1G9HA

Ternary complex between psychrophilic alpha-amylase, comii (pseudo tri-saccharide from bayer) and tris (2-amino-2-hydroxymethyl-propane-1,3-diol)
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
448
structure length
448
Chain Sequence
TPTTFVHLFEWNWQDVAQECEQYLGPKGYAAVQVSPPNEHITGSQWWTRYQPVSYELQSRGGNRAQFIDMVNRCSAAGVDIYVDTLINHMAAGSGTGTAGNSFGNKSFPIYSPQDFHESCTINNSDYGNDRYRVQNCELVGLADLDTASNYVQNTIAAYINDLQAIGVKGFRFDASKHVAASDIQSLMAKVNGSPVVFQEVIDQGGEAVGASEYLSTGLVTEFKYSTELGNTFRNGSLAWLSNFGEGWGFMPSSSAVVFVDNHDNQRGHGGAGNVITFEDGRLYDLANVFMLAYPYGYPKVMSSYDFHGDTDAGGPNVPVHNNGNLECFASNWKCEHRWSYIAGGVDFRNNTADNWAVTNWWDNTNNQISFGRGSSGHMAINKEDSTLTATVQTDMASGQYCNVLKGELSADAKSCSGEVITVNSDGTINLNIGAWDAMAIHKNAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE
publication title Crystallographic evidence of a transglycosylation reaction: ternary complexes of a psychrophilic alpha-amylase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 157
structure length 448
sequence length 448
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2000-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1g9hA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1g9hA01
5I78A 4HMEA 5HPCA 4W87A 3APGA 3CH9A 2WSKA 2FDMA 1W91A 3L4XA 5A6JA 3HG5A 5M3WA 2D2OA 3WNNA 4HPHA 2WYSA 2BFGA 4W84A 4QLKA 1FH7A 4TVDA 4FNUA 2E8ZA 3MV01 5HNNA 3AHZA 4UOZA 2DT3A 4D6DA 3ZR6A 1GOQA 4UOJA 4CGTA 5CPQA 1JZ8A 1E4MM 4HU8A 2BHUA 3BMVA 3U5YA 3QHOA 4LGXA 2V3GA 3O6AA 3VSUA 1BG9A 1CYGA 4UZUA 3MSGA 3RM4A 3VX0A 2WHLA 3GZAA 5I3DA 3T2QA 2X05A 4KGLA 1S46A 1LF1A 4UNIA 2VURA 1ZU8A 5FKYA 2W62A 1BHGA 3BUIA 1E3XA 3VGDA 1HNYA 5A8MA 1Z32X 3U7VA 4S3JA 1JF5A 3AOFA 1GNXA 2D0HA 1KGXA 3MS8A 5DF0A 3ZJ6A 2J7CA 3LPOA 4UFHA 3DX0A 1B0IA 2IXUA 3GXFA 1WCGA 4HZ7A 1H1NA 1E71M 1JZ7A 4MNJA 2A3BA 3II1A 5LYRA 4UQAA 2YBUA 3WSUA 4OKDA 3WH6A 5BXTA 2BXYA 1CLVA 3T08A 4BF7A 3VIPA 2WMIA 2WVVB 1BYDA 6A3HA 1QBAA 4PMYA 3ARZA 1PBGA 2A3EA 3AXHA 3RCNA 1XSKA 1C3FA 2PI6A 5ECUA 4PUEA 1GQLA 1XCWA 4HP5A 1NWSA 3WF1A 2GK1B 3TTSA 3VGHA 3CZNA 4V2XA 1XH1A 1OIMA 4J3VA 2CCRA 1D2KA 4AEFA 1ZBWA 4Q22A 1E6QM 3H55A 1SFSA 1GCYA 3VOCA 4PTWA 1OBAA 3N11A 2OYLA 3WEZA 2PWEA 4U3AA 4CD8A 1VEPA 5DFAA 4JCMA 3GBDA 1K9DA 1O6IA 1US3A 1UA3A 1MW2A 1JYNA 3N15A 4WJXA 1V3JA 3WH5A 1HX0A 1B3WA 1TQVA 2WAGA 3BAWA 2G41A 3ZT5A 3CIVA 4JKKA 4PMZA 5CPTA 4PSPA 2OSXA 4Z2GA 7A3HA 4HOZA 3FAWA 1UYQA 1WDSA 3NDZA 1BF2A 1HT6A 2WPGA 3BAJA 2WCGA 3D4ZA 1JI1A 2CKSA 1V02A 1GORA 1W1YA 4HU0A 1VEOA 3EJQA 1TVNA 2X0HA 3ZIZA 1TG7A 3AIBA 1EDTA 2ZE0A 1X6LA 4AZBA 5AC4A 4PMVA 3AHTA 2XVLA 1CIUA 2DSUA 3A5VA 3I3EA 4NRRA 3WD3A 4L4PA 3N12A 3ARVA 3PZMA 4UQEA 1K9EA 1C93A 3UESA 3VMOA 2E4TA 3EJPA 2YBTA 1F4AA 4U3CA 1PJ9A 4HOWA 4W8BA 2XFRA 2FYVA 1UWIA 2WKGA 1GJUA 2BY1A 4DM1A 3CZKA 4B9YA 2DSVA 3AJ7A 3PZVA 2WKLA 3RJYA 1QNPA 1XRVA 1RH9A 1MW3A 2RGLA 2VR4A 3VDHA 3ARQA 2OWXA 2J7FA 4FLSA 2EACA 4GI9A 3BMWA 3WEOA 4IPNB 5CQ1A 4AISA 4AZCA 5ABEA 3ALFA 3FAXA 4JFUA 4E2OA 2OSYA 4GZIA 4GIAA 1X1NA 4BQ3A 2YLAA 4MADA 3FN9A 2GUYA 5I2UA 1E9LA 3TTQA 2XVPA 1HN1A 3BLKA 3BUBA 3L2MA 4A3YA 2J78A 1W2PA 3WELA 1ZJBA 4WIWA 4IUGA 2ZX9A 1PZ3A 3WY3A 3FHAA 2QMKA 4JFTA 5A2BA 1VENA 3MO4A 2EADA 4EAMA 1VFFA 4AMWA 2ALWA 3T0DA 3CUFA 1DHKA 2C8NA 5TD4A 1ZJAA 3W0KA 2FGLA 1TQSA 4DO6A 1AQMA 1WDPA 4XZWA 2F1AA 4UFIA 1J11A 3BLBA 3ARWA 1R34A 3WBAA 4ACZA 3HMCA 4CCCA 1EOMA 1JZ4A 2WBKA 4F79A 2ZICA 2XHYA 1J0KA 2XN0A 5BYWA 3PZQA 4U2YA 1VF8A 2BVYA 1KWGA 4W86A 1CXLA 2VTFA 2O9OA 2EABA 5C8BB 2WVTA 3SCUA 2X0YA 2G3MA 3SCSA 3LPGA 2J77A 3VIMA 1UUQA 4AD2A 2D23A 1OGBA 1HJVA 3WUBA 2E8YA 1TA3B 4UTFA 1UOKA 4P7LA 5KEZA 4LYRA 1HJQA 1V3HA 1ODUA 5ABFB 2EBNA 3CGTA 1G94A 3TA9A 1C90A 2DT1A 5DO8A 3W53A 3AIVA 3W38A 1CWYA 3K4AA 3MUZ1 2X2IA 5A6KA 3WF0A 2VQUA 1R86A 1B3ZA 3WD1A 3L4VA 4HA3A 3SUUA 3WL1A 2YFOA 2WC3A 1DP0A 3NJ3A 2ZX6A 3WH7A 1MFUA 1C7TA 1ESWA 3IJ9A 1EXPA 3POCA 4WF7A 4HZ8A 3PN8A 4LYPA 4P7QA 1CZ1A 3VIOA 1KR1A 7CGTA 2XG9A 1RPKA 2NSXA 3TTOA 3HG3A 5M17A 3AIUA 1QW9A 1X6NA 1LL4A 2XGIA 4ZEPA 2G3JA 2RGMA 2FGZA 2CEQA 2CHOA 3AXIA 1KCLA 5FOOA 3MMUA 3S5YA 4OOZA 1A47A 2ZXDA 1JFXA 2XWEA 3NIYA 4AD3A 1JD9A 1J0YA 1NWTA 2VRJA 4HA4A 1NOFA 1UG6A 1HXJA 4JKLA 2VUYA 1CXIA 2XPKA 4IPLA 3OGSA 3GH4A 1TQWA 3CZEA 1OSEA 1JAEA 1UQZA 1NH6A 1UKPA 3FNDA 1WNOA 4MDPA 3NSMA 3W25A 2GDVA 4P8XA 4TUFA 2J7GA 3KL3A 5A6MA 2DQXA 3FY1A 6CGTA 5A69A 2ZX8A 3WF2A 3DHUA 4OOUA 1BQCA 5A2AA 1DWFM 4UFKA 1JL8A 4ACYA 1Q6EA 4X0VA 3K1DA 3ZSSA 3KE0A 2J8FA 4AIOA 3B9DA 4X9YA 2WM0A 2IXVA 2E0PA 2YJQA 5A1AA 1GHSA 4MJ2A 3ARTA 3QHNA 3AHXA 1E43A 4MTVA 1B31A 2Y5EA 3AQUA 1JDDA 1KBKA 4J28A 1XC6A 1J0ZA 1JF6A 1RP8A 1XH0A 3RO8A 5EFFA 1PEZA 4FLRA 1GQJA 4P8WA 4PMNA 4ZE5A 1J10A 1AQHA 1KR0A 3THCA 1V08A 4PN2A 1G5AA 2AMGA 3WMBA 4AZHA 3N17A 5LA2A 1OT2A 3BUQA 4IM4A 1NOUA 3W4RA 5CSUA 1QNQA 2J75A 4ZXOA 1K9FA 1H2JA 1VEMA 1WDQA 4AMCA 1MXDA 1BVNP 1R87A 3UEQA 2EPOA 1KQZA 2YL5A 2X1IA 4MNLA 3ECQA 2BHZA 1JYXA 2Z1KA 1UZ1A 3OLIA 2VVSA 1G9HA 1KGWA 2OW6A 4W8AA 4ATLA 1V6XA 2VCCA 1IT0A 1V0KA 2FE0A 3WDIA 2VC9A 4PRWA 3CZLA 4FNTA 3LRMA 1BYCA 4W7WA 3AMGA 3VMNA 4PMQA 1LG1A 2ZUSA 1CTNA 3VGBA 1GHRA 2VX7A 3D50A 2BY2A 3PZIA 3FW6A 3AIQA 3BVXA 4E4PA 4W7VA 5E1QA 1V0LA 3T09A 2B31A 3AMKA 3A21A 4ZENA 5JUVA 5HDRA 4AC1X 2D20A 1H5VA 3J7HA 3PTKA 3WD0A 1W9UA 1JD7A 3CHEA 2DSWA 3AMLA 3A22A 1DWGM 1U2YA 3WNPA 3JUGA 1TUXA 3L4YA 1KTCA 4W5UA 3WIJA 3DX3A 4CN4A 2ZUUA 5IFPA 2DPEA 4IISA 4C7DA 4TX6A 4GQRA 1FHDA 1OINA 4Q7NA 4HMDA 4CN6A 3RM8A 1VIWA 4J3SA 3L4TA 5BRPA 3VD7A 3EMQA 2AAAA 1ZS2A 3S6TA 3HG2A 3WNKA 1N82A 5CSYA 4M8UA 2YFNA 3DX4A 1H4PA 3VDBA 3SUWA 4FMVA 2D24A 3WDRA 1Q6GA 4UFLA 1PX8A 2YL9A 4CD5A 5AC5A 3GXPA 1EHNA 5A3HA 1HKJA 3GBEA 4GINA 1HKMA 1EDGA 4EANA 4AZ6A 2WK2A 1GOOA 1E6NA 2C7FA 5BROA 7TAAA 2VZSA 1BSIA 2A3AA 3AYRA 3CZGA 3DDGA 5DMYA 3HJEA 1E6RA 4OUEA 1UD5A 1SMAA 1W3LA 3WDHA 1UD8A 2V3FA 3OA5A 1LG2A 2WMIB 5IDIA 4XB3A 4BQ5A 1B2YA 2WC7A 4QCEA 4AXNA 1RP9A 4R27A 3BVUA 2OLHA 4CN1A 5I5RA 2G3IA 2XJ7A 1WDRA 1KB3A 4CU8A 2EXOA 1E6ZA 4U5KA 1BFNA 1Q4NX 4WKFA 3PHAA 4GI6A 4B16A 1IZJA 2OYMA 3VSVA 3DYMA 1CXKA 1HJXA 2UY2A 3VIIA 2FHCA 2EPNA 1L0PA 1QBBA 1CGXA 2VZVA 3MMDA 3G6LA 1UA7A 1EDQA 2VMFA 4AD5A 3WQVA 3VTRA 3U7BA 4HPGA 3A6OA 3VPLA 3WUGA 3OGVA 5IHRA 2QF8A 1K6AA 4KRUA 1WE5A 2XM1A 2DIEA 2G8ZA 3IK2A 3DHPA 2ZXQA 1K9TA 1XD1A 3VSTA 3D52A 4CKQA 2CERA 5A6LA 2UY4A 1WB0A 1UWQA 2VQTA 1CGTA 3I3DA 1EO7A 2AOSA 1BGAA 4MB5A 3NUKA 3ARXA 4KWUA 1EH9A 3CUHA 4D6IA 2F2HA 4JZ5A 1VFMA 3LXCA 4U33A 3AIWA 5EFDA 5A95A 3F5LA 1E5NA 4M82A 2WVUA 4W89A 1VAHA 1PIGA 1R33A 1W1PA 2GSJA 2PBGA 1A3HA 5I77A 5EB8A 1HP5A 3DDFA 5A8OA 2O9TA 1XSIA 4H8UA 3GNRA 4MNMA 4EKJA 1VJZA 2CKRA 4S3KA 4FLOA 5A6BA 1XYZA 5I24A 2PB1A 3ZMRA 4BZYA 1G1YA 1PAMA 3DX2A 1KBBA 5HOSA 5GNZA 4HA1A 4AZCB 2VRKA 5CLWA 1GVYA 1XYFA 3GYCA 3PZNA 1ISZA 3WFZA 4KGJA 3L4UA 4GZJA 1KTBA 3NSNA 5D9NA 2JE8A 1XH2A 2FHBA 3RIKA 1UZ4A 3UCQA 1R7OA 5JBDA 3LRLA 3GDBA 2YLLA 1DWHM 2WVVA 3CUIA 1QI2A 3W26A 2FH6A 1SYTA 3WY1A 1MW0A 4AYGA 1BLIA 8A3HA 3SUTA 2J47A 3OLEA 1WP6A 2F7RA 2QPSA 3BVTA 3EJSA 5D8ZA 3UG5A 4P7NA 4MPKA 2Q8XA 1FH9A 2VL4A 2YKKA 1E5JA 2XM2A 4FK9A 1UD3A 1MVYA 4LXFA 3QOMA 3LRKA 2J79A 3CHFA 2GJPA 5I79A 1W9PA 2WANA 2WHKA 3W28A 1JIBA 3OGRA 3BH4A 3N9KA 4ACZB 1F4HA 4QCFA 4AWEA 4ZFMA 4ATWA 1W3KA 1E0VA 3WFLA 1JYWA 4XV0A 1DWIM 1H49A 3WNLA 1QNRA 3RJXA 4U5IA 1M03A 1L8NA 3WL0A 2CBIA 4AY1A 4DUWA 1UKSA 4PEEA 3WD2A 4UQ9A 4P7RA 3HZ3A 1YQ2A 3A23A 1B1YA 4CUCA 4UZSA 5CZKA 1CDGA 2C0HA 2YA2A 3FXYA 1QVBA 2VJXA 3VIJA 4N42A 3W82A 2D1ZA 4NXSA 3TONA 2XSAA 2OYKA 3B8SA 5E6ZA 4FNQA 4M1RA 1EO5A 1KQYA 1MFVA 2W66A 4TXEA 3WNOA 3IGUA 4H41A 4E8CA 1Y7VA 2E9BA 2J7HA 1V3LA 1AQ0A 4AIUA 3EDJA 4EE9A 2CETA 3L2LA 4ZE4A 2WMGA 4H7VA 1NP2A 3TOPA 3N1AA 4PCSA 2XIIA 4OBSA 2DGAA 2PWFA 4FF5A 3WUFA 1OWQA 1VJSA 2ZX5A 3RPMA 3M7SA 1XV8A 5E9AA 5A6AA 1WZAA 4OZOA 4W5ZA 1MWOA 3TTYA 2OSWA 3BC9A 1W3HA 1TQUA 2Z1SA 3KLLA 3UERA 1C92A 2XN1A 3E1F1 4YN5A 2XSBA 1QX1A 3VIGA 3VKKA 2WHJA 1TZ7A 1CGVA 2WMKA 1HJUA 1G01A 2FHFA 1FA2A 2NT1A 2A3HA 1H0GA 2E3ZA 1QWUA 1WZMA 3SCQA 1E56A 3IJ7A 3AHVA 4F9DA 1NWUA 4QFUA 3EJUA 1FP8A 3AS2A 3KEHA 1HL8A 1B3XA 4A3HA 2J7BA 2J4GA 2F7OA 2EPLX 3IAPA 4W85A 3UR7A 1PX4A 1GOWA 1US2A 2ZOXA 4UQCA 1CXHA 5IXEA 1HWWA 2YOCA 3VIKA 4AMXA 2QHAA 1V3KA 1OT1A 3F4VA 3WY2A 4ZXLA 4WLCA 1QHOA 3H54A 4CVWA 4AZGA 5BWFA 2EPKX 3AROA 1TVPA 3TV8A 2VCAA 1E0WA 2VX5A 2VT0A 1E0XA 2ZX7A 4UCFA 2JALA 4Z2KA 5AY7A 3UG4A 2F1BA 1DEDA 1SR0A 2WNWA 4U31A 3SCTA 1KFWA 2O9PA 2G4FA 3EDFA 1TE1A 1CPUA 3LXBA 3RDKA 1ISYA 5BXRA 1XGZA 1H3GA 3VINA 4BA0A 2CPUA 1W9BM 1LQ0A 4WSJA 1E6SM 3KLKA 2DH3A 1M01A 1WKYA 3F5JA 4GPNA 3IJ8A 2EEXA 1GOKA 2J62A 2WMJA 1UH4A 2WLYA 4E8DA 4ATDA 4NX0A 1KXVA 2E9LA 1C8QA 2NW0A 4N0RA 1H41A 3AICA 2WW5A 3CMGA 4QLLA 4EK7A 4F8XA 2F18A 1HKIA 2V5CA 4NZFA 3EJTA 4AYSA 3DECA 2ZWZA 3OB8A 2Y24A 5CXPA 1R46A 2YDRA 2XVNA 3LX9A 3MSDA 3VM5A 3N13A 1ITCA 4LQ1A 3U5UA 2EAEA 1M04A 1HTYA 1W2VA 1PX3A 2XTKA 1WAWA 4GI8A 4M29A 1UQYA 1CECA 1GZJA 3AI0A 3ZM8A 4AIEA 2ZUMA 1E4NA 3EDEA 1E4LA 1V3IA 3SCVA 4AW7A 5IFTA 2W91A 8CGTA 4D6FA 2XFFA 1HIZA 1TCMA 4KMQA 3AIEA 3BUDA 3NDYA 3WH9A 3WQWA 3THDA 4XX6A 5ABHA 2GVYA 3ARUA 1J9YA 2W63A 2ZWYA 2YDQA 3OBAA 4JFSA 1JZ5A 1CENA 3GXTA 1CEOA 1I1WA 2VR5A 1HJWA 3SIMA 2GFTA 4GO8A 4WKAA 1RD6A 1MXGA 1GUVA 3HU7A 3B9EA 3H53A 1QHPA 4B9ZA 1LL6A 1UD4A 2WVSA 2JIEA 4CU6A 5EMYA 1HVXA 1GQKA 1LL7A 5HXMA 4TTGA 1H11A 1G0CA 2JIWA 3CZJA 1V6UA 1C7SA 2DT0A 3D4YA 3ARYA 1BTCA 3ZQ9A 4PTMA 4PTVA 5CPSA 1NOWA 1M53A 2D3LA 3WEMA 3SCNA 3ZJKA 4LYQA 4HTYA 2DSZA 3LPFA 3BSHA 2PBOA 2O9RA 4OBRA 3QOKA 1B90A 3WKZA 1UR0A 3D5HA 5A6SA 4MB1A 2F7PA 3A47A 4V28A 4FNSA 4AZ5A 1R47A 1EQPA 3M07A 2VOTA 1SZNA 3PTQA 4P8VA 4B3KA 4D6JA 5DT5A 4W93A 3SURA 3K8KA 3PTMA 1NWRA 4PMXA 1J0IA 2YA0A 2BV9A 5AYBA 4QDMA 2VZOA 4H2CA 3BAKA 5IHSA 3SUVA 2Y2WA 3VIHA 5M5DA 4J3WA 4DO4A 3ZO9A 2W67A 1OGSA 2JF7A 3WD4A 5LA0A 1E40A 1IV8A 3OZOA 3TP4A 1OIFA 1QWNA 1UKQA 1WZLA 1V03A 4D6HA 3MV11 1J0JA 3WQ8A 2CBVA 1VBRA 4H8HA 2OWWA 1QI0A 2XGBA 4UR9A 1J12A 4J7RA 5CGMA 1E70M 1QHZA 1UWSA 4WSKA 1GW1A 4RE2A 3WBEA 2BVTA 1E3ZA 2XWDA 1YHTA 1U33A 3ZR5A 2CBUA 4WKHA 3S5ZA 2UY3A 5E0CA 4CU7A 2WLZA 1V6WA 1LLOA 4UQDA 4QAWA 5BRQA 4PBGA 1EOKA 2IUZA 4PCTA 2PC8A 1QW8A 3VGGA 1PIFA 4Z2JA 1FHLA 2VRQA 4JKMA 4PSRA 4UQBA 3WENA 1MQQA 4B3LA 3BAXA 3QR3A 1FH8A 1E72M 4CD4A 3BCFA 3AIRA 1UWRA 3N18A 1BAGA 2VNCA 1CGYA 2G3NA 4DWSA 4MDOA 2GJXA 3EYPA 3T2OA 4NF7A 1OD8A 3AZTA 3CUJA 1W1TA 3MU7A 1JG9A 5CLTA 2PF0A 1MYRA 2DT2A 3CTTA 3NYDA 1JAKA 4PUDA 3GXMA 1CXEA 2V5DA 1UR4A 4W7UA 5D9OA 1QI4A 1T0OA 2WB5A 4MAVA 2JEQA 1UR2A 4TX8A 5EBAA 4CCDA 1E1EA 4D72A 1JGIA 1E15A 3W29A 4FNPA 2J7EA 1NP0A 2WHMA 4PMOA 5A94A 4BS0A 4C7FA 1AMYA 1AVAA 4D6EA 1ECEA 4GQQA 2VI0A 2WC4A 1D3CA 2CESA 1XHGA 1D7FA 1OGGA 1JNEA 3CHDA 5A8NA 1QI5A 3WN6A 1R85A 1OD0A 3POHA 2XN2A 2VCBA 3M6DA 1Q6DA 4KRTA 4TTUA 2WMFA 2DSKA 3FHQA 3EBVA 2WWCA 2BHYA 1KGUA 1GQIA 3RMEA 2CIPA 1UD6A 4LX4A 4D1IA 4JAWA 2W61A 4ML4A 4RL3A 3WMSA 1VFUA 3CPUA 4NZCA 5BXSA 5GNXA 2QMJA 2ZXBA 1I1XA 4MB4A 3ZJ7A 1E6XM 3GXDA 3SCOA 3EMCA 1FOBA 2ZUTA 3ZSTA 2PWDA 3ZT7A 2UWFA 1JYVA 3CMJA 4W8LA 1W32A 4J3TA 2W5FA 1TQTA 4CD6A 2WCSA 1CGUA 4NZJA 2O92A 4PYSA 3T0AA 1BGGA 1J18A 2YL8A 1TMQA 2X2JA 1QOXA 4TVUA 3CZSA 1JNDA 3WQ4A 2WMHA 3W24A 1QI3A 3AYSA 4URIA 3VILA 4C7GA 4D71A 3MANA 3CUGA 5A8QA 3D3AA 1E1FA 4U2ZA 5FCZA 3GXNA 4XZBA 1BYBA 1H0IA 3QGVA 5HPOA 4AD4A 5JBFA 3WDPP 2GJRA 2W92A 4MNKA 3VIFA 2D73A 3QHMA 5DT7A 4M24A 2YDSA 1CXFA 3VD3A 1UD2A 1GOMA 1HVQA 4OGZA 3PZTA 5I23A 4NXKA 3VX1A 4AZ7A 1E6PA 1E4IA 2DDXA 3HG4A 2Y4SA 3AMDA 2ESCA 1U30A 1XSJA 4FNRA 2CHNA 1HKKA 3SUSA 1FFRA 1H09A 4K68A 1NM9A 2UY5A 2VZTA 5JIPA 1IZKA 2GK1A 3IANA 4H04A 1MQRA 3WDJA 5LA1A 1PPIA 4CD7A 4D1JA 2J7DA 2ZXAA 3HN3A 4AEEA 4GZEA 3WQ6A 4AZIA 4DM2A 3IAQA 1B9ZA 3PZGA 3T2PA 3CBWA 3VD5A 5CJ5A 2BS9A 3MI6A 4QP0A 3EDDA 1UR9A 4PMDA 5ABGA 3BLPX 4UOQA 2CNCA 3O9NA 3W6MA 1V02E 3W81A 3MKKA 5FL0A 4JFVA 3ARSA 4J27A 5JIWA 3SCWA 4TVCA 3WF3A 3EMZA 3OLDA 4Z2HA 5A8PA 5AYIA 4JHZA 2QPUA 3KL5A 1KCKA 1KWKA 5FL1A 4LPCA 3WF4A 5E70A 4X0NA 1B30A 4JFWA 3GNOA 3GH5A 3WDQA 5BCAA 1ISVA 2YA1A 1ZBCA 5DEZA 3AZRA 5HBFA 3WY4A 1C91A 2D3NA 4YHGA 2A3CA 3SCPA 4DWSC 5C71A 5KZ6A 5JBEA 1BYAA 2XVKA 3AMCA 3VGEA 3GXIA 2J8GA 1V0NA 1UH2A 4YPJA 1FP9A 3WNMA 4GO9A 1LWJA 2WBGA 3BGAA 3A3HA 5BXPA 2E40A 2X8RA 3OLGA 3ZT6A 3AHYA 3OZPA 1ITXA 2OWCA 3MUAA 1OB0A 1BPLB 4AD1A 3AS0A 3UR8A 1GJWA 2YL6A 3BCDA 1CBGA 1C8YA 3PZUA 4NI3A 5D4YA 1CNVA 3BAIA 1O7DC 1W9DM 2FH8A 4MAZA 2VVNA 4JHOA 3DC0A 4HMCA 1ISWA 1R7AA 3L4WA 2XVGA 3O2LA 1WO2A 4NRSA 3G6MA 4P7OA 4PTXA 1NQ6A 1HL9A 3VU2A 3BVVA 4DO5A 4BQ4A 2VX4A 2GDUA 3K46A 3UG3A 1JZ2A 5E6YA 1W9XA 3CC1A 1GPFA 2X09A 3PZOA 3LXAA 5C70A 1TFVA 3RILA 5D9PA 3VDCA 1SMDA 5CGTA 2EPMX 1XCXA 1E73M 2VX6A 4AD0A 1QNSA 1MW1A 4CCEA 1JDAA 1B3VA 1R75A 3VD9A 1Q6CA 2X2YA 2WZHA 2VZUA 2WZEA 3MUIA 2ZUNA 3CV5A 3ZOAA 1V0MA 1ZB5A 1PZ2A 3MMWA 3AS1A 3AXXA 4HOXA 3LPPA 3KWXA 3D51A 2CBJA 4MJ4A 1NARA 2QV4A 3K8LA 3VMPA 5E0FA 3VM7A 3LMYA 3AS3A 3DYOA 5GNYA 4V27A 4NSBA 3A4AA 2DEPA 2BNJA 2WZIA 4BCEA 4RE3A 3KL0A 2WSPA 2W4XA 2D22A 9CGTA 3A24A 5FIPA 1V3MA 4PMRA 6TAAA 2V38A 3L4ZA 3F5KA 4DUXA 1GONA 3PBGA 4Y7EA 2NT0A 4QLJA 2ZUWA 1KXHA 3VUPA 1VRXA 1DTUA 1W9VA 1EA9C 1TA3A 1VFOA 3EJRA 3AFBA 3B9AA 4CVUA 1ISXA 1JFHA 3ALGA 3CZ8A 5ABFA 1ZL1A 1VBUA 1JDCA 4OIFA 5D8WA 4OJYA 3NCOA 5FD0A 2XIBA 1WPCA 4M56A 2WCAA 4H8VA 2EQDA 2BY3A 1CLXA 3K8MA 2ZIDA 4HZ6A 5CG0A 4BQ2A 1MQPA 1HJSA 3GNPA 3KZSA 1TR1A 2PWGA 3ZJ8A 3AZSA 2OW7A 5GPRA 1V6VA 2BY0A 4W88A 3WMCA 2WWDA 4MB3A 2PWHA 1DWAM 3PZ9A 4Z2IA 1UWUA 2D0FA 3MUY1 2V3DA 2JF6A 4TOQA 3M46A 1EHAA 3BSGA 1FFQA 1JZ6A 1OCQA 1ZBKA 2F61A 1UR8A 1I75A 2F8QA 1UR1A 3K4DA 4DWSD 5M03A 3VGFA 1EIBA 1LJYA 1VB9A 4PMUA 1J01A 3W37A 2CYGA 4F9JA 1Q6FA 1XD0A 3EDKA 3T0BA 3A4WA 4J3UA 4F66A 1BVZA 2XYLA 1HF6A 1UHVA 3CO4A 3DYPA 4R5EA 1QPKA 2J25A 2X2HA 3BAYA 3BXWA 3I3BA 4UFJA 2XUCA 1KXTA 3CHCA 4WK9A 3ARPA 4JCLA 3OG2A 4JL1A 1R8LA 4XUYA 2IGTA 2BXZA 3SCRA 2VO5A 4GKLA 3AISA 2DIJA 2Y8KA 3BVWA 1PS3A 2V3EA 2HISA 4YHEA 4P8UA 2JFEX 1JXJA 2XFYA 1P6WA 1QNOA 1O7AA 4JIEA 1ODZA 1GOIA 2F7QA 3U57A 1UKTA 4J3XA 3BUPA 3VDAA 4M81A 3DX1A 3CLWA 4D6GA 5GQBA 5F7UA 1KXQA 2E9MA 3NSXA 1W3JA 2WXDM 1OM0A 3UETA 3W27A 1LWHA 1HXKA 1J0HA 1UH3A 1UKOA 4M80A 1E55A 1B3YA 5D9MA 4B15A 1W1VA 5I6SA 3VNZA 3W6LA 2MANA 5A2CA 3N04A 4KH2A 4Z2LA 1JI2A 3S2CA 4DUVA 5E09A 2CITA 3GH7A 1ZBVA 4RE4A 4A4AA 3A4XA 1HP4A 3ARRA 3WQ5A 3VO0A 3VNYA 2BVDA 3WH8A 1GVIA 2Y8VA 1JXKA 2EJ1A 2QLYA 2EO7A 5A6BD 3OIHA 2DH2A 1JZ3A 2D0GA 4GXPA 3GTNA 3RM9A 4FLQA 2CXGA 3VD4A 4DWSB 2GJXB 2YIHA 2JEPA 4D6CA 1UWTA 2HVMA 1EGZA 1EQCA 3SEPA 1CGWA 1V6YA 2TAAA 1M7XA 3VVGA 1BG4A 4JL2A 2J74A 4UFMA 1DWJM 1UASA 3WUEA 2ZUVA 1C8XA 4L4OA 5I0DA 1WZKA 3GM8A
chains in the Genus database with same CATH superfamily
5D5MA 4QPEA 4YK4B 3APGA 1T5AA 1KPUA 3PDGA 5DZ9A 2OEKA 4K3EL 3L4XA 3UU0A 4PIRF 4C58B 2M26A 2IANB 4O1FA 3LOWA 3VH8G 2YLHA 3DKJA 3VC5A 3OKDA 4AZ8A 4CQ9A 1IAIH 4D6DA 4U6YA 2WTRA 1XRSA 1YX1A 1M7PA 4LARL 4C6PA 3SO7A 3LM3A 3D4GA 3F7VA 1D8CA 4OIIL 3NL3A 3D3VE 4ADIA 4O02H 2A83B 5FA3B 3ZUNC 4MMXB 4PLJC 3HE7B 2X05A 1U4FA 1S46A 4LDLB 3TWCL 2JKPA 4Z0JA 5AYTA 2DQFA 1E3XA 3VGDA 3OYXA 3V0JA 4AM0B 2D0HA 1FSKC 1QRKA 5AHFA 3ZJ6A 4X5WB 1TNNA 1G0YR 2UZ9A 4PJAF 5KSWA 3GXFA 3ATBA 1RH8A 3MLVL 5A40E 4ACPA 2BXYA 3T08A 1AACA 5BS0D 1Q94B 1N8WA 5MHBA 4Q97A 4PMYA 3ZKQD 2DWSA 1KFBA 3RGVC 2CPCA 1LVEA 2OMWB 3P4OA 3W9DB 1XM3A 4XBSA 4N0YL 4IQHA 3WF1A 4LARH 4MWAD 3CZNA 4CSZA 4WI7A 1W0MA 4F37K 1E6QM 4PJXE 4JM2F 1SUHA 3PJUA 3E38A 2J71A 4JCMA 1HL4A 1TQCC 1EEYB 3VXOA 3HZMB 4WJXA 4L18A 3QNFA 4XK2A 4O1CA 2AK4B 7A3HA 1WYIA 5CC5A 1KRCC 3NDZA 3N44B 4UTUA 4NQUA 1A5NC 1E0UA 4UTBA 1IGFH 1V02A 3MLVH 5B21A 5EBWB 2FGBA 1F1AA 4HLEA 1H5BB 1KCVH 3AHTA 2GEQA 4LSBA 4XO5A 1KM4A 3QSRA 1RZ7L 3OMAB 4BF5A 3UESA 4N0YH 5JIQA 1XIMA 4WK4B 4X99A 4PP1D 3EGXB 3FUMA 4QKXB 4XRCA 3O4LA 2Z93A 4JBSA 1LJMA 1GC1C 3QTGA 3O3EB 1DQJA 4ZFQA 2FR4B 3RQ3A 1SSDA 2FWUA 3MZNA 1G6RH 3FAXA 2MUCA 2Q87A 3S34L 3I65A 1TPWA 2OSYA 3L2NA 2E6JA 1LO0H 1X1NA 1AJ7L 3FTWA 4Y4KA 3TIEA 4C56D 4X2RA 2OQLA 3IGSA 4X7CC 3B0PA 2NXYB 2WNGA 2X1RA 3RP1A 2JJTC 2R8SH 5ECGA 4Q8QA 3QG7H 1VENA 2C9UA 1O5XA 3RKPA 3B0UX 1J1XH 3Q65A 3VFWA 3EOSA 4UFIA 1DQLL 3ARWA 4FG4A 4KVNH 1V7NL 5DQ9B 2XHYA 3C8KB 1ZAGA 1VF8A 2X10A 1PSKL 4EAEA 2O9OA 2EABA 4Z7WF 3RU8H 3ARFD 5FX3A 3P9LB 1RBOB 4LU0A 4LK4A 2ZTKA 2IPFA 4WI8A 3BDBA 3G6AB 2Y7EA 2ATSA 1OYCA 5B38A 3N6QA 2QCMA 3PWUA 4Q8TA 4R7XA 1EGJL 5BXFB 4ZW6A 4YDJB 4FFVD 3NGBC 3WD1A 4KK9D 3BEVB 5FGRA 3WH7A 5T1MB 4J12A 3H2EA 2J6EL 2Y5JA 3MLYL 1DQLH 5SWZB 1FCBA 3PL6C 2CDGA 4MZYA 4PJ8B 4MVAA 5D4IA 1PSKH 1A9EB 1G7QB 5F1IA 1XLAA 3U9UB 3ES8A 1OSZA 1JFXA 2ZCKL 3VE0B 3BP7B 1TJXA 4BQ8A 4DGYL 4P2AA 1CFSB 5LB1A 3W25A 4WVRA 3BWSA 2VFGA 3U36A 5IB2B 1EGJH 1UUOA 5DMKA 3KE0A 3CC5B 2WM0A 3WHE0 4O50A 2R2HB 3GFUA 5DHYA 1REQA 2J6EH 2R2EB 3QHNA 3AHXA 2HCVA 2Y1AA 3QW3A 3LNFA 4ELKB 1RP8A 3W1TA 4YHZH 3GLAA 2PDMA 4Z7UE 43C9A 1KR0A 3NABL 1XIWD 4L64A 4U3SB 4DVBA 4TUJB 3BUQA 3SBWC 4MXQD 3VFUB 5FXCH 4CBZA 2ZCKH 4ZW8A 1TR7A 1OGPA 1J2BA 3MUXA 1BYPA 2PDJA 1Z8AA 1WOBA 4W8AA 1V0KA 3D34A 3UMTA 3JWNC 5TDNB 3UP6A 1SFLA 2C3XA 4HIEA 5CJQL 2HG0A 1PY0A 3NQ7A 3CV7A 2PGFA 4QTFA 2GDQA 2B31A 4YSDA 4OV4A 5CP7A 1Y5VA 4KTEH 4RMBA 4R8WH 5DA0B 3UJRA 1U8CB 2OXHB 3H56A 1SJMA 2JSFA 4MZRA 2FNWA 3CHEA 1DWGM 1BVKB 2YZ8A 4O57A 3NABH 4L9LA 1VPOL 3IKCA 4PG2C 3TO4C 1FHDA 3MJ9H 1XI3A 1XF2A 1D6EA 4EPBC 1OHQA 3RM8A 5D7IB 1N8ZA 5H4ZA 2OMVA 3N2TA 2HKFL 4L48A 4KK6D 4ROQA 3GMPB 3OYZA 3FB6A 3AUVA 4DYJA 2X41A 1BBDH 4GG6B 4XHJC 5H2BB 1E2ZA 3D3VA 3VWJA 1WA2X 3NFUA 4YPGB 5M94B 4DGVL 5SWQA 5IZ7A 4PJ9D 3APFA 4DGWC 4JFXB 1MHHB 4L4MA 3AQDA 3C2AL 4DJEA 4OUEA 1VPOH 3H6AA 5I1DB 1Y0LA 3Q5TA 3AU1B 1XKJA 4Y88A 1TKWA 3GBNL 2IDTA 3MJ7A 1XLGA 5HHXL 1M7DA 3ONCA 5K1VA 4R88A 1S6NA 3GW3A 3C2VA 5L6UA 4TNFA 2W07A 4JRFA 4TF4A 4KXCA 3GRWA 3FQ2A 1MEWA 1SXCA 1T1ZB 4DGVH 1ZPUA 1P5VB 1TQBB 1IX2A 1PKYA 3WUGA 1K6AA 1HL5A 1CB2A 1C9SA 1WKEA 1HQ4A 4LFYA 1YMHA 2C3GA 1RJPA 2GYSA 2LTQC 4D8PA 4AQLA 4OGYL 4KWUA 2DWTA 2P80D 5CCKL 3HIJA 2CJTA 4NP4L 4GYFA 4ODSL 5HHXH 3DVIA 4EJ1C 4OF5A 3VXPA 1U4EA 4QJ5B 4L6OA 4I0PD 4M4PA 4O4WA 1YMMD 3DGCR 2VDPL 3I6SA 5FOJA 4F7CB 3H2QA 1MJJB 2RR3A 3URBA 4NO0A 1JCVA 3NL2A 1GZQB 3G5VB 1W56A 3KM8A 1Z42A 1V93A 1M05B 4GUFA 4PG9A 1MIMH 3ZL2A 1UG9A 2MQGA 4AEHH 4U6XA 3IXTA 5C0EB 3QJFB 4XCNB 2FB4H 1XTMA 1DWIM 1I7RA 2VGBA 4DUWA 3WD2A 9XIMA 4HHWA 4LF3B 1AA1B 4BWLC 3EGDB 2NOYA 1B1YA 4LUSB 4NHVA 2NUPA 2VDPH 3C8HA 3TBCA 4E9SA 2D1ZA 5E1IA 5E6ZA 4FNQA 2R94A 4QRPE 3MV9D 1N0XH 1W54A 2WKOA 4DJFC 2WQSA 4IGNA 1UUNA 3GRGA 2F58L 3O9WA 3BC9A 4TNEA 3P82A 1NAMA 1KF9B 1ZP4A 4YN5A 4IG2A 2OX4A 4R4NC 5B1BB 4FXGA 2JJUA 3HAEG 4MMZA 4RSVA 2NT1A 4L0YA 3SPCA 1R3VA 2VLRA 3L6FB 2C5DC 1WA3A 1M7IA 2PR4L 2KLRA 2W8CA 1OX4B 2ZADA 4QRTA 1DJSA 2QZ5A 5EORL 3FJTA 1RIHH 4UDTB 3F4VA 4ZXLA 5BV7B 2PDYA 1TVPA 4GC4A 5CEZD 3U46B 2OCCB 3F12A 1EK3A 3GTHA 1GVEA 5F0PB 5HI4D 2F1BA 4FC3E 3UAJA 1DEDA 4Q4OA 1K8XA 4QO1A 2POZA 3PG8A 4P2QA 1CPUA 2CLFA 1NIAA 1TFHA 5H8PA 1E6SM 2EYSB 1HHJB 5I66B 2IXQA 4S2BA 4QWWC 2PR4H 1Y18B 1ET5A 3RTQB 1LYQA 1O75A 4HEPA 4KITB 3D0CA 5T5NF 4F8XA 1QTSA 4PGBB 5E8DL 1HKIA 5EORH 4Z7UA 3RGVB 1I7TB 4RGNE 4JANA 3K2UH 4WJEA 1HS6A 2O61A 3UZJA 5EEWA 3MV8D 3HCVB 4MJ5B 4FOUA 3U5UA 4FHAA 4LLDB 5E7FA 1RZJH 4UTBH 4D0CA 3LKOB 3EWXA 2AXWA 1ORQB 3SPIA 4X7TA 1AD9B 3SY0A 3WH9A 3NDYA 5L0QC 5LJYH 3FCGA 1JGEA 2Y3AA 5B7FA 1DE5A 1HCYA 1CENA 4LVEA 1QNVA 5K9QG 3BHBB 1UM4L 1WAAE 4K55A 4IPJA 1MXGA 2IDUA 4AENB 3LQGA 1E4XL 5K9XA 3R1GL 2XZ7A 1ZLUH 3WJWA 4F9LC 1V6UA 3IJEB 5FECB 1GEHA 4MM1A 4LUYA 2VD9A 2ZSVB 1G0DA 2DZUA 5F96L 2QKFA 3EYFB 3JWDH 2XISA 5MEOB 2P8PA 2Z2UA 2R51A 1N68A 1IGJB 2IVFC 3BE1L 4D9PA 3VG0L 1A3ZA 1X8FA 1KCSL 3ITGA 2P0IA 4P3WA 4MKMA 3ULUD 4H2CA 2NX5E 1UM4H 3BWUC 4U7MA 4DP5X 1H61A 3UNDA 3NGFA 1ME8A 3R1GH 4P8QA 4HUXA 5KVDH 2QV2A 4QR7A 3KBJA 5BMWA 4YLQT 4ZB5A 2OWWA 2ZJSH 2WJ5A 3HBPA 2H32H 4FL4B 3RL2B 4WSKA 5K1NA 3BE1H 2HWZL 2E27L 4PCTA 3LSOA 3VG0H 2XC8A 4HIXH 2DZAA 3GLZA 1M7OA 1MN4A 4TSBL 4PB0H 4G8GA 1S7SB 5J6HB 3ECUA 5EN2A 3CTTA 4G9FB 3A6BL 1M6OA 1T0OA 2Z1WA 3UX9B 5I1EH 1TVBA 5EBAA 3VFNB 3C3NA 2B5IB 3M9YA 5E2VL 1S2CA 3UWEA 3ROOB 5B7MA 4Y2WA 4BI7A 1QO5A 2UV3A 1F3WA 4ZXBB 2HWZH 2PCPB 1AGCA 3EBVA 3LKQA 2KZWA 4M3KB 2ED7A 4LCQA 4L3EE 3HLKA 4NZRL 3BT0A 4XNDA 1IWPA 1S7VB 1FLRL 2HPOA 1RJZA 5GRVK 4R4BA 3OGOE 3RA7H 1AP2B 5HJXA 2Q6ZA 5EEYA 3LQMA 4OHQA 4KJYB 2YZ5A 1H8SA 4X6DE 2Q2LA 2J6XA 2PCEA 2BPBA 1ZSDA 4PV9A 4JFDD 1AE6L 3KX6A 4M1DL 4ETQB 3TASA 4GKTA 2ISFA 4H6KA 1C1EL 1QFWH 4Z1PA 4B4HA 1N26A 4JDTH 5E56A 4GUQA 5E2VH 4MUPA 5JBFA 4K5MA 3PWIA 1PZ0A 4I8YA 5L8JB 3WO8A 4TKWA 3SE9H 4LP5A 3RNKB 3Q6FA 4JTQA 4WJ8A 1QOQA 4NXKA 1HILB 4Y2LA 3W7DA 1UA6H 2AQSA 3RE0A 3GNDA 2ZKXA 1DLHB 1F3XA 4LUJA 1WIUA 4CMMA 5JQIB 4HCHA 1FLRH 2WSRA 3FFOA 3D69A 3VOHA 4R7WA 3IAQA 3MNVA 4P46C 3VD1A 3BPWA 1AE6H 4QRPA 4XAKD 1UR9A 1QU4A 4PUKA 3PGCB 3W0WB 3MKKA 1C1EH 4EVZA 4EUPA 1RJQA 4NQSA 4AQZA 1KWKA 4IU2A 4L29B 3LD5A 4BYHA 4LYKA 2WCPA 1T21B 4C6FA 4YNYA 1ISVA 3MRBA 4J3OC 2PF8A 3N50A 3TZVC 1W5OA 3MCMA 3AVEA 3UYOD 4IBWA 1JNLL 4O58L 2G5RA 1EFQA 3TJHD 3C3UA 2X4RA 3A3HA 2Z6JA 3E9AA 3VDGA 3V0AC 2BOBB 3IUIA 4MJMA 2YGOA 3RZCD 2BVOA 2FTYA 1IEBA 3C6SB 1AYOA 1OX6A 3I7RA 3ATYA 4YXHH 2WXHA 3UA4A 3SBRA 3UOAB 2JK5A 3T2LA 1DQUA 4M48L 5D7JC 3SE6A 1S2TA 3HKFA 1IAOB 4OSUL 3TSDA 3ZDYE 3RVXD 4F58H 3BVNA 3PZOA 5C70A 2I26N 3DUGA 4H0HB 3TN4A 2A6LA 3EPMA 1Q6CA 3VA2C 2CLPA 2NY0B 1TV8A 5E4IA 4OFYA 1M68A 1Z6KA 4Z7NF 2L8AA 1JNLH 5D7KD 2D69A 4O58H 2E09A 5E2UL 3SSGA 3KWXA 4XAYA 2IPKB 1RMFL 3GRWH 2YRBA 1XIIA 1F76A 2R9HD 5D5MF 2H6UA 2CGRL 1TYGA 3GRBA 4KK6C 3FT9A 1XR9A 1SEBA 2BNUB 3T1FA 1PGRB 3UPCA 5FIPA 3F5KA 1QEWA 2IDCA 4XMLL 2EUVA 4M8VA 2F6KA 4GP4B 1XB6A 5JNYA 4RX4A 2PAJA 3QHFL 2WQXA 2XH4A 4OSUH 4FIQA 5ABDE 3O0KA 3C8FA 4XCYB 4LAMA 4NSKA 4AMAA 4TX9A 2C18A 4HT1H 1NUGA 4FXKC 3BISA 3D2UD 2CUHA 2DM7A 3DU0A 1YQVL 3V9FA 5GS1B 4GW1A 1R5IA 3BPOC 2HMCA 1WAAA 3TBYA 2A5HA 4OI9A 2AQ2A 2JCCE 4NENB 4MMYB 3PBVA 3PZ9A 2JF6A 3MLWL 3GNNA 1FWIC 4EI0A 2CGRH 1UR8A 3L1GA 3CDFA 1I8MB 1EIBA 1BYOA 5D8JL 3ULSB 4Y16C 1VKXA 2H26A 2P3EA 2D7TH 4XMLH 3OTRA 1ID2A 3P2VA 1U92B 4PRHB 3V6BR 4Z3JA 3TWAA 1HWHB 1UOZA 4R7LA 3TC3A 3PP4L 3H9SB 5A2JH 4GKLA 1U8IA 1YXYA 4P04A 5IB3A 1YQVH 1SDDB 2ODOA 1Q0XH 3LEXA 1GOIA 4ESKA 2PDFA 2DQJL 4RLIA 4ODHL 1X96A 3NIFB 3F7PC 3QIUC 5AUMB 3UGRA 1JHKL 5CIPA 5INCB 3PWVA 1LWHA 1UH3A 1JPDX 1N59A 4G9DB 4WDXA 2PXYC 2GY5A 1ZBVA 1CLKA 4HWUA 1SM3L 1AH1A 2EJ1A 2H45A 2EO7A 2IO5A 1ZA6A 3K0WA 4K6AA 3PP4H 1YNTB 3L3GB 2QUMA 2C9AA 3CFEA 4XCFL 2EO1A 1XR2A 3EOYG 4GBUA 5ETUA 1T89A 2DQJH 1VGKA 2NY1D 3KZPA 5FAGA 5HPCA 1QPPA 3WQEA 1MI5B 4MD0B 2R29L 2CR0A 1LO3L 5M3WA 5I17A 4Q6JA 3AU6A 4ZUUB 3NPSB 4XNQB 2KX9A 1HHGA 5EEZA 3BMVA 4CC0A 2XA3A 2J43A 4ZT1A 5E9DD 3QIWD 3NFPA 3EWZA 4HJFA 3MSGA 1P0EA 1A9VA 3CWNA 5HP5A 1ZLEA 2GG1A 4L3EA 1NMAL 4XCFH 1X4ZA 4K07A 2P24B 2C1PB 4UNIA 4EO5A 1CG9B 4EIGB 3W7HA 3S9IA 1WAPA 3MS8A 2OOGA 4KKZA 2R29H 5GJPA 1F6LL 4MNJA 4PLOB 1S5VA 4A8NA 3KVMA 1VQTA 1UC4A 1RJLA 2QCDB 2CFFA 3KPQA 4MNQA 4NQEE 1ZHKA 6A3HA 3GU9A 3UVIA 4WW2C 3VUSA 5IMOB 5ECUA 4ENZA 3TT3H 3F83A 1XCWA 4E41D 5IVXB 1XDLA 2CCRA 5AZ2L 1PZ1A 3T77A 3WHXB 1OBAA 4CD8A 3VI3F 4YTQA 1US3A 1RAMA 3MRHB 4PGDA 2V17H 4Z7QF 1GS8A 1EX1A 1JRHI 5AAWC 3GSUA 3M1BA 4JKKA 1MH5A 1WA0X 4ZDHA 3QDMA 1UYQA 1WDSA 5EU5A 2O7QA 3EA1A 3FJLA 1ZHBB 4E9QA 3RL1B 3D4ZA 2VYOA 1SLXA 2VDLB 5FWQA 2LABA 1USQA 3T65A 1EDTA 4IGMA 1CGSH 2APXA 1L9WA 5AC4A 5EU9A 2XVLA 5DK0B 1RY8A 4K3JH 3I3EA 2L3BA 4KW2A 4UQEA 3MYJA 3VXNA 3MREB 5GIRB 3DV4A 1FYTD 4RNFA 5AZ2H 1UWIA 2WKGA 2BY1A 3KPLB 3WIIH 5BS0B 3IMSA 5IW1A 4P5MB 4NQ1A 2Y7QB 3AWGA 1XRVA 1MW3A 4ZMQA 4KWWA 2VL5A 2J7FA 1FP5A 4MWAB 4AZCA 1X97A 1EBPA 3FN0L 3IWPA 5F7KC 3I6EA 4XGZB 5TE6H 4A6YB 4MADA 5DEFA 3U2JA 3FS9A 3WV0A 3VXMA 5I2UA 2AQNA 2XVPA 1A65A 1URLA 2GPZA 3FF7A 5FEPA 3ZVHA 2JELH 1WWWX 4X0KB 3L2MA 5GGTL 4PLJD 4WY0A 3FPXA 4R85A 1VFFA 5IQOA 4DXKA 1K8DA 4PMEA 1ZJAA 3JW7A 5D2NE 1WDPA 3GK0A 4GOAA 1J11A 2ZOKA 4Y0GA 2WNXA 2I9LB 3HMCA 1UVQB 3QXDB 3SBQA 2HFGL 5DO2D 4O5LH 3NR0A 4PYHA 2JBMA 5J1SC 3RF9A 2OJZH 4HWNA 1MRCH 3W70A 4OCSL 4EEEA 3FGCB 2BVPA 3LPGA 2WXJA 3MRJA 3VIMA 4RX0A 4AD2A 3ZRCC 4DP9X 1NWOA 4NJ9L 1GVQA 4TOYL 1BTMA 4DERA 1NIBA 3FU3A 1T0NB 3SZ8A 3FQXB 4WEUD 4M62L 1M7JA 3SKNA 1I2PA 3ZKND 4NKDB 1IGML 2XPYA 2VQUA 3UD6A 2VDOB 4OFCA 3GJEA 4C56B 5DMJB 3ULUC 4JN1H 1J1OL 5GHWH 4MNHA 3GKWH 3XINA 4A7QA 1EXPA 1JCMP 4HZ8A 3HPZA 2XHNA 4HJIA 4YDIL 3S8FB 2FLIA 1LUCA 1U1HA 1T5WB 4O02A 4NWUL 2X4OA 4ZEPA 1KCLA 5CUSH 2EIBA 4AZUA 4OCSH 5ENLA 2N01B 1OE1A 2FD6L 4AD3A 2JCCA 3T0EE 3DBSA 1IUZA 4JKLA 2WWNA 5HJYA 4NJ9H 3ZE2B 4F15C 3HS9A 2C9RA 4TUFA 1AFSA 3FY1A 3ARFB 6CGTA 4DYEA 2MPAL 2V7NB 3TBTB 2I9TB 1ME9A 4X9YA 2OMAA 1SEQL 2YJQA 2PDCA 1Q85A 4YGVB 1J1OH 2PLKA 1R3KB 3ARTA 1D9EA 5I6OA 4A3QA 3AG1B 4DJDD 4FERA 1ZENA 4FYQA 1JUKA 3THCA 1KN2L 1MZYA 2FD6H 2GBVA 5FFGA 1R87A 1B0RA 1VCBC 3VOIA 1KQZA 4N3UA 3X13A 2HE5A 3QKEA 3HC4L 1JFQL 1UZ1A 4M6PA 3QRGH 5E9XA 3LKNA 2MPAH 4J2MA 5TK2A 2ZA2A 4H9YA 3ZDXB 3QDGD 1GHRA 1SEQH 4HIHA 5GGRA 5AOIA 4FABL 1YN6A 2RGSA 4ZENA 3G5ZB 3TC7A 4RMTA 5H8DA 1MSPA 3IFLL 3S1VA 1DE4B 4HPOL 2JIXD 3VFRA 4CLMA 1LK3L 1FGNL 2GLKA 4LALA 4HMDA 1C9WA 1HXYA 1L6GA 5IGXH 3LEYL 2BVQB 3TAKA 1H0DA 4BK4A 2H0FA 1KCUH 4NJHA 3HC4H 4LLAA 1XIWB 3O3BB 1NPJA 5K9KA 3FTSA 2DYPA 4RNHA 3RNQB 2RIKA 3GKFA 1ZGLB 1OAQL 1YN7A 3CUPB 3GFXA 4KMLB 3R5EA 3MJGX 5AC5A 1VFHA 4FABH 4RDVA 1CCZA 3EOTH 2IC2A 5BROA 4BIKA 4FQXA 1AW1A 1LQBC 3GK8H 3IFLH 4WO4A 3F7YB 1FY6A 3GAYA 2CO1A 4XB3A 4DQAA 5TDOA 1OFEA 2QSTA 2YCEA 4F3HA 1RP9A 4Z6AT 3LEYH 5H37A 5I5RA 3G8RA 4JNYA 4EN3A 4NQEA 2G3IA 4CU8A 1P1ZA 1S7XB 2VDRB 4GX9A 3QTPA 4PWEA 4DF2A 4LNYA 1MCKA 3CFNA 4PJIB 2FHCA 1OAQH 4ZMYA 3ESVF 3ITCA 1R5WA 3S47A 1WE5A 3B8DA 3HFTA 2SEBA 1JV5A 3E96A 2YMXL 4LT7A 2REQB 3GDKA 2ADIB 3QR2A 2IDQA 1RK1B 3UQNA 3BO8A 3QZLA 5AVUB 4PJ9B 2F2HA 5JYLA 1VFMA 1XRFA 3TV3H 2IANE 1R33A 4WEBL 5F1NA 4XSMA 2D7NA 1XH3A 2VUNA 2YC1B 4Z7IA 4KZEL 5DJCA 4FLOA 1NJJA 4FRWA 3O3DA 3RWGA 1EGJA 5EKYA 3SDDB 3TO4D 3FTGB 4N2CA 3L7RA 1U93A 1G7UA 4JN2A 1XS2A 3ILDA 4ISVA 1Z9SB 2A3TA 2OZ4L 2QCCA 1OPOA 4MD4B 2OCZA 2EJAA 4PL1A 1HZYA 2FH6A 1B4LA 2YMXH 1M71B 4QEHA 4X80L 3QYNA 3NM3A 4DFHA 4ZS7H 3BVTA 2P46B 4XHJD 1IGTA 2Z4GA 3MRGB 5CIPH 3KLSA 2F9BT 4ZFGH 3MZGB 4WEBH 3K6FA 2R0LL 3IU3B 2YYTA 3GB7B 1MAML 4WSGA 2BLFA 5C0BA 1EAPB 4XO4A 3UY7A 2B4CC 3CV6A 1GT8A 3WJXA 1S9YA 4JFZL 1EEZB 4PJHF 2OLAA 3HO8A 4C83A 1I1FA 3WQFA 4GAAA 2Y5TA 2G95A 3VFSB 4RMRA 1VA9A 2J7HA 1KENL 3NH7H 4WFFD 3GNXA 4AQ8C 4H7VA 3KPNB 4GAGL 4I0PB 2AK4E 1YMMB 1UB6B 2ZX5A 1OAYL 4NKOA 1W8OA 4W5ZA 3R94A 1YPZB 3TTYA 4OD1H 3UERA 1ZVSA 2XN1A 5IV2B 3T0EB 3VIGA 3NQIA 1F1DA 1CGVA 2A7PA 5E2WH 1FA4A 4OVVA 3FNKA 4KKLD 4XPTH 1H0GA 1KM2A 3SCQA 3QYQA 3MB9A 3ILEA 1Z9MA 3L9CA 2XTSA 1Q8MA 2EPLX 5JIIA 3UR7A 4WRHA 5LNDA 3CJJA 4N85A 3MRKB 2DIKA 2I27N 5LKNA 1DQWA 1E90A 1Z9OA 3AROA 1KENH 3DURA 4E9YA 2A73B 3EH3B 5FAAA 3CAWA 2XFXA 4GAGH 4UCFA 4Q6YA 2GSIB 4ICXA 1N6QH 4Z2KA 3P4LA 4GJ1A 2NSQA 1INQA 5G2NA 2WBJC 1F97A 1OF2B 5E8EB 1FPTH 2BSSA 3MV9B 4X6FB 4UM9A 2Z26A 3PSVA 3K2GA 5IT2L 4KVPA 4WKZB 4YDVA 4JEQA 2HN7B 1I85A 5HSFA 2GJ6E 2Z27A 1VLXA 4HIIB 4D0DA 5IESL 1DQQB 5I18H 2NY1C 2OX5B 3MFGB 4EK7A 1K5NA 3DARA 4MTMA 3S1UA 3WLBA 3WE1A 3EJTA 3DECA 3OB8A 3O8XA 4C6NA 1ICSA 3HMWL 3FDKA 1Z7AA 4WUIA 1R46A 3MO1A 2XVNA 2EE2A 3N13A 4NRZA 2Y6TE 5LO7A 4ZTEA 3QQ1A 2VFEA 3ZK0A 1JE6A 3AI0A 5I73C 3PUUA 4XN7A 4BFIA 3FQNA 4H5SA 4DHGA 5IT2H 3WQWA 1OF0A 3OZKA 5CJOH 2YDQA 5CC3A 2GSEA 4DJFD 5IESH 1HJWA 5SWZE 1RA0A 1J05B 1XIDA 2BIIA 1UD4A 5EMYA 5JA9A 1FNGA 4O53A 1LL7A 3L5WB 1H11A 3BDYL 1EWDA 2VGGA 2HVNA 5DMMA 1NOWA 2D3LA 2VZ1A 5EO0A 3N2XA 1OD9A 1ZS8A 1N2RA 3M0MA 1TWSA 3LA4A 3D8MA 2AJ3A 1NFKA 3MV8B 3V4VB 5FF3A 4DGIH 2PU0A 4B3KA 3MJ8A 4PMXA 5DVOA 4B7IA 3JZYA 2Y2WA 3FB5A 1VHPA 4OB5L 4ZOBA 1EC9A 2CO3A 1TTBA 2FLBT 4Z95H 4N9CA 4NQXB 4Y4FD 2MCAA 5C09A 1Q72H 1FH5L 1V03A 1U1UA 3V0TA 3G1FA 4Z0XA 1ZA3B 5TDPA 3RCYA 5CGMA 1UWSA 3VKJA 2BVTA 2FSEB 1IKOP 3ZR5A 3VNJA 2PYED 3MGAA 4NB7A 2HT3D 3TPUB 4KHTH 1PIFA 3HS0C 1QWGA 3V0IA 1LMKA 3IGAA 1FG2B 2V9UA 3BCFA 3N4EA 4DWSA 2DZVA 5AZ1A 1OD8A 3O0LA 5JOFA 2ZA1A 2OL3L 3WLNA 5DRWB 2HVJB 1YNLL 1MYRA 2CLLA 3N9GH 2YW4A 3C5ZA 3CK0H 5FOBB 1E1EA 1E15A 4LSRH 7FABL 5A94A 5LXVA 5C2UB 5D7IE 2WZMA 3P0XA 1TTGA 4K1WA 3I9AA 4F1SA 3E49A 4UTAA 1ULVA 5AWNL 4K3EH 1PZAA 2GVEA 5DO2C 4IUOA 3OC8A 5D9SA 1XHHA 2ZXBA 4GG6E 3KCPA 3DXAB 4AGQA 2PWDA 1TPC1 2AEQL 1AR2A 3LEVL 2A83A 2EDMA 4KXZI 2OL3H 4TVUA 1YNLH 4O4VA 4WTZG 4HNTA 4ODWB 4OIIH 2HLFD 2BP5M 1K8ZA 2AV1A 4I7UA 3P73B 3L9RB 4AM0A 5BOOA 5ALBL 3FSWA 4X5WA 3DX7B 1QP1A 3ZKNC 2E86A 3TWCH 4FTVA 5HVHC 3B40A 3STLA 4OGZA 3LGDA 1Q94A 2YR3A 4HWZA 3GO1L 1YEJL 5AWNH 2OMWA 3HRPA 4RPPA 3W9DA 2CHNA 4L9DA 1B4RA 3SUSA 1TPEA 4K68A 4AYBA 4YSRA 1V5JA 4DKTA 4HTBA 2CO4A 3WDJA 3RJDA 3LEVH 4CD7A 2J7DA 3FYEB 2DQCL 2DKSA 2EIDA 4D9LL 5ABGA 5CN1A 4UOQA 3Q2DA 3CXHJ 2J2ZA 4LPXA 1Y6MR 1LE5B 2WD0A 3UTPE 1ADWA 2O4EA 1HHKA 5PCYA 4NZ1A 1H60A 3F62A 4JFDB 4LPCA 1IBBA 1BZOA 4CDGC 3GNOA 4RUBA 4EDWL 1IBFA 1FL3B 3AZRA 3GO1H 2B81A 4DJDC 3HR5A 2CAKA 5KYXB 5C0DB 4F8TA 3LXUX 3TM6A 4TV3A 2CIIA 3BXNA 5DZNA 5L9FA 3E9UA 2GJ6B 1RZ7H 1CT8B 1SJHB 2DQCH 4ZQCA 3BCDA 4LPWA 4PP2B 3WIAA 4D9LH 3B2UC 4LEXL 4MAZA 1IILE 2F8XC 1U8HB 2PYFA 2O7SA 4B0MM 2WLMA 2BB0A 1HL9A 2VDRL 4DO5A 3AREC 1EP1A 1JWUB 3S34H 5H37H 2H32A 3OIXA 4BGDA 1AJ7H 1UZDA 1JXFA 4JQ2A 4KC3B 3LZNA 4CMHB 4L9YA 3QRBA 2CBJA 3R4RA 4MJID 3MRDA 2YQ2A 2Q2EB 1TYRA 4LEXH 4U1KB 2CXEA 3QWRA 1V7NH 2WSPA 1HDMB 3P9LA 3IDJB 4ZX5A 1FV1A 3PBGA 3ECWA 4HT3A 4AGPA 3G6AA 4OZIF 3ECBB 1L0YA 1JFHA 3RZCB 2ZUYA 5BXFA 4P46D 1M9WA 5D6CA 4OJYA 3NCOA 4F8PA 3P67A 1PCSA 1IEWA 5EC2A 3CFIC 1F3RB 4IRJD 5F88A 3T6XA 1S7QA 3UFYA 5SWZA 1R3LB 4GFXA 1S7UA 3NXLA 3CH1B 5KJ7E 2JH2A 1XDJA 5LNRA 3QNZB 1A9EA 1S5MA 3MKCA 3MLYH 3U9UA 4JIHA 4J3OD 3UIZA 4WQOA 1NFDB 3TZVD 1Q6FA 5ANMB 1V7AA 2XYLA 1OL0A 2G0WA 2ILLA 4XXCC 4KKQA 4NN5B 4GP8B 5BOEA 4ZTYA 4NFCA 3ENEA 3QSTA 3KCLA 4JXCA 1BKHA 4Y19A 2EEDA 4DGYH 2BXZA 4GIRA 3CC5A 4LVGA 1KB5B 4H01A 2XFYA 3IKKA 5F2FA 4WTXA 2R2EA 2RCSL 3OKKA 4B5SA 4WI0A 1IQWL 1MNSA 1JNNL 4ELKA 3CLWA 4D6GA 2E9MA 5D7JD 3CWOX 1GSMA 4LGPB 1B3YA 3D2UB 2PP3A 4AUUA 2P26A 5I28A 2VKXA 4U3SA 1G4TA 2G3XA 4H9MA 4G9PA 2A77L 3VO0A 3LM7A 4WGHA 4R3UA 2OMUA 2ITDB 4M19A 3TVAA 5TGBA 2NR6A 4O1AA 5BZDA 3GTNA 4P4RB 1G7IB 5GSRA 1VZWA 2WYTA 3WKPA 4JL2A 3ZIYA 2J74A 4UFMA 2RCSH 2HCZX 2OGYA 5AYZA 3SFKA 3FOLB 4P2VA 1IQWH 4XN2A 5CJQH 1JNNH 3C0QA 3OG6B 2R9RA 2Z7WA 4KAQL 3RWEB 1BVKA 2QJIA 1ET7A 2DAVA 4UV4L 4WIQA 4GBXC 4I5BB 4R0LC 2A77H 3AB0C 3NT0A 4N87A 3ZR6A 3WLRA 5D7IA 3DK0A 4WY0F 2B39A 3QXAA 2YX0A 3ZQXA 4OLWL 5EF0A 3GMPA 1TMHA 2Z7ZA 2HKFH 2Q8LA 4IL0A 1FNEB 2E1WA 4GG6A 4KGLA 5FKYA 4JTUA 2NUXA 1L0XA 4Y16D 4YPGA 3O41B 2OTDA 1Z32X 4DI8A 4NN6C 3OKEB 4EZKA 1FG9C 4FR1A 1R6WA 1XUUA 2IWFA 4KAQH 7ENLA 4PJXA 5ABTA 4ENEC 4UV4H 2X7WA 3IGFA 4OZFA 5JIMA 2FX7L 4KKLC 4S0HA 5E8PB 2PI6A 1FO0B 3C2AH 2R1MA 3D2TA 4HP5A 4XKMA 5KMYA 4XTIA 3QIUD 2B9BA 3GBNH 3P77B 4PLKC 3SE4C 2X6MA 2QHRL 2PXYD 1AR1C 2F74B 5E9DB 3N15A 3QIWB 4HNUA 1KYOK 5BJTB 2E6DA 1T1ZA 1P5VA 4AYEC 3O06A 3TJLA 2CRYA 3ZUCA 3KDMB 4G9FE 1WWBX 2LU5A 4GXWA 4H25A 2BJML 3E8UL 5H35B 5DJYB 2ENSA 5JR1L 1POJA 2FX7H 1GIGL 2HA1A 2JLPA 1K70A 3BUVA 3U2ZA 4OGYH 2YBTA 1O5PA 1PJ9A 4S2CA 4W8BA 2UZYA 1NFPA 4HYWA 1KLFB 2DSVA 1FC1A 4UT9L 5CCKH 1F73A 3QUGA 4NP4H 5I8EB 1RH9A 4BHUI 2XX1A 2NY4C 4X63A 3I85A 4DQOL 2QHRH 1X5YA 4ALDA 2B3IA 4E41B 1JRBA 4OCWL 4ODSH 1RCOB 4GLEA 3W73A 3P69A 3LB0A 4F7CA 3GU1A 4WHBA 5IHLB 1HXMB 1PDKA 2YLAA 2WXOA 2QV5A 3W85A 3T4AB 2WOBA 3PPHA 2BJMH 4LVNB 3E8UH 1GZQA 2WW8A 1KFGA 3O0FA 3UTQB 2P53A 5JR1H 4A3YA 1I7UA 3WELA 2YEZA 5AHLA 4DLMA 1J5SA 1ROCA 3SDOA 2XWBA 1PLCA 3IFNL 3RR4A 1FGVL 1BECA 3MRNB 4S1QL 3WI9A 5F4SA 4UTAL 1YUHB 1JZ4A 1YNPA 1FHGA 1BXBA 3OHXC 1BEXA 1VGAA 5F0MB 2WWKO 4OCWH 4KJPD 1FYTB 2HUHA 2NLJA 3QJSB 1OGBA 1BQKA 1FHVA 2H1LM 2LU4A 3W0WE 4Q8MA 1ZTXE 4P3CL 2VDMB 4TVSa 5CEXA 1CWYA 5I5IA 4HA3A 4G1EB 1IT9L 1FGVH 4I4WB 4QX4A 2XXCB 3CHVA 2HB0A 2F58H 2OAAA 4UTAH 1R3RA 5AHNA 1NCOA 3BD5A 3NZSA 3HG3A 1UEMA 4Y4FC 3REVB 3L6FA 2XGIA 2ICCA 2FGZA 1OX4A 1J2WA 2E5DA 1FSKB 1TU2B 2PS2A 3VG9C 3LVTA 1LDSA 2C3VB 4BRVA 4UDTA 1X9LA 2VN7A 3RVUD 2NRDA 5KJRL 4YWIA 3RYMA 3OKLB 3U46A 3FNDA 4N5UA 2R29A 4G7SB 2OELA 2J7GA 3K91A 1T22A 2HT3C 2PLMA 4P3CH 4HUWB 7PCYA 3DHUA 2XINA 1Q6EA 3K1DA 1S7RB 4UNTA 2IXVA 4FX8A 2E0PA 5A1AA 5IBLD 3HGRA 2R27A 1GKOA 2BOGX 1B31A 2Y5EA 4P23A 1KBPA 3N91A 4D9RE 2EYSA 3Q8CA 5I66A 2UY7B 2Y7LA 1TQCB 2LR4A 5IRPA 1VHNA 1Y18A 3RTQA 4KI1A 3DOHA 4N86A 4HFWB 2Q3ZA 2J75A 4K3DL 5F3FA 1A02N 3D07A 3CIQA 1I7TA 4GLRI 3UWUA 4US5D 1JN6A 4DW2L 5DQJB 5EOTB 3HN5A 3QFJD 5E8DH 3EWUA 1LP9B 1BJ1J 3UGEA 3QQ9C 3VU1A 3WDIA 4LLDA 4GGHA 3CBKB 5JXAL 2OQYA 2VX7A 2Q76B 2J8HA 4LLUB 1EPVA 2CUIA 1ORQA 3CBJB 3MHUA 2BGNE 2Z4QB 1KFCA 1AD9A 5HDRA 4KIEA 12E8L 2QSQA 4AE1A 1W9UA 1JD7A 2HLFC 2CJUL 3DTXB 2F08A 3V6FA 3BHBA 2OLDA 5XIAA 2Q10A 4KCUA 4AENA 1UENA 5DUBB 1YY9D 1OCBA 2PDBA 1KBJA 5I06A 1T40A 1QSFB 4DW2H 3P3BA 5MHSE 2D8KA 2NVAA 2AJUL 1EJVC 3NQVA 4DN4L 3REQA 1E4XH 4ONFL 3SPGA 3ANUA 4AI7A 3F6JA 1YKWA 1F07A 2PN5A 4FQHB 1ENUA 1IQDA 3EYFA 5JXAH 5JPNC 4PRHE 1XCTB 1IGJA 4TNGA 3AUJA 5KSUB 3MRFA 3H9SE 5F96H 1T4KB 3E3QC 2E7HA 1PF3A 2XOTA 4I9XA 3DHDA 2CJUH 4YFLI 1PG7X 3QDGB 3GTIA 4LRIA 4BFJA 3BKYL 1UD5A 1KCSH 2HFFB 3AQZA 3NIFE 4Q4IA 2Y1HA 2WC7A 1MCCA 2E9IA 2TYSA 5FKPA 1U2HA 3VFCA 1WFUA 4ONFH 1UJTA 1XP3A 3WBXA 1A21A 2ZTJA 5B1JC 3NGBB 1R2TA 1KJ3L 5GGTA 1L0PA 4G8FA 2GTZB 1T03L 5GRZA 1PTAA 1A64A 1G9NC 4HLZH 3UWQA 5J5RA 3PL6B 3C86A 3OTTA 3V6OC 1U8NA 1E51A 3PQYB 5CINL 2JKNA 1K77A 2JKTM 1DIOA 4GSDL 1LO5B 2H8ZA 3WLKX 2E27H 4NQCD 4AY7A 4YL4A 1ZD6A 4FXJA 5J6HA 3T55A 5C7ZA 5DTFB 1MI5E 2J13A 1RCYA 4TSBH 1TSIA 2G5BA 3VFNA 4M5PA 3IJQA 1KIUA 3DSFL 2MCPL 3A6BH 1A6TB 3JQOB 2EF9A 3ROOA 4S3KA 4CQCA 1SUXA 1KJ3H 4IP7A 4ZXBA 1PTZA 2VW4A 1GVYA 3GYCA 3ROLB 3I6TA 2AC0A 4ZK8A 2XUWA 3HAEB 4GSDH 2OGJA 3KYKL 3IVKA 1GYVA 1S7VA 4GY0A 2N7BA 1AP2A 4C5ZA 4KJYA 4AK1A 4NZRH 3V52L 1ZTVA 4J40A 4ABUA 3R8HA 2X9XA 5GS0C 5BVPL 3CNYA 2RHEA 3QOMA 2WHKA 1JIBA 2AANA 3P0WA 4RR4A 4S38A 2MCPH 1VACB 1M4KA 1O12A 4M1DH 2YW3A 4IRJC 3RNKA 4QAMB 1XDMA 4G7YL 3CZFA 5IVXE 4ZFZA 1JPHA 2QVTA 1P48A 3UBHA 3A23A 3EJJX 3W82A 3TU9A 3BOVA 3DOPA 5IFHL 3KYKH 1Y7VA 1Z3GL 4NAEA 3RX3A 2ED6A 3TO4B 4ZE4A 2WLIB 1GQNA 4IKIA 1QQDB 1QOKA 5HYEA 1ZIBA 3FTZA 4AWJC 5BVPH 4LOVA 1OZTG 1QTWA 3M0JA 3WEBA 1WS8A 3ABRA 1LE9A 4WQ6A 1A6WL 2Z8WC 1WZMA 4F7EB 3MRPB 4L29A 1E56A 2QDDA 3TR9A 3B2DC 1UZ6F 3D0VA 1T21A 3Q9PA 3X14A 2F7OA 3H42L 1IVLA 5BS0E 1DORA 4BR1A 3VIKA 4R0LB 4H8PA 2IOOA 4YE4L 1S9XB 4MOZA 1ML1A 4WLCA 2HFTA 4CVWA 2ALDA 4DP2X 3GVVA 5F7DB 3PWLB 3RIFK 4MWAE 1E0WA 2BNQD 2BOBA 4LU5L 3M0YA 1Z6JT 3FVDA 4HU3A 1NGYB 1KFWA 1R3HB 2Y36L 4OKVB 2QUUA 4BA0A 2CPUA 1LQ0A 2NNRA 4OZFH 4BI5A 2R1YA 5FF6B 4AV5A 1HO4A 6PTDA 3H42H 1L9PA 4N2KA 2X4SA 2P3YA 4M48H 5F6IC 3B4NA 1EZUA 2AKRB 3GYRA 3U0WL 4AYSA 2KDGA 2LTQB 2Y24A 4K3ZA 5KVGL 4LQ1A 4PY7B 4JIRA 2UXTA 5E2UH 1SQ2N 1RMFH 4G5ZL 4IMLA 2F84A 2BNUA 4YX2L 1F41A 2FL5A 3W2KA 3KS5A 2D9QB 4XX6A 1WIOA 5DUML 3THAA 3X1BA 1GJPA 1EERB 4C56E 4YSSA 4KV5E 4LBUA 4AWUA 2CCLA 4B91A 1NDMA 3MC5A 4XCYA 4CNTA 3RUGB 2WZPA 3QHFH 3BQ5A 5E1AB 1NIEA 3U0WH 2CWXA 1DO5A 1A14L 5GS1A 5K59E 2VXVL 1PG7L 1LRQA 4NENA 2AJVL 5EB9A 4MMYA 4PV8A 4M6ML 2NX5A 3ZE2E 3BSZL 4UM8B 4G5ZH 1I8MA 5A6SA 4NAFA 2Z7KA 1Q9WB 1DJXA 3IFPB 3MLWH 3PTQA 2CKNA 4EPEC 4PRHA 2YMTA 5D8JH 4GKOA 5AYBA 4Y9CA 3C6LC 4ODVL 3H9SA 3H21A 1WTLA 4HVBA 1OGSA 4XX1E 1L9OA 4RXGA 5D1ZC 2WBJD 4MA7L 3STCA 4G59C 2DVUA 2WPBA 2OZ4A 3FIGA 2XWCA 2VXVH 2AJVH 2XGBA 4UR9A 5INCA 2PDHA 4DH2A 4M6MH 4RE2A 2CO2A 5BV7L 4ODHH 1BZ9B 4B9KC 5HULA 1JHKH 5CLZA 2FRGP 5BUPA 1BFVL 3ZDXE 3QR3A 4HUKB 5HJ3B 3AIRA 1UWRA 5E7BA 4BKTC 1TZ9A 3WQPA 5EL1A 3E12A 1YNTA 1SM3H 2Q0ZX 2C6QA 3CAKA 5ICYB 3NEXA 4TUKL 1KY6A 3LCGA 1TTPA 3S2LA 1UR2A 2JI2A 4D8AA 3UXAA 5LCVL 1A6VL 4C7FA 2NY5C 1MI5A 4OUOA 4MD0A 2ICEC 3EYOB 3D0LB 1UROA 3AJXA 3NJNA 4Q8UA 4Y4FB 2BOCA 5BV7H 4X6DA 4ORIA 1Q6DA 4G7RB 3BPLC 4ZUUA 4XNQA 3U9PL 5EEVA 1LO3H 3QUZD 1UD6A 4I6VA 1U8JB 4DKAA 2EHHA 1Q6QA 4NZCA 1BFVH 3DFSA 3B8YA 1J93A 4KJPC 4U28A 5F7NC 1O6VA 2PYEB 1Q63A 1TZGL 2ZXCA 4N0UB 1AGBB 3UZZA 3OB0K 2P24A 4H3DA 3WEXB 1NPUA 2COQA 3QV6A 3MUHL 3KNBA 3GEWB 2F9RA 1NMAH 3MR9A 3M6YA 5LCVH 5BVJB 2B20A 3SE3A 3T3PF 1EPFA 3MJYA 3ABKB 1QR1B 1TV2A 1P1MA 2YCKX 1E6PA 1LHZA 3ARDC 3O3UN 5L0QB 4BEUA 4Z7OF 2R83A 2WWOA 3R7QA 1FQ9C 1HH9B 1FE8L 3L16A 1I8UA 4PJIE 1V79A 3R7MA 5IVXA 4TQTA 2P5NA 1GSKA 3SN0A 1GC1L 3HURA 1RU9L 1SNRA 4I13B 1PPIA 3QN3A 4CQDA 4Q8NA 5SV4A 4AEEA 3WQ6A 4QNPE 1CD0A 1QFPA 2BS9A 3RVUC 3WGUB 4QP0A 4TV5A 3BLPX 4WJ5A 1FWDC 2NNFA 4APQC 1GVOA 3OLDA 1ZHBA 3GJFA 3WTYA 5IBLC 1FUNA 2EC8A 1BQHA 4JFWA 2VN5A 3MRLA 3T3MF 2X88A 5KZ6A 1IO4C 1UH2A 4AXKA 4LFHG 5EWIL 2VCOA 1RU9H 3NFNA 3KPLA 2Y7QA 3PZUA 1DQIA 4L9ZA 2B0MA 1DKWA 1E9YB 1W9DM 2QVHA 2FIKB 3R43A 5EPDA 3FQRA 2Y9RT 4RISL 1F4XL 4BSWA 1V8EA 1RXLA 3M86A 4JGNA 5LIXX 3VU2A 5E8NB 3E0FA 3FN0H 1W9XA 1A1OA 5TF0A 3BQUA 2WO5A 1XCXA 4Y9NA 4NNXB 3T81A 3SODB 3NG5A 5GGTH 1PZ2A 4YZWA 2EO9A 4JCWA 3AXXA 1MY7A 2Z0IA 5EWIH 2I9LA 1LMIA 3TWBA 5BU9A 2AS5M 1YY9C 3BARA 2FJHA 2PDGA 3VACA 2X6AA 3G9VA 1XAKA 5AW9B 1JRHL 1JWMB 3U7AA 1TRIA 4RISH 1XLJA 1IJNA 2HFGH 4X42A 1YMME 4DUXA 5K9QI 4N8CL 5EMLA 2ZUWA 1KXHA 1DTUA 3RITA 1YPZE 1OYAA 2NY2C 5JH2A 1T0NA 5F6HI 1J5HA 4OIFA 4QRRD 4TOYH 4NKDA 5TJWK 2ZYHA 1XYBA 4CAGA 4M62H 4A66A 3RAJL 3PAOA 1EDHA 1IGMH 3GLCA 4EX4A 3ISRA 3HRZA 1T41A 2BNRD 4KDTA 3W7GA 3WS6A 2OL3A 1BF8A 4JTDA 4YDIH 4Q9CA 3M0LA 2PDIA 4PJXF 4PMUA 3VNDA 1VB9A 3W37A 4NWUH 3EDKA 4MJIB 3EYQD 3IU4L 3CAVA 3RBSA 2W81C 2FLMA 3MV9E 4MY9A 3TYEA 1ZTXL 2EUWA 3BD3A 4XUYA 1Z69A 2V7NA 4NP9A 4RZCB 1T5KA 1RY7B 3AISA 3B2UD 4XUGA 2BZCA 4YGVA 1R3KA 1JBJA 3BUPA 3IDYC 3RAJH 4PUNA 3U2OA 4P46B 3ARED 3V0GA 1J0HA 1NGWB 4NX5A 2A1YA 2DM4A 3PBUA 1NQBA 5JOPD 2CITA 4LHJB 1MREL 4RE4A 4K7VA 5I75C 4AE0A 3LZ5A 1KZQA 3IU4H 3R0MA 3MYOA 1KN2H 4R7DB 1YEFL 5CEZE 4I8DA 3SYQA 4F2ME 3KVQA 3URNA 5BW6A 1GTEA 1ZTXH 3D1MC 2WM1A 3TZVB 4LPUA 4WXZA 1JFQH 3LBMA 4LSPL 1VS1A 2J1WA 1DCLA 2AK1L 3EJYD 1WZKA 3G5ZA 4Q33A 3SGKA 1XXDC 1LBLA 2DYRB 1WWAX 4MXWL 1O0VA 3FQTB 3GMLA 1E4WL 4UMGA 2AQ1A 1DE4A 1YMYA 1FH7A 4AYFB 3WLIA 3RJQB 3BRFA 1MREH 2OKMA 1QPRA 2Z8RA 1AAJA 3P0YL 5D7JB 3KVLA 4HPOH 1LK3H 1YEFH 1FGNH 4XO9A 1XIWA 1KTDA 3H3PL 2WKOF 3NQKA 1D2OA 3MV8E 4XI5C 3UCDA 1WDDA 3T2QA 3PAYA 5CFHA 3CUPA 4OV5A 1JZGA 1IBGL 5HHNB 4NO5B 1TPUA 1ZU8A 2MJWA 4M51A 4LSPH 1EBHA 2AK1H 4ACTA 3U7VA 5DD3L 3IJLA 2FZ3A 4GAYB 2LLLA 4TMPA 3GZ3A 3W39A 3F7YA 4UQAA 4RGMC 2CXKA 2FTPA 1Q7ZA 1CLVA 4QEGA 3VNIA 4NJIA 4ZZ9A 3GQYA 3RCNA 5DRIA 1T1WA 1JWSB 3E0IA 5ADOL 3V8OA 4C6CA 2RFXB 2J44A 3K6SA 2VERN 1HHHB 4AGMA 5IMLB 1S7XA 3H3PH 2BSLA 4H0GA 3KPMB 4KRPD 3U48A 4FXKB 3LNDA 2QZQA 4PJIA 5F1VA 5G4WA 1IBGH 4EDXA 3TJEL 3BPOB 4HISA 3DG6A 5KBKA 1XLDA 4EI5C 5DD3H 3DBNA 4HBCL 3QC3A 2ZKWA 2D2CC 2JB6B 5C9JB 4HJGA 4B2DD 2ZCGA 1W1YA 3IBEA 4JM4L 4K39A 1RK1A 3CVCA 4Y16B 2BLEA 4Z7UF 1CIUA 2UZPA 4PRID 4ANVA 1X9RA 3C61A 4BCZA 1XCQB 1UXMA 1ZAHA 2CCVA 2AGKA 3QWNA 3FUIA 4ES4A 5HGHB 3SDDA 3DXAE 1TEGA 4GBXD 3C0LA 4B27A 4HG4K 3FTGA 1E50A 4F8LA 3BMWA 3K71B 1RUSA 4KZEH 2EZ0D 5GS2H 3QIUB 5FYJD 4KNUA 5CBEB 1Z9SA 3GB6A 5D2NA 2VABB 4ZB2A 1S78D 4CQAA 2PXYB 4YDLC 4YTUA 4JM4H 2OZ4H 5DHXB 1I8LC 4XPAL 4ZFFA 3MRGA 3QCTL 4X80H 3PRZA 4MPQA 4NFDA 4KY2A 2YQBA 2F1AA 3DHMA 5ID1A 3WBAA 3IU3A 5E00A 2ENQA 2XN0A 3SD5A 1HNFA 1EAPA 4PV1C 5ILTL 4ENED 1UWFA 1UT1A 5BMFL 2R0LH 1EEZA 5IUSA 3SCUA 1MAMH 2XKNB 2ZZ7A 2GAZB 2XBZA 2DQIL 3OAZH 4KBXA 3V5CA 5KYYB 3VFSA 3MP4A 2YSTA 4JFZH 4JR5A 1TT6A 3KPNA 5G55A 4PLKD 3G1AA 3GM0A 1UB6A 3AIVA 2X2IA 4FHKA 1AR1D 4JFDE 2NXHA 4A7VA 5IV2A 3T0EA 1OAYH 2OTUB 4MYXA 1OCCB 3S7GA 4Y5VC 4ZX6A 1MXSA 4CEUC 3L5IA 4P3DB 1F42A 5ILTH 2DQDL 1Z9PA 1FWXA 3AXIA 2FZ8A 2V33A 3S5YA 4TNVK 4M00A 5FHAL 4XH2B 3U2CA 3D18B 4ZW3A 2DQIH 3LV6A 4C60A 4MDPA 2A73A 4WW2B 2C19A 4TQIA 4AKQA 3ATEA 4DWDA 2NY4D 3HZKB 1W1B1 3UAFA 1EXBA 4AIOA 5E8EA 1OF2A 1GHSA 4XAKE 2PW2B 3NAAL 2A99A 2VDLL 1F1GA 3MV9A 5IJCC 4MLIA 5B8CC 2LAAA 3WLJA 3MA8A 3QXVA 3O0RL 1WOAA 4K8GA 5FSEC 5CPMA 3WFEL 3CVDA 5EFFA 4Y4HA 4HIIA 1UWGL 4N2HA 4F2MB 4F7MB 2X0SA 3NEEA 2DQDH 1DQQA 3SSZA 1NFAA 2OX5A 2W94A 3KAOA 4ZXOA 1A8ZA 2EYRA 1B0GA 3H2WA 1PZ5B 3EZJB 2YRZA 3VAEA 3ECQA 4BK9A 2BHZA 4KKXA 1IT0A 1W80A 3QUZC 2FE0A 2CUMA 3O07A 1WUZA 1FVCA 3TIMA 1BQ5A 3LJ3A 1K2DB 4NUMA 4YLBA 4A6YL 3HMWH 2FATL 3GJFH 3PZIA 1NGXA 4IDJL 3NAAH 4L7ZA 2VDLH 3H9HB 4A2HA 1EJOL 3GBML 3O0RH 1AL7A 2GSGB 4EZLA 2DSWA 2DLIA 1U2YA 4NYLA 1UWGH 2FECI 3FQWB 1PLBA 1DOSA 1EUTA 3D12B 1B4EA 3C87A 2BOFX 1W3IA 2WQRA 3L5WA 3T9WA 1XL4A 2QXWA 3ZHKA 1A4LA 2YFNA 3KPOB 1NFDE 4Z1AA 4K38A 1L8PA 3LV5A 5ANME 3BDYH 4C54A 3GPSA 4YDMA 4HHHA 3OP2A 2FATH 1F3TA 2YJLA 4IDJH 3QFJB 4IX2A 4NI6A 2WK2A 1OP4A 7TAAA 2VZSA 4M6QA 3AYRA 2VDOL 2HPMA 5C0GB 5AKQA 5DRZB 4UT9A 1E6RA 4YSTA 2E68A 3UZQB 4PBFA 4FQIL 1BCIA 2DY2A 4FIRA 4H8WC 4NQXA 2X53A 3PF3A 2BSED 4OB5H 1Z3NA 2JVUA 5EU6D 3MVTA 1ZA3A 3L2IA 1TG8A 4E4UA 1SY6L 4ZL1A 3IV8A 2VN3A 5EU7E 1FH5H 1HJXA 2FB2A 3DI0A 2RQ8A 1KLUA 2FSEA 4JDYA 3HGOA 1SJEB 2WNZA 4JE4B 2BIQA 2JWYA 4GXMA 4FYTA 2O5NA 1NANI 3GSRB 3TPUA 1U3JA 2IANA 1QA9B 5ENWB 1IXNA 2P44B 2VDOH 5A6LA 3QQ9D 5MEND 2B7PA 1MNUL 2X28A 5DRWA 3D46A 2ZZ1A 2ZTBA 3BWAB 1YEHL 4Q32A 4F15B 4UAOC 4CA4A 3GWQA 1HOEA 1GY2A 4X6BB 3IJ6A 5FA3A 5FOBA 1A3HA 4MMXA 4F2UA 1HP5A 3HE7A 3SCMD 5C54A 3GR4A 1BVWA 2FTWA 3OBEA 2C4FT 1A5AA 1PAMA 2VFIA 3F4CA 1FWBC 1GR7A 1OAKL 7FABH 1XF3B 1U3HC