1G9HA

Ternary complex between psychrophilic alpha-amylase, comii (pseudo tri-saccharide from bayer) and tris (2-amino-2-hydroxymethyl-propane-1,3-diol)
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
448
structure length
448
Chain Sequence
TPTTFVHLFEWNWQDVAQECEQYLGPKGYAAVQVSPPNEHITGSQWWTRYQPVSYELQSRGGNRAQFIDMVNRCSAAGVDIYVDTLINHMAAGSGTGTAGNSFGNKSFPIYSPQDFHESCTINNSDYGNDRYRVQNCELVGLADLDTASNYVQNTIAAYINDLQAIGVKGFRFDASKHVAASDIQSLMAKVNGSPVVFQEVIDQGGEAVGASEYLSTGLVTEFKYSTELGNTFRNGSLAWLSNFGEGWGFMPSSSAVVFVDNHDNQRGHGGAGNVITFEDGRLYDLANVFMLAYPYGYPKVMSSYDFHGDTDAGGPNVPVHNNGNLECFASNWKCEHRWSYIAGGVDFRNNTADNWAVTNWWDNTNNQISFGRGSSGHMAINKEDSTLTATVQTDMASGQYCNVLKGELSADAKSCSGEVITVNSDGTINLNIGAWDAMAIHKNAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE
publication title Crystallographic evidence of a transglycosylation reaction: ternary complexes of a psychrophilic alpha-amylase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 157
structure length 448
sequence length 448
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2000-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1g9hA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1g9hA01
3TTYA 4DO5A 3WNOA 1EDGA 2BY2A 2BVTA 4WJXA 2QHAA 5AC4A 1M01A 3ZM8A 2PBOA 2YDRA 1W1TA 3W28A 1GHSA 1H1NA 2PWFA 1Y7VA 1F4AA 3DECA 4PCSA 3POCA 4S3KA 5E0CA 1ISYA 2VOTA 3VVGA 3UG4A 4NZFA 2OYLA 3L4VA 5A6KA 8A3HA 1JXKA 3WD3A 2RGMA 4ZEPA 1IZKA 3CZSA 3F5KA 2XVPA 3AXIA 3CZJA 4J27A 1BTCA 3LPGA 3CHDA 4F9JA 2V5DA 4WF7A 3CZNA 1HKMA 3GNPA 3WUGA 3W37A 2WMFA 3ARRA 1E1FA 3WL1A 2ZWYA 2A3CA 3ALGA 3WBAA 4AZGA 1HKKA 1TMQA 1CXFA 1FFQA 2PWHA 5A8MA 3WELA 2PC8A 4TUFA 4B3KA 3BCFA 1XD1A 4TX8A 3CZKA 4KGJA 3IJ7A 1EXPA 2X05A 3ZJ8A 3CHCA 1OWQA 3OG2A 4CCCA 5BWFA 1WDRA 1UH4A 1E0XA 3DHUA 5A6MA 2DGAA 3DDFA 2DSKA 3PZVA 5CPQA 1CXKA 3BMWA 4UQBA 2OSYA 1KR1A 1UH2A 5D9PA 5A8PA 3HG3A 3AMGA 1UWQA 4FK9A 2XFRA 3IAPA 2YIHA 5A8NA 1U30A 5FOOA 1GQJA 1VFFA 5HPCA 2QV4A 2JF7A 3AIEA 3CH9A 4X0VA 1V6YA 4YN5A 1FFRA 4FLOA 1V02E 1HXKA 3BMVA 3T08A 1C90A 2AMGA 4U3CA 2W5FA 3EMQA 4LXFA 1WZAA 3DX0A 3LXBA 4UZSA 1K9EA 2J75A 1BG9A 4NXSA 3UEQA 3OIHA 2W4XA 3BSGA 3ZMRA 5KEZA 4UR9A 1HN1A 2CHOA 1BHGA 5GPRA 3SEPA 1HX0A 3A24A 1LG2A 5M3WA 3ZQ9A 2ZUUA 3EJTA 1FH9A 3ARQA 3CBWA 3K4AA 4KRTA 3WUBA 3QOMA 3A5VA 1Q6EA 4J3SA 3OLDA 1VB9A 3VD4A 1H09A 5CQ1A 3S6TA 3VX0A 1J11A 3WDPP 1O7DC 2C0HA 2ZXQA 4HOXA 2VZTA 1V3KA 4AISA 1MXGA 3GYCA 1E4MM 6A3HA 5DEZA 1EDTA 4GO8A 3W6LA 5E6ZA 2GDUA 2WXDM 2J7DA 2EEXA 3MU7A 3GNOA 1B1YA 1US2A 2GK1A 1JZ6A 4ATLA 5BXSA 1XCWA 5A6BD 2Z1KA 2WHKA 1RD6A 3EDFA 2ESCA 3N17A 1ISWA 4H2CA 2WCSA 4AZCA 3AQUA 3CPUA 5BXRA 4UFKA 3KLKA 1DHKA 3PTQA 1V08A 2YL8A 3GNRA 1ZS2A 5FD0A 1H11A 1BYBA 3KL5A 3VMPA 2VCAA 4DM2A 1E4NA 1E6PA 3TTOA 1UR4A 5A95A 1TA3A 3WDRA 4BZYA 1W3HA 1HJUA 1TG7A 2WSKA 2FHCA 4X0NA 3AS2A 5GNXA 4EKJA 3AS3A 1JZ2A 3CLWA 1MQPA 1UR9A 1QBAA 3ZJKA 1C7SA 3MUIA 3PZQA 4LGXA 2F7OA 4H8VA 4AMXA 2VQUA 1LQ0A 3II1A 5ABHA 1GOOA 1WNOA 4JFSA 5JBFA 3WENA 2O92A 3U7VA 1A3HA 4M56A 2W91A 2IUZA 4CKQA 1GZJA 2FGZA 2FH8A 2CHNA 4FF5A 4ACZB 1KGXA 3T0AA 5A6LA 1HNYA 4HZ8A 3KZSA 3WDHA 3AJ7A 1GOWA 1TFVA 1E6NA 5I0DA 3ZSTA 4QAWA 2MANA 3RM8A 1KCLA 4PN2A 1MFVA 5JIWA 2QMJA 2DH3A 4GZJA 2CIPA 4C7FA 1V0LA 3PZTA 3ZSSA 3LRMA 2YA2A 3BAYA 3M7SA 3W6MA 4PSRA 4IPLA 1J18A 4AXNA 2ZUTA 3SCNA 4BCEA 1OB0A 1DWGM 1BYCA 1FP8A 2OSWA 1W2PA 1UKQA 1CTNA 4F9DA 4JHZA 4PUDA 1XC6A 4J7RA 3VSVA 4N0RA 2WB5A 1PPIA 1F4HA 3LMYA 3ARVA 1KXTA 4KH2A 3BLBA 1HT6A 1ISVA 2D3NA 3G6MA 2WVVB 3GDBA 3H55A 3MSDA 5E09A 1B30A 3WNLA 3WQ8A 1C8QA 1K9DA 4PUEA 1BVZA 1V02A 1XSIA 4HZ7A 2QMKA 1UD8A 4WKAA 3HJEA 1W9DM 2XVLA 2PI6A 3G6LA 4MNLA 1ZBCA 3CUIA 3GXDA 4NZJA 3PZUA 2UY4A 4HU0A 2VQTA 1QNOA 3WQ4A 1JD9A 1ZBVA 4NI3A 2J74A 4AWEA 1SMAA 1UD4A 3BLPX 1E6ZA 1CLVA 4WSKA 3IANA 1GNXA 4DWSB 4MJ2A 1GJUA 2C8NA 1CZ1A 4PMZA 1E40A 2G3NA 3VIJA 3BLKA 3WD1A 2WAGA 3SCVA 2DSWA 3A3HA 5A6AA 1HF6A 3WEOA 2CBIA 2X2JA 2XN1A 1SYTA 1C92A 1G0CA 4RE4A 1R87A 3IAQA 1W32A 3HU7A 1GOMA 1NQ6A 3ARPA 1DP0A 1BG4A 3A6OA 3TONA 3WF4A 1QHPA 1I75A 1E3XA 4LYPA 3VNYA 2VZSA 4JKLA 4CU7A 3CUHA 2EBNA 2JALA 1LL6A 3ARYA 3CMJA 2Y24A 3AMCA 3VD3A 1MW3A 4PMQA 1J0JA 2VRQA 1UH3A 4D72A 4M29A 3MUZ1 1EIBA 2NW0A 3AZTA 5I77A 4GXPA 5C71A 2WBKA 3MV11 3NCOA 4UFIA 1UR0A 2WHMA 2F7RA 2Y8KA 3VDBA 2E8YA 3RDKA 1PAMA 2JIEA 3OGVA 4GZIA 4F66A 3WBEA 1UWRA 2E9MA 3NIYA 2XM2A 4UQEA 1X6LA 1JF5A 5E0FA 1VEMA 5I78A 1MQRA 1VF8A 1UWSA 1BF2A 3TTQA 1OIMA 3BVWA 3T2OA 5BYWA 4AYGA 3SCRA 3TV8A 3B9AA 2EPNA 3FAWA 4OOUA 4V2XA 4FNQA 4OGZA 4H04A 4PBGA 2D73A 2QF8A 1W1YA 5C70A 7A3HA 5A94A 1DWFM 1E55A 5DT7A 1JAKA 1FHDA 4JAWA 2CPUA 4MDOA 4QCEA 1OBAA 1UYQA 3KWXA 1WZLA 3IJ8A 3FHAA 5EMYA 4MAVA 2EXOA 1TZ7A 4BQ3A 4RE3A 3WD4A 3AIWA 1NWUA 5BXTA 2JF6A 4TX6A 3CUFA 4HMDA 2EAEA 4MNKA 3W81A 3D4ZA 3GBEA 3K4DA 3GM8A 3RM4A 5GQBA 4F8XA 1CYGA 1VENA 2QPUA 5JBEA 2XFYA 1UHVA 3WDIA 5BRQA 3WFZA 5A2AA 3WF1A 4JFTA 1VFOA 1JI1A 4FLSA 4EK7A 1JYNA 4TXEA 2XN0A 3WKZA 4GI8A 4Z2KA 2E9BA 3MMDA 3W4RA 3T0DA 2J4GA 3M07A 2E3ZA 2CBVA 4U5KA 1KCKA 1JGIA 5HXMA 8CGTA 3MUY1 3AHXA 2D0HA 2G41A 4D6FA 1S46A 4HA1A 5CPSA 3WH6A 3BUPA 4P7NA 2WKLA 3VGDA 2J7HA 3E1F1 3LPPA 1GHRA 1E0WA 1J0IA 4FNTA 3W25A 3W82A 5AC5A 2YBTA 1E6XM 2BV9A 3FXYA 3WSUA 2VMFA 1TQTA 2CKSA 5A8OA 3M6DA 4V28A 3VTRA 3WF3A 1V6XA 3HN3A 2WANA 4CN1A 3RM9A 3VILA 1NP0A 4LYRA 2GJRA 1VEOA 3BAXA 3EBVA 4GPNA 2YL9A 3ALFA 1TVNA 2WHLA 2XIBA 1HXJA 1E5NA 3VD5A 2VTFA 1RPKA 1TR1A 2B31A 3U5YA 1TUXA 2WWDA 1KXHA 2CERA 1QNSA 3AMDA 4CU6A 3FNDA 4JCMA 4UOZA 2BVYA 5I2UA 4QLJA 4FNRA 1C93A 3W29A 5A6BA 1J9YA 1CXHA 4HTYA 3QHNA 2WMGA 1Q4NX 3BVVA 1R8LA 1HKJA 1B3ZA 1MW1A 2XVGA 3TTSA 1EHAA 1CECA 1QNPA 1UA3A 3CZ8A 3BCDA 1GQKA 4U5IA 3KE0A 4MPKA 5IHSA 2DT3A 5HNNA 1KQYA 1XSJA 4XV0A 3TA9A 3WQ5A 4UFMA 1H49A 2BS9A 4R27A 1Z32X 1LG1A 1BQCA 2YBUA 1KTBA 3TOPA 2F2HA 1U2YA 3N11A 2FH6A 2VR5A 4ZXOA 2V5CA 2WVSA 2ZUWA 3WH7A 3KEHA 3MV01 3I3EA 3WMCA 3EMZA 4FLQA 3F5LA 1KR0A 4AIUA 3BSHA 4J3XA 1E0VA 4V27A 4XUYA 3WMBA 1QBBA 4PMUA 1PX3A 3MUAA 3WD0A 5CLWA 5EB8A 2F7QA 1UG6A 3L4UA 4AEEA 4PTMA 3SCPA 4AD2A 2D1ZA 2JIWA 1V3LA 2VRJA 4P7RA 3WF2A 4IUGA 3VNZA 1J0YA 3CMGA 3LRLA 4NSBA 5D9OA 2VL4A 2CNCA 3LPFA 3CTTA 3GH7A 1SZNA 4EAMA 4QDMA 5IFPA 2XTKA 2FYVA 1E43A 1OIFA 2XSBA 3AROA 4JIEA 1E6QM 1T0OA 4GINA 1JDAA 1QVBA 1VEPA 1BGGA 4AIEA 1VIWA 3VMOA 1W9XA 4U31A 4AD3A 3DX4A 2DT1A 5ABFB 3ZR6A 3U5UA 5I24A 2CESA 3IK2A 1WDSA 2X1IA 1UOKA 1LF1A 1W1PA 1E15A 2DEPA 3SUUA 5D8ZA 4B9YA 1E73M 3AI0A 3PZIA 3SCSA 4IISA 4FNSA 2WMIB 4P8WA 4CVWA 3W38A 1HVQA 1GJWA 3OLIA 3QHMA 4ATDA 3O9NA 3NYDA 2D22A 1J0KA 2UWFA 4E8DA 9CGTA 2DIEA 1PEZA 4XX6A 3D50A 2J7GA 4YHGA 2TAAA 1QI5A 2ALWA 4OKDA 3VIHA 1B2YA 3K8KA 1CEOA 4ACZA 4CGTA 3AXXA 1NM9A 1P6WA 5CSUA 1Q6GA 5IHRA 4HA3A 4MB1A 1KWKA 3DC0A 2VUYA 4C7GA 3F5JA 1R7OA 1XSKA 4Q22A 2VT0A 1KXVA 3T09A 5IFTA 3LPOA 1DWHM 3AMLA 3VGBA 5EFDA 2BY1A 3ARZA 3N12A 1XYFA 3WMSA 5EFFA 3WD2A 4CCEA 4IM4A 3DX2A 2W63A 4K68A 3ZJ7A 1ECEA 4W85A 4AZ6A 2VJXA 2JFEX 2OSXA 1I1XA 5A69A 3CZGA 5E6YA 3WQWA 2VNCA 1JDCA 5A8QA 3PHAA 2J8FA 2VX7A 3A47A 2WVVA 1W3KA 1V3JA 3VSUA 1W1VA 4A3HA 4HU8A 3PZ9A 2G3MA 1L8NA 1WCGA 4XZWA 3CO4A 4AD0A 4LYQA 4JL2A 4TVCA 1K9TA 1E1EA 1JZ8A 2PF0A 3N15A 2CXGA 1B90A 4W7UA 4M80A 2J7FA 2FGLA 4UTFA 2EPMX 1TCMA 2O9PA 1OT2A 1NOUA 4JHOA 1HJXA 1UUQA 4KRUA 1E5JA 4OBSA 1B3XA 5CPTA 3BAWA 5D9NA 2J47A 5DT5A 1UKPA 3K46A 2ZX7A 4DWSA 1ZU8A 2WC3A 3AFBA 2XWDA 3RJYA 2IGTA 4P7QA 3L4XA 2ZE0A 3L4YA 1RH9A 3AYSA 1EQPA 1ESWA 4W7VA 1BGAA 1VFUA 1BYDA 1NWTA 3N18A 4AD4A 3AIRA 3SCWA 2G3IA 4CUCA 2VVNA 1H5VA 3DX1A 1GORA 3ZR5A 3WEMA 3HZ3A 5A2BA 4PMYA 3CC1A 4CD5A 3BAJA 1GONA 4URIA 4ZENA 4BF7A 2XVKA 3BUBA 1GQLA 2YFNA 1UR2A 4X9YA 1JDDA 3MMWA 3RIKA 3A4AA 1US3A 4Y7EA 3GXIA 1HTYA 3EJUA 3I3BA 1TQWA 1WDPA 1PX8A 1K9FA 1HWWA 1QW8A 2Y8VA 5TD4A 1GOQA 1UD6A 4JZ5A 2JEPA 3M46A 4P8UA 2J79A 3WFLA 3NUKA 4JCLA 4MAZA 4CCDA 4H7VA 4MNMA 4UFJA 1ITCA 1W3JA 1NOFA 1XYZA 1HVXA 1XH2A 3WY2A 1R33A 1CGVA 4PRWA 3D52A 4W8LA 2CYGA 3AS0A 2A3AA 4CD7A 1E4LA 4W5UA 1AQHA 1JZ5A 2VX6A 1E4IA 2GK1B 2QLYA 3AMKA 2CCRA 4D6DA 4AZCB 5E70A 1O7AA 2W61A 2CITA 2OWWA 2WVTA 2VCCA 4EE9A 1EO7A 2F61A 1TA3B 1B3VA 4GKLA 3VSTA 3OZPA 1R75A 1BYAA 1W9PA 3O2LA 1PBGA 1E3ZA 3VD7A 3WN6A 1MXDA 2G4FA 3W0KA 5GNZA 2EO7A 1HP4A 1R47A 4TOQA 1QNRA 1OGGA 3QHOA 2DSUA 4DUVA 4GI6A 2DDXA 2XSAA 3AIBA 1JFHA 2BFGA 3WNPA 2Q8XA 1UQYA 4ZE4A 1YQ2A 5DMYA 3UESA 5ABEA 3WF0A 3LX9A 4D6GA 4E4PA 4PYSA 1OCQA 1SMDA 1VAHA 2VC9A 1V0MA 5D8WA 5LA2A 3GXNA 3NSMA 2NT0A 3W24A 3DYOA 4UNIA 3WH5A 4ML4A 2X8RA 1BFNA 3ZT6A 1V3HA 4D71A 1H0GA 1AQMA 2DQXA 3RMEA 4ACYA 1HJSA 4DWSC 2FHFA 4ATWA 4P8XA 2WZIA 2J77A 5CXPA 5EBAA 3A21A 4W7WA 4CD4A 4H41A 3WEZA 2YDQA 5A1AA 1V0KA 4UCFA 3NSNA 2OWCA 3THCA 3APGA 3BUQA 1HKIA 4Z2GA 2CBUA 2VR4A 1WKYA 2G3JA 1JYWA 3ARXA 4DWSD 4FMVA 5JUVA 2EPKX 3AHYA 4NF7A 2ZX5A 2W66A 5JBDA 2XIIA 1VBUA 3MKKA 2F1AA 4FNUA 2FE0A 4J3WA 4AYSA 3TP4A 3OB8A 1ISXA 1UWTA 2ZICA 1ZJBA 1VBRA 3LXCA 3VGHA 1UWIA 2J7CA 2PB1A 2VZUA 4RL3A 3WH9A 1QPKA 3WDJA 3BAIA 4MB5A 3HG2A 4AMWA 3N9KA 2VZVA 2DPEA 4Z2LA 5CGTA 4Z2JA 2YA1A 4KMQA 2PWEA 2X0YA 3UETA 1R46A 4TVDA 3SUVA 1NWSA 3WIJA 2WCGA 2V38A 1FHLA 4M24A 4QLKA 2VX5A 5LA0A 3VIKA 1JNDA 3WUEA 3CZLA 3UR7A 1OSEA 2XPKA 4LQ1A 1FOBA 3EDKA 2DSZA 2ZXAA 3WL0A 4UQ9A 2WM0A 2WC4A 1MQQA 5CSYA 4C7DA 1JZ7A 3UG5A 2OYKA 2JE8A 5C8BB 1XD0A 1FP9A 3CIVA 1KTCA 2E40A 1JI2A 2ZUNA 4OUEA 3MSGA 1UR1A 3RCNA 1J0HA 2UY3A 2VURA 1W3LA 3WY1A 3MS8A 5CJ5A 4P7OA 3SCOA 2WNWA 1WZMA 4W89A 2D3LA 3FHQA 4J3VA 1R85A 4GQQA 5ABGA 4WSJA 4D6CA 1MFUA 1UZ1A 1CGXA 2ZXDA 3HMCA 1PS3A 4P8VA 3VO0A 3VUPA 2D0GA 5A2CA 3AHZA 2F7PA 3DYPA 4AZ5A 1GUVA 1CNVA 2BVDA 5I23A 3SCUA 3EDJA 4JKMA 2J7EA 1G94A 2J8GA 2NSXA 1GVYA 1DWIM 3W53A 4D6IA 1EGZA 4M1RA 2GJXB 4UFHA 4OZOA 2VX4A 3AZSA 2EJ1A 2WWCA 4W86A 4S3JA 3A23A 4UQDA 3BVXA 2V3DA 2ZUMA 5HDRA 4HPHA 4P7LA 1AVAA 4PMXA 1QW9A 3AOFA 1JD7A 1PJ9A 1B3YA 1BPLB 3ZT5A 2O9TA 1CPUA 4QFUA 4WKHA 3A22A 2A3HA 4U3AA 3VM5A 3RJXA 3VDCA 4D1JA 1TQSA 3L4TA 4DO6A 2W62A 1FH8A 3WNNA 1Q6DA 3L4WA 3T0BA 2EACA 1G5AA 4GI9A 1HJQA 1C7TA 3PTKA 2VCBA 1KQZA 1E72M 4ZE5A 3VIPA 2J7BA 1E6RA 4J3UA 4HMEA 4H8UA 1V3MA 3B8SA 1DEDA 6CGTA 4D6HA 5BXPA 2JEQA 1GCYA 3VINA 1W9BM 1IZJA 5M17A 3VIOA 4IPNB 1JL8A 4L4OA 1QHZA 3RO8A 1WDQA 3KL3A 4PMNA 4JFVA 2EPLX 1EA9C 3FAXA 1UR8A 3VPLA 1EQCA 1OD0A 3EDDA 3J7HA 2D2OA 1GOIA 2CETA 2F8QA 3VGFA 1KXQA 4PMRA 4HPGA 1EHNA 2WBGA 3PN8A 2BHYA 2EQDA 4HA4A 4QCFA 1E9LA 3EJRA 4MJ4A 1XGZA 5CGMA 3A4WA 3ARWA 5CG0A 5CZKA 1B3WA 2BXZA 5HPOA 1LL4A 2IXVA 3GXFA 1OM0A 3D4YA 2YL5A 5LYRA 1B0IA 1DWJM 3LRKA 2BY0A 1GW1A 4WKFA 3SUWA 1C8YA 3W27A 1CGTA 2XG9A 4H8HA 3OA5A 2GSJA 7TAAA 1KBBA 2X2IA 1UQZA 2ZIDA 3B9DA 3PZGA 1WE5A 2D0FA 2G8ZA 2ZUSA 1ZBKA 1E56A 5IDIA 4FLRA 4TTUA 1LWJA 1ODUA 1M04A 4PTWA 1CGUA 4CN6A 1WP6A 4MTVA 1UD2A 1KBKA 4HP5A 2O9OA 4BA0A 2X09A 1NWRA 3UERA 5A3HA 1TVPA 3BVTA 4M8UA 2WW5A 4PCTA 2YL6A 3S2CA 1KGUA 2ZX6A 4U2ZA 3MANA 4CN4A 4OBRA 3BAKA 3BVUA 4JL1A 2DSVA 1V3IA 1L0PA 1CBGA 1GQIA 5D9MA 3OBAA 1VFMA 3ZJ6A 1KFWA 4PSPA 1M03A 4Z2IA 2VO5A 3EJPA 2XVNA 1HL9A 4TVUA 3SIMA 1H4PA 2XM1A 3DDGA 3HG4A 3WNMA 4YHEA 5HOSA 4BQ2A 3CGTA 5GNYA 4AIOA 4PMVA 1X1NA 2WCAA 3SCTA 1BAGA 4OOZA 3UCQA 3S5YA 5BCAA 4A4AA 3K8LA 4E8CA 3NJ3A 3VGGA 1D3CA 3PBGA 2HISA 4EANA 5IXEA 2GJPA 2BY3A 4UZUA 1EDQA 2WMKA 2ZWZA 1G1YA 3WDQA 3PZOA 3AICA 1H3GA 1HJWA 4JKKA 3WUFA 1MW2A 1UKOA 1R34A 4GIAA 1CIUA 2YFOA 4W88A 4NZCA 1D7FA 3VM7A 4MNJA 3EMCA 4Q7NA 2WYSA 4NRRA 3ZIZA 4J28A 3CHEA 3PTMA 1D2KA 1JG9A 4UQCA 1HJVA 3CV5A 2F18A 1Q6FA 2YDSA 3QR3A 3N1AA 4J3TA 2PBGA 1R7AA 1U33A 4UQAA 1B9ZA 2D23A 3VMNA 1V0NA 1V03A 2VZOA 1UASA 3H53A 3UG3A 4AD5A 1AQ0A 3WH8A 5E9AA 3WY4A 3NDZA 4GO9A 4MB4A 4AMCA 1UKTA 2VVSA 3LXAA 4RE2A 2E0PA 3W26A 1O6IA 1C3FA 3BXWA 1H0IA 4CD8A 1TQVA 4QP0A 4W87A 4AZIA 4DUWA 1CWYA 1OT1A 1JZ4A 1VJSA 3IGUA 1C91A 1WPCA 2Z1SA 4MDPA 1UD5A 3GZAA 1ZBWA 1IT0A 3AZRA 3THDA 1MYRA 1UKSA 4N42A 1GOKA 1H41A 2UY5A 4LX4A 4KWUA 1UD3A 3OLEA 4AY1A 2OLHA 4JFUA 1QWUA 1OD8A 1DTUA 1QI0A 2ZX9A 5I6SA 1EO5A 5M5DA 1CENA 2DIJA 1UZ4A 2WVUA 4PMOA 3F4VA 2NT1A 4ZXLA 1QI3A 3CZEA 2BHUA 1BVNP 4D6JA 1LLOA 3D51A 4XB3A 1ITXA 1W9UA 4UOQA 2ZOXA 4D6EA 1HIZA 3VIGA 2EPOA 3VGEA 1J10A 3RILA 2WMHA 5HBFA 3PZMA 2UY2A 2WSPA 2WK2A 4M82A 2WLYA 4JFWA 2YLAA 2V3EA 3DYMA 1MVYA 1NOWA 2Y5EA 2D24A 2DT2A 1V6VA 5BROA 4DUXA 1XH1A 1GVIA 1JYXA 1CGYA 2J78A 2WHJA 1KWGA 4WK9A 2V3FA 1RP8A 3AIVA 3KL0A 1KB3A 4AZBA 1J01A 2XJ7A 2HVMA 5AYBA 1RP9A 5F7UA 4CVUA 1CGWA 3GXMA 2J25A 1DWAM 3O6AA 1H2JA 1OGSA 5DO8A 3ZT7A 4W8BA 2XHYA 1KGWA 1EH9A 2GFTA 2XUCA 1CXIA 3GXPA 5FL0A 4AEFA 4D1IA 4WLCA 2WLZA 2E4TA 2WKGA 2CKRA 5M03A 1QI2A 1JNEA 1E70M 3VOCA 2ZX8A 1CXEA 1W91A 1QX1A 2A3EA 1JF6A 2PWGA 3CUJA 5A6SA 3ZO9A 1G9HA 3VIIA 2YOCA 2WPGA 1JAEA 4HOWA 1BSIA 1FH7A 2WZHA 1NARA 1ZB5A 3IJ9A 5CLTA 3POHA 5AY7A 1JZ3A 1VRXA 1LWHA 5A6JA 2GVYA 7CGTA 3OLGA 1QNQA 1XCXA 1J12A 4PMDA 1OINA 3D3AA 4HOZA 2BNJA 2XN2A 4AW7A 4BQ5A 2DT0A 4W93A 1EOMA 3CHFA 3BH4A 5DF0A 2OW7A 2XWEA 1NH6A 3KLLA 1PZ3A 3QOKA 4U33A 4BS0A 2J62A 1ISZA 2OWXA 3OZOA 4M81A 1E6SM 3AIQA 3QGVA 3WY3A 4OIFA 2A3BA 1V6WA 4WIWA 4YPJA 3BUIA 4R5EA 3VKKA 3L2MA 2WMJA 1M53A 3VD9A 3OGSA 4KGLA 5FCZA 1UWUA 4B9ZA 1CLXA 1EOKA 3BGAA 1J0ZA 2X0HA 3AIUA 2X2HA 1JFXA 2EABA 2QPSA 1V6UA 3HG5A 2W67A 2BXYA 4FNPA 3AHTA 4NX0A 4PTVA 5FL1A 2AOSA 3VU2A 4W5ZA 3AHVA 4QLLA 1AMYA 3VDHA 1M7XA 2CBJA 3EJSA 1W2VA 1CXLA 1WB0A 2VRKA 3U57A 2YLLA 2GJXA 4BQ4A 2E9LA 4XZBA 3U7BA 1TQUA 3AXHA 3K1DA 2PWDA 2YJQA 2OW6A 5E1QA 2AAAA 2O9RA 1PX4A 4B16A 3BUDA 4GZEA 3T2PA 3MO4A 3ECQA 1CDGA 3GH4A 5I79A 4NRSA 2Y4SA 2WZEA 1IV8A 1LJYA 4MB3A 3GTNA 3FN9A 3MI6A 1JIBA 2C7FA 3ARTA 4NXKA 4AD1A 3PZNA 3H54A 3JUGA 1XV8A 1OGBA 1MWOA 2XFFA 3B9EA 4U2YA 3OGRA 4L4PA 6TAAA 1QOXA 1BLIA 4ZFMA 3WNKA 4CD6A 5FKYA 4DO4A 3T2QA 4DM1A 1W9VA 3GH5A 1WAWA 1JXJA 3K8MA 2XGBA 1B31A 3WQVA 4MADA 4AC1X 1LL7A 3BC9A 1SFSA 2GUYA 2FDMA 4PTXA 5I3DA 4AZHA 2YKKA 2Y2WA 1PIGA 3N04A 5BRPA 4LPCA 2EADA 2XGIA 1C8XA 1N82A 2X2YA 2RGLA 1QWNA 3EDEA 1ZL1A 2VI0A 3I3DA 1XRVA 4B3LA 3NDYA 4F79A 4A3YA 3SUTA 2CEQA 4TTGA 4Z2HA 4W84A 5LA1A 4PEEA 2BHZA 2DH2A 2ZXBA 3MMUA 3FW6A 4HZ6A 1Q6CA 2FHBA 1E71M 1TE1A 5FIPA 3VIFA 4UOJA 2XYLA 3NSXA 4GQRA 2E8ZA 1MW0A 1VJZA 3WQ6A 5DFAA 1QI4A 3SCQA 3CUGA 4OJYA 3AISA 2OYMA 3DX3A 3AYRA 3RPMA 3GXTA 3SURA 3D5HA 1UA7A 2F1BA 2YA0A 1X6NA 1WZKA 5I5RA 1YHTA 4W8AA 3DHPA 1R86A 1PZ2A 3L4ZA 1SR0A 4B15A 2GDVA 3ARUA 2WC7A 5ECUA 1FA2A 3GBDA 3EJQA 3N13A 5ABFA 5D4YA 4HMCA 1G01A 4AZ7A 3L2LA 2ZUVA 2V3GA 3ARSA 1XH0A 3VDAA 2WMIA 1ODZA 1K6AA 1GPFA 3FY1A 5KZ6A 2D20A 3VIMA 1QHOA 3ZOAA 3S5ZA 4UFLA 1NP2A 2IXUA 2W92A 1XHGA 3VX1A 5AYIA 1JYVA 1WO2A 3EYPA 3AS1A 4E2OA 3A4XA 3SUSA 1HL8A 5JIPA 1HP5A 1A47A 1ZJAA 4CU8A 1PIFA 3UR8A 1I1WA
chains in the Genus database with same CATH superfamily
4NN5B 4ZQPA 3MYJA 3MHZA 2QHAA 3TJPA 3TBWA 1QMLA 4MYWB 4BWLA 3LSOB 3UJ2A 3F7LA 1Y7VA 5LB1A 3DECA 2OI9B 2GI0A 3WD3A 4IGBD 4ELKA 1QMUA 1EGJL 1A8JH 1I4NA 1BQSA 1NDZA 1OCWH 3RGBA 2WMFA 1FLRL 4FYTA 3WL1A 4AZGA 5KSBF 2G5UA 4RWYL 2HFTA 2RJMA 2QVTA 5HJBA 4WGVB 3M16A 1P1XA 1ORQB 1BGXL 2OTWB 2MIZA 4UM9B 4FQ2L 5JOPD 2MJWA 1E6OH 1FCCA 3SE6A 4CQCA 4KXZH 5DJ2B 4DNHA 1EFXB 3GGWB 4OIIH 5IUSA 5HI4D 3SPJA 3TCLA 1R3JB 1G9NH 1E90A 1MRAA 2XTJE 1QRNB 3EHBD 5C07A 1TTUA 4DYJA 1QNZL 3MHGA 4JJOA 3GDMA 2EILB 5FYLL 1FKWA 3EMQA 3LCIA 1T5XB 3PWVA 5CEZL 5JXAL 3RFZB 4NNXA 4UT7L 1RH8A 2QUVA 3PWNA 5LBGA 5BPPA 4FQCL 4KQ4L 4PHZA 4JY5L 3QEQD 2A83B 3E5BA 4DZ5A 5CQ1A 4MSWA 4TL4A 1LM8V 4HOXA 5I07A 1JCXA 1V3KA 4M5PA 1J5TA 1TQCC 1G7UA 3M0ZA 2YBVA 2TSBA 2DQFB 5T3XL 1ISWA 4G8GD 5BOPA 1PKQA 4OD1L 3IDGB 2JQMA 3PR2A 2PW2B 5CIPH 3UPCA 5JU6A 1LEIA 3AREA 4Z0JA 5IREA 3L3HB 1THAA 1WDAA 5DRIA 2ZOWA 2ARJQ 4M8RA 5ABHA 2QZQA 4FI4A 1ZHLB 1IXNA 2IQ9H 4X7SL 2XQ0A 2WJ5A 2QCNA 2E6DA 2WZPD 1B3OA 1HNYA 4H8WC 4G6MH 1DUYB 1LOLA 5CZXC 1MFVA 3ISWA 3ARDD 1BBDH 2OT1A 3GSXB 3DUUA 3E2HB 3LEYL 1M7DB 3LEPA 1JPFB 1CTNA 1T40A 3BT2H 4NENA 3DV6B 3JZYA 2PPEA 3VFSA 4YHMH 1BKHA 1WQ5A 3RN6A 3GDBA 1FWDC 3GEFA 2PWUA 4QNPF 2Y0FA 1JUEA 4POZD 2GLKA 1OC5A 5IQ9A 2EDWA 3LKOB 4UAOC 2YW3A 1G7QA 1DO6A 5FJRA 4JB9L 1TZGH 1QNOA 4NUQA 2QEJA 3IXAA 2P80D 2Z35B 1UD4A 4WSKA 4KEVA 4G42A 2Q6WB 4I18B 5K93A 2B1OA 3ITXA 2VDRL 4HS3B 4YXGA 3GSQB 4QY8B 5L4JA 3B83A 5J12C 1PS9A 4PRTA 4HCIA 3WFHB 3HHRB 3FUMA 3HGOA 3GQYA 4RIRA 4GRWB 1RZFL 3MV8B 2KPWA 4ZFOL 2ROYA 2Q1EA 3TVAA 2H32A 2QEZA 2VZSA 1IM3B 2D31B 4ODUA 4PMQA 3QIBA 4WO0A 2A2IA 4ZQMA 5B39B 1HHIA 1JGDB 4X3ZA 3BH9A 4N2HA 3KR3H 3DARA 3MX0A 3UTPE 3NIYA 4P46D 4BQ9A 4K7FB 1M6OA 1ZA3B 3EEZA 1WITA 5AG9A 2YQ2A 4K3EL 4PW3A 1QASA 3VXUA 3KPNA 2CBQA 3LHPH 4WEBL 3QXDA 4G8IA 4ZT1A 2C6QA 3CUFA 5GQBA 4NUPA 4WQ6A 3PV6A 4XXCA 4L37A 1AGEA 5I1JL 3EGXA 3E3QC 3K7UA 3NGJA 2V8MA 4IJBA 1O12A 4XMWA 5JOEA 2A7RA 3LPWA 3T0DA 4KK5C 4PJ7B 2EYTB 4NQCD 2BWIA 1RIHL 3EA3A 1XLDA 3W39A 1EHLH 4P59L 2Y7SA 2VERN 4FAMA 2HZHA 5IFAH 5IBUB 3DX8B 1IC5L 2ACSA 5L2JA 3JTSA 2VMCA 4AE1A 1TV7A 2RHGA 4V28A 3WF3A 1MCBA 1IFGA 5IB2B 3SJ3A 3WJZA 3CXDH 3DVGB 3UYRL 1QR4A 1HXJA 3RNQA 3NFPB 1F00I 3OQ8A 2V37A 2OCZA 1QNSA 3H42H 4L5ZA 1JGLH 2Y23A 4NO2B 1MIEL 1K8XA 1AFVL 4R4FH 4FNRA 5FLUA 5AOMA 4A1RA 3RGHA 3BVVA 2DQHL 1VCBC 1F6FB 4CJ0A 1H8OA 5D1QB 1FFNA 5TDNA 2X4RA 3WS3B 3RMJA 3Q2WA 2W0FB 4Z08A 5E6SB 4YHNB 3UTZA 2AEQL 5KBDA 3VH8B 1BQCA 3FTSA 4Q3MA 3QFGA 1QPRA 5EU6B 2PDYA 4KK6C 3UPAA 1U2YA 5ETUA 2Z8WC 2ZUWA 2E6PA 4JFXB 2VWEE 4PTUA 4NN6C 5I1CH 1AI1H 4C4BA 4ZUTB 1BXNA 2OLAA 3BP7B 1AS8A 3SCPA 5JW4N 2JIWA 4WY0A 5EB9A 4X7TA 1GQNA 2KS0A 3CCHA 1NIBA 1A5SA 3GH7A 4EAMA 1NFAA 5C09B 2CMRL 4M5ZH 2XSBA 1XEDA 2OL3H 1BOGB 1BGGA 2YGNA 1JUFB 3CWNA 1EWDA 3MBFA 3BN9C 1VIWA 1UWAA 4OF8A 1CW2A 4W9HC 5AZ2H 5MP6L 5I24A 3N73A 5JW3L 4LCCC 4Z6AT 3EYFB 2AI0H 4X9IA 4WWKB 1E51A 2BZDA 5DRWA 3L1OL 4XZUA 2VMJA 2A5UA 3EYUL 4NILA 2TAAA 2ZRZA 2H1XA 4QNEA 4UTHA 2IGFL 4MJ6A 4LUIA 2J6XA 3O3EA 2LVEA 4S1SL 1KLYA 2X87A 2R1KA 2R94A 1U8KA 3OW1A 5IWLA 1S39A 3ZQWA 4R2GB 4G6JL 3QYSA 3VGBA 2NR6C 2Y7EA 2OZ4L 5F9OL 2V5KA 3V7PA 2FJFB 4AZ6A 2VJXA 3K71B 1KB5L 3PWPA 3PREA 2BWDA 5BWAA 3L7FB 3SR7A 5D2LB 2JBMA 4R88A 2I9UA 1WCGA 2VDPB 5EPDA 4LNRA 2HNHA 4LO9A 3I9GH 4UIMB 3EB2A 2W38A 2PU1A 3UADA 5DJ0B 2O9PA 4G59C 3W2DH 3DKJA 4OBSA 1ZANH 1FFTB 1UZHA 5F6HI 1X5LA 2KLTA 2GI7A 5E8EA 1TOXA 3CWGA 4Y5YB 1JK8B 2ACQA 5FUZL 3GKFA 1OTUC 1TJPA 1IO4C 3L3DA 5J9PA 4P23D 1IGMH 4YSSA 4AD4A 5D2YA 3DX1A 4R96A 2PC4A 4F0LA 3IJEA 1YBQA 1AQ8A 3LKQB 3C2RA 5AYQA 1SHWA 3FMGL 1EEXA 4WNQA 3RL1B 3EJUA 4HWZA 2QQNH 1K4CA 5CPLA 3W1NA 5HYJD 5CBEA 3LNHA 1ZRQA 3KHOA 2FDBP 2E1WA 2CJSA 3CJPA 2XNAB 4O54A 2CYGA 4HD5A 4O12A 1IL1B 4TLSA 1FORL 3QS3A 1DBBH 1LO0L 5GGVH 4LLVB 5FF0A 2J8TA 3L66A 2BP3A 4MWFA 4AZCB 1HJBC 5ID1A 3W88A 3PUUA 2WVTA 3C6LC 2R29H 2DVTA 1B3VA 3JUZA 1TKKA 3FUDA 2ZCKL 3TO4C 2OMAA 4KX8A 2G4FA 3OMIB 2W5PA 4BH8A 2EO7A 4M3HA 4QXTA 1J5DA 5FHAL 2G2PA 3U2EA 4PJBF 4EN3B 1RAKA 3LZQA 1A9BB 4N0UB 2RD0A 3ZBMA 1YC7A 1TCRA 1UW9A 2OXGA 5C7VA 5ERWB 1LE9A 1AH1A 4WHTA 5CD5C 1P0DA 5FGBA 4I2XB 5IEHB 1D5RA 2NX5D 3FQYA 1VRSA 2RH0A 5ANMB 3RMEA 3AU6A 3UFIA 4WTZG 3TCSA 2WZIA 5AQ0A 3P4NA 2OR7A 1IJNA 3H2AA 5I19H 1L3NA 4UCFA 1YMMB 3APGA 2J88A 4FKEA 4AQAA 5FK9A 2CZFA 1OAKH 3NIDB 1A6VH 3I9IA 4OZHA 2BIQA 2W66A 1CLZH 4AYSA 1J5SA 1GGBL 3Q1SL 4G8TA 1YNTF 3F84A 4IJTA 4US5D 2VFHA 1FJ1A 4FB7A 4FFZH 4AMWA 3MBDA 4JQIH 2WLMA 1HYSC 4KMQA 1ZPTA 2WCGA 1SXZA 4PWIA 2R24A 1E5CA 3SD5A 2W07A 1N0XL 1UOZA 3NM3A 2FGWL 4UMCA 2OYKA 1XD0A 3I84A 4PMJA 5C0CB 4UT6H 1TEFA 1Q63A 3NTCL 2BOEX 2DUXA 4RZ6A 5KS9E 1W3LA 3WY1A 5CJ5A 3KHDA 1W8SA 3UO1H 2DPKA 1OAJA 1F1GA 1UP2A 3HZYB 1UZ1A 2WWMD 5JLZB 4HHPA 1F3XA 1EIXA 3VO0A 5I73C 3VI4A 5GXBB 1IAMA 4JTFA 2VO8A 4JKMA 3ABRA 4OFKA 1BSLA 1YPIA 1DWIM 1P6BA 4OZOA 2BOFX 3TAOA 5FGCE 1IGCH 4PTTB 3AG2B 4CSSA 3QUZD 1AVAA 1XBZA 3N55A 2YXGA 3D2UB 5HHME 1HGYA 3NZ8A 3FCSB 4PBWD 5ESAA 5C2CA 5JUEL 4DO6A 1ZHBB 3CHRA 1INEL 4L23A 5I74C 2J8UE 1DE4B 5LIKX 2Q2LA 1OPOA 2NV9A 2X1SA 3GYRA 3V0FA 4JZJB 2JKNA 4O2CA 3VIOA 2HE8A 3I02A 4JQXA 3RHWK 3WTSA 4EWJA 3FQ4A 2NY5C 1CWVA 3FAXA 4YTQA 1REQA 2RTTA 2LLLA 4GRLD 3RURA 1I7UA 2PDPA 5DLML 1IEQA 4JY8A 4I9TA 4P5MB 4Q52A 2R1XB 4MJ4A 3KBPA 3NFNB 2NNXA 4BK5C 1B3WA 2F08A 4Y89A 4ZDHA 2ZCLL 1QLRA 4HK3N 2J4WL 3SUWA 1Q1JL 1H15A 3DRTB 3W27A 2FTWA 4M6NH 3STGA 3HRZB 3C60C 7TAAA 2X2IA 3E0IA 1T2QH 3QQ9D 5BS0B 1BFOA 1N2RB 3KFTA 1VC4A 1N3NA 4G80B 1ONQB 1UM4L 3W23A 3ZW3A 3O8XC 5I1AB 3HNTH 2UZPA 2O9OA 5DFWH 2VR9A 4FN0A 3N3TA 5D5MB 3RU8H 4A7TA 5EPMB 3GR4A 1PF3A 3WN5C 4Y4FD 3MA9H 2N7SA 4LEOA 2V17L 1KFWA 5I3IA 4ZNEE 4LVFA 3SKJL 3JT2A 1OQXA 2Z27A 3OKNA 4JYFA 1T7XA 3WLSA 1QFEA 3ZLFA 3KPRB 2MPAH 5AHIA 3P8IA 4IEFB 2WCAA 1BAGA 2IWKA 2YAMA 4JG0H 2IANA 4NIKB 1GYAA 4Q4MA 3VTTA 3IMSA 4XBMA 3TBVA 4XMTA 3B8IA 5AOJA 4LDOB 3A67L 1J1PH 3M1BB 2WMKA 5IM7A 4GX8A 1KFGA 1NKRA 3M1OA 4EI6A 5C0RH 4B9PA 4LW7A 1CIUA 2YFOA 4W88A 4I87A 4P3DB 4EUPB 4KAQH 4EWND 5D1XE 2NY4C 4R8WH 1D2KA 3OVRA 3RZCB 3CV5A 1JPHA 5L9DL 2DZEA 2CHRA 3VXMB 2DW5A 3VMNA 1V0NA 3VWJD 4N4YB 4N7QA 1AQ0A 3N1GC 3NDZA 4A67A 4AMCA 5EEZA 4F9LA 3TZVA 2PXYC 3X11B 4JFDE 3R0NA 1F74A 3LA4A 2BSTA 1G9EA 3CWHA 3N2MA 3QDJB 1ZBWA 1OY0A 1P5UA 2CBTA 4XISA 1UD3A 4UQIM 4JFPB 5EOQL 3C75A 1TJHL 2O4MA 1UZ4A 4WD0A 4PJEA 4ZXLA 1ILUA 5KJ7E 4KNQA 4OB5H 3D51A 4OTXL 3ZKXC 4FABH 4Q6YA 2MNWA 1J10A 3MVSA 2QCDB 2WSPA 4Z7AA 5F3HA 2GIMA 3C08H 5J6SA 3ZIYA 1KBLA 1X5AA 3MUXA 4I9MA 4WCYL 4KI5F 4B9IA 2G2RA 3ARFD 2V5TA 1GVIA 1OY3B 2J78A 2JIXA 2WQVA 3D34A 1P2CA 3WO4C 1LYQA 4L8DB 3NQ7A 1KB9K 4LCQA 5EZOL 1FE8H 4B5NA 5IB1B 4FALA 3ZRCC 1OFAA 1E70M 1V7ML 4W9JC 4KKXA 3HMXH 4O9HL 3BW3A 1ZDSA 4XB8A 1UM6H 1LQ2A 3UR5A 1OSZA 2EVIA 3MRKB 3IJQA 4INFA 5CLTA 3WS6C 2ZOTA 1W8OA 1RV6X 3G04B 3GJFH 3TVMA 4H7CA 1B9KA 4WI2A 4TNEA 3UACA 2JJTA 3WO3B 5CR1A 1A5AA 4HEPA 5I15L 2ACRA 1AHWB 2FPVA 2ICWB 4M81A 5KTEH 3GNDA 4KZDH 5HJXA 1ULVA 5C0JA 3K2UL 1N64H 3BGAA 1GZQB 3URQA 4H8NA 4XD6A 4WRLA 3U9UB 3JVAA 5LXGL 4PV8A 1WT5C 1AO7E 3GZOA 2OCCB 3CEPA 3VI3F 2EIZA 4WUKH 1IBGH 2Z6JA 4ZGYA 4PY7A 3MRFA 3ARGD 5IHZA 2V2DA 4OLVL 5H94B 2LAAA 3W02A 3LBCA 2WZEA 3MVTA 1OP4A 4MB3A 4XO6A 5A40E 1GL4B 1RLCL 3ARTA 1DVFA 3HG1A 3SM0A 2CW6A 3KNBA 2OMUA 1DQUA 3SE9H 4NKIL 3KVPA 4ZXBA 5F1IB 1LO4H 1IKFL 1UUMA 2GAZB 1SFSA 3PABA 2E7CA 4LS1A 4IMLA 1TTPA 4H9UA 3ZHNA 2XGIA 1TPFA 2PP7A 3QORD 3C2AH 2XIJA 4HZ6A 3BRFA 2DLEA 1HTIA 1DBJL 4G6FB 3SE4C 3H7BB 5HJ3B 3UTQA 3ABQA 1MUJA 3JVFC 3RP1A 1OX4B 1G7PB 1GGUA 3FCTA 5EA0L 3K30A 4MX7A 4F0MA 3NPUA 5D1ZD 1A7NL 4QHRA 3EJQA 1S38A 2HRHA 1DCEA 4GRLB 4XD3A 3U0PA 3NQ8A 4R7NB 3DFSA 5GGRY 3QQXA 4IMEA 2VDGA 4N28A 1T22A 3RVUC 1AA1B 5J3HD 2PLKA 1WFMA 2Q3RA 4DO5A 2IBZY 3G1XA 5IW6A 4M8VA 4QOKA 3CN4A 3UNDA 4S2SA 1GTEA 3WCZA 3GJFK 1I8IB 4L56A 5A6KA 5EU9A 2P44B 4ZEPA 3JBG7 4HU4A 2YBRA 1VPYA 4QSHA 3WOVA 3KP0A 2VEFA 3X3GH 4OZ4A 1IBZA 3ALGA 3HI5L 4JKNA 2PC8A 2WMPA 1JK9A 4NQQA 1EL3A 4ETYA 3MYOA 4P0DA 1E5AA 2KQNA 3OP2A 1OWQA 5D04C 4AOFA 1WDRA 4DO7A 12E8H 1UH2A 1UQSB 2QDGA 2ZSVA 1E2ZA 4WW1B 5FOOA 2X6MA 1G1CA 4ADTA 3T0XA 1V54B 4FLOA 5IGXH 3D07A 3BMVA 2FK9A 4POCA 1YEIL 4UZSA 1K9EA 4NXSA 5JIDA 1UP0A 3QV7A 4LUYA 3N9RA 3VXQB 2ILLA 2Q8ZA 1XFPA 4KRTA 3K4AA 4GAJL 2CWXA 4LBSA 4ZX3A 4ERSH 1OG0A 1H09A 2EKGA 3ZDXF 4IL0A 2LU4A 3AWGA 4YEEA 1HILB 1N55A 2RA1A 4P5TB 2LTQC 3I7SA 3UWQA 3OPZH 3IIPA 3MO1B 3ESVF 1OTTD 3MU7A 2XKNB 3L7EB 1O75A 1JZ6A 1QFHA 1AGFA 4A6YB 2IOMA 4XX1G 4PJ8A 2FQDA 2F0CA 1X5HA 2GSIA 1WOBA 2KZBA 1RJRA 4HZAA 2WINB 1U5VA 4JO2L 3MCG1 3B2VH 4CQBA 1OANA 4GSDH 3K2GA 2XV6B 1LD9A 4P9HC 3IWUA 1JGUH 3USBA 1EYEA 5FW7A 4N02A 3M0MA 1U1JA 3PZQA 4P3CL 4FP8L 2FBRA 2VQUA 1V7NL 3LCHA 4JFSA 3DG6A 2FECL 5JBFA 4H83A 4N2YA 2FGZA 1F11A 4FF5A 4OF6A 5KYWA 1J2BA 5A6LA 1NSNH 3WDHA 2FZ3B 6ALDA 4PJHE 1BQHG 3KPTA 2DMCA 4Q8UA 3LN5B 2DH3A 2CIPA 3BPOB 1EEYA 3LRMA 3W6MA 1YEKH 4XB7A 1ET8A 1UM5L 2AERT 1NWPA 1T1ZB 3SCNA 3UBXI 4I0PA 3NSYA 1A1MB 4QBXA 1OABA 1MFDH 4F9DA 1YEJL 3NZHH 2HLFD 3IE4A 4J7RA 5EO1B 1PZDA 4YHOL 1ACZA 1AKPA 1RFDH 5HHOD 1X9UA 1FWCC 5J04A 1C8QA 1V02A 4DPQA 3I65A 4DVRL 2YRZA 2Q87A 1AJ2A 3O9WA 2J20A 4DFHA 1JNNH 3RHGA 4BFAA 3RWIA 3ML9A 4BFFA 2WQUA 1SO5A 4KDWA 1GNXA 1GTFA 2OR9L 5DD3H 5ICZA 5ACLA 4KMTH 1U58A 1S8DB 2NNRA 5GS1A 2HRWA 3TN0A 2OT0A 3QFJD 3WEOA 4EKXA 1MZHA 4LALA 4ONHA 1QSEA 1RJYB 4J1OA 2NY3C 4OVVA 1IGJA 2RFGA 1BG4A 3IXTB 5TQLA 3F58H 4A2DA 2R39A 2CIIA 3S2LA 4JFYA 3SE8H 3CMJA 3DVNB 4ZS7L 3S1WA 5HR6A 2VRQA 4A39A 1I2NA 3EO1A 5I77A 5D7LE 1U8HA 3NFUA 1NELA 3VDBA 3PE9A 4JRYD 1UWRA 1MHEA 3HC3H 4GMSL 3UQNA 1A3WA 3BVWA 4PGZA 2NUTA 2XISA 4LUTB 4GSRA 1DQDH 1X9LA 4QO1B 3W7EA 4PFHA 3EH5B 3S98A 2PYED 5I3KA 2KUTA 5H6HA 4X6CE 3NIGE 3MRQA 1F61A 5GGSB 2VC2H 2ADJA 1FAIL 1OW0C 3K4DA 3AACA 4HUVA 4ZAKA 4QHPA 4I9XA 2GDQA 4Y2DD 2G4JA 2C4FU 4LSTL 5HGDA 1VFOA 4LSVH 3QZWG 1EERB 4M7JL 4GI8A 4ELDA 4MCYB 1NGZA 4P9HH 5IQOA 1IC7H 2QJGA 5TDPA 3EJZD 3OC5A 3LZPA 5LXEA 1R3YA 1FVDB 1Y65A 1PAZA 3D25A 4H0IA 3G22A 1Q45A 3LPPA 1E0WA 2BV9A 2VMFA 4LLMB 2FDSA 5DANA 1P1ZB 3UAFA 2C1GA 5FS5A 3UPMA 4QRPB 5F0JB 2I7SA 3FGCA 1KJ3L 5ESVB 3QZOA 2W9DH 4ZPTB 3L1EA 1F6PA 1TVNA 3LI1A 4MIMA 4L1HA 2AJYH 4QXUH 5AG8A 3V0IA 1E5NA 1Y5VA 1MCWM 4DW2H 2WO5A 4NPKA 1WKEA 2BNQD 1WS7A 4RNFA 3T3PB 2XH7A 2H0PA 2CERA 1QA9A 3AMDA 2R9HD 1U3ZA 3CFDA 4UILH 3ZDZF 1NTHA 4RW5A 3ZVIA 3NCEB 3KH4A 1FH5H 3QHNA 4K2UH 4ZX6A 2HFFA 3DHDA 1CYXA 4H9YA 4MLJA 3FTWA 4HK5A 3QWNA 1KIPA 4XNZC 2AHIA 2Q76A 1ASQA 5IHSA 4L8BB 3RITA 4WHYG 2IQAA 4HLZG 3T0EB 1JHLH 2DI9A 4Z8FH 3FYYA 1WTLA 4DELA 2VR5A 4RKAA 2WQPA 4IRSD 4R85A 4Y5XA 4W70A 1KV5A 1CBJA 4WXYA 3WMBA 3ZDYE 2HXAA 2DZVA 6FABL 3GMQA 3HPLB 1HESA 4AD2A 2IO5A 1J2WA 4AGMA 1MCCA 1YEFH 3NEEA 1DE6A 3QNYB 5CO1A 4XOEA 1E43A 4KDTA 1GWJA 5XIMA 4TKWA 1T1YB 2YN3A 1VEPA 1E27A 4M6MH 4G3YH 2X1TA 4NHCL 3WEXB 4E5TA 1XR9A 5E1GA 3AI0A 1MI5E 1H5BA 3SDDC 3Q5TA 4P8WA 4FS9A 4I3SH 1TTAA 4EF9A 4C6MA 1ITBB 2D22A 3ZHKA 5CLYA 2DIEA 4F24A 2J24A 4REQA 4GQ0A 5C0BB 3KLQA 1KYOK 3HAEB 2P43B 5FEBA 5D93B 3QJZA 2VZ3A 5JHDE 5F9JA 1DSWA 3QQ3B 1C5DB 4U6HA 2H6PB 5HJYA 1K8DA 2X1QA 4WJ5B 4HA0A 4O8RA 3VE0B 3T4YA 1BVWA 3TBSA 2P42B 4UM9D 4W9ZA 1IM9B 1NGWB 5GJNA 2VLJE 2PURA 3TYUA 5EFFA 3ESOA 4ECNA 2VDKH 1AD4A 2W63A 1TETL 1QZNA 4I9WD 1EFXD 2V5BA 2ZUYA 4W85A 4QF1B 2OSXA 5CF3A 3PPHA 2Z64C 4PY8J 4WWID 5JHLA 1QRND 2YPKB 3A47A 4QDPA 5F0LB 3SPHA 3K0YA 3EWBX 3PZ9A 4PJAA 3KWWB 2FTPA 3RPBA 2H41A 2R7EA 4XZWA 4Z18A 3M0XA 4N5ED 3FO2A 4YUEL 1NTDA 1B90A 4BFRA 2A9BA 1TV2A 4MZYA 1URLA 3OXSA 5D9NA 5E6RB 2BIHA 3K46A 2F5AL 3VCNA 1I2QA 3ULUE 5F6IC 3BXNB 4YTRA 1HZHL 5K9QG 1YLBB 1RJZA 1R5IB 3KDMB 1NAMH 4X5PA 4I7WA 4BFOA 1D5MB 4YJ5A 2NY1C 3BAJA 4QT5B 4OLWL 1CB7B 2ODOA 2A9CA 1C08B 5IQ7L 3LZLA 4KROC 4UUIA 1WDPA 3VWKA 4NNBA 3RDTB 5B7MA 5DZPA 4UFJA 1NOFA 3QUML 1KTDB 2PTYA 1LMIA 1YEGH 3ME0B 1HH6A 1R33A 1OQFA 3P9LB 3RJQB 4M3JA 4WWOA 1Y8BA 4EZJA 3RWJB 4KX9A 5KUKA 4NWUH 4UTAA 3BQ5A 4M0XA 5HGAA 4PLJC 5D2NB 4ORGA 4KTDL 1A5BA 1H9VA 2ALAA 1I9IL 4O0QA 1AP2B 2BVPB 4XNYH 1Q8JA 2HP4A 3QYQA 1M7OA 2H3XC 2D2GA 3K6DA 1HP4A 1DEEA 1EKOA 1OK6A 3QHOA 1DN0A 2XSAA 2DDXA 2PGEA 4MVAA 4UAHA 4G7YH 4XD5A 3U9PH 1N59A 5LAXB 4U0QB 4YNGA 4IS6B 4RQQA 5BRZE 3UJIL 5D8WA 1PZAA 3ULSA 4YGVA 1SUXA 4IX0A 1U8JB 3FT2B 3MCNA 2QFRA 3DJ9A 2AJZA 1GZGA 4FX5A 2MMXA 5IFJB 3M64A 4HPYH 1DVSA 5ENWA 4HCFA 5H37H 4H41A 2EDTA 3NQGA 3LV3A 5CSBA 1BF5A 4KWVA 2WLKA 2JVUA 4H20L 1G9NC 1HKIA 3ANUA 2ZYSA 3GWJA 5I1IL 3GSRB 5TGBA 3LQGA 3M1CA 3F7RA 2XIIA 1MRFL 2PCFB 1V55B 4HDIA 1SXCA 2PTDA 4XAPA 2KZWA 4NQDE 5FXCH 4L9YA 4PJ9B 5C0NC 2HSIA 3KLSA 5FM5M 3MV8D 4JREB 4Z2LA 3SD2A 2VLME 5B8CB 5CJQH 4LARL 3V5FA 1IM3D 3P82A 1QVOA 2Z92B 3BDXA 2P8BA 3GLZA 1QBML 2ITCB 3JV0A 4LK4A 3O2DA 3VIKA 1HCVA 5I6LA 4J3OH 2XPKA 2DSZA 4IIQB 1V6TA 4DI9A 3UG5A 2JE8A 4ZFQA 5LGJB 4ZUSB 2VXUH 1KTCA 2E40A 2GSMB 1WKDA 1KCRH 4AE0A 3FQUB 3AXLA 1JPTL 3EA2A 3QYCA 3UMNA 4IF2A 4U4BA 1NBYA 1T66C 4ZD3H 5IOBA 4NHVA 3CLFH 3MC5A 2XUWA 2ZF8A 1TR7A 3GTHA 4CVXA 3ECUA 1SYVA 2O1AA 2IMNA 5F1VA 5C8JA 4RMBA 3NCFB 2IAMB 1F3WA 2VLKE 2Q02A 1KT2A 2Y7MA 3UCRA 1T03L 1L6PA 1D8CA 3WLRA 4IRSB 5HI3D 4TS6A 3N9GH 3PGCA 4GXFA 2EJ1A 4M7ZC 4R5XA 4JNMA 3IU3B 5LAPA 2FFIA 1UXSA 4MBOA 1FHVA 3V6BR 4AJ0A 1EZ2A 3L5HA 3Q1EA 5A8GA 4PJGE 2FX8H 2A77L 4MNHA 1GPOH 3DIVA 2W62A 4M6OL 4KKLC 5FIEA 4ZSTA 3S2AA 3SPVB 4Q9QH 4ZE5A 2HTLC 1IEXA 2G9HA 1NA8A 5DLLA 4R9HA 4IPNB 1WZ1L 4GACA 1DANU 5JIMA 1AD9B 1EJ8A 3QLDA 4OSUL 4DZIA 3D39B 1E9OB 1DLFH 3TW6A 4NJ9H 5F9AC 4OGAD 1CDBA 1A6UL 5I18H 3ARWA 1GGCH 1W16A 2AS5M 3SDCB 1GW1A 5D1QD 4KBPA 5EU3B 4GD0A 5K9QI 4HCLA 1OAYL 1P6CA 1GG0A 1B3JA 4GYJA 3VK5A 4ZR8A 2KX9A 4S0SD 2OFJA 3CJJA 5EBMB 4UB9A 2ZUSA 2FBOJ 4TTUA 2A6IA 5EU6D 3ELQA 2EDXA 1TQCB 2ZX6A 4U2ZA 5HDBE 4MMZC 1CBGA 2ZG2A 3ZTCC 2F19H 1IFHH 2NMSA 5HYQA 2Y5SA 4OCNC 2XVNA 5H35B 4CNTA 5RUBA 2AEPH 1TRIA 3WNMA 3F7VA 4MMXA 5I1KH 2DTMH 4AIOA 3CPGA 4PUUA 5C09D 2OODA 1ONXA 3K8LA 4HJ1A 5L8KB 3W2UA 3DTXA 4FFYH 5HWNA 4K3DH 1KCWA 3FUFA 4N25A 3AICA 1HJWA 3HZVB 2IFFH 5A16A 4WWKD 3VXSE 3M7OA 2YEZB 1G9MH 2QF7A 5EL1A 5AD0B 4H1ZA 1L5GB 2F18A 3TA4D 5CSRA 1HSBB 3FKUS 1EZVY 2CKBA 1I0DA 2ZPKH 1JVLA 1GY2A 1IGYB 3WY4A 4OFIA 4IKIA 5HHPB 3NQKA 5GZNC 5L2KB 5CPNA 1CWYA 3KWSA 4R2GD 1W56A 3UC0L 1HI6B 4O15A 2OU4A 3VFVB 3FLUA 1IT0A 3THDA 1UZDA 5AUMA 2NZ9D 4H9ZA 4HPNA 4NNCA 5F97E 1EO5A 5DMKA 1FIGH 1QEWB 3IVKB 3LD5A 4OZHF 3HC2A 4AB4A 4BZ1H 5K69A 4FQXA 4UXDA 2B4CL 5CJXA 5FF6B 2H2PD 3VGEA 2GC4C 3IJYB 3CQ0A 5GGUB 3S34L 3CL6A 3H3KA 3QDMB 3IRDA 1WAPA 43C9B 3S9DB 5J12B 1IE4A 2FFCA 3CK0H 6TIMA 4IIBA 3GNMH 4QRUB 3SDXE 2B59B 5HVHB 5PAZA 4Y5VA 5CGYD 4FG0A 4IW4C 4L1TA 4LLQA 1CGWA 5EN3A 3RWFA 4AL8L 5DY3A 4MAYA 1CXIA 1DLHA 1JNEA 4CADB 3FTGA 3ZO0A 2A3EA 3GSUA 3N43B 1G9HA 3RTQA 4LRSA 2I5YH 3P1VA 5DY2A 3TYFA 3L0GA 4AQEB 5I1GL 1QUMA 2GVYA 2DYPA 2WTRB 3P3TA 4PMDA 4JXCA 3KCJA 3DOHA 3VI4F 3PQYA 1LROA 4BS0A 1RL1A 1RK7A 3ABLB 2P1FA 3ARBB 1NBVH 4LRIA 3QGVA 4ALAH 4L4MA 1NFKA 3VKKA 1MAML 2QHRL 5C0IA 1ZPLA 2WIMA 3STZB 1UWUA 1NCHA 1IEAA 4ZQTA 1JFXA 3EX1A 2YGYA 4Z1DA 1O5DT 1T1WA 3S37L 2XFXA 2X10A 4EN3D 3VDHA 3NSDA 1K3UA 2GJXA 1NDVA 1B6UA 5KJ4A 2YZRA 3VRIA 4O58H 4HWBA 3R4IA 4B16A 1R5WA 1A50A 3CE1A 1ZNNA 2GOUA 2DW7A 3LKSA 4D9QD 4P4RA 3T6VA 1LJYA 3EXTA 5GGTH 3DGCR 1HAWA 2R1MA 1TVDA 5HMDA 4L1LA 2AJVH 1NIUA 2HX8A 1YMMD 4GUCA 4A7QA 1LP9B 3HHSB 2OKTA 2MTPA 4GYPC 2NUWA 3MBXL 2ICEC 4QHUB 4NKOA 5HUPA 2V2WB 2GABA 1ZL1A 1TLKA 3UZ5A 4PEEA 3MMUA 2Q3OA 3JRKA 4QJ3B 3Q2DA 2GYIA 3KD4A 3OJGA 3CLEL 4H25B 1S2AA 1NBQA 1NFGA 1H50A 1K7XA 2OYMA 3GO1H 3SURA 5KVEL 3DETC 3IDYC 1VKFA 4Z1YA 3KPPB 2A6JA 2C9XA 1G01A 4E2BA 2FB3A 2DZPA 5C0CD 3RI5F 1TEYA 3EOUA 2L7EA 2WMIA 1E9PB 3KOYA 3KYMB 3FY1A 1M3JA 3VIMA 1QHOA 4S3BA 1XSOA 3CDFA 2EXYC 3KPSE 5IF0A 2HN7B 2CK0H 2Z26A 4WO4C 1TJXA 5DEFB 1CT8A 3ZM8A 2FTAA 2PBOA 3CFQA 3KG5A 3UJTH 4ODTL 1JWMB 4IWWA 2ZADA 3FKKA 2CR0A 3O4LA 1GK8A 2WXPA 4OLUH 8A3HA 4UU9B 2EIEA 2ONEA 3LEVH 1ZIAA 4YXLL 3QW9A 4K3HA 3F6JA 2PEVA 4GKTA 3CZNA 4LCCB 5FJUA 2YUZA 5CU5A 3D2UD 5A8MA 2F58L 4US6A 1YRRA 1XQKA 1QYGH 4PJ5B 5FESA 4XPBH 2IPGA 1E0XA 2MRYA 3R8GA 1S9VB 3IDIA 3FONB 1KR1A 4PGCA 2YIHA 4FQQA 1Z9SB 3PUGA 3CH9A 4UMSA 4HJJL 2YB4A 5KS9A 4F93B 3HJ0A 2KH2B 2BRRH 3ZMRA 1NCJA 2OZTA 2MFNA 1HN1A 1P7KA 4CGUB 4QS5A 4AC4A 1K6WA 3QV8A 2ZDSA 4ELMB 5EIIB 3QCVH 1XXFC 2DMGA 4QDWA 3MODH 4FIRA 2LV4A 1HHHA 1LO5A 4MQXD 1MXGA 2Y07L 2ZWLT 3UDWA 5BS0D 1XGUB 1GYLA 5DEZA 1ZAJA 3PVFA 1JEZA 3DJZA 4GJIA 1WEJL 5A2IH 3Q8EA 2ZZ2A 3W0WE 4L1BA 3D69B 4MWAB 1T6WA 4DIAA 3N17A 4G6AC 3PTQA 3UTSE 3NA8A 4K3JH 2VCAA 5A95A 4O5LH 4KHXH 4HUXB 3VXTB 1DFBL 3AQXA 4X0NA 3X1EA 3VCLB 3CWOX 3W9DA 3NG3A 4IOTA 3KPRD 4QRQA 1ADDA 4PRBA 3DURB 4QX4A 3TEZA 4KNUA 4UV7H 1GOOA 1GKQA 3TIDB 2ETWA 3T0AA 3GSNA 2OAAA 1BJ8A 5GJTH 5CU9A 1U41A 3WFEH 4K23H 3K4WA 3MJ9A 2MHAB 4U6VH 3RZCD 1DDHA 4FKKA 32C2A 5C9JB 1MEXH 3VXMD 2ZJSH 1OB0A 2X4OA 5A6TC 2VDIA 4IM8A 3MTWA 3ROLA 3MOAL 2PLMA 5LLIC 1RK1B 4O4YL 3W9EA 2ED9A 4TQPA 2O61A 4AUBA 2D3NA 5ESQB 2EE2A 3PGFH 1KCXA 4MJ5B 5MKGA 1XSIA 1A7PL 4WKAA 4OM0L 3QDJD 3G6LA 1X44A 2CO2A 3MREA 2VXNA 4IQHA 2HVBA 1LMKA 5J1TC 1JHTB 2GSHA 4C60A 2WOQA 1W6LA 5ACZB 1QFUH 4JTJA 1DL3A 5LBSL 3PP4L 1VS1A 3ATFA 3GY1A 2RJGA 1YN7A 1ETZB 4JHWH 6REQB 4TUOA 2YXWA 3ARPA 4BSJA 1JCNA 5ICXB 1YX1A 4BEIA 4Q32A 2FJUB 3FB7A 4WDUA 1QR7A 1A1NB 3JVGC 1JV5B 3GMRB 1M7IA 1BQ5A 5D1XA 3WKML 2Y24A 1O6SA 4M93C 2YMXL 2WQSA 2WHMA 3QQ4A 2MSPA 2NRDA 3WBEA 1F2QA 1X6LA 3DI3B 3BZ4B 3T2OA 3HE7B 3L3OA 1NKOA 3F7QA 3FAWA 1SO6A 2A9DA 4C83B 2C71A 1OBAA 3THML 3U2OA 3U0HA 2EXOA 1FI8C 3IDXH 4TOYL 3DG7A 2CE6A 3C2YA 1O9ZA 3RM4A 3WMLA 1RIUH 4FOUA 2XFYA 1DSFH 1EO8H 5AB3A 3QEGL 3GC2A 5BRQA 3GPEA 2QLVB 5LO7A 4GVGA 1DDTA 4FZ8H 2XN0A 1VFTA 5I73B 2E9BA 4B6ZA 1YPXA 3DUSA 4PJDE 8CGTA 4OCSL 3R11A 4DF0A 1AJ7L 4OUIA 1S46A 2QJIA 4N85A 1QTPA 5GISL 3WH6A 3DERA 1QQDB 4IKJA 1TJGH 4FNTA 2WXQA 4U1MB 4E6MA 4G7FA 1SDAB 5HP5A 5DMGC 5CSZB 5T1DL 3LYEA 2GJRA 3QXAB 2Z7KA 3ALFA 5TE4L 5I74B 2YRLA 4IBUA 4LMQI 3O1NA 2QDHA 1QFOA 1OB1B 2OMBA 1OALA 5HNRA 1OAZH 3ULVF 2X4NA 3TN6A 3CDGA 1C93A 5GRJL 5A6BA 3D6NA 3GW3A 4PCNA 4ANWA 1UB6A 1FVEB 4O10A 2YSWA 3U82B 4FTVA 2C0AA 4RMQA 4OJDH 4JAMA 4PUJA 2CU9A 1UMLA 5CC5A 2BXVA 3N1QC 1H49A 3TGXA 2R1NA 1EVUA 1KTBA 3AG3B 4G6FD 2FH6A 2DQGH 3P84A 3MV01 3I3EA 3JV6A 4JDZA 4FX7A 1MQKH 3EJJX 1E0VA 5T1LB 1ZTXH 1KLUA 4NYLB 5JO5B 1AO7A 1UG6A 3HC4H 3O8XB 4G1EB 4AJYV 3WF2A 4K94L 3U7WL 5I7GA 2PF6A 2VL4A 3ELAT 1UFUA 4PRPB 2CNCA 3CTTA 5CP7B 4NNPL 1CL7L 4GBXA 1FGVH 4V33A 4RRPM 2QDVA 4X0KA 2PR9A 1T0OA 4AITA 1A5FL 4N4QA 4G8EA 1KRAC 3LQAH 2IW0A 1W9XA 5IR1A 1HQ4A 3PGDB 5D7SH 5CFAA 1MSSA 3GHRA 2XT1B 5L6YH 8FABA 4DGYH 2RDWA 5JXQA 5EO0B 4E41E 1B54A 1INDL 3RGVB 1XLJA 3W38A 4ATDA 1WHOA 1LDCA 1YY8B 4XT1C 3W5MA 1G4TA 1R9FA 4G43B 5DXXA 4KKBD 1IBFA 1DVTA 4J1UA 3O6CA 1P6WA 2XPGA 5L7XL 4FX8A 4L5FH 4LCSA 3IDJA 4LLYA 4A3UA 1B4EA 2NXYC 4Q22A 1EJOL 4Z1PA 2UZIH 4JKWA 1FV1B 1KXVA 3BWSA 1HO1A 4UMAA 2HS8A 3QR2A 2CGZA 4E38A 1CI3M 3F6IA 4KRZA 5I66B 3DX2A 2PXYB 1I7TB 1KEGL 1XLGA 1K77A 5EBLB 2UYLB 2PTWA 1IB5A 1UWGH 3B5GA 4QHNA 3VD2A 3DV4A 1MWAB 5EOCL 3EO0A 3PSWA 4YWGH 1V3JA 1W1VA 3B9OA 1LK3L 3WTWA 4HG4J 2H9AB 1NFDA 1JZIA 3UTTE 3KHJA 2O72A 4UNVA 2FJHA 1KM2A 3S7GA 1WD9A 3FNKA 3P61A 3BVDB 1DFXA 1TVBB 1E9QB 1DXFA 1B3XA 3ES8A 3FCGA 5JQHC 5IIEB 1UKPA 4UBDD 3ZKXB 1M6UA 3L4YA 2HLAB 5FO9A 2G0KA 4P5TD 5EU4B 1T4WA 1PG7L 1POKA 4FOMA 3BZEB 1BFVH 4HXAL 2MTAA 4J8QA 1RZGB 2XJLA 5E8OB 1FWFC 2YFNA 1UR2A 1YNKH 4NN7C 5D7KE 3WO4B 2Z91B 3I3BA 3IRZA 2ZUXA 1BIHA 4UTIA 2BZCA 2OP4L 1MY7A 4JZ5A 2WM1A 3NUKA 3A6BL 2VIRB 2C1PA 4FKHA 1T20B 3LI0A 2AJ3A 2H3DA 3IIOA 5FKAA 5MEOB 4YIWA 3AS0A 3QNXB 4BE5A 3REWA 3QAQA 1EAPA 3TNBA 4F9PA 3X1NA 3EOAB 1TPWA 3ZLGA 4R3UA 4D6DA 4Z7UE 4ABQA 2UWEE 5LWYH 1S7QA 4NZ3A 1YYLL 5GHWL 4GKSA 5FO7B 3T9WA 2EG7A 3NNTA 3WIIL 2AV7B 3OAUH 5D71L 4JFQA 1ZAHA 1QTSA 4PLKC 2PA6A 2J2ZB 4KTEL 5C9ZA 4R33A 1BQUA 4M7LT 3WNPA 2Q8XA 3QVAA 1UQYA 4OQVA 4CSPA 3N6QA 3RY5A 5D30A 4MS8D 2WIIA 1SF5A 2RB8A 2QJHA 4LSUH 1OCQA 5I1DA 1O7DE 4MXVE 4JN1H 4DJFC 3AO0A 3V4VB 4OD3H 3WUWB 1V3HA 1TPDA 3SQRA 3MDJA 3IPEA 5A1AA 1X9RA 4YSTA 4PRIE 1UJ3C 2V0AA 5T5FH 4BF9A 2V7NB 3KX6A 2DZUA 4LCIL 1KNOA 3O6FA 2GG1A 4DJEA 2NQCA 3RY6A 5JBDA 3TXVA 1X5FA 4YR6A 1WC7B 3DOPA 4YHPA 5AVZB 2J7CA 2XH4A 5FO8B 4RL3A 3OVUB 3U4BL 3UBXG 2DZAA 3TAKA 3IMVA 4PJHA 1XX9C 3MY9A 5AZ1A 2V2XA 1ICSA 2X0YA 3LH2H 3MR9A 1NWSA 2DZBA 2EKSA 4U6XB 4KVNL 5AOZA 5FW6A 1GG1A 5AKVA 3MPCA 1HUVA 1EJWC 4G7EA 3APMA 5LXVA 5D96B 1ZGLB 2X7LB 1RHFA 5AAWC 3B6SB 5BZXA 1CTMA 2X70A 3QUKA 4LS2A 4TM9A 4JQ4A 5FYJH 2B8OT 5D03A 1Q9KA 4FQ1H 2R69A 5GSRA 5FUOL 4C47A 3AUJA 3LCWA 4H01A 4F40A 3ZL4H 1A6AB 5EBGA 3AHZA 3Q13A 1XLFA 1BJ1J 1HZLA 3IMRA 4RLIA 3ZTNL 3W53A 5DQJA 4MJIE 1V05A 4Q4RA 3EJYC 4XWGL 4HHWA 4GH1A 4BZ2H 2Q3AA 1L9SA 3N3EA 2VDMH 5F1SA 2X89A 3TN4A 3TUUA 2V82A 3VM5A 2HBXA 3L4TA 2QR6A 3UABA 1MHCA 4HKJA 2Q3XA 2G30A 2JTDA 1KELL 2VCBA 1YE6A 5TK4A 4HMEA 4I5BB 3M5VA 3VFCA 4FF9A 3FA4A 4QRPD 4F58L 3BZFA 3SDAA 1FYTE 5CWSA 1IZJA 2WUCH 1HOCA 1NL0L 3W70A 5DBTA 5DJ8A 3VFUA 2P5WE 3C87A 5SWQA 4PJAF 1DQJB 3C09C 2CETA 1MCOL 2F8QA 4WGHA 5JPNC 1KIRA 2P88A 5BVJB 3THUA 4XG1A 1Q9LA 1G4PA 4YDMA 1M56B 4X6CA 2IXVA 3H7UA 5LYRA 4RDVA 2P49B 3KOWA 1O5PA 3BJ91 3SGZA 1ED3A 3G5WA 1S7UB 3O3DA 4K8RD 1R19A 3CS2A 3T0ED 4ONOA 1LWJA 2FO1A 1WP6A 5DQ9B 4LT7A 5HGBB 1NEZA 1ZT4B 3FU3A 3RCMA 4N68A 5E5MB 2VR7A 1K1DA 3HEIB 2R1PA 3B06A 1XCTA 2X2UA 3IGSA 1G6CA 2F7FA 2DSVA 1V3IA 2CPCA 2PO6B 3OBAA 1QUNB 5DHEA 5E8NB 4XVTH 3DI0A 2VO5A 2CDGA 2GKIA 3MV9B 4JM2A 2F84A 4R34A 5KAQF 4LSRH 2UVFA 3A3XA 3MAWA 3T9PA 3BW2A 2Z28A 4DZ8B 2VOMA 3QYNA 2H9GA 1PSKH 1GW9A 4UBPC 4J6IA 2EH7L 1VFBB 3SOBL 3PFUA 3MRNA 3U9IA 3DROB 1SQ7A 3KXFB 3ZZSA 4GIAA 2VH5L 4FA3A 1O4UA 4NZCA 2DWXA 4OY9A 3PJNA 3ZIZA 4YYFA 2A7PA 3PTMA 4HU2A 2N56A 3V4PA 5C0BD 1HEZA 2QGEA 2H6UA 1L2QA 3KGRA 4XX1E 3WD5L 4V1XA 1GXEA 1BA9A 5D4IA 3MLTB 3VVWA 4RE2A 2YPLB 4DCQB 1S5IH 1E4XL 4J40A 1XL4A 2OZNA 4HWNA 4QP0A 1CO1A 4GOSA 3I7QA 1IM9D 3A13A 3IGUA 4OLZL 4LBEA 1L6FA 4Z0BH 3MSRA 4NQEA 1ND0B 1NCGA 1YXCA 5ICYB 5TQ2L 2C3WA 3F3HA 3H70A 4KWOA 4K7PH 5JDJA 5GSVA 4M6VA 4MZRA 2NT1A 3VW3L 1HL4A 5REQA 4D6JA 2MNRA 5FA3A 1F4XH 4X8JB 1JGVH 1ICTA 3PDOA 4FNLH 1XTMA 2AQWA 3WK0A 5HULA 3S4SB 3PZMA 4C56B 5JOFA 3QG7L 5CZVL 5F3BB 3QPZA 1V6VA 2VEIA 2FX7H 4QHMB 2JFCA 5FYKD 4UCGA 2REQB 2CZDA 2GT9A 1F0LA 3S6CA 3E6EA 3MRMA 2P3YA 4DK6A 5CCKL 4NL1A 3GLDA 5JHDA 3O2WH 5D4QA 3T1FA 2MNJB 4NT6A 4OBTA 4IMKC 1BQLH 3HGRA 1LNUA 5TF1L 4ICWA 3O7UA 3G0XA 3RDTD 1W72A 4NZUH 1TELA 2M2DA 2RH9A 4K8EA 4DZBB 1RZKH 3LS5L 2Z93A 5DA0B 2VLJA 3QQ1A 3IJ9A 1JZ3A 2K6WA 3QG6A 1S5TA 3UBPC 4OKVA 4MD0A 5AZEH 3CZUB 1QNQA 5EU5B 2X4UB 5EDSA 3HOGA 1E4WL 3ZMEA 4ZFFB 1IIIA 5IV2A 4IT1A 3VRJA 4AYFB 4AENA 4OIFA 4YPJA 4BD4A 2Y88A 4X5XB 3OGOE 5KVDL 5AW2B 2B16A 3MV7E 1EOKA 2NZLA 2X0HA 1L6ZA 1VZGA 5G4NA 4XBJA 5IBLD 4AZ8A 2CUIA 1DBML 4JUSA 5BQDA 2CQVA 3ITVA 1FO0A 4YL2A 3BVNA 3SO3C 2L3BA 1ZHKB 2O9RA 3CIQA 3FYEB 1PX4A 4JS7A 2H4EA 3U30C 5HNUA 2W80C 2DWEA 1RA0A 3CHVA 4KVCL 4NRSA 4WGKA 1IX2A 3MJ7A 4GIPD 2XQBL 1RURL 1OG6A 4H2AA 4MCNA 2VISB 2QDWA 3OGRA 3AT8A 4CQAA 4A3QA 3S88L 4B4FA 3K0WA 1RUML 5C0QA 4P2AA 5I02A 2GW5A 4AZHA 2PCPB 1N82A 2VI0A 1TPXC 2IWEA 3NDYA 1SR9A 4A3YA 2VEMA 4PJ9D 4WK0B 4GG6A 1VZHA 2QQLH 2HEJA 4PTNA 3OVQA 2EDHA 3SQOH 2WJZA 4XNZB 4FOKA 3WJLA 3QJOA 1FY6A 1DJYA 1X6NA 2YA0A 2A6LA 4NBXB 4EDWL 3WIHH 5DI8A 1RKRA 4NRXA 4Q0XH 3IFPB 4LBAA 5EZPA 3ULVH 4U6YB 3DOIA 5BRZA 4LCYB 3APTA 5DELA 3ZVHA 3GIQA 3PWUB 4Z5RB 3VX1A 4X4YA 3ABZA 4OF3A 5EMMA 3BGJA 2AL2A 1DSYA 3S5LB 2HKHL 1ANUA 1LDSA 3OTTA 1NANI 3NK4A 4WI3A 1EDGA 2BY2A 3KCLA 4KZ0A 4NUGH 2IAMD 3V8CA 4HPXA 2C1IA 3L6FA 3P73B 2C9SA 2O93L 1JPST 3VVGA 3HC0B 1U8NB 3STLA 1QOKA 1UOLA 4L3EB 4GXUN 4DXVA 3N9SA 1PZUB 5HHNB 4QMEA 1R3IH 5FWQA 4WF7A 5T1MB 3QEHB 5C9KA 3W37A 3SDDB 2CCWA 1D7CA 1FFQA 1BTMA 2PWHA 1KW1A 4IIDA 3S3GA 4QR7A 4N2FA 2APWA 1N8IA 4JFEB 1EXPA 3PPSA 3TV3H 1S2UA 3UYOD 3OG2A 2WQ8A 5E4IA 3VKBA 3BMWA 1NEUA 4QLRA 1ZLDA 3TNNB 3ETTA 5FLVA 5KVGL 1GOXA 1HDMB 5HPCA 3OB0H 4MXQD 4EIVA 1IC4H 5CP3H 2FYMA 1QSVA 1NLDH 2MEJB 3ENEA 3GS6A 5DJCA 1PG7W 3UEQA 1U8MB 1P7TB 2NY7H 3C5JA 5TE6H 5FM5O 1KBPA 3D39D 3CN1A 4UR9A 1KCVL 2JJUA 1ONRA 1MJJB 1E6JH 1SJAA 1UZ8A 3FT9A 3B0PA 5LGHH 5M3WA 1PZ5A 4AGPA 2R1YA 3ARQA 4MY8A 1NCWH 4L7ZA 1E4XI 3L3KA 3QOMA 1I1YA 4EXKA 3SDCD 4EQ3A 1S2CA 1SDYA 3W75A 2IBBA 4WY7H 4X2PA 6PAZA 2FECI 1DQLL 1T1XA 4W9LC 5JIQA 1W0WB 2J7DA 1XR8B 2O56A 2WJFA 1S7VA 1AZBA 4QTIL 2JXMB 5D6DA 4H6RA 4PC8A 3EDFA 2R4SL 1HEHC 2WGXA 3HCVA 4JG9A 4PJGA 2BNRE 1MJ8L 1FWJC 2NY1B 4J3OC 3QI9A 2WKJA 4DM2A 4RGNB 4BFKA 3NQVA 3TTOA 1I8AA 2AK4E 3I6RA 1TG8A 2PE4A 3UCDA 3D48R 1EC8A 4DGIH 3WKQA 2C13A 3ROOA 3HQPA 3LAFA 2NQ9A 1NFPA 4OQTA 7FABL 2ADFL 4M56A 4H5SB 3OR7A 3VOJA 4PJFE 4BQCA 4XAYA 4MQ7B 4KJYB 2E6AA 4HIXL 1PCSA 3RM8A 3OX8B 5ABZA 5KJRL 1V0LA 4YMPA 1OARL 2YQBA 3IBEA 2YA2A 5DCDA 5D7IB 2Z7WA 4YMZA 1XGQA 4A8NA 2KI6A 2W8CA 1EBGA 2CFFA 1N5AA 1W2PA 3PNWA 1XF2A 3GBNH 2OX5B 1P9MC 2R23B 3LMYA 5E1AA 5KN5B 3U4KA 5L2KD 1F90H 3P0WA 1E9ZB 3VFLA 1B30A 4YSUA 5AB9A 1OLZA 3U0TA 2UXVA 3KHQA 1UD8A 2IXQA 4JFZL 3BIKB 2VDOH 4DB7A 1WIOA 1EBHA 5LCVA 1U3HC 2N01B 4NS0A 5EU7E 3HA1A 4OZIB 4HQQL 3MBEA 2IDSA 2VDPL 1HSAB 4NLAA 1GT8A 3OB0K 3WD1A 3A3HA 1R2SA 3H9HB 3QDGB 3GHUA 5HGHA 1H7WA 3G0SA 1T7VA 4S1QH 1PKNA 4JW3A 3GI8H 1JVKA 3QDMD 1TTQA 4WK4B 1QTWA 1I75A 3CU1A 4AIZB 1ADQL 4CU7A 3VFWB 3T8XB 1BZ7B 1O95A 4B5SA 3RWDB 1P6AB 1G6RH 3NT0A 1JNLH 1EIBA 2FGBA 1X5KA 4I0CC 3B0XA 4PVBA 5L4FA 1OGPA 4K07A 3RDKA 3ITYA 1PAMA 2NUPA 1ZA6A 3TTQA 1OGAB 3MUCA 3LN4B 1IAOB 5E0QA 4K0OA 4DJDA 3S6OA 1EJ7L 5CILH 1CUOA 1P4IL 1ZGLM 4GJJA 5DT7A 1AOHA 2CIKA 3VUSA 3FHAA 4PMEA 3CX5K 4MAVA 3N40P 2A6DB 2OCJA 4N2LA 4ACTA 5EWIL 5F93C 5D4HA 4ZZFA 3VD0A 3L2NA 5K39B 2X4QA 4DIXA 5C6TL 3KBFA 1OP5K 3ARBD 5EUOE 4EK7A 1EC9A 3TWCL 4D0DB 2OK0H 3MMDA 2YZ1A 2J4GA 4Z7NF 3ZZLA 4IUOA 4U5KA 4EEEA 3QHFL 4WY0F 3IIXA 1YJDH 1G9MC 5HXMA 3KDPB 4F15B 4JX4A 3IIZA 3IKKA 4HA1A 4P7NA 4KK5D 2J7HA 1XIDA 4YNYA 4ONFH 5E1IA 3UWVA 3HI6H 4L8CB 3FXYA 3GVRA 3BSZH 4YAQA 3RAJH 1UGNA 2WANA 1THCA 3OF6D 3RM9A 4XPGL 3BW9A 4R3SA 2YL9A 2IDTA 4XRCA 2XKSA 3ABKB 3TT3H 3EXRA 3JQOB 3CFNA 3R8QA 1JXGA 1TV8A 2HJLA 1YEEL 1WCBA 3LS9A 4R0LA 3LTYA 5F88B 4QLJA 4E3VA 3CL8A 4LUSB 2DQWA 1JGEB 1P6FA 4JR9L 3BH8B 5TQ0H 3W74A 3T6ZA 1WAAE 4OZFH 2P46B 4PG2C 3SKNA 1CURA 2DLIA 1XSJA 4IDLA 3WQ5A 4OLEA 4IGSA 4U7MA 2B7NA 5IBXC 2BSRA 3P77B 2R56H 2HJKB 1FL3A 4OCXL 4IMFA 3QMRA 2CO7A 2XX0A 3CNKA 3G5ZB 4Q6IC 4QRRB 5G5DB 2R2BB 1I7ZA 4HHGA 1S7WB 4P5KA 1I9EA 1NCBL 5LJYH 3OAWA 4WOQA 3LM7A 4PBVC 3QPXH 1H3XA 2IG2L 3AB0C 5IFPA 1JNJA 1BLNA 5EZLA 4P2OA 4X6DE 3ZZ1A 1MVUA 4Z7OF 3QHTC 2E7MA 4YX2H 3X1FA 5F89A 2CJUL 3ZTDC 4RISL 3U5UA 3FJNA 5DEGB 2VEKA 1RJPA 3ZL1A 3SUUA 1BECA 4B9YA 1OVZA 5B7EA 5BZDB 4M7KL 1S3HA 2VP8A 4HIJA 4XNXH 3QP3A