1G9HA

Ternary complex between psychrophilic alpha-amylase, comii (pseudo tri-saccharide from bayer) and tris (2-amino-2-hydroxymethyl-propane-1,3-diol)
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
448
structure length
448
Chain Sequence
TPTTFVHLFEWNWQDVAQECEQYLGPKGYAAVQVSPPNEHITGSQWWTRYQPVSYELQSRGGNRAQFIDMVNRCSAAGVDIYVDTLINHMAAGSGTGTAGNSFGNKSFPIYSPQDFHESCTINNSDYGNDRYRVQNCELVGLADLDTASNYVQNTIAAYINDLQAIGVKGFRFDASKHVAASDIQSLMAKVNGSPVVFQEVIDQGGEAVGASEYLSTGLVTEFKYSTELGNTFRNGSLAWLSNFGEGWGFMPSSSAVVFVDNHDNQRGHGGAGNVITFEDGRLYDLANVFMLAYPYGYPKVMSSYDFHGDTDAGGPNVPVHNNGNLECFASNWKCEHRWSYIAGGVDFRNNTADNWAVTNWWDNTNNQISFGRGSSGHMAINKEDSTLTATVQTDMASGQYCNVLKGELSADAKSCSGEVITVNSDGTINLNIGAWDAMAIHKNAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic evidence of a transglycosylation reaction: ternary complexes of a psychrophilic alpha-amylase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE
total genus 157
structure length 448
sequence length 448
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2000-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1g9hA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1g9hA01
2ZWYA 1WO2A 1W9UA 3CHDA 4UQ9A 5BCAA 3D52A 2F7QA 3SCRA 3CZEA 3EJRA 1K9EA 5CLTA 3EJTA 1R86A 3W29A 3K1DA 2OW7A 3LXAA 4EE9A 3ARQA 3TA9A 1RP9A 5M5DA 4E8CA 1R47A 5A8PA 2VVNA 4AD4A 3LRLA 2YBUA 2ZUUA 1UYQA 3O2LA 4DWSA 2V3EA 2FYVA 3RM8A 4UQCA 4QDMA 3ZJ8A 5GNXA 5I5RA 5IFTA 1E6RA 1KGUA 4FNUA 2CBUA 2XFFA 4DUWA 3BH4A 4CU8A 1H09A 3EMZA 2WVSA 1LQ0A 4DWSC 3WQWA 3ZR5A 2DPEA 3VD4A 3VDCA 5FCZA 3BUPA 4CN4A 1R75A 1TA3B 5A2CA 3VIFA 2PI6A 2V38A 1JXJA 1X6NA 3PTQA 3HG3A 2DH3A 3AZRA 3WELA 4D1JA 1K6AA 3WBAA 1PPIA 4P7OA 3U5YA 3K4AA 3FHQA 8CGTA 2YDRA 4CCEA 4W7VA 1E0VA 1XH2A 4KRTA 3T0DA 1MW1A 5ECUA 5D9MA 1QNSA 4JFVA 8A3HA 4J28A 3GXTA 1UH2A 3WDIA 2WMJA 1QNPA 1TCMA 1WZLA 4U2YA 1G0CA 1MVYA 2G3IA 1GVYA 4NI3A 1HP5A 2WKLA 1HVXA 3WY3A 1V0KA 4JKKA 4PMUA 1BQCA 2VC9A 4P8WA 4CU7A 5BRQA 1CPUA 4JKMA 5D8ZA 3OBAA 2W66A 1XC6A 2DDXA 1C92A 1TA3A 4DUXA 1CTNA 2XIIA 1E6PA 3MS8A 1GPFA 4DM2A 1VEMA 2WWCA 1BGAA 3EDDA 1W1TA 1CECA 3BLBA 2V3FA 2BXZA 3AZSA 1NP0A 4IPNB 3DX2A 2A3BA 2PBOA 2XFYA 3A21A 2W4XA 1ZJBA 2NT1A 4HZ6A 2D24A 5GNYA 2X1IA 2CHNA 1AMYA 1J0YA 4AZ6A 1R8LA 3BSHA 4U3CA 2V5DA 3GH5A 1OSEA 3WD0A 2DSZA 3K8KA 1QW9A 4MDOA 4J3XA 1MQRA 3OA5A 3SUTA 3VDBA 3AICA 4MAVA 1KR0A 1H5VA 2XM2A 2YOCA 2ZUMA 4W85A 1LLOA 4M56A 1M01A 2DQXA 3LPGA 3T2OA 2A3AA 4ML4A 2BHZA 4E2OA 3TP4A 3VD7A 1KB3A 2XWEA 4AZCA 2D73A 2YKKA 3A5VA 1GHSA 1PBGA 4NRSA 1Q4NX 4MAZA 2XHYA 3IJ7A 3AI0A 5A6AA 3ARSA 4MJ4A 4BQ5A 1E1FA 5ABGA 3ZR6A 1DWAM 4LXFA 1E72M 5M17A 2VR5A 1IT0A 1VRXA 1V0MA 2QHAA 2GDUA 3KLKA 2AOSA 4W87A 4HOZA 4HMCA 4PYSA 1CYGA 1NP2A 4QCFA 5I77A 5CG0A 1G9HA 4WKHA 1FH8A 5CSYA 1ZJAA 3D4ZA 5FD0A 5DT7A 2ZE0A 4PMDA 3AYRA 4UZSA 5A3HA 4LYPA 4W86A 1JG9A 2F8QA 1QX1A 4FNRA 1B30A 2XSBA 5A8QA 2BV9A 3FNDA 2CHOA 1Z32X 3CHFA 1OGBA 1OCQA 1ZBCA 4H8VA 3VM7A 1V3MA 1W32A 1EOKA 5D4YA 2BY1A 1WE5A 1PS3A 2WWDA 3IAQA 2D1ZA 1JIBA 4GQRA 4Z2HA 3OB8A 1I75A 1UH3A 3SCPA 3ZJ6A 2YL9A 5CXPA 1XV8A 3VSVA 1EXPA 4OGZA 5E6YA 4A4AA 4CVWA 2E3ZA 3CPUA 4PEEA 4U2ZA 3MSDA 1X1NA 3L4TA 4UQAA 4GXPA 1QI5A 3A6OA 3WF1A 1KCLA 3PZMA 2Y2WA 4FK9A 3ZJ7A 3W0KA 4BQ2A 1V6UA 4XV0A 1AQMA 1AQHA 4BQ4A 2PF0A 4M82A 1FHDA 2V3GA 1HWWA 3AFBA 1MWOA 4AD3A 3WN6A 5A8MA 2VCAA 9CGTA 3S5ZA 2JIWA 3LPFA 3VIKA 2BVTA 5C70A 2EJ1A 5BXPA 2DT2A 1GZJA 5HPOA 3ZSSA 1D2KA 1HJWA 3FW6A 4FNTA 4AC1X 2WZEA 1HJSA 2MANA 3KE0A 4MB4A 3AHTA 2JALA 3WQ8A 2WSKA 1XGZA 7TAAA 2WZHA 5M03A 2ZXDA 2O9OA 4GZJA 5AYIA 4ZEPA 1HNYA 1E5NA 3B9AA 2EABA 1CGYA 1HVQA 1G94A 4E4PA 3UCQA 3QHNA 4UQBA 4HZ7A 2J74A 1VFMA 1BGGA 1HXKA 2RGLA 2GJRA 4AY1A 1PEZA 5I78A 1VJSA 1UWTA 4AZ5A 1TG7A 4JL1A 4P8UA 1AQ0A 3A23A 1J10A 2UY5A 1J18A 2XN2A 4D6CA 3WEMA 1TR1A 1CEOA 3OGRA 2J79A 5I6SA 1TQUA 7CGTA 3N18A 3EJSA 3MSGA 3VX1A 1KQZA 2X0YA 1RP8A 4WJXA 4UFKA 1CNVA 2ZX7A 2VTFA 1M7XA 4BZYA 1B3XA 1WZAA 4LYQA 3UERA 2G3JA 3BAJA 2WHKA 1V6VA 1B90A 3IGUA 1ISVA 2Y8KA 3ARXA 3L4WA 4FLQA 4GI6A 1W3JA 3WD1A 1CXEA 4XX6A 1UWRA 2JFEX 4N0RA 3UETA 1UKTA 2O9RA 4FMVA 4JKLA 4CD8A 5KEZA 3EDKA 2W62A 4HA4A 4FLOA 5ABHA 3VIOA 2F2HA 1BYDA 1C90A 1XCWA 1M03A 4H41A 5KZ6A 2FH6A 1TMQA 3IANA 2YL8A 1WB0A 5IHRA 1W2VA 4XUYA 3W28A 1HL9A 3WH7A 4X0NA 5A94A 3WF3A 4DO4A 3D3AA 2GUYA 4R27A 1BG4A 4AMCA 3MUY1 3KL3A 1VBRA 3CUHA 5E1QA 4HOXA 4MTVA 4UFMA 1KXTA 3AIUA 1H1NA 2FHBA 2EXOA 4UZUA 4TVUA 4HP5A 2X0HA 3DYOA 1W3LA 1VF8A 1OGSA 3BAIA 3HJEA 3PHAA 4CD5A 1Q6FA 2J47A 5A6LA 3WF2A 3PZUA 3DYPA 2EADA 3B9EA 4LPCA 1HT6A 2W67A 6CGTA 1KXQA 1OGGA 4UFHA 4FNQA 3RILA 4AMXA 3TONA 1UHVA 3UEQA 2PB1A 3AMKA 2YFOA 4NF7A 5ABFA 1LWJA 2BVYA 3MUZ1 2OWXA 4WSJA 1NOUA 2XSAA 3AHXA 1W1PA 3VDHA 3LPPA 1UH4A 5JBFA 3KL0A 5BYWA 4A3YA 1JZ5A 1GQKA 5EMYA 3WH9A 1LL6A 2ESCA 4CCDA 2CERA 4CD7A 1CXKA 5I23A 4OKDA 3K46A 3NDYA 5D9NA 2VZVA 2E9LA 3ZT6A 1WKYA 1JDAA 2VCCA 3ARTA 5AC4A 3F5JA 1GOWA 3DC0A 2WKGA 2X2HA 3DDGA 2CYGA 3TV8A 3LXCA 1UKQA 3CIVA 2BXYA 1E56A 3FY1A 2O9TA 1BF2A 1HKKA 2FGLA 1OIMA 3N04A 4BF7A 4F9JA 3WBEA 1PJ9A 2YDSA 3PZTA 1UR9A 1BG9A 1FHLA 3E1F1 3CGTA 4PTXA 3BVVA 1GOOA 3VOCA 2E0PA 2WBKA 2ZXBA 3VGDA 5IDIA 2DH2A 4WLCA 2G8ZA 4URIA 2WCGA 4KRUA 4F9DA 4AZ7A 2WMKA 3S2CA 2XVPA 3GYCA 3MUAA 3K8LA 3T0BA 3FHAA 2YLLA 1CGUA 4X0VA 1UG6A 2JF6A 1WAWA 3OLDA 4Q7NA 4CN6A 4JL2A 1H41A 5FKYA 5CJ5A 5LA0A 1NH6A 5BXSA 2J8FA 1OBAA 2GJXA 1WZMA 1EHAA 2BY2A 3FAXA 2E8ZA 1GHRA 1UWIA 5A6BD 3WNNA 3L4UA 1UZ4A 1XD1A 3PZNA 2WZIA 3IJ9A 3I3EA 2ZWZA 3VUPA 4UOZA 2D20A 3VX0A 3TTYA 1H0GA 3QOKA 2JEPA 4PRWA 4FNPA 2G3NA 4HPHA 1PX3A 1ODUA 2F1AA 4IPLA 1ZBWA 4AISA 3THDA 4UOQA 5I3DA 4AIOA 5A6SA 5A69A 4W7WA 3W6LA 3VGHA 1DWFM 1TVNA 4IM4A 4HU8A 2XGBA 2FDMA 2WVTA 2YA1A 3EMQA 1I1WA 2X2IA 1EQCA 1JNDA 3AROA 4R5EA 1QPKA 2ZUNA 4QFUA 3MV11 4OBRA 2EACA 1ITCA 1QI0A 2A3HA 5CPQA 3VDAA 2ZUVA 3CUIA 3W81A 1GQIA 3KZSA 1H2JA 2EQDA 3VMOA 2O9PA 2IGTA 2ZICA 2EPLX 3D51A 2Y5EA 3AOFA 2YJQA 3HG4A 3W25A 1R33A 2CEQA 4ATLA 4YHGA 1UD6A 1DWHM 1ZL1A 4D6JA 3GXDA 4PSRA 1K9FA 3OGSA 1Q6GA 3TTQA 1DTUA 4CU6A 4TX6A 3BSGA 1X6LA 3G6MA 3W24A 1V6WA 1JYVA 6TAAA 3AHVA 3NDZA 4OJYA 1JF5A 4MDPA 4EK7A 3AMDA 1WNOA 3W27A 1ZU8A 4B9YA 3CC1A 3L4ZA 3W37A 5CGMA 1E15A 1KGXA 1V3IA 3N11A 4AZGA 1JAKA 1U2YA 4FLSA 3MUIA 2X2YA 2EPNA 3I3DA 5FIPA 2OWCA 5A2BA 2OYKA 1MQPA 3OZOA 5BROA 1L0PA 2D0GA 4MB5A 1QVBA 3VGGA 3BVTA 4GO9A 3BVUA 3H55A 1TQSA 2QMJA 5BXTA 1OD8A 3T09A 2WC3A 4KMQA 2J78A 1DWIM 2A3CA 5A2AA 2YBTA 3LXBA 4ZFMA 4D6EA 2YA0A 3GNOA 4D6HA 1JAEA 3BAWA 1R85A 2CIPA 3T2PA 2J7EA 2ZX6A 3SIMA 4L4PA 5A8NA 1SR0A 2GJPA 3CTTA 4GPNA 1G5AA 3QHOA 3AMCA 5GNZA 4JIEA 2X09A 1E6ZA 1I1XA 3APGA 1MFVA 1NWUA 4AWEA 1V3JA 4M81A 1LL7A 2J62A 5CSUA 4JFWA 1HF6A 3AIBA 5HXMA 3VGBA 1XRVA 2XGIA 1UASA 4J3WA 2OSYA 3AIEA 2ZUWA 3ZT5A 3CUJA 1KWGA 1E43A 2NW0A 2F7PA 1J0KA 1QOXA 3CZKA 4QLLA 3D5HA 1QHPA 2D3LA 4EAMA 1WCGA 4MNMA 1GJUA 1P6WA 3DYMA 2IXVA 2FHFA 3W38A 3GXPA 4J3VA 1JFXA 1G01A 3AIRA 4W89A 2VRJA 4D71A 1BYAA 3ARZA 3NSNA 3A24A 2C7FA 1OB0A 3AHZA 1FFQA 4GKLA 1CGWA 3WF0A 2YDQA 2IXUA 1JDCA 4RE2A 3QGVA 4ZE4A 1CGTA 1SYTA 3WNMA 5CGTA 5FL0A 1BLIA 3WMSA 2OW6A 3WQ4A 2DT3A 1KQYA 2BHYA 1GOMA 2Z1SA 1KTBA 3AMGA 3ARVA 3AZTA 5DF0A 3RM9A 4ACZA 2XVKA 4AD2A 3ARYA 1PIGA 3CLWA 1CENA 4IISA 1GUVA 1WZKA 1V08A 4HTYA 2VZSA 1UD5A 1ISWA 1DEDA 3QOMA 5C8BB 3VGFA 2FH8A 3UG3A 3CBWA 4FF5A 3J7HA 5A8OA 1DP0A 4NSBA 2G3MA 4TUFA 3PBGA 1VFOA 2WW5A 1LG1A 1EDGA 2AMGA 1J0HA 2D0HA 3EDFA 3OG2A 1CXFA 1JFHA 3CMJA 3MMDA 1QNRA 3KWXA 2J7FA 2ZX8A 3W53A 2WK2A 1VENA 1QWUA 3PTMA 2XTKA 3WNLA 1UWSA 2B31A 1UQZA 1MFUA 4PN2A 1Q6EA 5DMYA 2OSXA 4ZXLA 1ISZA 4JFSA 2ZOXA 3NUKA 1HP4A 1E0XA 3EMCA 4W8AA 1ZB5A 3PZVA 4MB3A 1XSIA 4EKJA 1MW2A 3CZGA 5M3WA 2HVMA 2WVUA 3CUFA 5D8WA 3CZLA 5E70A 5JBEA 1WDRA 1EDQA 3ZSTA 1MQQA 3ZJKA 4WF7A 3DHUA 1PX4A 3M07A 3BXWA 2OYLA 4UCFA 1BTCA 4Z2JA 1Q6DA 2XN1A 2XPKA 1C7TA 1B2YA 3N13A 4MPKA 4MADA 4AMWA 1HTYA 3WFLA 1JL8A 2CKSA 3WDHA 1WDQA 1SFSA 2TAAA 2C8NA 2VOTA 1KCKA 4UNIA 4F66A 1BSIA 4K68A 4LGXA 3WDRA 4TVDA 4NZJA 3POHA 3WD4A 3EJUA 3DDFA 1ZBVA 1NARA 4P7LA 4JHZA 4YPJA 4D6GA 4H8UA 4Z2IA 2E40A 1T0OA 4TXEA 1KFWA 4PBGA 3L4XA 1C91A 1B0IA 2FGZA 2WC7A 2WHJA 3RDKA 5I0DA 2CNCA 1DWGM 4NXSA 4BCEA 4HMEA 2X05A 4Z2GA 1TZ7A 4ZE5A 1L8NA 3OLGA 1EHNA 2XFRA 3W4RA 2JIEA 4M29A 3KEHA 3UG4A 2CITA 1VFFA 4J3SA 1NOFA 4PMXA 4W5ZA 1C8QA 4JFTA 2WVVA 1PAMA 2CETA 1OINA 4MJ2A 1NWTA 1WDSA 5A6MA 4Z2KA 3AS2A 5GQBA 1B31A 1HN1A 3CUGA 2X8RA 1VAHA 1QBAA 3A3HA 5IXEA 3W6MA 2WHMA 1R87A 3EJQA 3VIHA 3WNKA 3BUIA 2OSWA 3L2LA 3SURA 4D6DA 2V5CA 4C7GA 1CZ1A 3BAKA 2VUYA 1IV8A 4RL3A 4J3TA 1GW1A 1PX8A 2BY3A 3U7BA 2VO5A 3QHMA 1UZ1A 1Q6CA 1OWQA 3VD5A 1QWNA 3CZSA 4HPGA 4IUGA 1VFUA 2WPGA 3BAYA 4NZCA 1D7FA 1E71M 3BUQA 1O6IA 4UQEA 3BVWA 3VILA 5E6ZA 2NSXA 1HJVA 1CGVA 5DO8A 1HKMA 4CN1A 3SCNA 1JI2A 3SCUA 2Q8XA 4FLRA 2VL4A 4YHEA 4W7UA 4V27A 4S3KA 2GFTA 3AJ7A 2D3NA 1ISYA 1JZ6A 2XWDA 3A4XA 4NRRA 1HJQA 1OT2A 4JCLA 1OM0A 3VD9A 1QI3A 3CV5A 1C3FA 2UY3A 1V0NA 1XH1A 2DSVA 3O6AA 1GCYA 1JNEA 3W26A 1XHGA 5IFPA 1VIWA 1JI1A 1GOKA 1JGIA 4MNJA 4U31A 1QI4A 2J25A 4KGJA 2ZXQA 3IK2A 3OZPA 1FP9A 3SCWA 1E6XM 1NQ6A 1FFRA 5C71A 5A6JA 1H49A 2F61A 4J7RA 5EBAA 5BXRA 4JZ5A 4B3LA 5BWFA 3DECA 1F4AA 1R46A 1W9DM 2V3DA 2VZOA 5HOSA 1HKJA 1E55A 1W2PA 5E0FA 2J8GA 5ABFB 2DT1A 4B9ZA 4GINA 1FP8A 1J0ZA 1QW8A 3D50A 1OIFA 4CCCA 1W1YA 3ALFA 1K9DA 4OUEA 4WIWA 3GTNA 1US3A 2BHUA 4MB1A 4UFLA 1V02A 3BCFA 2EAEA 5LA2A 2WBGA 3WY2A 2QMKA 1U33A 3VNYA 4DUVA 3AIWA 2XN0A 1ITXA 1C8XA 3ZOAA 3HMCA 1KWKA 3BMVA 1LWHA 3GZAA 3GDBA 3VKKA 4M80A 5EFDA 2XG9A 3K4DA 4PTVA 4AXNA 4C7DA 4DM1A 1R7AA 4PMZA 2W63A 1CDGA 3L4YA 4P7QA 1PZ2A 3WSUA 5JUVA 3T0AA 1WP6A 5ABEA 1UR8A 4ZXOA 3RMEA 2NT0A 1W3KA 4ACZB 3CZ8A 4PMYA 4AEFA 1V03A 2X2JA 4MNLA 4CGTA 1ISXA 3NYDA 3VTRA 2GK1B 1BAGA 2VJXA 7A3HA 2GSJA 2BVDA 1XSKA 3W82A 2WAGA 3SCQA 1HKIA 1E9LA 2O92A 2XM1A 2VQTA 3S5YA 3DX1A 3BUBA 3AS1A 2GDVA 4AD1A 2QPSA 2ZX9A 1FH7A 1JZ8A 1UD2A 4WKFA 4WKAA 2BY0A 2VX6A 4U5KA 1H4PA 4KWUA 4TX8A 4L4OA 4PUDA 1UA3A 1H0IA 3PZOA 4QLKA 1ECEA 3WY1A 4HA1A 5CPSA 4DWSB 3GXFA 1YQ2A 3B8SA 1JDDA 1XSJA 2GK1A 2EEXA 5LA1A 3ARWA 4M1RA 4UQDA 1LG2A 1NWSA 4W5UA 2EPKX 3GH7A 4OIFA 1J9YA 3U7VA 3WQVA 2E8YA 1UA7A 1KR1A 1E73M 4PMVA 3SUSA 4AD5A 2XIBA 1GVIA 3ZO9A 3AYSA 4QAWA 2D23A 4QP0A 1TE1A 3F5KA 2WXDM 2GJXB 1EQPA 1O7DC 4S3JA 1UKSA 3BVXA 2DEPA 4U33A 3RPMA 3EBVA 4F8XA 1BVZA 4NXKA 4N42A 1EH9A 2EPMX 5HNNA 3DX3A 3AIQA 3EDJA 1E6SM 3GBDA 1XYZA 3VSTA 4HZ8A 5I2UA 1J0JA 3VPLA 1EO5A 2JE8A 1MXDA 3BLPX 1F4HA 1E70M 1UD3A 2PWEA 1SMDA 1A3HA 4AYGA 4B16A 4UFIA 4XZWA 2WCSA 3N17A 1JYXA 1UUQA 4W84A 4JHOA 2WMGA 3DHPA 2VURA 1VEOA 1QNOA 2JEQA 4D1IA 4PMNA 1UWUA 4U5IA 3VIMA 5I79A 4AD0A 4CD6A 5E09A 5FL1A 5A95A 3OLEA 2F7RA 1NM9A 2VRKA 1EOMA 3IAPA 1JYWA 3CMGA 4BA0A 4B3KA 2J7BA 3S6TA 1D3CA 1JYNA 3AISA 2WNWA 2E4TA 4BQ3A 3BLKA 1IZJA 1J11A 1VBUA 1TUXA 4HMDA 5DT5A 5EB8A 1EIBA 5JIPA 1GQLA 4U3AA 3MV01 5BRPA 3LPOA 4V2XA 2VX4A 3CZJA 4UOJA 5HDRA 2VMFA 1N82A 2YFNA 4J3UA 5AY7A 3PTKA 1V3KA 3A4AA 2ZUSA 1KBKA 1ZS2A 1HIZA 2XVNA 3RM4A 1M04A 1PZ3A 3OGVA 4A3HA 3PZ9A 4ZENA 3WD2A 5E0CA 3RCNA 4AIEA 2WMFA 4DWSD 4H7VA 2EO7A 3PZQA 3OLIA 5A1AA 4H8HA 1MXGA 5F7UA 1HJXA 3WQ6A 2WSPA 2PBGA 3AQUA 2WYSA 1C8YA 1B1YA 4W88A 2ZX5A 4CKQA 2WLZA 1DHKA 3WDJA 2WANA 2VQUA 5IHSA 2DIEA 3II1A 4EANA 1CXIA 1W9PA 4P8VA 1K9TA 2WCAA 4UTFA 3WD3A 4UFJA 4W93A 3AXIA 3VSUA 3T08A 1KXHA 3GM8A 1HJUA 2UWFA 4P8XA 1W3HA 1OT1A 2E9MA 1E1EA 4ACYA 3L4VA 3VNZA 2Y4SA 2J75A 2J7GA 1UKOA 4TTGA 1ZBKA 4PUEA 3WH5A 1B3YA 2XJ7A 3LX9A 2DGAA 4PTMA 3CHEA 1J01A 3G6LA 4GI8A 1Y7VA 3SCSA 3VIGA 4MNKA 1SMAA 1CLXA 1E6NA 4AZCB 4W8LA 3F5LA 2D0FA 1ESWA 5HBFA 5E9AA 1TQVA 3WEZA 3WNOA 3UR7A 4GO8A 2VVSA 4HA3A 1KBBA 3VIPA 1BPLB 1JD7A 1E4MM 3GBEA 1MYRA 4TTUA 3ALGA 3N9KA 1TQWA 3GH4A 1V0LA 2XUCA 3ZM8A 1JZ7A 2CPUA 3BUDA 5JIWA 1U30A 1UR2A 1J0IA 3ZIZA 3HZ3A 5AC5A 3DX4A 3VD3A 3AXHA 3ARPA 2F1BA 3LRKA 1EGZA 4QCEA 2W91A 3N12A 1HXJA 3VMPA 2WMIA 1RD6A 1YHTA 4CUCA 3WF4A 1W91A 3WENA 1H3GA 1JD9A 1B3WA 1GONA 2VR4A 3AS3A 4TOQA 1KXVA 2CXGA 2F18A 2VCBA 3D4YA 1CBGA 1S46A 2XVLA 1GORA 1GNXA 3WY4A 1R7OA 3HU7A 3NIYA 3A22A 1SZNA 3N1AA 3CHCA 3L2MA 4LYRA 1BFNA 1E5JA 2UY2A 3K8MA 3GXNA 1TVPA 1ODZA 2BS9A 1UOKA 1GOQA 1EO7A 3EYPA 5D9OA 2FHCA 1C93A 1QI2A 4P7RA 3UG5A 3N15A 5A6KA 3WH8A 3O9NA 1UD4A 4XB3A 2OWWA 3M6DA 4PCTA 2DT0A 3UR8A 4PTWA 3SUWA 1FOBA 2Y24A 2BFGA 1QBBA 3H53A 4DO6A 3M46A 5EFFA 1E4NA 3AIVA 5A6BA 2CKRA 2BNJA 3WUBA 2OYMA 3WEOA 3PZGA 5D9PA 4AZBA 3AS0A 4AIUA 2IUZA 1TQTA 1LJYA 1V02E 1EA9C 1MW0A 3ECQA 2VT0A 1V3HA 2VZTA 2PWGA 5FOOA 2VNCA 1XH0A 2AAAA 2PWDA 3F4VA 1FA2A 2OLHA 1V6XA 2DSUA 2J4GA 3KL5A 5GPRA 3WUGA 3M7SA 3I3BA 3POCA 3WIJA 1LL4A 1TFVA 4FNSA 2E9BA 3HG5A 3LRMA 5I24A 1XCXA 2VX7A 3GXMA 3VINA 4CVUA 3CH9A 1JZ2A 3WKZA 4AEEA 2CESA 1VB9A 4HOWA 2JF7A 4TVCA 4Z2LA 1E4IA 1RH9A 4AZHA 1BVNP 1NOWA 3CZNA 2WHLA 2J7CA 3WQ5A 2CCRA 3RJXA 1JF6A 3UESA 4KGLA 1JZ4A 3WH6A 3EJPA 2PWFA 5AYBA 3RO8A 2WC4A 4AW7A 4WK9A 1G1YA 3NSMA 1V3LA 3VIJA 2A3EA 2XVGA 1NWRA 2YL5A 2QPUA 4M8UA 3BCDA 1W9VA 3OIHA 1PIFA 1WDPA 2ZUTA 2YIHA 1EDTA 4AZIA 2DSKA 1E3XA 2QF8A 3U5UA 1US2A 1UR1A 3MO4A 3WDPP 2G41A 4CD4A 1GQJA 4DO5A 3ARRA 4C7FA 1DWJM 1R34A 1A47A 4H2CA 1UKPA 1B9ZA 1JXKA 2G4FA 3ZQ9A 4HU0A 1WPCA 4X9YA 3FN9A 4M24A 5CLWA 3TTOA 3SUVA 2EPOA 3GNRA 3HN3A 1FH9A 1RPKA 5CQ1A 3VM5A 5LYRA 2YA2A 3A47A 1UR0A 5CZKA 1E40A 3VVGA 3AMLA 3WMBA 3IJ8A 4GIAA 3RJYA 2VZUA 1E4LA 6A3HA 1XD0A 1BYCA 1QHZA 3VO0A 3TOPA 3MMWA 3JUGA 4KH2A 1V6YA 1GOIA 3H54A 2CBIA 2PWHA 4PMRA 2J77A 2QV4A 5JBDA 3SCTA 1W1VA 4UR9A 2GVYA 2ZXAA 2YLAA 3NJ3A 3AXXA 1LF1A 3B9DA 4XZBA 1VJZA 4ATWA 2WMHA 2FE0A 1M53A 4Q22A 4YN5A 3MMUA 3GXIA 2DSWA 3FAWA 3KLLA 3RIKA 3QR3A 4QLJA 5HPCA 1OD0A 1CGXA 2EBNA 1J12A 3ZMRA 5CPTA 1KGWA 2Z1KA 3PZIA 4OOUA 1KTCA 1JZ3A 1H11A 2WVVB 4OBSA 1B3ZA 3VGEA 4RE4A 3PN8A 4PMQA 1HX0A 4OZOA 3LMYA 4GZEA 4H04A 4D6IA 1W9BM 1XYFA 2VI0A 3NCOA 4OOZA 1UWQA 3WUEA 1UR4A 3SCOA 5DEZA 2Y8VA 4JAWA 4LQ1A 3NSXA 3U57A 2DIJA 3BMWA 3ZT7A 4NX0A 3AHYA 2HISA 3MI6A 4JCMA 2W92A 3BC9A 1O7AA 4E8DA 4NZFA 1IZKA 4P7NA 4PSPA 3A4WA 2RGMA 1AVAA 3DX0A 1QHOA 4GI9A 4GQQA 3BGAA 4PCSA 1E0WA 3WUFA 2PC8A 2CBVA 3ARUA 3THCA 4D72A 1BHGA 4LX4A 2C0HA 1E3ZA 4PMOA 4B15A 3MANA 2XYLA 3MU7A 4AYSA 4V28A 2W61A 2QLYA 3TTSA 4F79A 2ZIDA 2WM0A 3T2QA 3BAXA 3WFZA 1HL8A 2VX5A 2ALWA 1W9XA 4BS0A 2D22A 3FXYA 2VRQA 1QNQA 2UY4A 1C7SA 1GJWA 1UD8A 3GNPA 4J27A 1MW3A 3MKKA 3WMCA 4WSKA 1CIUA 3CO4A 5TD4A 1VEPA 1B3VA 2W5FA 2WB5A 3VIIA 4RE3A 4Y7EA 3SEPA 3VU2A 1BYBA 1E6QM 5DFAA 3SCVA 3WDQA 3EDEA 3SUUA 1CLVA 4ATDA 1CWYA 2F7OA 2J7DA 2WLYA 4JFUA 1UQYA 4GZIA 2WMIB 3WL0A 3VMNA 1CXHA 2J7HA 4D6FA 1CXLA 2CBJA 3HG2A 3WNPA 3WL1A 4W8BA 2D2OA 2YL6A
chains in the Genus database with same CATH superfamily
1HL2A 1L9QA 2XTJD 1C12A 1IC0A 4Z3EA 4WCYL 5KW9H 1WO2A 1W9UA 4R6UA 3KVJA 1CF8H 3D52A 1OP4A 4QRRA 3BMXA 5HSFA 5J4MA 4BQ8A 4CQCA 3DOSA 1UB6A 4YDZA 5F1SA 4LHQB 3M1BB 4LSSH 2YDAA 3EJTA 3Q2NA 1AR1C 1T04A 1UEMA 2B2XH 2Y36H 2V5JA 4Q3MA 3U4FA 1AZZC 3K81A 5IFHH 2FJFA 1XIWC 1I1YA 3LXAA 1Q38A 3QO1A 2QCGA 4TSCL 1AHWC 1DQLL 2NX5E 4NZUL 3PWPD 3GSMA 2ZG3A 1HGYA 3DXIA 5EN2B 1S78D 3TA9A 2XZ9A 4EE9A 3HN8A 5DCCA 4EOWH 2N4IA 1X5ZA 1EAQA 2QCDB 1A1MB 3CU7A 5M5DA 1R47A 4GXUM 4BYHA 1CDUA 2YBUA 5HDLA 5E2WH 4LPYA 3ZE1F 4J3OF 2ZUUA 1L8PA 2IBZY 2X4NB 1RHCA 1UYQA 3RTQC 5IB2A 4NT6A 3O2LA 3UX9B 4DWSA 3OKNB 3VRJB 5FXCH 4G8IB 1HE7A 3FUDA 5JUEL 2V5KA 4QDMA 1FIEA 1AZCA 4WKXA 3RZCA 5IBXA 5E6IA 1SW3A 1CDHA 1V5JA 3M0XA 3KPRB 2ITCA 2YD5A 4X9IA 4GFXA 8FABB 4HUVB 2I5YL 2XFFA 5C08A 2C3WA 2GBUA 3EMZA 3BPCB 4QYOB 2A7PA 2FJGB 1JVKA 3HKFA 2NXZB 2DN7A 2W07B 4WO4B 3WTSA 3NEHA 4FEZA 3WQWA 3ZR5A 2VLRA 2DPEA 3L13A 2YPVA 3VXSD 4MD4B 3WJLA 1I9RH 5CGBA 1R75A 5IMMB 1PB0A 2DUXA 3W7MA 4KTYA 1XDTT 3E12A 3SGKC 3MGTA 3LKSB 1H3VA 3HG3A 2GSHA 3AZRA 3L0NA 3OHXC 4DOHE 1IXQA 3V5KA 2DDQL 2L7UA 5J11B 4IBVA 5C3LD 3IFOB 3HC0B 5C0AB 4BKLB 1CDIA 1QRNE 1YNTA 2ZZ5A 4IMCA 1KY7A 3UY7A 1L6WA 3LUTA 4N2KA 4JREC 3FTSA 4FL4C 4ZOCA 4JANA 5E2VL 4FFTA 1O1HA 4UNUA 4CCEA 1XGYH 1JNNL 2ZADA 3X12A 2ZZ6A 1E2VA 1MCSA 2YO3A 3HS0A 4LKCB 4JGNA 2GQ3A 1SOKA 4AWJC 2CO7B 4KRTA 2FIKB 3KTSA 1D5RA 3BQUB 1T21B 4X4XB 1E4JA 3ESPA 5D70L 3UZYA 3BI9X 3GZQA 1OAKL 2Y07L 1S7QB 1SUHA 3HBZA 4UTBA 4ZGYA 8A3HA 5I09A 3KH4A 1Q72H 2X1SA 3P0WA 4R2GD 3SADA 1AMXA 4QJ3B 3CD4A 3R0UA 4NQ1A 3HJZA 4IGMA 4ZB2A 5KANI 5FA4A 4NAMA 3CFKA 3IDXH 5EV7A 3W2MA 4N2EA 4JKKA 4PMUA 3U0TB 3TJLA 4OQVA 4NPYB 5AOUA 4FO4A 2EE0A 1CPUA 4F5CE 3OBAA 3ELQA 1D6EB 4L5FH 4MX7A 4PG9A 1R0AL 1EGVA 1FVPA 2DQUL 4UFJA 5DCDA 1AAJA 3PP4L 5B8CC 3O63A 3VU1A 1BV8A 3CLFL 1TPB1 3BDKA 3BICA 4HIEB 5J56B 1R5YA 3MV8B 4QGTA 4XNUH 5ANMB 1GYAA 2PDCA 2XIIA 5C55A 3ITTA 4LCCB 4WZ9A 4NB7A 3DGGA 5DC9B 3RL2B 1OAZL 5AD0B 1KRAC 5DHEA 4HCDA 1JPST 5A6IA 1W1TA 4LSVL 3L6FB 4PJ5B 3PAOA 1EHLL 1T89A 1W6TA 1Q9OA 3BLBA 1F6FB 1SO4A 4QXUL 2BXZA 5T1KB 3AZSA 5C0BA 4NRZA 1NP0A 4NUPA 3EW3B 3GSRA 3V6BR 2WXOA 1BZ9B 4JGDA 1BYPA 3CFMA 2B1AH 4FN0A 2M8XA 5GS0L 2YMXH 3LYEA 5IESL 2NT1A 3VXMA 4HZ6A 4QDPA 1Z5YD 4L05A 4PGBB 1U21A 4MXQC 2AZAA 5HDBB 1CU4L 2BFVH 1IGMH 3FB6B 4YHKH 2EKSB 4XBEH 4MAYD 3WS3B 2YPIA 5A6SA 5F7HA 5BZZA 3W56A 3VXTA 3GINA 1J0YA 4WI9A 1J9CT 3MWAA 2E7MA 2WQPA 4MDJA 3BSHA 3NBNA 2QIWA 3D18A 5C0RH 2H1PL 4LSUH 3TN0D 1F02I 1NPUA 4JFXA 4TL4A 4U3CA 2OYPA 5EOCH 4YGVA 4ODUA 1NDVA 2JKNA 1OSEA 1NICA 1X9RA 2X4TB 2HWGA 3UZZA 4I9WE 2EIMB 4KW2A 3WD0A 1HJCA 5C0GB 1YC8A 5J6GA 2AKRA 2P9RA 4A3RA 4J3XA 1GHFH 5IK3A 4B53A 4FTVA 4F57H 4M02A 2XWTB 1X1OA 3L9BA 1K77A 1EQWA 3LY0A 1YPZB 2TMDA 4TV6A 4UI2A 2BVQB 4MFHA 2C1OB 2X1XR 2O30A 1DQXA 1H5VA 2XM2A 2BNQB 3QPZA 4ZW3A 4W85A 3M0VA 4IQLA 1M01A 3LPGA 2B1OA 2DTSA 4X8CA 3T2OA 3P5ZA 1L2UA 4OLWH 1D5MA 3QZAA 1Y5WA 4E2OA 1TPH1 3INUH 3GKFA 1VGEL 1RLDA 3QIWA 1EZLA 4CLMA 1BWWA 2OZ4H 1FSKC 1N7ML 2YKKA 3A5VA 1Z44A 1PBGA 2W0KA 1TEGA 3B3IB 2XZQH 2BNRE 1DJHA 4AQ1B 3T6WA 4MAZA 4G9DB 3UO8B 1AZ2A 3KPMA 1TUFA 3GIPA 1RULH 5BPPA 4FYRA 3PJSA 4Y9AA 5FAAA 1WH0A 1LO0L 2QQLH 3NIDF 4MJ4A 5ABGA 1KCRL 3ZR6A 3CV6A 1A7OL 2HJLB 4JPSA 1QNIA 2Q3XA 5AW5B 1SJMA 2EIZB 5HDWA 3S34L 2PD9A 3C2RA 3L9RB 5KJ4A 4WWKA 3RNQA 3IMRA 3G1XA 3I7RA 4ZXBB 4FZIA 3VFOA 1MWAB 3NJMA 1T7YA 4HK0B 2HCZX 4XPTH 4XWGH 3TJHC 3BJFA 2YXWA 1KBVA 1PSKH 5D1XD 1PCKA 4ICCX 4HJ1A 3QDGA 4X5XB 4PJFE 4JTDA 4R34A 3K2UL 3U46A 5FECB 4XHJD 4KTGA 1UMLA 2JB5H 2DWDB 3MV9B 2PS2A 4XNZC 3O6MH 2Y1AA 1KN2H 2OTWA 4HMCA 1Q6RA 4XN4A 4PYSA 1FFPB 4KIRA 4ASTA 5FYKU 1NIDA 3N6HA 3Q94A 2AL2A 2EZ0D 5TQ0H 3E80A 1HL5A 3MOBL 3SGDH 4WKHA 5CSYA 2Z1VA 1SFHA 1Z5HA 4W1TA 2AXHA 3DRTA 4P3DB 3TA3B 2R4SH 3CHVA 2QQKH 1CD9B 2C4XA 3REQA 3T1GA 1NOAA 3OTRA 3WBYA 2WO4A 3QQXA 4PG2C 5HI4C 3K1KC 5LLIC 3S3GA 3ZKND 4G8IA 2B0MA 3ITGA 1JGEA 1QX1A 3B1TA 3AGVA 3L0KA 5D05A 2BV9A 2G5RA 2NCMA 4PJAE 4K9EL 2VQ1A 4BQCA 3WJJC 5DTFB 1S7RB 4WDTA 4DWDA 4E41E 4YSPA 3OKKA 3IWUA 3F7QA 4PD4J 1ZBCA 2W81C 4H8VA 3VM7A 3PWAA 4OM0L 3IS4A 2WJDA 5AB9A 5H8UA 2PTWA 3GDMA 2IXQA 1ESOA 2PP1A 3W88A 1PS3A 3SGKA 5FJUA 5KBMA 1I7ZA 2QZRA 3QWOA 4XNZB 4XO3A 2XH7A 1GOFA 4XN7A 3N43B 4CQ9A 2Z3FA 4NDMB 4DK3A 4X3ZA 3MREA 3CJPA 3F7KA 3CHXA 3PL6C 5KTEL 3SCPA 1BVWA 5FUCC 2FEDD 1IQWH 1FNFA 3NWRA 3LA4A 3V5HB 2XH0A 2PLMA 3VSVA 4D9QD 1EXPA 2LHAA 4OGZA 1AODA 4ZX5A 1IX2A 3V10A 4CVWA 5I6OA 2PP0A 1IC7H 2E3ZA 3LQZA 5LDSA 3MSDA 4F2ME 1X1NA 1VZGA 3PP3K 1QI5A 4QX4A 1EWEA 5FFGA 4K5PA 1QP1A 4JKPH 1NFDA 5LG6A 3UWWA 1MWAA 2Y2WA 5D4QA 3CT7A 2CHXA 3O07A 2H41A 5AOKA 2OMVA 3E6HA 3NFNB 4PMFA 4ZVJA 1IYXA 4MD0B 4GYPA 3L3HA 3MLZL 4XV0A 3ZO0A 1XSOA 2A6JA 4KI5F 5IRPA 3TJHD 2DMGA 2ZPKH 4OB5L 4L9LB 2V2WA 2NNFA 2B08A 2BRRH 3UABA 3EYSL 3CQHA 4LAQH 2MCAA 3IDIB 3I4EA 2JCWA 4XCEA 3T4AC 1H8LA 3D12B 4EO5A 2PF0A 3NM1A 3LV6A 2G30A 1HDMB 1FHDA 2MCPH 1Q85A 1QKZL 2V3GA 4M82A 3AFBA 3TNMB 4AD3A 3WN6A 1ONQA 2Q2LA 5ENWA 4U6VH 4P3CL 2Y7GA 4XTIA 4QXVA 1AZUA 3LPFA 2JIWA 3LRSA 1X7TA 3P4NA 4C6EA 2EJ1A 1UUNA 5HPMA 4UIMB 4P2OA 4TS6A 4DF9A 1BQHA 1UACH 1SJCA 4HVBA 2H6OA 1FNSL 1I45A 3IIVA 3VAVA 3VZYA 1UJ3B 3FKRA 3QRFM 1XLDA 1DCLA 1WS8A 3CSYA 1HJWA 3KPSE 3CO8A 4ECLA 1JZFA 3LV3B 1V8HA 2B59A 3I6GA 4TKWA 3SPGA 4CGUB 3DMMA 3IJIA 4PWHA 3W00A 4D8AA 4XO6A 1BMZA 5DHMC 3V4UL 1Q9KA 2OMWA 2YAFA 3TT3L 4LS2A 4IOSD 2R94A 4AC1X 4LZKA 5T9BG 3EOBA 4MB4A 4ZFFB 2W9DH 3AHTA 4POCA 5KITA 4WO0A 3PHQA 4WW2B 3WIHH 1XGZA 2CDEB 2BSCA 3CZFB 1Z3GL 3COOA 4PLKD 1JQXA 1YE6A 2XTJB 3KBMA 4IW4C 5AYIA 3KPLB 4KHXL 3QMTA 1DV7A 2IPJA 4RZ5A 2EABA 5CAKA 1HVQA 1G94A 3TPUB 4E4PA 3QHNA 5IQ7L 3WAJA 3NJLA 3LN5A 4UQBA 4HZ7A 5C0ND 4PUWA 1RBAA 1LNUB 4K8GA 3KS6A 4XWOC 2ZZ2A 4LNYA 5J6HA 1WKEA 1H50A 4G1NA 2IKJA 4WD0A 4HGMA 4BF9A 3L95A 3MBDA 1GYMA 4JM2A 1CZ8L 2B9BA 4NUGL 1A3RH 4HUNB 1PU0A 3TWCH 4QGCA 3WL9B 2I60L 2OR8A 4LBSA 1BWKA 3FFCA 5EC1A 1ZLVH 4IQEA 4LCIL 3KGRA 3RE0A 5FYLL 4QRQB 3BLEA 3WEMA 3BJTA 2JKTM 1CEOA 2J79A 2C3VA 3NMEA 1TO5A 1YNYA 1NSJA 4MKSA 5I6SA 7CGTA 5DQDL 5FKAB 3TCEA 4AVFA 3G08B 1XLBA 1Q9LA 1D5BB 1YUHB 2WP3O 3IYLW 3QVQA 4Y9BA 3U30C 4GHRA 1RP8A 4FQHB 1PKMA 4JDBA 5JH1A 1U8JB 1FJ1B 5E99H 3L3OB 1RCQA 3CL8A 3QR0A 2Z8RA 3HURA 4UFKA 1CNVA 1WUEA 4JTSA 5CC7A 2O5YH 5JHLH 3L3JA 4BZYA 4QXTA 2P7TA 3TQKA 4KNUA 2D7NA 5F89B 4HYTB 4QY8B 2G3JA 2V6AA 2NQ9A 3R10A 4BJHA 1RZIA 3H42H 4I0PB 5J89A 1F61A 1K7EA 1TTUA 3EWYA 3WIFA 1BEUA 3Q5OA 1B90A 1FPTH 4NYLA 4OFKA 5I7GA 2VEGA 4LUSA 1TSIA 4QI3A 1NFPA 3L4WA 2FPTA 4ZBCA 4ZSOE 2TSYA 3N91A 32C2B 1D9KA 3TJXA 3ZL4H 4ADGA 4GI6A 1NIBA 4OJAA 4E9XA 1WFUA 1HHJB 4HHWA 5KTLA 1HSBA 4D0DA 4APQC 1NC4D 5JOFA 2QHRH 3RA7L 5AKTA 4ZQMA 5HMEA 4JKLA 2AABL 4FMVA 3BWAB 5C08B 2BMKA 3LIZH 3QUMB 3X2QB 1H7OA 3E0WA 3MJ7A 5GGTL 4FQ1H 2W62A 1FZOA 1CBVL 2XA8L 3AUOA 1FVCA 4FLOA 4DI8A 1WWBX 2CJTA 3OAZK 1DBJL 2F2HA 2K7QA 3VXRE 2QQNL 5GJTH 3D3VA 4G6FB 3C3NA 3MODH 4FHBD 2JCCB 3WO3B 4H0HB 1POJA 3C6LA 4WGKA 1DQIA 1G0YR 5HJBA 1H5BB 2EO1A 1MSSA 3W6YA 2FH6A 1TMQA 4FFYA 5CFHA 3G5XB 1CD8A 3QXAA 2PEVA 1HL9A 2R83A 3WN5A 4X0NA 5A94A 3RX7A 3SKMA 4MPQA 3GS7A 1FV1A 4FEMA 3CFKB 3QIBA 3ZUNC 4HIJA 1TYEB 3LH9A 3LTVA 2ZCLL 3H9YA 2K78A 4NJAL 3SW6A 2VQ1B 5EWIH 4ZUVB 2UVFA 2HNHA 3UGVA 1BG4A 1KPUA 2JCCF 3L3IA 4KRPB 2DYRB 5LG1A 3GT6A 4UFMA 1LJMA 1ETB1 2NQLA 2J73A 3MLVH 5DUJA 5IMMA 4MWAC 3F58L 3XISA 5DLMH 1H1NA 4YLWA 3V3WA 1JTPA 1T21A 4JO2L 4BFGA 4FZ8H 2CLZA 4J9JA 3P3RA 3BP6A 4ZMVA 1IAIL 4ORGB 5IKCB 3EUUA 1DLFH 1CGSH 2YGNA 4GS7C 5DURB 3WE6B 2AQ3A 2ICWJ 3HIZA 3ZLQC 4CNIB 1VF8A 1OGSA 1WBZB 1IM3B 4GXVH 4Z3FA 1ZIBA 1UWFA 5H37H 3UC0H 1LBMA 1Q6FA 2ZDSA 4LT7A 1DQMH 4W4OA 5A6LA 4IRJA 4MAYA 2HT2D 3IVKB 1U1UA 2J47A 4JRYB 2UX7A 2W79A 3PUEA 1KC5H 1AG0A 4MQTB 3TJEL 5ACZA 4D6HA 3DTXA 5L6UA 1I85A 4NENA 1SGJA 1HT6A 2W67A 1PY0A 1X1ZA 4RDWA 1KXQA 4UM9A 3RILA 3WEXB 3ULUE 5IV2B 3MJ7B 4MOZA 3DIVA 3TONA 4PJXF 3UEQA 5IB1A 4C91A 3QUYB 2B4CC 3GSNB 4G7YL 1JGUH 1YADA 4W9LC 4OLUH 3AMKA 3EA3A 4YX2L 4MMZC 3GS4A 4QRSB 2VLJE 3TBWA 1TE6A 1NAML 3V0FA 3KR3L 1DL7H 1F11B 1LWJA 1U3JA 3UTSB 4DNHA 4E6MA 5E1GA 1D5ZA 5IVNA 3MRJB 4EMZA 1AGCB 1Z7AA 3H3KA 4O15A 4TSCH 3N0AA 1P0EA 4HUUA 2OWXA 4PRHB 2CBOA 3KLSA 1SN5A 1W1PA 3ULVE 3R8BB 3CFEB 5CAHA 2AK4D 2Y6SC 3KL0A 4G42B 4ILSA 4I3SL 1TF4A 1JFQL 1OX4A 2BC4A 3D6NA 3LHYA 3W7PA 7ENLA 2ZXCA 3AGWA 1GQKA 3TDFA 2IVFC 5DD0L 3RHWK 5FO9B 5I9QC 1ADSA 4JPQA 3UPBA 1R9YA 1ZFJA 3FB7B 2OMUA 4G7EA 4CCDA 4LAOA 4Q4QA 1JS4A 4CD7A 3IXTB 3AG1B 4FQ2H 3MJ8B 4OJFH 3NDYA 4R7LA 4LDCA 1UMYA 2A0LC 1XEDA 4OLXL 3O3RA 1PYWA 2RJGA 5D2YA 3TNBA 3P9WB 5KETA 4FZEL 1UJQA 4R7NB 1OY0A 1TTIA 2NY0C 1SY6L 4IXHA 1NFIB 5CP7B 2CC0A 4N0YL 4XB8A 1U8IA 3QORA 2P88A 3BGGA 4AY8A 1EGJA 4NIRA 2CYGA 1O9WA 1S2TA 2GJNA 4NLHA 1AXTH 1UKQA 4G8FB 3ROOB 3FCTB 3QRLA 1WC7A 2K9FB 3H1ZA 4HCGA 3IRCA 3SIZA 3S1VA 5H94A 1KB9J 1TMHA 3TQ0A 1I9IH 1IIHA 2A6IA 2RDUA 3OKDA 1PD1A 1RK0A 4HUKB 4U7KA 4UQIM 4WO4C 4QRRB 5CN1A 1E56A 4H0IA 1DVYA 1RJYB 3W2JA 2F19H 1OX6A 1CBVH 3HGOA 1HKKA 2P5WE 1P5VA 1MEHA 2FGLA 3T0EA 1P69B 1DFBL 4KJQC 4A7GF 3F01A 2LLEA 4LLWA 3NQ7A 4PJGF 1RZFL 2E59A 3IJQA 1I2PA 3MB9A 1E0OB 2IPKB 3L1GA 4TLUA 2NUTA 4R4BA 5ILTL 4KY1L 4LSQL 1E2ZA 1XZ0B 2P3YA 1KYAA 4RCAA 3S2JA 5I6NA 1XUZA 3CGTA 4MNQB 3VFVA 2EDHA 2WXGA 4PTXA 1GOOA 1E5AA 1HC1A 4G42A 5F3HA 3VI3B 1MUJB 4NOFA 3WMPA 2CIKA 2AJ3A 3EYVA 4ZSTA 4W4OC 2Y07H 4YAQB 4I5UA 4XMPH 1MAJA 3CVDA 4HSNA 1AS6A 2VSKB 4NO3A 1JJKA 1AKPA 3A4JA 3NJFA 2FBJL 3C2OA 5J9PA 5J5DA 4FQ1L 4U3XA 5C08D 1ZIAA 5EA0H 1JHKL 5AVVB 3T0BA 4C59B 2YLLA 4X0VA 1Q2RA 2ADFL 2DZPA 1EEYB 3BQUC 4HT1L 2R0WH 2W60A 4D6EA 3OLDA 4ZNCD 5C2GA 3WXVL 1UQSB 4AEHL 1C5CH 1MVUB 1OZUA 3AU0A 3UAJC 3BP4B 4Z7UF 4EF9A 5F88B 1DBBH 3DARA 5CJ5A 4YFDB 4GOAA 5JPMB 3FXGA 4Y1SA 3OZKA 5RUBA 4YFLI 3TZVD 3RG6A 3M0JA 3GKZA 4NC1E 1MFEH 3C0SA 4PUNA 3ZYOA 1ET5A 3FAXA 4AE1A 2WQDA 4TVPD 1UWIA 1GHRA 5A6BD 4K71B 3WJLC 5E03A 1NF0A 1TX0A 4GD0A 3PWPA 5C7XH 4HF5H 2X7LB 1U41A 5DHVA 2OFJA 3RCYA 5L6YH 5B7FA 3CAKA 1UP3A 3CMOH 2KYIA 4GPVA 1YECH 3IJ9A 2WZIA 3VUPA 5JHLL 3NSJA 3TTYA 3Q2DA 1RY7B 3C6SB 2Y7MA 2EO9A 4RNRA 1KFAL 3NQDA 3QOKA 3TE9A 4DBUA 3QM3A 4PRWA 5IBXC 3G5VA 5DHVH 5TH2B 3H2WA 4UU9B 2R2EA 1X38A 2HXTA 4R88A 3WQCA 3FRUB 4PRID 3N43F 2F1AA 2EVGA 1KMGA 3C0QA 4TUJA 4IPLA 1MCDA 2NLJA 4RWHA 4AVNA 3G04B 4AISA 3ZIMA 4EXQA 4BE6A 1S7RA 2D03H 4AIOA 2CLFA 3OMIB 3GSWB 3EFFA 6ALDA 3QPQD 4GRLC 2WINB 1WAAF 3IFPA 5DHYA 1QATA 1YN6B 4EI6A 1FZOB 2CG9X 5B1AB 1TVNA 3QH2A 4NQUA 4P2OC 1X5HA 3FSVA 3QISA 4NUGH 4XC3H 1KTJA 1ZHBB 5CCKL 4WHYH 5FAJA 1PF3A 3GMOA 1AUSL 2DL2A 4P99A 1CN4A 2V7NB 4PGDA 5LBSH 4KJQD 3CVIH 1RURL 4R0LB 3LEVL 4TULL 3VUSA 4NJJA 4YDKL 3ZLHA 3AROA 2RBLA 1JOIA 1THFD 2HX9A 2NQ5A 3LS5L 4KCTA 4OBRA 1S38A 2WV3A 3QNFA 4Z7VE 5AVUB 2YHGA 2VW7A 5FUZH 5IEHB 2HLEB 4FSAA 4H9ZA 1YN7A 5CD5C 1AY1L 4MVBC 4YHZH 2BSDA 1GH7A 4WVRA 3K6IA 4XN1A 4NQCA 3VDAA 2GSEA 2JGYA 6XIMA 2E6QA 4POZC 1MEXH 2NMSA 1KSRA 3AG3B 5DTFA 3T8VA 1FN4B 3VJ6A 2OEKA 3SY5A 3MRBB 3V6OA 1KCBA 3B5HA 2DLFL 4O53A 2EEFA 3GU2A 3CFTA 3TA6A 2EVFA 3C0LA 3U4KA 4P57A 5L2JA 1G6RH 4GG6F 4P2VA 5BU9A 4HZLB 1I3UA 3FB8A 4NQEB 4YSCA 5FYJE 5E93A 2AP2A 3LEVH 4TULH 2Z1BA 4ATLA 4JM2C 1BEXA 4QO1A 4Z5RA 4D6JA 2FZNA 4YXGA 4PSRA 1EWDA 3W9EA 4ZAKD 1R3LB 1KJMB 1TJGH 2G5BA 2ZOLA 4NO5A 1DTUA 1JPFA 4KROB 4K5LA 1Q6GA 2A9BA 3DHDA 1SQ7A 1YDPA 3PPSA 3UO1H 2FZ9A 5DANA 2VL5A 2VOMA 1IQDA 1SRDA 3G6AA 3T3PB 1A4BA 5HI5C 3AHVA 3NESA 1JF5A 4O1EA 5D1ZI 4LAQL 1O5QA 1FCCA 1OG0A 4MDPA 1YEJH 4HCRL 5AW6B 1MHCB 4JY8A 3W27A 3CIAA 3FFCD 3CC1A 2P8CA 2FB4H 3FYYA 4QXUH 5C0EA 5CGMA 1E15A 3KVKA 1DLHB 4AZGA 1JAKA 1U2YA 3F7LA 3IF1A 2VWSA 4XP5H 2ZG2A 4FTVB 5IDZA 3FKKA 4H8PA 1IRAY 2WOYA 1SVDA 2QUNA 5FIPA 2ADGA 1YNLL 2OWCA 2EE6A 3KXQA 3NAAH 3NL2A 3ZWTA 5CZ0A 5A2BA 1F4WH 2D3JA 3TBYB 2F6KA 4Y8AA 1YRRA 3HZKB 1HOCA 1D9KD 4HD9A 3FUNA 5C9JB 3SB3A 1D7KA 1PTGA 3ICJA 1L0PA 1U58A 3VFNB 3WQFA 1XBRA 4A8RA 3PWPE 4R2GC 2VUNA 1NCWH 4JIPA 1XF5A 5K9OA 3N2CA 1QLRB 4UTIA 1UJ3A 2J5LB 2BWQA 4ICNA 3S42A 8TIMA 4GO9A 2XDHA 2PDMA 3HHSB 3H55A 3GW3A 3KDOA 2Z93B 4FFVD 4ONVA 1SHSA 3D85B 5IBTL 4QG8A 3S6OA 3M8OH 1EP3A 1NAMA 1OD8A 4P59H 3N41B 4M6MH 3TT1H 5AAWA 2J78A 3L23A 4S1SL 1DWIM 5BS0D 3L95B 2GVJA 3C9NB 4DF2A 1EGMA 1I1AD 4IDLA 1EX5A 1ERNA 3HAEG 4OSUL 3LXBA 4V2CB 4C56E 5KSAC 4PUJA 1MN4A 3AXLA 5H37A 5B7MA 2DW5A 4HJIA 1I2QA 1GTEA 4ZFMA 4ZX4A 2IBZX 1PL3A 2IADB 2HUHA 3O4LB 1M6UA 3MACH 4APXB 5E6SB 3GS0A 2YA0A 4X4KA 5CJOH 3QUXA 4Z7WE 5T1MB 3SD5A 4NYYA 1RZ7L 1KIRA 4YBQD 3HAEB 3UPMA 1XR8B 3KBPA 2Z0IA 1TQBB 3KS0J 3VXSE 3T2PA 2CIPA 5D1ZB 3LQLA 2J7EA 4YU1A 1T03H 4MJ6B 4RSVA 4NG3A 3PPFA 5FYKD 5I1IH 3ABLB 1QEWA 1A4CA 3QR1A 4LCIH 1GC1C 1NY1A 5HMDA 2OSLA 1ZAJA 1G5AA 1BEYH 3C5ZB 4I7UA 3WFEH 2DP3A 3LPWA 3V7AG 3W2DH 4LB4A 1QZ1A 1P9MC 3AG2B 5C0BB 5I71C 2PYFA 5DY2A 1E5YA 1ECQA 4G6FD 4HJSA 1X5LA 1FHGA 4AUJA 3HZKA 4D0BA 1I1XA 1P4UA 1MFVA 3SFWA 1B54A 2FTYA 3UZJA 5I1EH 4JFWA 2FVKA 4KXAA 4L9LC 3DGGB 1SW7A 5DUMH 5HXMA 4JFEE 3TN0C 3HZMA 1GAFH 1JCXA 4LPTA 2DZWA 2XGIA 3RRAA 1MCWM 2X53A 3NRQA 1K1DA 3AIEA 2N7SA 2HZGA 2ZKYA 3LIZA 4ZQTA 2X7VA 4Q4IA 3UDWA 3VA2C 1TV2A 4C1KA 4KJPC 1KWGA 1W8NA 2XHNA 3TBTB 3K7UA 1ZHKA 3GMPA 3H4GA 2NW0A 3W2NA 4TUOB 3D5HA 1QHPA 3W2UA 1S9VA 4WAFA 5EBMB 5F1VA 3L5XL 1GJUA 1ZVSA 2A9NH 2E09A 4BGDA 2FHFA 3RYSA 3QS2A 3KHDA 1TPXB 2IQDA 1EFQA 3T81A 3I6RA 2NY6D 2ZSWB 3A0OA 1XIFA 3C08L 2FBRA 2XN9E 3TYBA 2WKOF 2XTJC 3RWEA 1DXEA 3EXJA 1XG3A 1QR4A 3Q8BA 4TN9A 2UZYA 5AW1B 1O75A 3P3BA 2DM7A 4KWWA 4PW3A 1CFQA 1G87A 5D1QA 2JMRA 2YB1A 4D71A 4JHUA 3MZ2A 4EWND 5IBTH 1WEJL 5CJQH 4JFFA 3A24A 2OT0A 5FAGA 3CFCH 3KR3H 4WJ8A 1KXTB 4Z0XB 4HU3A 2GKIA 4XTRD 2B5IC 4LCRA 1XIJA 2BZDA 2EDNA 4GKLA 5CCJA 4F27A 1JTOA 5CBIA 4GC4A 3WF0A 3IFPB 4OIIH 2DI9A 5DHYB 5DUPL 1SJXA 5IESH 3FGCB 5H6HA 4IP4A 3SRFA 2MRYA 3BZ4A 4G56A 1JDCA 1YEDA 3E3QE 3FN0H 5B8CA 3ULVH 2P52A 4OB5H 4R9HA 1M2OA 3QKEA 3EWBX 1LK3L 4LNRA 1YMME 1P7KB 5DRNB 5D1XC 3WBDA 4H8WH 5F0JB 3WIIH 5DZPA 2DQEH 2NZ1A 3FO0L 4L2YA 2OW6A 5HDQH 1N8IA 4CADB 1IAMA 2BP0B 1KQYA 1LQ2A 5CHNB 3GRWH 1KCUL 2GY7B 5D7LE 2E1DA 3SJVE 4OD3L 4ABQA 5DF0A 3AZTA 1YN7B 3TJPA 4YDVB 1ZHKB 4PJCE 2F6XA 3QDGD 1NBCA 3U0WL 1DL3A 3M44A 4U1LB 3CLWA 2RAMA 4UNKA 4XAZA 3W7JA 2PC4A 1FL5B 4PTTB 1CENA 1IWPA 1SO3A 4IISA 1V08A 4EI0A 2VZSA 4Y5VA 1Z9PA 1RQEA 2WGNB 5E9DD 1RY0A 5BOOA 3H12A 3U4AA 1RFDL 1UD5A 4LRIA 4OD2A 2OMZA 1DEDA 3HZMB 4DLMA 4BUQA 3LLDA 5F4WA 1X5GA 4YFEA 5D7JC 3QOMA 1K3ZA 3DXAD 4FJYA 2Y0SA 3WIHA 3MV7E 2UV3A 5LGJB 4XCFH 1W6WA 3J7HA 3W57A 5SX4H 4IFRA 4JX4A 4A6YB 5EMKA 2XWXA 3LZ5A 4R0LC 4M51A 4L29B 4UBDC 2E76C 3VABA 4PWEA 4NSBA 4WV1B 2IANA 4KWVA 2WW5A 4OM0H 1QTSA 1ZVSB 4AVHA 4N2NA 2X44D 4KJYA 1LG1A 5DO2D 4JY4A 5D7JA 5C07D 4DVRL 2P10A 2AMGA 4ES4A 4KJWD 4UV4H 2ZT9C 3BW9B 1KJ3H 2UY7A 5EU6B 3WUZA 2VW4A 1ZV9A 1PTDA 3R1ZA 3VE0A 3W53A 4JM2F 3T6ZA 4JHWH 4Q9QH 2WWKO 1OG6A 1RHHB 2MPAH 1QFPA 1ZS8B 2GTWA 2PO6D 4U6YB 1FCQA 5DJ2A 2IFGA 3KYKL 1QWUA 5AZEH 3T8XA 3LI0A 3PTMA 1XZ0A 2B31A 1XGPA 3MLXL 1KYFA 2YEVB 1CDJA 1S7XB 2V0TA 2J56A 5EZOH 2V9TA 2EVJA 3FDGA 1M7PA 3ARDC 2RD0A 1AD4A 3DV4A 4A2DA 1ISZA 4AQ8A 4NJGA 1ROWA 4XPHL 2BJMH 3UBXB 4ZS6C 1E0XA 3WHXB 1ZB5A 3EMCA 4MB3A 3AUJA 1XSIA 4EKJA 3DRQA 3QQ3A 5FYKE 3CZGA 3FU0A 5E4IA 5M3WA 1MI5E 3H9HA 4YDJB 2H3BA 2VFGA 2WVUA 3SQLA 3CUFA 4JHMA 3CZLA 5JTWA 1BW8A 4MUZA 4YHMH 5KSBB 4K1WA 1H3WM 3FU5A 3QUXC 5E70A 5LAXA 1GXEA 1B4EA 4IIEA 2A6KA 4X50A 5JBEA 3PQYE 4ZMWA 1L9NA 2HFEA 5BOJA 1LHZA 1LM1A 4G9FB 4LQFL 2DJMA 2YAMA 3HQ1A 3R43A 2AEPL 1F18A 1BXNA 3P2TA 3H7BB 3TZVB 2LLGA 3NGFA 2OYLA 9PCYA 2J1ZA 1B4KA 2BCKB 1BTCA 2PURA 5I66A 4Y1AB 3SE8L 4DKAA 2YB4A 2XN1A 3FT9A 2JGQA 4CJ0A 5CJMA 2FSEA 1A3XA 1ONEA 5I1GL 4AVOA 1YBQB 3N41F 3UZEA 3SKOA 4M4PA 4MA3A 3O6KH 4MX7B 1W5QA 5HY9A 4AMWA 1IMHC 5A2FA 2G37A 1XYCA 5JLZB 4K94C 5EZJB 5CJBA 3JZUA 5FUZL 1TQJA 3CSFA 4BBWA 5FI8A 3VXTB 2CO3A 4K39A 2A6IB 4Q8PA 2O6CA 4OW6A 1EJRC 3WNIA 3PL6B 2IBBA 1BQLL 3HZVB 4UNIA 1BSIA 5I8OH 1AH3A 4EPDC 4K68A 4F66A 4K8HA 5D2LE 3WDRA 1UB3A 4TVDA 1UA6L 1S7XA 2XZCH 1MDTA 1XB8A 2EDRA 3POHA 3ZHNA 3H2AA 3EJUA 3AREB 4JHZA 4ORZC 4JRXB 5EU5A 1P4LB 5T1KA 4NRZB 5BXFB 5IK3B 4H8UA 4AMKL 1P7TB 3PAVA 4P5MB 4LY8A 1IHIA 1T0OA 3ZVHA 4GK8A 3ZE2B 3RLHA 4M6QA 3IMUA 4AJVA 1KFWA 2D9QB 4MRBA 1WUNT 3GIZH 4YSQA 5A8GA 3MBED 3D39E 3OHMB 1B0IA 2PDWA 4MNGA 4R90L 1CI5A 3BEWB 3RVXD 4UV4L 4I9XA 1DQLH 2QULA 5ERWA 3SKJH 2XICA 5GISL 3PIQA 2CNCA 1FV1B 1KELH 1PZDA 5G4WA 5HUPA 4BCEA 4YXHH 1N70A 1HUVA 1TWZA 4PJXE 2CW6A 4HMEA 2E5CA 3DH7A 4MAYB 3V52H 4G8EB 3TEWA 4Z2GA 1S4IA 4WGVB 3TV3L 1NEZA 3D09A 1DIEA 3LEYL 3OLGA 1UATA 4ONFH 4IEFB 3EOEA 1B3JA 3CMOL 4ABUA 4RAVA 1OOAA 2JIEA 1VP5A 6PTDA 3UG4A 1NPNA 1X3DA 2CK0L 4B0MM 4U4MA 4PMXA 4B41A 1ZDSA 4DBDA 4UDUA 5INCA 3ZRFC 1OINA 2OP4H 1CLYH 4DT2A 4MJ2A 4A67A 3I68A 4A3UA 4F48A 1R5WB 4Y2DB 3EXTA 4KEMA 3OPZH 1AKJB 1XX9C 3MRKA 1S9WA 3L3DB 2Z29A 3N73A 1D5ZB 4QXGL 4Z7QE 3QT2A 2X8RA 4KCVA 2YS4A 1JK8A 1VCVA 4E68A 5I3JA 4PGDB 1JPGA 3W6MA 4PJXA 5KYWB 2YD7A 5TJWK 1DQTA 5B3JE 2P3EA 1H3PH 4WWOA 3EJQA 4PRBB 3VIHA 4XNUL 3V52L 2A83A 4MA8L 1Y65A 3WNKA 5AAWC 3BT2H 3L2LA 4L3EB 1UFUA 4PRHD 2VN7A 2CLOA 3IUDA 2V5CA 2OZ4A 1FORH 3BAKA 3F00A 2Y2YA 3P67A 4BFOA 5F7DB 3B0UX 1W1B1 1P1XA 4BHUI 3DJSA 4NQCB 5AFAA 1IM9D 3L3JB 1O7SA 1PG7H 1R3IH 3URAA 3QDAA 2WXFA 1GW1A 4HK3N 1U8CB 4O2FA 1I8MA 2NXHA 3BEWA 8XIMA 3LKSA 4L8SA 4IMGA 3UZ5A 3A64A 1OC6A 4C5YA 2BIPA 3RXZA 2VO5A 4XD3A 1WWWX 5B80A 3QHMA 5FOBA 4OKVB 2ZXGA 1Q6CA 3DIDA 4BFFA 4L7ZA 2YYTA 4U3SB 3G8EA 2E47A 4PP2A 4LV4A 1BZQK 1SDAB 1QWNA 3FT4A 4APQD 4ML4A 3LZFH 5SWUA 2CLVA 2CRMA 32C2A 4IUGA 2V7NA 3BE1L 1MFCH 4XAYA 3M0ZA 3H2NA 2D7QA 4LPUA 1XTLA 1XO8A 3ETTA 4MCZA 4WFHD 5IMOA 4HJJL 2V0AA 3W7QA 2LOEA 1SEBB 4CQDA 1D7FA 3NPWA 1RPUA 1EPXA 2GAZA 3S8GB 4KPHH 4MRCA 4QTIH 3V4VH 3LHTA 3BUQA 3DVFA 3LKNA 1AHWB 3O6KL 3E6EA 4NJIA 5LZLA 4QRRD 5M2FX 4RFNB 3BVWA 2P5WB 4MJHA 1M65A 2Z0UA 4QHUB 5KVFH 4CN1A 4QRAA 1FLRL 1OW0C 4D9RE 1A6TA 1FLRH 5HVHB 3EH4B 1UUOA 4W7UA 2YMTA 5D72L 4V27A 1BQLH 5I8OL 1XLFA 3AJ7A 2GQHA 1ETZA 3KWWB 3QDJD 3MW7A 2J27A 2XWDA 4ILDA 4KQ3L 4XXWA 4XMKH 4KPLA 2WCPA 3QUMA 3ZZLA 1HJQA 4QF1B 4N87A 1VYSX 3B2XA 2ED6A 3JU2A 1ES0A 2G3XA 4OCWH 4OGYH 4K8RH 4KROC 3VD9A 1OM0A 5BQ7B 4HK6A 1NGXB 4Y16C 4WJKB 3WYRA 3K6FA 1S1PA 5MKGA 3GJEB 4AYEC 1MFBL 4L3CB 4P48A 5J1AB 4TRPH 1XH1A 3IN0A 4R96A 2PPDA 3V0VB 1N68A 2ZOUA 4WW1A 5L2KB 2ANUA 2XSXA 2YRZA 2K9UA 1BEYL 4P4KC 3HBQA 3V0JA 4LIQL 4DBWA 1CCWB 1ACCA 3O11B 4P46B 1TWIA 3B8IA 1LOSA 1IGIL 3U48A 2F9RA 3H70A 1PLCA 1ZMYA 2Z31C 2A77L 2G3FA 2QJMA 2ZZ1A 4KKQA 5FUCE 5BS0E 2Q87A 2BP1A 4MNJA 4KVPA 2OJZL 1A4LA 1BJ1H 3ZXAC 4BEUA 2OJEA 3MAWA 4M48H 3ULUL 1JMXA 4I9AA 1RV6X 3IK2A 5GJTL 3WGUB 4N2YA 2Z4TA 1I3VA 2KQMA 4UTBH 5C2BH 2OPCA 3DA0A 5J13C 5KAQF 1FNGB 1WSST 4LFHG 1IFHL 1UT9A 4LAMA 3T55A 5GGSB 3IIZA 2Z35A 1K2DA 2F61A 4NRRA 4K73A 1J1PL 4YBLB 1NGWA 4P2YA 1Q8JA 3BW4A 3VRIB 1R5IA 3TESA 3LK6A 3KDMA 3FLUA 1Q1JL 3QRBA 4YSOA 5F71A 3F4CA 5DWUH 3FOKA 4ANKA 4KRPC 2VLKD 1XIWB 2QPDB 3WFBL 1PW3A 4L0YA 5IGXL 5ICYB 3GHUA 3MJMA 3MVTA 1KB5H 3JVFC 3NOEA 7ODCA 3DECA 1F4AA 2CM6A 5SWZA 2GAZB 3GFYA 4JG5A 4UAOB 1R46A 3SECA 1W9DM 1M41A 2VYOA 3KZPA 1HKJA 1QKZH 1E55A 1Q66A 2HEJA 2GBTA 5ID0B 1FORL 5HY9B 3B3DA 1A3WA 2HRPH 2OTUA 4HV8B 4YHNA 5E0FA 4R97C 3V0GA 5KSVA 2DT1A 2J8GA 2VFDA 4JIQA 3ARDA 3Q13A 4PLKC 3GJFA 4F7KA 5CCGE 5I15L 1WD9A 1J0ZA 1TTJA 3OR6A 1G69A 1QNVA 1KV5A 4ODTH 3D69B 2YD3A 3BJLA 1G7IB 2GSIA 4XP6H 5DMIL 4HNVA 1ZA3B 1OIFA 5AB2A 1BQSA 4CCCA 5GZND 4NWUL 5C6TL 1ADOA 4WIWA 1MHEA 4XKMA 1F3DH 2EKCA 2QKSA 3OAWA 4GSRA 2EXYC 1US3A 5IW1B 3TA3D 4UFLA 1MEWA 1V02A 5L7XL 3DPDA 1T1WA 4QRUB 2EAEA 4RQQA 1TKWA 3FKUS 1BXXA 1U33A 3VNYA 4FXGC 4DUVA 4PY7B 3MRQA 3IUHA 3CV1A 3ZQWA 3QQ4B 2XN0A 1VGAA 1ITXA 3ZOAA 2XIJA 1OE2A 2WXKA 5EIIA 1LWHA 3RVTD 1DQKA 1WBXA 2E9GA 2YAHA 4N9OB 3THMH 4Q8VA 2AJZA 1XCTB 5DMKA 3STLA 3QJRB 4M80A 2XG9A 3WLOA 1QLFA 4YDMA 3N4AA 1I8LA 1SJAA 1L6FA 4C7DA 4UAOC 3ZTJG 4AF0B 3TU9A 1CDGA 4XNMB 3K5RA 2A0NA 4FF7A 5JOEA 5D1QB 5JUVA 2ED8A 1K8DB 1WP6A 5JZ7C 1PZ5B 3AG4B 5D9SB 2AL2B 4N9DA 1U92A 3B8YA 3DROB 1G7VA 1CIDA 2NQCA 4MDIA 3S36L 3SZ6A 5CEXB 5IJVA 2I9TA 2D4DA 3DFOA 2CK2A 2ZUQB 2WLJA 4ACZB 5I8EB 5FEPA 1CD1B 4RDVA 3QHTC 4MLJA 2X2JA 4K94H 3X3FL 3L48A 1OARL 4KBXA 4CGTA 3Q3GB 1NCCH 4JZJC 4OM1H 4A2MA 3EKGA 1BVKA 4TLKA 2W0FA 3G5XA 5CILH 1OP5H 2PDHA 2QCLA 5I17A 4ZB0A 3SCQA 2OTPA 4LL4A 3NP3A 5GGTA 3RFZA 3QDJA 3TZFA 3L5MA 3L1OL 4Z0XA 4TNVF 2F5AL 5T5NF 5HGHB 5EU3B 1U91B 3SPIA 4Q4SA 4PJAF 1OAKH 5HYJB 4P46C 3PY2A 4G6KH 1NSNL 3KPSD 4IGBA 5D2NA 3S9IA 1RIUL 3OHXB 3HB3C 4XVJH 3MCKA 3IRPX 4QRPA 1DSFL 5FF6A 2XLLA 5IM7A 2DWXA 3RKPA 4WKFA 1Y8BA 3QCUH 4NDMA 4E41D 1WCBA 4U5KA 2RHGA 1ZT7A 5HHNB 1UA3A 5DJXA 1G9ML 2HJKA 2IDTA 5FOBB 1ECEA 3E2SA 1UCBL 4HA1A 3OQEA 2X12A 1VPOL 3PG8A 5CPSA 4N24A 2WGXA 1O4UA 4QQUA 1E3FA 1QBLL 1YQ2A 3OKMB 5D2NC 1G9MC 4K23H 4KQ0A 3EO9H 2EKGA 2R6OA 3NAVA 5LA1A 1TYJA 4N6RB 3JYBA 3Q8CA 3JV0A 1D3GA 1NKOA 1EK3A 1K8DA 2DEXX 1LG2A 1VRSA 3STPA 1A14L 3NRFA 3RI5K 4ZFOA 4GKTA 3N2MA 2OKMA 1T6WA 1FVCB 4I77L 3EYFA 2RR3A 5C07E 1D5IH 3RWIA 3HPSA 2X89D 1UA7A 2IADA 3O4LA 4IKKA 1AJ0A 4C56B 2A4ZA 4XPHH 1E73M 4IS6A 1SQ2N 2OZ4L 4EN3B 3AUWB 1BYNA 4R4FH 3GG1A 4MYAA 1QSFB 2KPWA 4MDJB 4FQJL 3RYMA 2BGNE 1BD2B 1DXIA 2OOGA 1LQBC 1EQPA 2GL5A 2A5UA 3H7VA 3O16A 1EXGA 4RGND 3NZHL 4NYUA 2PGFA 2V2XB 1CK0L 4QSHA 1UKSA 4LKXB 1KY6A 3FA4A 3RHGA 4J1UA 2W3ZA 3RPMA 1P7BA 4O1DA 3VXOA 3HFYA 2MHAA 1MCBA 1A3QA 4JOMA 3G6DL 4I4WB 5F7YC 1XF4B 1RJPA 3QF0A 1TMCB 2H8ZA 3T07A 2OMYB 2EPMX 3Q58A 5CZXD 4Y5XC 3QC0A 2GYIA 4DBSA 5C6PB 3BT2L 4UYQA 4A3QA 3MA7B 3O2WL 2VDQB 3VSTA 2A6DA 1EBAA 4JY6B 2KI6A 3ZYIA 1VZWA 2C15A 3FJNA 3HQNA 2R27A 4LUTA 3BPLB 1G6VK 4JPWH 2PP8A 4HJGA 1NDZA 2Q3RA 3L68A 2EIZA 4B92A 3AACA 5BRZE 3D33A 2CZNA 1OTSD 4GNKB 1TO3A 1F4HA 3FUHA 3V55A 1VHPA 3KRUA 2WWMC 3VKCA 2DS4A 3F6JA 2PWEA 1RHHA 3NZGA 5LGZA 3SFKA 2XNAB 1CK0H 5ID1B 3V75A 4QNWA 2JXMA 4B16A 4ZFFA 3ZKXC 3SKNA 3PP3H 2YSTA 4KKBC 1P53A 2CO1A 5KSAA 1KBJA 1LORA 3PY9A 1EVTC 5CEYB 4UFIA 3RVWC 1DANU 1CL7I 4NQVA 3MJYA 2BP8A 1GA2A 1UUQA 3ANUA 3KOXA 3TOYA 3MI2A 4C6OA 5JO5A 2C34A 4E9SA 3MA9H 5HHNA 2WMGA 1CT8A 3CMFA 3RWGB 3QQ0A 3FT1A 3GLAA 3TWCL 3OBEA 5PCYA 1A3RL 3NCFB 1VYRA 2EJAA 5FA3B 1QNOA 3LKPA 1U1JA 1AO7B 3SQMA 4JDTH 4QPEA 4PMNA 2FL5B 1HCVA 4FMFA 4L8DA 1MI3A 4HJWA 4U5IA 4JAMA 4UTLA 2JVUA 4WUIA 3U4EA 3L1FA 1OGPA 3ZVVA 4CD6A 5FL1A 5LA0A 2R69L 5IQMA 1NU5A 1PYFA 3G9AB 4L8BA 2DLGA 3EO9L 5KBLA 5I1AA 2QSTA 2Q3ZA 3SKOB 3ESOA 3PP4H 1P0DA 2VRKA 1EOMA 5F3BB 3IDUA 4EPEC 1RJLB 2NW3B 2QDGA 3CMGA 3ORWA 1D6EA 2K7PA 1T80A 2XGZA 1NC4B 3IGHX 4UDTA 2J7BA 1U9KA 1YYLL 2F8IA 1ZHNA 3DHFA 2WD0A 1XRFA 2O55A 1Q2SA 3TT3H 5HGBA 1LWIA 3AQZA 3OXSB 2O7SA 4RGMB 4TQTA 4L4LA 2ESVD 3W1AA 1IBGL 1E9OA 3M1OA 3OGCA 1DVTA 4YWGH 2ZA2A 1NQBA 3CX2A 5L9DL 4XPFH 1GQLA 2MHAB 3TMLA 2ADJA 2YBRB 4H3DA 3KXFE 3HG1E 5BRPA 3F3HA 3N85H 2VABB 4V2XA 3EGJA 3K6SB 5C0JA 1LP9A 4PB4A 1V7NH 4L64A 4NC0B 5DU7A 3SN6N 1LTXA 1A4JA 3CDGA 5GRZA 3W7LA 3ZY7A 2H3XC 2RH0A 2J8HA 4J3UA 4YWIA 4PB0L 3HZYA 2IPTL 5D7SL 2UBPC 1N0LB 1HIZA 3MREB 4OCYH 4JW3A 3OGVA 4A3HA 4YZFF 5AB3A 4N9BA 2J8UA 1OD7A 3IETA 4MD0A 3WD2A 1FAIL 3L3OC 4LLMA 5E0CA 4G6JH 3N1MC 4J6IA 4TRPL 2GGJA 2PP9A 4LP4A 2WMFA 1UZ8A 3RWFA 3TZVC 2VR6A 3BPNB 3QZLA 3S5LG 2Z27A 1RVGA 1PZ5A 4XZLX 1EGJH 1QFHA 3OLIA 4H8HA 4P8QA 4C47A 4PJHF 1ZAIA 3JW7A 1NZRA 4YC2B 5EB9A 2LAAA 2FCBA 2Y7FA 3U2CA 1P0KA 2GTZB 3MXWL 5C7XL 4HWUA 1T22A 4JICA 1IKNC 4O11A 4WW2F 3L67A 3WS6A 4B90A 1ZHBA 2ZWSA 4BWWA 1OAYL 3NP4A 2XTLA 2WLZA 1KYUA 2XCMC 5INCB 5JW4M 4G5DA 2BNQE 1I82A 3L45A 2XTSA 5CH9A 2AEQL 1TQCB 2N0MA 3IFNH 4ZW7A 2ZTJA 3MV8D 4MHHG 1OARH 3OZMA 4ZL1A 12E8H 1H9VA 2FJUB 2P5EB 1DBBL 3II3A 3QDJB 1T96A 2EYRB 3GUGA 3LSBA 1I9JL 1HAWA 2WCAA 4NWUH 1I8KA 1QSEB 2NTFA 4PRNB 1J5OL 1FL3A 5LN8A 1UJPA 1XXFC 3QTGA 1KXHA 2A83B 1BZ7A 3IKCA 4OFQA 3V0WL 2EDEA 1E4WL 4YMPA 2E5BA 1I6NA 2PPGA 1MCOH 3OXSA 3C5SA 3RVVC 4PUKA 4F7TB 4J2XA 3MNWB 4ICMA 1VJIA 2OX5A 4DBEA 3O45A 4JR9L 1ZGLM 5JQHC 3Q06A 4ONGL 2NQDA 4XR8C 5AYUH 4X8GA 3S88H 5FGCB 2PWVA 2J7GA 2YSSB 2EDOA 2HVJA 4ACPA 2B4CH 4WU5B 4PUEA 5JIDA 2Y72A 4LCWE 3LX9A 4JNXA 3PYCA 3VXME 1FDJA 4IQJA 2WTRA 4F8LA 5GS0H 3R89A 3DFNA 3PSWA 3NN8B 1Y0LB 2HJFB 4XNYL 5E7FA 2VKWA 3RRXA 2L8AA 3IPWA 3TAOA 3RAJL 4ELME 5C0NC 3HR5A 3P0VL 4K3EL 1L9WA 1M3JA 2NXYB 4H88L 4H1LA 2VWEE 3W7KA 4W8LA 1AHKA 3MNMA 3GG7A 4TVPL 4X5WA 4GCAA 1ESWA 4Y19B 2Y7OA 5DHXB 3D25A 5JIHA 3QDGB 1LO4L 2OJZH 2H3NA 3LKOB 4X5XA 4CMMA 2WNZA 3AYVA 3NL5A 4JK0D 4G43B 3W7HA 4NY2A 5BOEA 2VR3A 4GO8A 5CR8A 2VVSA 4HA3A 4CJ1A 3SYOA 3EH5B 4HIHB 4OIAA 4E9LA 1GZHC 2PU1A 3QJVB 5D4JA 1JD7A 3VIPA 3GBEA 4QF1A 2OXGB 1RA0A 2QR0B 1A5AA 2JKWA 3MCLH 4FZEH 3ILQC 1ACZA 3SN0A 2K0RA 4P5MA 4AHQA 1JGDB 2AITA 3JV6A 4CMHB 3N9KA 4HKBB 3U1PA 1V0LA 5DQDH 2XYBA 2XUCA 4M7LT 4Y5XA 5GSRB 4OVVA 4M3JA 3OR7B 3W5NA 1UOVA 3CQQA 4IWWA 4MXQD 5I74B 3N9RA 3K2IA 3OJ2C 2NVDA 4HHHA 1CE6A 1U30A 1UR2A 1G7QB 3W0WB 1J0IA 1SO5A 4JY6A 1S7WA 1GVEA 4N9EA 3HZ3A 3FK4A 2IPUK 3WYZA 3WLIA 3UZXA 3RLSA 5AC5A 3ARPA 3TV3H 1OYAA 4OVXA 2AXGA 2F1BA 3LRKA 4BK5C 1IGJA 3PWGA 4YTRA 1DE4A 1YXYA 3NJVA 4NJ9H 2WMIA 4U1HA 1U8KA 3CYVA 4G8TA 3NPZB 2TSAA 1GOXA 2VLJA 4CUCA 4MHHI 5D4IA 2G2NA 1BIIB 5A16A 3PBMA 3EPOA 4JTGA 1JD9A 1I2OA 3TZNA 3ZUCA 5KBDA 2PLKA 1KXVA 1NIEA 2CXGA 2F18A 2QV2A 2JI3A 1CLOL 3FB5A 4PJ9D 3OA3A 1XDMA 1OPGL 2I32A 3NZ1A 4I88A 1S46A 3AITA 2YQ2A 1X5XA 4NKIL 4O4YH 4ZSOB 4XD4A 3JWOL 1LRNA 1AY1H 3C8KA 1QEXA 2D03L 1O94A 1FWCC 4JFDA 3FQXB 4F2MB 4XG1A 2JELL 4EI5A 3T0VA 2QPEB 1ZGLB 2HRGA 4O18A 1BFTA 1G4RA 2XZCL 4DJMA 3LCWA 3WJZA 1J8HB 2ARJQ 3CHRA 4CMMB 4Z8FL 4YGAB 1PXGA 4WXYA 2IFFL 1XUUA 3P77A 5C0RL 5JW4Q 1B0RB 3BHBA 2Y63A 4NJ9L 4J3OC 1IAIM 3FHEA 3ZDWA 4GIEA 5JHLA 3VXRB 4Y7MA 1E5JA 1O5RA 1T89C 1MHPL 2UY2A 4JE4B 4XBPA 1SM3L 2JCCE 3GXNA 4XVOA 1PZCA 1SN0A 2AJUH 2KZWA 2W95A 1IAIH 1LD9A 1UOKA 5T1DL 3S2MA 3UYIA 1GOQA 2C7UB 4LGSB 5IBLC 2JKLA 1SHWA 1HQTA 4L1WA 1U8OA 1CTMA 4YYCA 2H6PB 3QUXD 1ECYA 2QZ5A 4L3ED 1QI2A 1W54A 4NAEB 1A5LC 1BM3H 5AW3B 4TVPE 3CK0L 3N15A 4JDYA 1FBIL 2UXGA 3UW6A 1QLRA 4HS3A 5GS1C 3N25A 4KFZC 4MA7H 5BS0A 3ILPB 2ICWI 3M6DA 4DN1A 4XHJC 2ZWNA 1M7JA 1HYSD 3FVMA 4HNLA 3SUWA 1U91A 2CJSA 2Y24A 3FQYA 1UVQA 5E9DB 2L3BA 3DTXB 5C7VA 3TFKC 2GJ6B 1WA0X 4RDQG 1YX1A 3MUGA 4M1CD 4NZ1A 4RKAA 4B9PA 4L8SB 3Q05A 1KV8A 3WEXA 3OP2A 5D2LA 5D71H 2Y25A 1FUNA 3P81A 2HH0L 4MNGE 1NDMA 4U1MB 1GYNA 4QM1A 1QRKA 3GJFK 2H2SC 3KLDA 3LKNB 4MS6A 4WEEA 1ADQH 3AYTA 4MAUL 5I2IB 4O2CA 5F93C 4NJAH 2DZTA 4FXKC 4GAGH 5IGXH 2OYMA 3PZGA 2F7IA 3K6OA 1XIHA 2YAOA 2J21A 1CF8L 3UGXA 5SWZE 5BUAA 3BP6B 4BUHA 5IKCA 1VKXB 1LJYA 4EPSA 4XXCC 3O3EB 1H5YA 2ESVE 4IBTA 1H8OA 2VRAA 4AIXA 4GUIA 2I5QA 4C55A 4MTMA 1N6QL 5I19H 3PGCB 3MBEC 2VNCA 4LJ3A 3QJFB 4EKXA 3G22A 5AB0A 1HL4A 3OHXA 1V7ML 4J5VA 1E8WA 5H8DA 3F4VA 3TYZA 1RAKA 5GGUB 1PZBA 2JQXA 2J4GA 3Q2LA 3TFCA