA 4JMNA 1BYOA 3WENA 1KBLA 2FX9H 3ETBJ 4LUSA 1F3RB 1QO3A 3WUWA 1OVDA 2AZUA 1IMHC 2FJHA 1E6JL 3URAA 2XFGB 4F57L 4LAOA 1WIUA 4JZNB 4H8WC 5LXVA 4MNQA 5EUOF 2VC7A 1MFUA 2YCKX 7FABH 3WTUA 4O0KA 3CZLA 3CWGA 5F6HI 3A12A 3NCXA 3TPKA 3MLTA 1VBUA 4M7TA 3I6SA 4Q7BA 3MGAA 1ACYH 2V2TB 1GC1C 3MRIA 3C2AL 2F6AA 3U2SB 2Q71A 1GXEA 2A3TA 4OGXH 3O6ML 2QZQA 2PO6A 4GUGA 1T80A 1NIBA 1CI5A 2IQ9L 3S36X 1VLIA 3D5HA 2GWNA 4HYVA 5I75C 2DLFL 8CGTA 3KM8A 3I2CL 3KDMA 3E2RA 3L1OL 1NEZA 1Q9KA 3UNDA 2LR4A 3W02A 3SKOA 5I06A 1NLDH 5LKYA 3LNEA 3BO8B 2PC8A 5F3BA 3NVTA 2GK2A 5JPNB 4HC1L 1BVZA 3SHSA 3KBHE 4CDGC 3GINA 4FIRA 5G2NA 2UXGA 2O56A 1CF1A 2QPFA 4JNXA 4OIAA 3IYLW 5I66A 2IW0A 2CH8A 1CZ1A 2JJUA 1VF8A 4PREB 3D4YA 3BKYL 3ZTCC 3SQMA 2C3HA 5I8CA 1AJ7H 1AY1H 2PD5A 1FH9A 2JK5A 3GRWL 1E1EA 3T2QA 3ARBC 3SY1A 3FTXA 2CESA 1NWOA 2CHZA 3AYSA 4G82A 3QIWC 4HHHA 5GGUA 1K8YA 4D8PA 1UC4A 4IBVA 2AEIT 3CFCH 2ALDA 4I1NB 3QYQA 3P0XA 4M62H 4GY7A 1NGPL 2IDCA 3OA3A 1KB9J 3MC0A 1F3WA 4ILDA 1BZ7A 4Z0BL 4Y1SA 3A6OA 4L1TA 3UEZA 2OL3H 4AV4A 1XIMA 4K7VA 1HT6A 5DJ0B 4Y2DB 4N3TA 5M5DA 1I3GL 3IJ8A 4I7ZC 1X6NA 3JT0A 3A64A 2NQ5A 2GITB 5FGBA 1IM3A 4FERA 2ZUSA 2Q8AL 1SJEA 3FT1A 2F53E 5ANME 2J77A 4X4XB 4E41B 1U8HA 3QAZC 1NDMB 3WCYA 3VG9C 4PRDA 5EMYA 5E8PB 4YU1A 4M6ML 3SKJL 4DTGL 2QHLA 4WQ6A 5IFJA 2VENA 1ECYA 1PTAA 3WD0A 3VRIA 3VKBA 3KPMB 3I7RA 1E4WL 2X4UB 1VJSA 3GR8A 9RUBA 2IQAB 4PTTA 4AGQA 1AQKH 4LSRH 1LBFA 3KPRB 4K9EL 1OP4A 4R90L 4PBWD 1MREH 1QSFE 2K4AA 1X5JA 1E5YA 1AG6A 2YKLL 4CCZA 1QHPA 5F6IC 4JDZB 4MZ3A 1WDAA 1OOWA 4JHBA 1WHOA 2OX5A 1DEDA 2CR6A 2EEDA 4FOJA 3VD0A 1LJYA 4Q7NA 2GK1A 1SXZA 5D30A 3CFBB 2X4TB 1GYAA 3VZYA 2PLTA 4S3KA 4LQFL 6CGTA 2ABAA 4JM2C 3LN5B 3UERA 4KJYB 1RK1B 4J3TA 4OCXH 4F9PA 4MF4A 4RNHA 1R5IA 4ZW6A 4YXLH 3FB6A 1YBQB 4FABH 2J1WA 2D2OA 3QXAA 1EEUA 4U6VL 1XXDC 3DXIA 2Y5SA 5C6TL 4H00A 1ZHAA 4CKQA 4Z3HA 2YFNA 4ZTPL 3MYOA 1P69B 2R0KH 4ZQPA 3ZJ8A 3THUA 3INOA 3RIAF 1AUSL 4K94C 1P4IH 4JO4L 3FHAA 3L3OA 5H8UA 3LNHA 1QEWA 2VSMB 5ABAA 1WKDA 1I7TB 4Y5XA 3T4YB 2A73A 4HTBA 2WXIA 1H7XA 4D9PA 2FJFA 4A8LA 2F8QA 1OSYA 2P7TA 1H8LA 2DV0A 1BBDH 4BWLA 4AKOA 3H2OA 5DVOA 4RJEA 3FFCB 3BEWB 4MJIB 1NBYA 3V4VL 4A3UA 3FA4A 2FK9A 3OL2A 4KDTA 4RIRA 1Q9OB 1KTJA 3D3VB 2DMKA 2VR5A 3PBUA 2R0ZH 1FNEA 5J12B 5E8EA 3NSYA 2NW3A 1A5KC 1JTTA 3K81A 5DHMC 1AMXA 3CFJA 4HZ1A 4Z7OF 3PJUA 1CFNB 4LF1A 4PFEA 2XU2A 2KQNA 1WPCA 5AW6B 3U7VA 4KV5E 4RNIA 4WWKB 3UCQA 2F8VA 3FFDB 2HTKD 3H3KA 1IU1A 3F04A 1UACL 4P4KD 5E7BA 4IGMA 1NVMA 3G1YA 4AQAA 2D73A 4PTUA 4GZEA 4Y2OB 3G1AA 1V0LA 3EFDH 1M3IA 1OZMA 4N2BA 2QDHA 2VVNA 1IT9H 3PGFH 3KPOA 1SPQA 1GOHA 1YDPB 1IL1B 1DANT 2QQ6A 1W8SA 3V5HB 4H2CA 3FY1A 4ICWA 2EJAA 2DJSA 4MCYB 4ZOAA 4XAFA 1G6RA 4NKOB 3WEOA 1T66D 5HHMD 3T8XA 4BFIB 3JBG7 4AWSA 2E7BA 2NQJA 1Z8AA 3O11A 5DURB 2OI9B 3G6JE 1ACZA 3L67A 4PUDA 3HRZC 4HZ6A 3BT2L 4J5VA 4IXXA 2WSPA 1LJMA 3OGVA 3GQYA 1DDTA 3H3PL 3Q2CA 4HCHA 3S1VA 3OD3A 3SE8L 1YCSA 3GH5A 2AGKA 3V0VA 4XP9H 1N8WA 3SI9A 2YD4A 5F1OB 1ZFJA 3ZDZE 1F3JA 2QQLH 2VQ1B 2BZNA 5SWUA 1ADQL 1UASA 5SWQB 4MCZB 1XR9B 4N9GB 4GAGL 2FFCA 4OZIF 5D09A 3H9SA 4DJDC 1WKFA 3UX9B 4X6FA 4XNUL 4I5UA 4DKDC 4DBWA 3QRGL 3TZFA 2XFWA 1TVHB 3QR1A 1K1DA 2E28A 3L66A 4OCMC 1J7VR 3VUSA 1X7IA 2NV9A 2D3JA 4LLQB 2H9AB 5FACA 1GOIA 2BJML 2XFXB 4PCTA 5EIIG 3ALXA 4EUPB 4ZTOH 1L9RA 3LQAC 4U1NA 1QBLH 4WWPA 3E74A 4Y9CA 1BKSA 7ENLA 4WI3A 4LSTH 2G9KA 4GIOA 1KCSH 4MDJB 3ERPA 5TK2A 4GUCA 1HG3A 2B20A 4RVBA 3ML9A 4LC8A 3ZT7A 6TAAA 3A47A 1UGKA 3ZR4A 3V1PA 1YPFA 4KERA 4XNXL 2ROXA 1K4GA 1RZ7L 3SKNA 1U1UA 4C91A 1LQBC 1P6AB 2PP1A 3TSBA 2WNNA 2XLLA 1CXEA 2JKRM 3TVMA 3ES6A 4HJJL 2XIOA 1AODA 3LKNA 3W1XA 4K37A 3NTCH 1IBBA 3MI6A 4XZ4A 3VIMA 4ZBJA 1QQDB 4HQVA 5H2ZA 4NUMA 3TAKA 3QXDA 3VW3H 5FHBH 3OODA 3VI3F 1JPFA 4N2MA 3OGSA 4QDWA 4GXPA 1PKOA 3QEUB 3QN3A 1WUZA 3CDGB 3C6SA 5E8OB 3KLHC 4O0QA 1UCBH 1T89C 1EVTC 4JEGB 3FTGB 2PAJA 1JSYA 4JZ5A 3WIIL 1UKQA 4P4KA 4V27A 3KDOA 5TPWL 4H5SB 1TPUA 2X0SA 5I6SA 2CETA 4JDEB 2R24A 4ZPTB 1G7HB 1C08B 4FLQA 4F15B 2PD9A 1IQWH 5G1YA 4PWKA 1PTDA 3DGGA 3FK4A 3NGBC 5I76B 2D69A 3EWXA 1AS6A 4AM0A 3V9CA 5KJRH 3FXGA 2XI9A 3EADA 2VKZG 1OF2B 1SHMA 2Z2BA 4YHEA 4JPVL 1OGTB 5AKSA 3T42A 3WK0A 1V8HA 3WU1A 4I5RA 1IAMA 2D7NA 1AKJB 1GOGA 2I9LB 2AV1A 3MV8D 3VCNA 3U4KA 1YJDL 3BW3A 2DQCL 2X6UA 4BJHA 2J7DA 3MP3A 1UWAA 1NUGA 1IGYB 4JM2F 3Q45A 4YTRA 3E3HA 1TFVA 4G1EB 4HWEL 1JV2B 2YRLA 1VYRA 4P5SA 2YPVL 2WGNB 3K2MC 4RGNE 4S3EA 3L9EA 4EPKA 1D7BA 4JKLA 3M86A 3P4LA 4M80A 2EDLA 4B5EA 2JEQA 4NILA 3CVDA 3LG3A 2CUIA 1WA0X 2IWGA 2CZVA 3MZNA 4H44C 1CE1H 2SEBB 5SWSE 3MW7A 4E0RB 4I88A 4BCZA 2NYYC 3D5OF 4H8HA 1YRRA 4JDTL 3NFSL 4JB9L 2DTML 1E0TA 1BQHB 3BXWA 1KB5L 5FUCC 1FL3B 2G5BA 1CJYA 3COOA 1MEWA 5J6GA 3RU8X 4BKLB 2P50A 4F91B 3WXVL 2YLAA 1Z5LB 3MOBL 3HAEA 3HI5H 4XZLX 5E99L 4LK4A 4E5XA 1VCBC 1KGYE 4GKNA 4OGQC 4ZODA 1JZ2A 2CLKA 1XL4A 5G5DA 4Q8UA 3LTYA 5JW4N 1HWWA 3E38A 1NGZA 2EXYC 1NEZG 3W5NA 4XT1C 1O66A 3I9IA 3T40A 4CMMA 2BHUA 5I30L 5DC9B 5GRUH 4N0UE 3RLVA 3WLQA 4TTDC 3CQJA 3U9PH 1FWGC 3HUJF 4IIZA 4FA8A 2OXHB 5CD5C 4EKJA 4QEEA 3NG5A 2YOAA 3OSKA 1GK8A 2Z8RA 1H15B 5EGRA 1AD0A 3REQB 4P2QE 5HJDA 1EAOA 3BJSA 2ZICA 3RGVC 4PGDB 3MP4A 1HQ4A 4XZBA 4UOQA 4P2AA 4IKJA 1HVXA 3GS4A 4TXVB 5KYWA 3DPBB 4XPAL 4M0XA 3VRJA 3BPOB 3Q1EA 3GIVA 3ME0A 3JTSA 4GI9A 4O02B 3QORD 1A5FH 4IEFA 4ZFFB 3SE3A 4G7YH 1H0GA 1JVKA 1MQQA 2TPSA 4P8VA 1GVIA 5TF1L 2F53B 4XH2B 5ANMB 4W9CC 1QOXA 3DIFA 3K8KA 3GHBH 3G6AB 1NDGB 3RI5K 1ED3A 4Q7IA 2H6UA 3GK8L 2AERT 1T41A 3EH3B 1CPUA 2ZUWA 3VK5A 3RLGA 2D7PA 3IETB 4KK6D 3U46B 1JQVA 4YIQB 2V33A 4KJWC 1DWAM 1P1ZA 3DX7A 4NRYB 1C5CH 4M9PA 2JKEA 1CFQB 4DPRA 1W1A1 2UUDH 3M64A 4CD7A 5HHNB 3AG4B 4APQC 3FO2B 4AE0A 3QXUA 4JPKL 2G8ZA 3TC9A 4FR1A 1U33A 5L0QB 4LYKA 2H6PB 3ZHDA 1AXTH 2R7EA 5DCDA 4IIFA 5A95A 2I16A 1P43A 1QSFB 4X6DF 1NUDA 1I8LC 1EKOA 3H7RA 1FDZA 2DU2A 1QI5A 4HAFA 4R85A 4KU1A 4JQXA 4HOZA 1XBYA 4BH7A 4Q14A 3ZL2A 3BP7A 3MV8A 4ZOEA 4V15A 4K68A 2GOUA 4FQCH 2PPEA 3D69B 5A2IH 1Q38A 1XLBA 4CN1A 3AAMA 2DZXA 2PF8A 1P1MA 1KR1A 3FO0L 5B7YA 3G5VB 9XIAA 1K3IA 3QHOA 4ABUA 3NACH 1H6EA 1J5IA 3HTWA 1OC5A 5IW1A 1YEHL 4N2OA 4U05A 2A99A 5CKGA 2JJTA 5HY9B 3VFOB 3T1FB 3GXPA 2I5YL 3K4ZA 1RBAA 3SPCA 4BZ2L 4PJXA 3K91A 3EYOB 1JMXA 2FNWA 4KS0A 3ELAT 4ALAL 1XRFA 4O16A 1INDH 3WI9A 4CILA 3QUMH 1UJ3A 4ADGA 5AG8A 2ZSWB 4OUEA 4P9HL 4MYXA 1ZV5A 5ESVA 3MCNA 4M6VA 3B0UX 4LVGA 3M0ZA 1JUBA 3CUPB 3OHMB 3B06A 3CUHA 1KGIA 3DI0A 4NNPL 3OKEB 3MRRB 3GDCA 3OKOA 3SYOA 4NENB 2ZXWB 1LQ2A 2F8IA 1W72H 3R4IA 2YWYA 1FCBA 4P7OA 4GNJA 1D9KC 1EC8A 5T91A 4WTZA 4QR7A 2ZRYA 4D0CB 4LLUB 3RITA 2AJ3A 1KRAC 2A9NL 4YEFA 3ONCA 3CIAA 2VMJA 3GKWH 1ZLSH 3FB5A 2K8MA 2LHAA 4JTFA 3EGDA 3UDWC 1I9JL 4XBSA 1AGEB 3D87B 1KSRA 5FYKH 1S7WB 1CT5A 3UR7A 4AQEA 3VOHA 1UWRA 4B15A 4GW1B 1KV7A 1ZB5A 3IVSA 1BJMA 5E24E 4IQEA 3MUUA 3LB0A 2IMMA 1CWVA 3VCLA 1GUVA 3Q4DA 4LVHB 2ZT9C 3NPXA 5CEZL 4DO4A 1P5BA 1T6MA 4NWUL 2EQDA 2ISSA 3E7JA 1RJQA 3Q65A 1OCJA 1ZE3H 1CBVH 4QG6A 3SGDH 3NEHA 1E6NA 3VA6A 2PB1A 4F33B 1F90H 1GZGA 3MRKA 4ELME 3F5LA 3W3BA 2PF0A 3MV7D 1EXHA 4E9YA 4PU2A 4N28A 3BOXA 1ZS8B 3QCTL 2JIXD 5D1QE 3W6YA 4V1DD 3PWPD 5DHVB 2VD8A 3IPFA 1I6NA 3STEA 5CJXA 3FQNA 2YCLB 3KCOA 1NMCB 4U1GC 2XPGB 4HPOH 3ARUA 3KP1A 1XGTA 3OHXB 4JJOA 3VABA 3N91A 2V7NB 2Z7GA 1KEGL 2J8TA 3G6JB 4XXDB 4GQZA 3ARGC 1TPWA 4XO7A 4Y5VC 3ZR5A 5J6HA 2WMIB 1PZAA 2BOFX 1IEQA 4N26A 1VH7A 4WHCA 3IMVA 4XNBA 3TN0B 3GXDA 3M0YA 4NF7A 3ZDZB 3VYNA 1COBA 2PURA 4CJ1A 2Z1PA 1KCVL 3SGKA 3APTA 1Q1JL 4M7KL 1IVTA 3G2GA 3F5JA 3K71A 3E0VA 4KWSA 2CNCA 3GSNL 4UTFA 4RR4A 4XC1H 4TVPH 3QPYA 3TH4T 5I8OH 3CXHJ 3E2SA 1VACB 4HS6B 4FZEL 1CFTA 5KMYA 3GDTA 4JN2A 1SJDA 3SDXE 2ADJA 4WW2C 3WKZA 1IFHL 4KEVA 3FH8A 4IIGA 2DQDH 4PG9B 4AQOA 1R86A 2BXYA 4HZLB 4AYMC 4GIPD 3RWCA 1GGOA 2A7RA 1V51A 2HTLC 3DHDA 1ZENA 3KZ8A 4DO6A 3E9TA 3ITOA 1N19A 2OXGB 5DU7A 3BKJH 3OEXA 5E2JA 4E36A 2Y0SA 2Y7QB 2O4MA 1GKEA 1F6LL 2XA3A 4I87A 1R87A 2C3ZA 5A5WA 3FT4B 3O05A 1JZ6A 3VWKD 3MLWH 3V35A 4HW6A 4FFWC 3MA9H 4OZFA 3RVTC 5IOPA 2X0WA 4IKLA 2DQ6A 3DARA 2VDIA 1I1AD 1J96A 1S7SB 3O6CA 1FZJA 5D70H 4KY1H 2H3NA 1UUQA 2QLVB 2DEYX 4KNQA 3RTQC 1M05B 3DUSA 2JWYA 1T83C 3UGUA 1OAXL 4IMFA 4PRBB 2X89D 2GIXA 4JGUA 2X1TA 3A9BA 2X1PA 2XG5A 1KYFA 1OSPL 2B4CH 1J05A 1C8YA 2IWEA 1BEUA 3CSFA 4R7DB 3SSJA 1SM9A 3F85A 1R3JB 3IUIA 2R0LH 1MFMA 4ODHH 4C59B 2GC4C 5D2WA 1PSCA 3O16A 4GACA 3N2XA 2DIJA 5CLZA 1RPKA 3PWNB 2HB0A 3AIEA 1SZRA 4DWSB 3PE9A 3VXTA 1ZTXL 4Y4HD 1UTDA 4PV8B 2FDBP 3IKCA 1IC0A 2BNRD 3EH5B 4YXGA 3BCFA 2ZKHH 4JX0A 1MFCL 2Y36L 5T3ZE 2UZIH 3KLAB 4EI5C 2W0LA 5E2VH 5MEND 4DETA 4DBUA 4AW4A 1AE6L 2GY7B 3MV7A 3W39B 4L9LB 2XNAB 3O45A 1T04A 3QARA 1VGKB 1EHAA 2FECI 2JIXA 1QFPA 1GCFA 3PWPA 3UG4A 4JN7A 2QCNA 1BG4A 2J6XA 1UWXH 4H6QA 3LAFA 3PFMA 2K4WA 2Y62A 3NNTA 4WKAA 3TV3L 2PNDA 4ZT1A 4KEZA 3V1HA 2VXSL 2E6FA 3ZE1B 3MNDA 5KVGH 3SR7A 2JALA 4PMFA 2QMJA 1H62A 3B9OA 4H4NA 5CUSH 3JUYA 2FLRT 4QTIH 2ZYSA 4QHNB 1KOAA 4RGNB 2YS4A 4I77H 2CAKA 3D85D 1WIOA 2HG0A 5HHOE 3DROA 1AL7A 3SCNA 3D09A 3OAYK 3RGBA 1SU5A 4FF5A 1EZWA 4XMZA 4BFKA 1IARB 3AG2B 1LNUA 3PUGA 3LGEA 1IGMH 2GQ9A 3C08L 3NAAL 5FOOA 4XO8A 5SWSB 1E6XM 5F9JA 3SO3B 3PUCA 2OM5A 2E9JA 2V0TA 3MLYH 3OZ9H 3UVAA 3R13A 5BOFA 3WXWH 3HLKA 1ML1A 1WUFA 2VEGA 4FPSA 3L5HA 1JAEA 4ALDA 5BS0E 5AB3A 2WMPA 3BPLB 3U48A 4BRJA 3L5WB 3TN5A 5JIPA 1FSKB 2AFNA 1UXWA 2ICWB 3W71A 2OZ4L 1SNRA 4US6A 5BV7B 1QTYT 3S3PA 4WY7L 1IEHA 2JJSA 3EYFB 2OZTA 1EMTL 4GAYA 4OTKA 1QU4A 4YPGB 5IV2B 1KM5A 3II2A 5D7LD 4E5XG 5A7EA 2WMJA 1HO4A 4TRPL 1WO2A 4N0UB 1OWQA 3ABSA 1PKNA 3VA8A 2VZVA 4FD0A 1IC5L 1HHJA 2FKPA 5C7HA 3SCWA 1IZKA 2HX8A 1R5WA 2LLNA 3VD3A 3ZVHA 2B31A 5DJ8B 1QPPA 1QTSA 3VWKA 1QNZL 1U58A 4U1SA 4KZEH 1KIRB 3UPRB 3IV3A 2WTPA 4K3JL 1OF0A 5LG1A 4KGLA 2FT7A 4PB9L 4P2QB 3U4AA 4XCCL 1SFHA 2DMCA 1T1WA 2GC7C 3P30L 2B08A 3QPEA 3EYUH 4BXSV 2ZRUA 1I1AA 3PTQA 1CGSH 2CJUH 4TNVK 5J6SA 1IJNA 3X2QB 3L5XH 2CBQA 1GIGL 1AIFA 1A3LH 2ED8A 4ZW3A 4G6FD 4RE3A 4FNLH 5FYKU 4JX4A 2X89A 3KYKL 4GG6A 2BASA 1R24A 1VFLA 4G56A 1FHUA 2PDWA 2XBTA 1NBVL 4ZMWA 5IK3B 4HSNA 3UP8A 4JO2H 3FUFA 2MNUA 1TVLA 1GEHA 3SBRA 3MYJA 4WJ8A 5FM5O 4OFDA 4PG2A 4L2YA 5JR1H 3GY1A 4LASL 4Z7VA 1R1CA 3IGXA 5HDQH 4AD4A 1CURA 4CNTA 4Y4HA 5IB4A 2K7QA 1ZHKB 1CYWA 3H4XA 2BNRA 3PSVA 3TJHC 3DXAD 1R3QA 1KXTA 1QNQA 2R59A 5MENA 3EBVA 3GMLA 3CX5J 2VDKB 4DVOA 2D03L 1D5MB 5I9QC 3EKLA 1D5RA 2ITCA 2XTJC 2C4FT 4TNWK 1Q9LB 3FSVA 4XBPA 3GBML 4GO9A 5KG9A 1C29A 2TRSA 1XLFA 4OCRH 4FA7B 3TYDA 1I1YB 3GFZA 5DCEA 3SY0A 1VYSX 2IXQA 5CSZB 3QYMA 4YTQA 4AF0B 4WW2F 3O8AA 1MHEB 2AEPH 4LLMA 2FQDA 1KJ2H 4W93A 2NYKA 4IBQA 5F3FA 1TA3B 4NQDE 1VFBA 5FUZL 4HCDA 1T5XA 3G18A 3MXVH 3D4GA 1UCTA 1FL5B 4LCQA 3D05A 3KBNA 3D85A 3OMAB 3O2WH 3WO8A 1E4XI 3DI1A 2OTWA 3RUGA 4F58L 2Q1EA 4XPTH 3ARSA 5JNYB 2PWVA 3MR9A 1W3KA 1DFXA 5E56A 4IL0A 1A1NA 3KP0A 1OINA 3L4CA 1N2RA 1ENUA 3S9YA 1LK3L 2OMUB 2MCPH 2BO0A 2NPLX 3MNVA 2CJ3A 2CSPA 3CHQA 4DBDA 3QIBD 2X38A 3DFSA 1YEYA 1Y0LA 1HIML 1WHPA 1OHQA 4LNVA 2X10A 3FYYA 4YHNB 2IVFC 4Z7WE 2Z7ZA 1UADC 2I5GA 3N9RA 3WF2A 2G37A 1IR1A 5I73B 4CD5A 4G9FD 4MXQC 1K4HA 3ERXA 2J4WL 4UQ3B 1LD9A 3O0RH 4PH8A 5GJTH 1A3XA 2W5FA 5D7LA 3DHPA 2ESVB 4FFZH 3PQYE 2GOKA 1T8QA 2WJZA 4OI9A 3TCLB 3FTWA 1NWUA 2HN7A 4KROD 1FRBA 4XN2A 3WLWD 4Q6IC 5D6DC 2WZEA 2CALA 4U1JB 3P67A 3A5FA 4YDMA 3O6FD 1EPVA 1C16A 4BKTC 4R3SA 3OKLA 4TLKA 3DVGB 2PW2A 1TQWA 4WCYL 2EPOA 4RGMB 2FX7L 4PY8I 4JQ1A 4BS0A 1L6XA 3VGAB 4ELMB 1LLOA 4X9BA 2IFFL 2X2IA 3RFAA 4E0CA 3L0KA 3BXNA 1Z9MA 5D1QB 3H42H 1P0KA 3FAXA 4XN5A 1IQDB 3AU6A 3UTZB 2AQ2A 1TZAA 4AHPA 4UWMA 4IHOB 1QNIA 3SM0A 3WIFB 4RXGA 1H4PA 4CQ8A 3W11C 4OD3H 2MOGA 2X4OA 3FBQA 1G7IB 3FU7A 1BFVH 4NQCD 2XBDA 5E6ID 1NANH 4IF2A 1OCRB 5I8EB 4ZTYA 1SR9A 5LB1A 3T8QA 3CU2A 1ORQA 1KV8A 4XAGA 4O9HH 2W07A 3NCJL 5B4MC 1NMBH 1OCBA 2INFA 5JUEH 2WHMA 5FOBB 2QCHA 4RESB 4S1QH 1V93A 2Z31B 2VLME 4AX3A 2HVKB 1DBJH 5CGTA 1XKYA 3CYVA 2PCFA 5BZWB 2YEVB 1KC5H 5FF6B 1GHFH 1OCZB 2B59A 3BD3A 5FA5A 2WNKA 4XNMB 4J6RH 2Y24A 4XCYB 3PZUA 1E5UI 4LPYA 4EXPX 4HIJA 4OZHE 4O51B 5BCAA 4JGMA 3KHOA 2HNEA 3PPGA 2ATKA 2LLLA 2VELA 1ZTXE 4TNVF 1HEZB 2Z91B 3GFYA 4JEQA 2YLKA 4L9YA 4ADTA 1VPYA 3N14A 4YTSA 3SDXB 4NM8H 1OYBA 3X14A 1ZJIA 3D7PA 2AEQH 1G9MH 4XD5A 1CWYA 2C3VA 2Z35B 1EX1A 3GZPA 1LQ0A 2IQDA 2J44A 4PVMA 3FOMB 5ADPH 3ZIYA 4LSVL 5U4NA 4WUUD 5IHWA 2PXYD 3MHGA 1M1XA 4XBKA 2XWBB 3AZUA 4IRZH 1P4BL 5AHEA 4WOQA 4ZUSB 1ISXA 4I90A 2CD0A 3OWRA 5EKYA 2V5KA 1L5GA 4YE4H 3CT2A 2BVEA 1NC2B 4R7NA 5IT2H 4IBLT 2VDRL 3NL2A 4DXVA 5GRJL 1GKQA 3AU0A 3QIBA 1SSGA 5I1HH 5AHLA 3BVDB 5DRCA 2QZ5A 4ZAKC 1DZBA 4AWTA 4HXBL 3AMGA 5D4QA 2WHKA 1OAKH 4TNWF 4G9FA 5EIIA 5DHYA 2PTYA 1ANUA 4AVJA 4OZFG 1W9PA 4FG0A 1EX5A 3B2UC 1GRWA 2AABH 4U1MA 1UOLA 1TQCC 1KB5B 4PJGF 1H5BC 2IPKA 4AYEC 5L4IA 4QLJA 1I1RA 1AAJA 1FGNL 3W7OA 1XDTT 3S35H 3BDBA 1I8KA 1KV5A 2WO2B 3O6FA 1JPDX 1GSKA 4U6XA 1REQA 1E43A 4ZXOA 1TDQA 1P9MC 5L6YL 4QQUA 1WV7T 2ATPA 2GFTA 1GYUA 4MZ2A 1DVQA 1P84K 4GRWF 3S88H 3S34H 3WLKX 1OTUC 1J1OL 4WIWA 1LEKB 2PDQA 4PS7A 1RSCA 2YXFA 2I56A 2E7CA 1ZJHA 2OGJA 4K55A 3FU5A 1BYPA 4U7KA 6TIMA 1U1HA 3U36A 4JX6A 1IAIH 4NQCA 3HC4H 4U4MA 4AXWB 5E6IA 3UPMA 3EFFB 5HGDB 4NJAL 3PBWA 1QOKA 1A9EB 2CLEA 4J4KA 1JF5A 3T3PE 5E0FA 3QHFH 3BE1H 5JLZA 3TFKD 5AECA 4L1GA 3PGCB 1Z9LA 3O3BB 5HHOB 1ODUA 3QNFA 3ARFD 1OM0A 1KFGA 4Z1YA 1NQBA 2SFPA 4HU4A 4GUFA 3ULSB 2J6VA 4O17A 3IAQA 3L3GB 3SE6A 1QKZL 1Q0XH 5GS1B 5E4EC 3QQDB 1KJMA 3W24A 2CERA 2A6KB 5J57B 3TH3T 1GGBL 3BAEH 2QPXA 4W9TA 4NNBA 1EC9A 5BS0B 3I6TA 4PY7A 3W23A 4OM0H 3Q6GL 4HU2A 3TT1L 4YVXA 1KYAA 4JIIX 2WP3O 1AGBB 3REVB 1B3WA 3AI0A 5KOMC 5FYLE 4GJTB 2A9CA 1LE5B 1YQ2A 4BZ1H 1BWLA 4YVUA 4RE0A 2MJWA 2W67A 1ZGDA 4WUUA 3FSOA 2PXYA 1Y18A 5EEZA 3NA4A 1LO4L 3IVTA 9XIMA 3CJPA 4KFZC 3FJ6A 3C60B 4EN3C 2ACSA 4RBPK 3IN0A 3R43A 4PJAE 2A5UA 2HG5B 4YN3A 5KSBE 3CMGA 1SXCA 1KGWA 4NKCA 3KYOA 4NQ1A 4LOUD 3FO9B 5L2JB 3FF7A 3EPNA 5JIQA 4H9XA 5JW5A 4MTMA 1MHCB 2X9XA 4ZPVB 2BVQA 1ZZMA 3ZSSA 3APDA 1TO5A 5FV1L 5A8NA 4RK8A 5F9DC 4TUUA 5EMJA 1G9NH 3PB0A 2XINA 3LCWA 3PUUA 5EN3A 1N64H 1AVAA 4LAQH 3I6KA 4CD8A 1AD4A 3WHXA 1VCVA 3PABB 4XNAA 4HP5A 1MRDL 1A0QH 4AYGA 1BZDA 4L5ZA 1YEGH 3FQYA 5FKAA 3O3AB 3WH7A 4HIPA 2OMWB 3AS1A 2R56L 2QEZA 3ULVC 2CHXA 5ID0A 3CUFA 2GTWA 4C47A 1KKOA 1GYWA 3V0IA 1MCHA 1AZBA 1ISYA 2G3XA 1PG7H 5HGAA 5CBBA 2XSXA 3LEVH 1JK9B 3L4WA 4KZDH 1MSSA 3P1VA 3L08A 5E93A 5K9OB 3JTTB 3L3IA 4H7CA 5HHXL 4JGNA 3D52A 4LC6A 3CFEB 1C93A 2Y89A 1JPMA 3KRUA 1KTNA 4F3HA 4WI6A 4MGXA 3WK2A 4GVIA 1ZVSB 4Q2ZB 1JMZA 3HI6H 4XCNA 1ZCRA 1DWHM 4EWND 3VYPA 2AAMA 2WIIB 4NT6B 3QDAA 3M1BA 4MYWB 3FCGA 4IOTA 3IB4A 4FI4A 5G2WA 5EBWA 1BAFL 3MTXA 2H1PH 3AM8C 5EOTB 1BGXL 3JWOL 1I2OA 2XV2A 2AAAA 3I6LD 5I1DB 1IX2A 3PS6A 3KMDA 2NUWA 5CIPB 1KFKA 4NQDB 2J9ZA 5ESQB 1XWYA 4LJ3A 1AZ1A 1V54B 1DXIA 4GO8A 1TPEA 3N06B 4I7WA 1M7IB 1I85A 2ZKYA 1IZJA 3HPLA 4KTDL 4JAMB 3VWJD 3ARFA 2OEMA 2P5WD 2B14A 5CSBA 4L65A 3QDMD 2NY3B 5LGJA 1XGQA 3CZFA 4JQ3A 3HB3D 1KQYA 1JHLL 1RZMA 2JCCF 4MA7L 5BV7L 4H9UA 2Q76A 4M82A 3LHZA 4QAMB 2JKJA 4MB1A 1RIVL 3O9WC 5EBAA 5GGTA 1ZTMA 4A2DA 4NQEE 3V79C 4C6EA 3BCDA 4Z7WB 3X3GH 2GSJA 4JG0H 2PR9A 1OADA 4KUCF 3Q9QA 3RVWC 3LPOA 3ZDYF 2C1PB 2AJZB 1TTBA 5E5MB 3BVVA 5KWYC 5E5RB 4BFAA 1Q72L 4MJ4A 1L3NA 4WZ9A 4A04A 1B4LA 3GSNB 2E6AA 4LYQA 3PQYB 5C9UA 2BOBB 4YO0A 5F7YC 3VOCA 5XINA 4WXZA 5GIRA 2YDRA 1KCUH 3T6ZA 4AG4H 4PCYA 3TBTB 5MHSD 5B39B 3ABKB 4BFBD 3RWJB 1S2CA 5FDYA 1C12A 4K6AA 3V5CA 4DQAA 3V4PB 2AXWA 5D9SA 2A77H 4KWUA 1S2VA 3MVIA 2BS71 2NY5L 2R94A 3U0TA 2DMHA 5IFHL 3SCUA 3IFLH 1KZQA 5IQ7H 1MO0A 3EWYA 3NQIA 3BAXA 4F92B 2FYYA 5B8CA 1A80A 3TBWB 2ADIB 1A6PA 1W6WA 3OG4B 1LP9E 1GVYA 3HR6A 5KUKA 1XIJA 4PTWA 5F1KC 2DVUA 1IEWA 4GFSA 1YPIA 1A8JH 4R0LA 4HCRH 2NVAA 1WGOA 3OZOA 4GMSL 1QRND 2VKWA 4MAUH 3ZE2E 2WZ5A 1GYCA 3UJ2A 3A23A 3VD4A 3BZEA 2O30A 3F4DA 2VDKL 5D7JD 4PCPA 5EEVA 1NGXB 1I4FA 1G0YR 2OKOA 5JIIA 5JHLH 2ZXDA 5DC4B 2DQEH 4JREC 4B91A 4PJ7E 1BECA 3N41F 5F89B 1MHPH 2NTFA 3J8F7 3MJ8B 3RB5A 2V3GA 3T77A 1MJUL 4IMDA 1KYOJ 3EBIA 1OFAA 4OZHB 3BVNB 4M8QB 3JV0A 1S3KL 3C6LC 1UR3M 2SODB 4E9WA 1PUDA 2ITFA 2BNQD 3HMXL 4KEMA 3U25A 5CZXD 4MQXD 3EUUA 3CH9A 3MODH 4K4KA 2OAAA 3LNMA 3BKCL 4LLWB 2FH8A 4X8CA 3O6LL 3HG3A 4M03A 1P7TB 3MV11 4WSKA 1BQCA 4R5VA 1Z9SA 4YTTA 1II4E 2G75A 4I3RL 4KO9A 4WWNA 2XWTA 2NY4B 5DJCB 3FXYA 1IAKB 3DTUB 3VWJA 3HG1E 2WY3B 5HJXA 2P5WA 1ZKAA 4NRSA 3LRHA 2VZSA 1W6TA 3QDMA 1TUFA 4HISA 1CICC 2AQPA 2NV2A 1OGPA 3I50H 1PD0A 2B0SL 5L8LB 2NY6B 3W1LA 2ZOKA 3V5DB 3SJ3A 2FLBT 5FCUL 1KLYA 5D32A 1OK4A 1MIMH 3KHDA 5AD0B 2VZUA 2VGLM 1A7RL 4UR9A 3KW8A 1HAWA 4CNUA 4Q0XL 3DHFA 1EGJL 2A7NA 1PD6A 3LSCA 3RVUD 4ZENA 4I5BB 1U8JB 3GI8L 3T55A 2DJXA 1MCQA 2DQIL 4L8SC 4A2LA 1A22B 5FEZA 2RGMA 3C5ZC 2E0PA 3DC8A 4KKAC 4HKJB 3BJ91 1MRCH 3IKKA 1MJ8L 3TYCA 3FMGL 4PJ8C 2J8UF 1GS7A 3UG5A 3ULVF 2CITA 4I13B 2NY0D 3RJOA 3RHWK 1E4KC 1QR1B 4UINL 3PAYA 4AJVA 2EVGA 3C8NA 1S5IL 2DZAA 3RFZA 3WZ0E 2ZXEB 4KNSA 4AJWA 2HRHA 4YMZA 1CL7L 3KZPA 4QR6A 2HKAA 3N15A 4HNLA 3LUTA 1GGCL 3ULUE 3FDKA 4XPHL 4M6UA 5DMMA 4JTUA 2ZX6A 2XWZA 4DESA 2A3HA 5IQ9A 2RIKA 2YBRA 4LE8A 1H1ZA 4Z7QE 3K30A 3D6GA 5BOEA 4D9RE 3A6CL 2ONEA 3QC0A 1YNLL 1PKMA 5GZOC 4F7CB 1H3WM 3AREC 2ZUMA 4I3SH 1XJBA 1VZGA 4XUGA 3V6ZB 5KBNC 4UTAL 3BWAB 4JFZH 4HUXB 1JNLL 5FCZA 2L8AA 3GSUA 3DRQB 1PTZA 3U0PB 2C1HA 2A9MH 1QRNA 4QRSB 2DEWX 4PS4L 2IUZA 3FGCA 5HBFA 1DQQA 5CZVL 3O6KL 3T3PB 1FVCA 3QA3B 4JIHA 5D7JA 1VLXA 3QJRB 3AU1A 1FNGA 1QX1A 4LKXA 4JQIL 3ISRA 2RQ8A 5A6AA 3KBPA 1YY8B 2OYMA 3BP5A 5FYJD 3QG7L 3ZJAA 2FB3A 3Q8CA 4FHJA 1U4FA 2D7QA 1PZBA 1SLXA 1M7PA 3WFBL 1LO3L 1V3IA 5GSVB 1BRLA 4YTUA 4QKXB 1EWHA 3D8MA 2BNQA 1W1IE 4HDIA 3RY4A 4JGJA 1XKJA 2A3EA 5DHXB 3E12A 3JVGA 3TR2A 3FYPA 5KYUB 2VDNB 2KERA 4IM8A 2A2IA 3EZ8A 1T0MA 1XZ0A 1XRTA 1AZZC 4U49A 3ZE1E 1XYFA 2HYMA 4DEUA 1PFOA 3SPVA 4QRFA 4XCFL 1EVUA 1PYFA 2WVVA 3TA3D 5DD6B 5F1SA 1G01A 3MCLH 4BQ9A 1DVZA 1I8MB 3LEYL 4KIEA 1F02I 3NQ6A 4HGXA 4LARL 2BMKB 5MEQA 5EO0B 3MP5A 4WFGE 1BIIB 4DN3L 2A6DA 4PJAB 2XOTA 1RY7B 3GXMA 5KSBB 4GSXA 3GFUA 1I82A 4FQXB 4BFRA 1QWHA 4HIXH 4K0OA 4H1LA 4YDZA 3S47A 2HLAB 2QW5A 4AD5A 1IILE 2BVPA 3GJFB 3GAKA 4C6PA 5D1XD 2V69A 1J01A 3XISA 1ML0A 2B0MA 4MLRA 4OTXL 5I0XA 4ANKA 2YA2A 1BQHG 3QF0A 1WWWX 2LTQB 2E7MA 2F54E 4NDMB 4FAAB 5IFAL 5CJ5A 2A7PA 1X5HA 4C6BA 3QNXB 4LGPB 2WUBL 1UWGL 1EEZA 4G43A 2VDOB 1FLTX 2B81A 5T3ZL 3W4RA 3HZ3A 4BFEA 4P05A 2D7TL 2EYSA 5D2LF 4LLDB 3WOVA 3W74A 3FRPB 4NIRA 2Q6ZA 5C8JA 3UOAB 4F48A 1OT2A 1JQXA 1GHSA 3WKML 1MVUA 2ID5A 5LCVL 2H2SD 4JO1L 2E9BA 2E40A 4XVSL 3LNGA 4RRPG 3E2HC 1E0XA 4ILSA 3UAEA 4QI3A 3EHBC 3CZNA 4WO0A 5IHUL 1XXXA 3GMMB 1ZAHA 1XLCA 1E3FA 5D5MA 3QUYD 2PYED 3HE6C 5AB2A 4POCA 3V8CA 2CIIA 2TRHA 3JXAA 1NIAA 4N0RA 1NFAA 4L8DA 1Z7JA 3DO7A 4UT7L 2RBLA 1D3CA 1FCCA 1UT1A 2IO5A 3W72A 2RHGA 4O14A 1TJIH 5BVJB 5IHZB 1JZHA 4NN5C 4HVBA 1EJVC 1US2A 2GVJA 1UUOA 4P3DB 4WCJA 3M6YA 3NH7H 2B1HL 1U93B 1T03L 1RK7A 1YN7A 1FIEA 2FR4A 3V4VA 1FFOA 1FC2D 3T65A 2XG4A 4X9YA 3DV4B 4LAZA 3OAZH 2PR4L 4C6CA 4D9LL 4TSCL 1KN2L 1SJAA 4WHDA 3RNQB 3R94A 3I9AA 3PL6D 4M5ZL 4WI9A 2BOCB 1KENL 2FSEB 3IF1B 2A74A 1MAMH 1S2UA 2JCWA 3NFNA 4Z77B 3DUGA 3NZ8B 4AL8L 4HJTA 3OMIB 2P8BA 5HYQB 2L5HA 1XG3A 4K5OA 2WJ7A 4NQEB 2EIJB 4QWWD 2HS8A 1K72A 1N6UA 1ZDSA 1V6WA 3DU0A 2WAQA 5D8JH 4RQQB 2J2ZB 5DD0H 5K5YA 2Y7FA 4Y96A 1XIBA 4ONGH 2AJXH 4PJDA 3ROLB 3TA3A 2R29L 4YC2C 2HWZL 2HT4C 4Q58C 4ADIA 3NL5A 3IDNB 3BN9C 4GBXB 2OJZH 4TLUA 4MSWB 3RA7L 2TYSA 4Y4FC 1RVKA 1RVFH 3Q01A 5FFOA 3VVWA 5JQ6H 4WFFE 3U7WL 3B5GA 4KPHH 1DLHB 3F7RA 3QJHB 5TFSL 1CLOL 3EGSA 1FWRA 4EIZC 3R0NA 1UA3A 4NNAA 4NPYB 4LMQI 3NSXA 2GZXA 5BUPA 1MW0A 1JZDC 3EB2A 3SUWA 2KZWA 1JWSB 1R6VA 5D1XA 3WN6A 3IK4A 3IGLA 4QE4A 3A13A 1MDRA 2JELL 3W1ZA 5LBSH 3H2QA 1SW0A 3P4NB 2LOEA 4FX5A 4I5XA 4C6QA 3QQ1A 1LP9B 3G24A 3KL5A 3TYBA 4QAIA 4KX8A 4HU3A 1AZUA 1W5PA 2RKXA 5IDIA 1B4RA 4QTGA 3TE9A 2XFFA 3KZSA 2VDRB 4I2XA 1UJTA 2OX1A 2Z24A 4IRJC 4F8NA 2O93L 4PS8A 1Q6DA 4KBPA 1VKXB 2MRYA 2YQBA 4X9GA 1H7NA 1WG3A 2VEIA 1V7NH 3QO1B 3K1KC 1AZRA 3ZE2B 1T4KB 2ESVE 4B3ZA 4FKKA 1IAOB 4BSWB 3R58A 3NZUA 5SX4H 1EL3A 4BF5A 1IC7L 2X42A 1O7AA 1FORL 1Z1WA 3CTTA 4N0FB 3FQWA 6XIAA 4PJ7B 4YZWA 3LCHA 5TTRA 4FQLH 3QUYA 1TR1A 1ECEA 2PYEA 4X5WA 3UXDA 4QM1A 1SO3A 2N7SA 2QCGA 1SXSA 5ADOH 3WNPA 2FD6L 2VWEC 3S5YA 2X87A 1FV1A 2YXMA 2WXDM 1QO2A 1CN4A 4OAWA 3C2RA 4H26A 2AKZA 2YMXL 3BZ4A 3QORA 3RX5A 3OXRA 3LQMA 1A6WH 3FB8A 3FPYA 2DBJA 2R83A 3O3EA 3KD4A 1CB2A 1QFWL 4FLSA 1HC1A 1JGVL 2W80C 1S38A 4XTDA 5EBMA 4IWWA 3AT9A 4MWAD 4WRHA 5ESAA 2ZCLH 3CXFA 4PGBA 3AROA 1PZ5B 3HG1B 1IKFL 1FWBC 1N10A 2WBWB 1U95B 4XPFL 1DBKL 2IAMD 3VNLA 4E4UA 2VC9A 3HNSH 2GIYA 3PL6A 4P04A 5CFHA 8RUCA 5DD1H 1QTWA 1QI4A 3ZUCA 4CQ9A 1U8PA 2FUTA 3KEHA 1JPSL 5FEPA 4S3CA 4H2HA 3IXTB 5HGGS 4NUGH 4LB4A 3SIMA 3UTOA 1JDEA 1GJIA 5PTDA 3OPUA 3MRGA 3LRSA 5HDLA 3L3KB 3AZTA 2HRLA 4L4LA 3GSMA 3NZ1A 4AI7A 4MLIA 3S0PA 2VW6A 2NXZC 4WVRA 1YNTA 4CN6A 1HNGA 2VKXA 4A38A 2WHJA 2QQKL 1LDSA 1W80A 4LVDA 1S5VA 1PHWA 1A7PH 1OP5K 1HHGB 2YPKA 1V3LA 2VJ0A 2QCCA 3PBVA 3OKMA 1C5DB 3MJMA 3V4PL 3QCVH 1KXVC 3SCMC 1FO0B 3O63A 1NGWA 2WUCH 2OV0A 3EYQC 3LPFA 5FAGA 4OGAC 2GSMB 3JUGA 4IIQB 2AXHA 1YVLA 1C8PA 3RI5F 1Y6NR 4ZUVA 3EOBA 3UCRA 2PP3A 2VB5A 1RQ5A 3VXNB 3AXMA 4ZFGL 2YEZB 4CCDA 4WW1B 4KFPA 3WN5A 2ZZ7A 7XIMA 3BSZL 5DD5L 4MMXB 5BVPL 3JWNC 4JG9A 4PRHD 1KYDA 3LTSA 3EJJX 4Z7QB 1G69A 4IHBA 5ICZB 4IBWA 4RPPA 4X5XA 5IBTL 1EWEA 2YRBA 1HK6A 4B7LA 3MLRL 3BHBA 4O15A 5T1LB 1MCWM 2FGZA 5BXPA 1JPST 2ABBA 1I7ZB 3B4UA 4DP6X 1XYZA 3C86A 1WZ1H 4A6YB 3I02A 3RCMA 1WBJA 3EJQA 3N9GH 9PCYA 3P9LA 2FEJA 1WYJA 1Y7VA 5HPCA 4FALA 1F58H 1W15A 3DETD 1W16A 1JRHH 1S46A 1Q6OA 1OFEA 3OQ8A 3UBGA 1IBGH 1MSPA 4M1CD 1KTDA 4R8WH 1VB9A 4Y5YB 4LEFA 3UWYA 5J04A 3U4EB 3FYEB 5LGKA 1XBRA 1F1AA 3CUIA 4M7LL 3BLKA 2FPYA 1KFAL 6A3HA 4PJ6A 2JB6B 2QT6A 4A7UA 1Y5XA 3A4EA 3VVVA 1IO4C 1C5BH 5G2HA 5CEZD 3T09A 2Z27A 5D2NE 5FKPA 1KN4H 4V1DA 4ZX6A 1ISZA 2E74C 1NU5A 3SIZA 4WI5A 3QPZA 5IDZA 4Y2DD 1CDIA 1AHMA 3GK0A 5JDSB 4P2VA 3TN4A 1KLZA 1L6PA 4Q74A 1KCWA 2EXOA 2FVKA 1YLBB 4N9CA 5EOCH 4J3BA 3G6DH 2PPDA 4XP1H 1HE8A 1A7OL 5B1JC 4PUWA 5LSMA 1E4HA 3WLRA 4Y6GA 3MKKA 4PBDA 3B2XA 4MWAA 1H7PA 1S9VA 3GFXA 4ZSOE 4YDLB 1N6QL 3BD4A 3LEXA 4P5TB 4PBGA 4WGKA 1IGIH 2BSTB 2IAMA 3GNMH 1VGEH 5EMLA 1NAKH 2DMGA 4O4VA