1G9IE

Crystal structure of beta-trysin complex in cyclohexane
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN, CATIONIC
publication title X-Ray study on an artificial mung bean inhibitor complex with bovine beta-trypsin in neat cyclohexane.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1g9iE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1g9iE02
1C1UH 1O2WA 3ATWA 4NFFA 5LPEA 2IJOB 3F9FA 3U1IB 2TBSA 5GXPA 2FX6A 1AQ7A 5GDSH 3E6PH 1ZJDA 2PKAA 4I7YH 1YLCA 1FN8A 1OWIA 2B0FA 5BRRE 2BVRH 2QC2A 4I31A 3C1KA 2XYAA 3GCTF 8GCHF 5ABWA 4R8TB 1C2JA 1UVTH 1HAZB 2VIOA 4WMDA 1PQ8A 1Z8IB 1TA6A 3ZZDA 3ZZCA 1BTXA 2A0QB 3H7OA 1TRYA 5A0AE 3K2UA 3SV7A 4X2YA 1O3PB 1W8BH 2Z3CA 3A7WA 1C5YB 1LVOA 1UTOA 1Y3XA 3OTJE 4CHAC 4INHA 3RXJA 2ODQA 5PTPA 1M9UA 1RIWC 2GD4B 3M5OA 1L1GA 2VNTA 2I6SA 4B75A 3VB7A 1V2RT 3A88A 1GHYH 3QGNB 1E36B 1QIXB 3HATH 4FVBA 1VGCB 2HNTF 1C2DA 1O2UA 1P2NA 1A5IA 3PLBA 4Q7YA 1FZZA 2Z6BD 1IQEA 2QGRA 3HK3B 4MPUA 4Z0KA 3Q3XA 2GCHG 1QBNA 2ZHDA 3MWIU 1BITA 1EAIA 3V7TA 2GKVE 1K1IA 1V2VT 1DWCH 3IWMA 2ZCKP 4K60A 2ZI2H 1K1JA 3SNCA 3HKIB 1XUKA 1NT1A 3Q76A 1J17T 2CXVA 1O3BA 1H9IE 2BZ6H 3UY9A 1TNJA 1Y3WA 2O8WA 5EQRA 1O3CA 4YT7H 3ZZ7A 1QURH 1BT7A 1QRZA 2V0BA 1DANH 1P2OA 1QJ7B 4UE7H 5ESBA 1IQFA 1E37B 4RKJB 5FX6A 5H4IB 3TJUA 3DUXH 4A7IB 2XWBI 3ATLA 1GVKB 2AEIH 1V2JT 3EAJA 3MNXA 2P8OC 4O03A 4AOQA 1TBZH 2ZQ2A 3UTUH 2J92A 1ELCA 2PR3A 3SGQE 2BMGB 3RU4D 2GVFA 2OQ5A 1W7XH 2P3FH 3A81A 1TIOA 3EDXB 1C5UA 4OS4A 2ASUB 1T4VH 5EU8A 4NWLA 3O8CA 3SGBE 1YPMH 1CO7E 1FY4A 3LONA 1G3CA 1WTHD 2Q1JA 4ZAEA 4YO9A 5LPFA 1MAYA 1ESBA 4IGDA 3T62A 4X1QU 1H4WA 1EXFA 2B5TB 1AN1E 1CHGA 1JMOH 1FIWA 4YTAA 4BOHA 2DUCA 3SI4H 5EW2H 2HLCA 1G30B 2ZFPH 3A80A 3P6ZB 1BMMH 2J4IA 1OX1A 3SQEE 1EZQA 3VEQB 1IAUA 1E38B 1HXFH 2WV4A 2BLWA 1FY5A 1BTPA 1Z1IA 4DURA 4ABGA 2A1DB 1TPOA 3LJOA 1T8NA 1O36A 1MMJN 3QDZB 2Y5GA 4ZKSU 1C5MD 1K2I1 4K3JA 1K28D 4D9RA 1N1LA 3D62A 4QT8C 2HVXA 1ZSKA 2OC8A 4AFQA 1UTJA 2C93B 1NTPA 1QL7A 1RRKA 3JZ2B 1EPTA 4TYDA 2R2MB 1YF4A 2C8ZB 3RMNH 1ID5H 1YPEH 2AH4X 1UTMA 1O3EA 2VH6A 1LQEA 2WPJS 3RXRA 4NZQA 1AD8H 1ZRKA 1CA8B 1DFPA 2XXLA 5FBEA 4NWKA 2ANYA 2QY0B 1GJ8B 4ABIA 1ANBA 5FPTA 1BTYA 3UNQA 3MMGA 4WXVA 4X6MA 3M3SA 3TGIE 5DO4H 4Y8XA 1VZQH 2QAAA 5HM9A 3N7OA 1A0LA 1S82A 1CHOG 2HGTH 4A1XA 4ISNA 1KXAA 4D8NA 4BAHB 2FI4E 1GPZA 1YLDA 1EAUA 3RXBA 4AORA 2G4UA 2F83A 1GBBA 1A46H 1YCPM 5JBTA 4TWYA 1V3XA 2ANWA 1C2MA 3P95A 5DG6A 2R2WU 1QNJA 2BD9A 2BX3A 1BBRE 1TALA 1NRPH 4X2VA 1UHBB 3RXTA 1DY8A 3SU2A 2OLGA 3PV4A 1HAOH 1DICA 1HDTH 1ZSJA 1MH0A 3L3TA 3G01A 1EPTC 4FUDA 4DJZB 1N8OB 3R3GB 1TGCA 3PWCA 1C1OA 1SVPA 1XMNB 2Y5HA 3H7TA 1PQ7A 5EODA 1O38A 2VIPA 1GJDB 3HKJB 2FMJA 1FNIA 3QTVH 2FP7B 3K6ZA 4CR9A 1VITG 3Q00A 2AGEX 2NU0E 1TNIA 4D7GA 3ZVBA 4YM9A 3UQOA 4ZKOU 1DXWA 3F9GA 4DIHH 1J8AA 3SU1A 1C4U2 3UPEA 3O8DA 4Y8ZA 1O3JA 5L6NH 4O3TA 5BPEA 2UUYA 1DLKB 1GHBF 1ELEE 3FAOA 3E0PB 4ZKRU 1EKBB 3AW1A 1LHEH 2FTLE 1GGDC 2D2DA 4PROA 1F92A 7LPRA 1GHAG 2P94A 3RXPA 2BD5A 3SW2B 2O8LA 2H6MA 1ANEA 1FPCH 4I8JA 2FI5E 1MTNC 4U30A 1ZMLA 3O8BA 1B5GH 1GHZA 1C5VA 2FZZA 2FESH 3SZNA 1GI5A 3T28A 1X7AC 1DT2A 1TRNA 1O2QA 1BJVA 4CREA 1WCZA 2ZTYA 1HJAB 1XVOA 1S5SA 1HAYB 1MTUA 3RXIA 3SNEA 1JRSA 2XRCA 3V3MA 5LPRA 3ATIA 4RKOB 5LH8A 2BVXH 4X2XA 3ZZ5A 4K8BA 4CR5A 4KELA 3SJ8A 2AFQB 3EA9A 1C2HA 1LHGH 4HGCA 1YGCH 1O2MA 2WYGA 3ZV9A 4NA8A 2V3OH 2FS9A 1V2PT 1HPGA 1TGNA 3FFGA 2FPZA 1TBRH 3A8BA 3SU4A 1PPGE 5CHAC 3M3VA 1CSOE 1LDTT 3KNXA 3UNRA 2FOEA 3JZ1B 1TAWA 1QRXA 2CF9H 5J4QA 2VGCC 3MNBA 1BQYA 1CBWB 2JH5D 2ZF0H 4GHQA 3TK6A 1O5CB 2GCHF 1L4ZA 2ZWLH 2ALVA 1SLWB 2FS8A 3T27A 3F6UH 2Y7XA 3UOUA 5DP8A 4CBOA 3SN8A 2BY9X 1HJ8A 2JKHA 4FUFA 1P2MA 2BLVA 1Q2WA 2H9EH 3PLKA 1HAHH 1O5GH 2QV1A 3S69A 3V12A 2B9LA 1P8VC 2GCTB 4NA7A 4K1SA 3RC6A 2GDDA 1PPBH 4GLYA 4NGAH 5TCAA 2FOCA 4Y6DA 1HBTH 4ISIH 4Y11E 3KCGH 4WVPE 1ZYOA 2JH6D 1D6RA 3M7TA 4WMFA 1EATA 1HAXB 5C67A 4WF8A 3BIVH 5GWZA 4AGKA 3S9BA 1NRNH 2ZA5A 1MUEB 3UQVA 2FEQH 1IQGA 1FAXA 1ZTJA 3BEUA 1G3DA 3SV9A 3QLPH 1MBQA 2PWXA 1N6YA 2ZKSA 4HFPB 1EQ9A 1H1BA 1L4DA 1J9CH 1ZR0A 1O2VA 4GSOA 1GJ4H 2TPIZ 2PTNA 2J2UA 3FP6E 2QXGA 2LNCA 3ZZAA 1PFXC 3RXGA 4WY3A 2BD3A 1W7GH 3D65E 2ANKH 2BDAA 2HWLB 5AVDA 1KXDA 2AMDA 1AIXH 1Z71A 3SJIA 1AHTH 1SGFG 2VB0A 1BRCE 2DE9A 1H9HE 3GDVA 5DP6A 1DITH 3GCHB 1VGCC 2ZPSA 5FHTA 2EI6A 2TGAA 1XM1A 4MPVA 1ABIH 4VGCC 1HGTH 1DSTA 2ZU1A 3V0XA 2BLOA 2IPHA 5FXLA 1O2ZA 1TWXB 4FUHA 2Z9IA 1HV7A 1S83A 4KGAA 3ELAH 1CT0E 1RGQA 4HI3A 3E91A 3AAUA 2FYQA 5F8TA 2QXJA 3RXOA 1BIOA 1GI4A 1SGYE 1GI7B 1V2NT 2V6NA 2ZHQH 2BX4A 1HAGE 1TX7A 2F3CE 4H6TA 3A89A 2ZPQA 4FU9A 1H9LB 3NUMA 1J14A 1L1JA 1XKAC 4AG2A 2B8OH 1HAPH 1IQLA 1QR3E 1ACBE 1MTSA 1TA2A 5JBCS 2XWAA 4K69A 4X1SU 5EW1H 1WV7H 3SUEA 3QTOH 1NZQH 3FP7E 1GBDA 2ZZUH 4ZROA 3PROA 1T7CA 3RUOA 1P11E 3GY4A 3GYLB 4FUEA 4A6LA 4AYYB 2VIVA 2OINA 1EJAA 3SNBA 1ZHRA 1BOQA 1AFQB 1BDAA 1DWBH 2DE8A 3M5NA 4X1NU 1WOFA 1MTVA 1MZAA 3ZVAA 2R0LA 1AU8A 2ZTXA 5E2OA 2BY5X 1A5HA 1GHVH 4ZKNU 4CH8B 5JDUB 1QB1A 3RLYH 4JYUH 3RDZA 1SPJA 1SG8B 4YLQH 5DP3A 1W13U 1F0UA 1GMHG 2P3TB 3AVZA 1BZXE 1P06A 4B2CA 1TNKA 2W3IA 4FUIA 4INLA 9ESTA 1C1NA 4AB9A 4FXGH 4GHTA 3VGCC 2CN0H 1YPLH 1O3MA 2VVUA 4GCHG 1B0FA 5DP9A 5C1YA 1BTHH 5A8ZA 3RLWH 1OKXA 3D49H 1ARBA 1FONA 1WAYB 1VITF 1ZLRA 1O3LA 3I77A 1V2WT 1GJ9B 4E7RG 1NRRH 1C5RA 1TQ0B 2ZO3H 1NRSH 2O8MA 1GMCG 3B9FH 2ZFTA 4MLFB 1GI1A 1C2GA 5C2ZA 3FVFB 2VU8E 1DS2E 4GUXA 4JZEH 1NFUA 1TPPA 1OWHA 1BHXF 3UWIA 1P01A 1BCUH 1C4V2 1C5LH 1JIRA 2ZC9H 3D23A 4OS1A 1EZXC 1P3EA 3S0NA 1QL8A 5EXMA 2C3SA 1LCYA 2I6QA 2O8UA 1GHAF 1GJCB 2SGDE 1H8IH 3TH2H 1YPGH 1DWDH 1O35A 1ZGVA 3RXDA 5T6GA 1IQIA 3GOVB 2BDCA 3GY8A 2FODA 4NSVA 1TONA 2AS9A 4OS5A 1GHBG 1QB9A 2ZDMA 4IW4E 4U01A 1D3QB 1GI6A 2ZGBH 1P9SA 1LHFH 1UTLM 1YCPK 1O3AA 2EA3A 3ENSB 3SU6A 3U9AH 4AX9H 1L1NA 1PYTD 4AN7A 1AI8H 5K7RA 1AVGH 1SGFA 3QO6A 4I8LA 1MBMA 4XDEA 4Y0ZE 1ZHMA 1QL9A 2ZPRA 3U8RH 3SU0A 2AMQA 1N8OC 1C9PA 2V35A 5JBAS 1TNHA 7GCHF 4F49A 2PV9B 2AGIX 5EGMA 4MVNA 2NU3E 3P8FA 4IMZA 2CJIA 3GISB 3P70B 8KME2 1O2GH 1O2IA 1ZPBA 2BM2A 1ZPCA 2ZU5A 1P2KA 2ZDAH 3BTTE 3W95A 2SGQE 1J16A 1SGPE 1DDJA 1AY6H 1BBRH 1TX8A 3ITIA 1TNGA 2G5NA 3PMJA 2XBYA 1C5XB 3F68H 3KF2A 1QA7A 4TY7A 1A2CH 4O3UA 3Q3YA 1DVAH 4ABBA 2BXTH 3RM2H 2VINA 1ZJKA 4KKDA 2ZGXH 1TRMA 1Z6JH 1MKXH 3M5LA 1GBIA 1Z6EA 4THNH 5HM2A 1O31A 1AWHB 4ISLA 1C5WB 4ABAA 2A4QA 2D8WA 1PPFE 3B8JA 3M35A 1SGTA 1TGTA 4JMYA 4BTIB 1FY3A 3BV9B 3IITA 1BMAA 3KEEA 1HJAC 3SV8A 4KTUA 3K9XB 1GDUA 1PPZA 1V2OT 2FLRH 4JYVH 2P3UB 3QX5H 5DGJA 3ZVCA 5C5OA 3U8OH 2GT8A 2H1UA 3M7QA 4AB8A 1AMHA 1L0ZA 3PMHB 3SV2H 4AYVB 5E0GA 3BEFB 1YPHC 3E1XB 1P57B 2WPIS 2OBQA 4ZUHA 1WTGH 6GCHG 1KSNA 2JETB 1VCWA 4NG9H 3MYWA 3LGWA 1Y8TA 3A8DA 1LPZB 3VXFH 3H5CB 1AWFH 1LMWB 3ZZBA 1CBWC 1OWJA 1O30A 3T25A 1WBGB 1S81A 2XNIA 1YC0A 4M7GA 4O9VA 4I32A 2QXIA 2G81E 3LC3A 5AF9H 2BQ6B 1GBAA 2EI7A 2F9UA 1RJXB 4IN2A 1C1MA 1UVPA 1D3DB 4Y79A 1KXBA 2YNAA 1G2MA 3RXSA 3U1JB 1NS3A 3OY5U 2W5EA 1EZSC 3SUDA 3RU4T 1FLEE 3KQDA 4NIVA 5FAHA 1UCYK 1FY1A 2BQ7B 4AZ2B 5JB8S 1ETRH 3SUGA 3UIRA 1AFEH 3ZV8A 1RS0A 1ZZZA 1XUGA 1UK2A 4OS7A 1EJNA 2FYRA 1GJ5H 1RXPA 4X1PU 1BHXB 1SSXA 1NPMA 1A61H 1XUIA 3TIUA 1AO5A 4A1VA 3MH6A 1UVSH 1C5QA 4IC5A 2SGPE 4K2YA 3QK1A 1BTZA 1CGIE 2HRVA 3A8CA 2OQUA 1V6DA 1S6HA 1C4Y2 3NWUA 2XBWA 4ABJA 3E16B 1SI5H 2FOMB 1GCDA 3I29A 1UK4A 2XW9A 4SGAE 2Z3DA 3A7XA 2A5AA 2NU2E 3DA9B 1P3CA 3CP7A 1Z8RA 1MD8A 5GJ4B 1ZTLA 3GY2A 4Y7AA 3BTDE 2WPMS 2ZCLP 1SQTA 3GCHC 2FOAA 3F9HA 1O2LA 1GMHF 2Y7ZA 6CHAC 1F0TA 1UTPA 1WYKA 2GP9B 1MU8B 4GVUA 4ASHA 1BRUP 2XCFA 4NIWA 3LGUA 3S7KB 1D3PB 1SFIA 3ZZ9A 1EB1H 5EG4A 4JCNA 4GCHF 3M37A 3MU5A 5CE1A 1Y3UA 1SOTA 1HFDA 1P2QA 1O2OA 1MU6B 2FLBH 1TB6H 4UFDH 3STJA 2J38A 1GBJA 1G37A 3RXUA 4BAKB 3GDUA 3MH7A 1GMCF 4B2BA 2G8TA 1YPHE 1AB9B 3AASA 1RFNA 2W3KA 7ESTE 1BTUA 3UFAA 2PFEA 5IYTA 4K8YA 4ABHA 3PWBA 1LVYA 4J2YB 4NIYA 4ZHMU 3WY8A 1NU7B 2AIPA 1MZDA 2H9TH 2ZFQH 3R0FA 2Z9JA 3M36A 4I33A 1MKWK 3TJVA 1ZSLA 1DLEA 4AFZA 1IOEA 4JYTA 4J1YA 1XXDA 1TX6A 5C20A 1GG6B 1F2SE 2VIWA 2J9NA 2HPPH 3PMAB 1A4WH 4KTSA 1ELGA 1FDPA 4UFGH 1A0JA 1OWDA 1KXCA 1NY22 1P04A 1SLUB 2R0KA 1KDQB 1G36A 1TGBA 2C8WB 1WQVH 1DUAA 1O3HA 1AFQC 4IMQA 1O5EH 2GV7A 3SV6A 1ANDA 1TPAE 4ZHAA 2PSYA 2OP9A 5CMXH 5C3NA 3M61U 5F03A 1GBFA 1K9OE 1LO6A 1THPB 3C27B 4CHAB 2GTBA 1XVMA 2RCEA 1QB6A 4MPXA 1EB2A 2ZGJA 2Q6FA 4CRCA 4YT6H 5C1UA 3A7ZA 3LJJA 4MNWA 2ZHFH 2SNVA 1LKBA 1LPKB 4DVAU 2ZTZA 3DFJA 2CF8H 2KAIB 3U98H 1FV9A 3SU5A 3T5FH 3PO1B 3UR9A 5EPYA 1XUJA 3BTQE 1HJ9A 3AW0A 3MTYA 4DIIH 1P02A 2OXSA 4X2WA 1O5BB 1Q31A 3UREA 1THSH 1LHCH 3A87A 2G4TA 1P2IA 1UTKA 1SGRE 1C5SA 2J94A 4D7FA 5EXLA 3DHKH 2WV5A 3KQBA 1THRH 3BN9A 4Q7XA 2VWOA 1T8MA 2UWLA 2XC5A 5GIBA 2W26A 2STBE 1C5PA 1QBVH 2FIRH 3E8LA 3ODFA 4A92A 3GYMA 2BY7X 1H8DH 7GCHG 5L2ZH 1V2TT 1E0FD 1G9IE 3FZDA 4OS2A 3PLPA 1O2HA 2FX4A 2ZECA 2ZEBA 5E0JA 2BXUH 1QGFA 2G52A 2OCVB 1GDNA 4UFFH 1SC8U 4MTBA 3EQ0H 1BJUA 2H5DA 2SFAA 4E05H 5A8XA 1OYQA 2ESTE 4CRFA 3MO3A 4X1RU 1DE7H 3UWJH 1O2SA 3MO6A 4D76A 1Y5UT 4MDSA 1K1PA 2VIDA 4WH8A 3TJOA 1UTQA 3E3TA 4BTUB 1NM6A 1AVXA 3BTGE 1GCTB 4F4OC 1TBQH 5L2YH 2A4OA 4FUGA 1LQDB 2ZHWH 1FJSA 1AKSA 1BTWA 3MH4A 4NA9H 4ABFA 2Y82A 1V2UT 1HRTH 4DCDA 1GMDG 1A3EH 3SNAA 1AE5A 3TK5A 2ILNA 5T6DA 3CENA 1G3EA 6GCHF 3BTHE 3GY7A 2XTTB 2PUXB 4LOYH 1GJBB 1CT2E 1QA0A 1YBWA 2BD4A 1O5AB 2BOKA 2GMTB 2ZNKH 5C1XA 1CVWH 3A82A 1BMLA 1SMFE 2EC9H 3S9AA 5FPYA 2GX4A 4LZ4B 1GHXH 2ZG0H 3ZVFA 1JWTA 3A7TA 1EOLA 1V2LT 5GCHF 1MCTA 5C5NA 4OS6A 1T4UH 3LH1A 1EAWA 1AGJA 4NZLA 1O2JA 1Y5BT 1OPHB 5SGAE 5DKMA 1LHDH 4JK6A 1CT4E 2H9HA 2ZCHP 1FN6A 1QJ6B 4BAQB 4B71A 2OC7A 2W7UA 2C8XB 4WH6A 1TQ7B 2OUAA 1GBHA 1IHSH 1Y3VA 4Y7BA 2GZ9A 3OSYA 3I78A 3TPIZ 1PPEE 3TVJB 5I46H 4Y8YA 4E7NA 4UFEH 1ZGIA 3MNSA 4XFQA 5EXNA 2YOLA 4BAMB 5FX5A 2UUJB 2BD2A 1OP8A 1K1LA 2IOTA 4BTTB 3GY6A 1O2PA 2R3UA 4JZFH 1UJ1A 5E8EH 4WJG2 3DT0H 1MCVA 1O33A 2A5IA 2A7JA 2QN5T 5FBIA 1UCYE 1BRAA 4UEHH 3SHAH 1TOMH 4D9QA 4IN1A 4X6PA 3RXEA 3MNCA 1ESAA 3NZIA 1GDQA 2V3HH 2Q6GA 2RA3A 2JETC 2G00A 1Z1JA 1C1VH 3UUZA 4I8HA 3U8TH 1KLIH 4CRAA 2BOHB 2AMPA 2J34A 3BTFE 1NFXA 2JH0D 5JBBS 5A8YA 3ZYEA 1ETSH 2Z7FE 4X8UH 3P17H 2ZGCA 1OP2A 4ZH8A 3P92A 1L2EA 2VVCA 4AGJA 2UWOA 1WUNH 2J95A 3RXAA 2BZAA 3PMBB 2M5TA 3M7UA 3F1SB 1C2IA 4ZMAH 2FOGA 1IQNA 3SO3A 4FU8A 3TH4H 2BVSH 2YNBA 1HXEH 1C1TA 1FPHH 3NXPA 2PGQB 2BB4A 3GY5A 4UONA 2WUCA 5A0BA 5FCKA 1YM0A 1SR5C 2VH0A 1BRBE 1S6FA 2HOBA 1TMUH 1SBWA 2STAE 4H42U 4K5ZA 1GGDB 3ZZ8A 3TH3H 5J4SA 2FOBA 1HAVA 3L33A 4B1TA 4MPWA 4Q80A 1A3BH 4K1TA 2XCNA 1EP6A 1KLJH 3KGPA 1QQ4A 2GZ7A 3PTNA 1ABJH 2Y81A 1DOJA 1GBMA 1OWEA 5DP7A 1O2XA 2WPLS 2GV6A 1KTTB 1RTKA 3A85A 4OGYA 3A86A 3LPRA 2D1JA 4CRDA 2ZGHA 2A4RA 2VWNA 5G4BA 3SQHE 1WSSH 4X6NA 1ANCA 3TNSA 3UOPA 1W14U 3B23B 1C5NH 2FO9A 4GPGA 1MAXA 1KDQA 2Z3EA 1NROH 1DY9A 3HK6B 2BY8X 4Z6AH 3LGIA 2WPHS 3EA8A 1NN6A 2PLXA 4LXBH 3RC4A 5CHAB 2BD8A 1O3IA 2FM2A 2AYWA 3LGYA 4BANB 2A32A 4UDWH 2A31A 2Z9KA 1Z8JB 2LPRA 2GZ8A 1GBCA 1C2KA 1O2YA 1YPKH 1GL1A 2PKSB 1GI2A 1SHHB 1P10A 2Y80A 4Y0YE 3RU4E 5IDKA 4Q2KA 2WUBA 1TYNA 1S0RA 4AG1A 2XBVA 2KAIA 1U6QA 2F9OA 2F91A 1AB9C 4X6OA 3O8RA 4YESB 1HUTH 1SGDE 1E34B 1O3FA 3GY3A 1C1PA 3P8GA 1KXEA 3RXHA 1HAIH 1GBKA 2BDYA 2HNTC 3TITA 1O3GA 4XBCA 2Y5FA 2H2ZA 1P2JA 2THFB 3QUMP 2BD7A 2D26C 5E2PA 5DP4A 1QFKH 1EP5A 1UTNA 4K1EA 4B2AA 2BHGA 3RXMA 1GG6C 1T32A 3KQEA 2A4GA 4TPIZ 4TPYA 3URCA 3LKWA 5LGOA 4ESTE 3BTKE 4CBNA 4B73A 1O34A 1SHYA 2NU1E 1ETTH 1P12E 1FXYA 2IN2A 2QIQA 3LDXH 4MG3A 2PSXA 1QHRB 3VPKA 1UVUH 2PTCE 2R3YA 4TWWA 1ZHPA 1ORFA 1OWKA 4BAOB 2RDLA 2ZIQH 1JRTA 2FTMA 2GT7A 3NCLA 3V13A 1TOCB 2RA0A 2C90B 5F8ZA 1HLTH 2BQWB 2FXRA 3ATMA 1WU1A 2BY6X 4JZDH 4R0IA 2AGGX 1P09A 3MI4A 1AKSB 3ATKA 1ELDE 1GMDF 2PUQH 1ZMNA 3PO1C 3QN7A 1TNLA 4VGCB 4XBBA 3TJNA 1QY6A 3SJKA 3EGKH 1CA0B 2A2XH 2TIOA 2VJ1A 2ODPA 2WPKS 1S84A 1UO6A 1GL0E 3BTME 3FP8E 1FAKH 1PQ5A 3SI3H 3BG8A 1FMGA 1VCQA 1AUJA 5HXFA 3BIUH 1GI9B 3NKKA 4H6SB 5EQQA 1GHWH 3HGNA 3ZZ4A 3BG4B 1TMTH 4Y76A 1YYY1 3GCOA 1A7SA 3MU4A 4GAWA 2XC0A 4MNVA 1GJ6A 1EUFA 2G51A 2Z9GA 2BDHA 2OC1A 1GI3A 1NESE 1WQSA 2Y6TA 1W12U 4Q7ZA 3LT3A 8LPRA 1FI8A 5HGGA 4AFUA 1GJAB 3CS7A 3A7VA 3TK9A 1EOJA 1YCPH 5JYIA 5GCHG 4DGJA 3LH3A 1GJ7B 2ZDNA 1K1MA 3LOXA 2A7HA 2GCTC 1DXPA 2AIQA 3PYHA 5E0HA 5EOKA 4Y10E 1RD3B 2CHAB 3EYDA 1V2KT 3SHCH 3A83A 1P05A 2W7SA 2QCYA 5EPNA 1HCGA 3RMMH 2OTVA 4X8SH 3NK8A 1XX9A 1GCTC 4NCYA 1MQ5A 2HNTE 1O3KA 1YP9A 2QA9E 1SLVB 2O8TA 2A5KA 3MO9A 3MFJA 4WXIA 1SGQE 3KQCA 5TCCA 4DT7B 2F9NA 1QCPA 4ABDA 3GCNA 1PQAA 4XBDA 3SORA 2ZHEH 2VWLA 2ANMH 1DX5M 3VGCB 1LVMA 4JZ1A 3ZZ3A 3QWCH 1JBUH 1F7ZA 1QJ1B 3EA7A 1QRWA 2GMTC 1Q3XA 2ZU2A 3M3TA 3TU7H 1ZRBA 1C5OH 3BSQA 1TGSZ 4X0WU 5DP5A 5L30H 4WMEA 1W11U 3MU0A 4KP0A 1SLXB 3FZZA 2GGVB 2OC0A 4IS5A 3LC5A 1F5KU 3RXQA 5EQSA 3ZVGA 2H5CA 1IHTH 1F0RA 3TLOA 1TABE 4DOQA 1AUTC 3ZYDA 2ZU4A 1G2LA 1TE0A 1TLDA 1P0SH 4LZ1H 1N6XA 4WWYA 1C1RA 1V2MT 2CV3A 1AVWA 2ZDVH 1F0SA 4YZUA 1HAVB 1FIZA 1K1OA 3ZVEA 6ESTA 1W3CA 1DUEA 2NWNA 2A2QH 3LIWA 1NU9A 3KHVA 4X8TH 2ZP0H 3UR6A 2TGPZ 1TFXA 3PTBA 2EEKA 3PM3A 4FUCA 1CU1A 1VJ9U 1VCPA 1W2KH 3RMOH 5AHGH 1SGCA 1OXGA 3KIDU 2ZDLA 1K1NA 1BUIA 3OYPA 1W10U 1OS8A 1O32A 3L6PA 4YOIA 2WINI 1QTFA 1EAXA 5AFZH 1UCYH 7KMEH 1LPGB 4OGXA 1V2QT 3S9CA 3A7YA 2FOFA 4XE4A 3VB3A 1RIWB 4FUJA 4BNRA 4ABEA 3RXFA 3HPTB 4TY6A 2BDIA 1O0DH 1RTLA 3DD2H 1IQMA 1IQKA 2Z9LA 2ZFFH 4E06H 1ELAA 4AFSA 1GWAA 3BTWE 1HIAA 5DJ7A 1C2FA 4A5TS 2SGFE 3SNDA 5JPMH 2BDGA 2Z94A 1O2KA 3P8OA 3DFLA 4B74A 3LU9B 1NC6A 1C1WH 2PKAB 4DG4A 2FDAA 1E35B 1NRQH 1BMNH 1KXFA 4NIXA 3RMLH 4ISHH 4MNXA 3MH5A 1UVOA 1ZPZA 3FANA 1K22H 1O2RA 4A1TA 1A0HB 1C1SA 3ODDA 1SOZA 4DY7B 2CMYA 1C9TA 3A8AA 2FI3E 2K1QA 4KTCA 1KY9A 4NSYA 3RC5A 1W0YH 1QQUA 4U2WA 1AE8H 1TMBH 3GCTG 5ESTE 1FQ3A 1SFQB 3K6YA 8GCHG 3TGJE 2BYAX 4CRGA 3VB5A 1DM4B 1BB0B 2P8OB 4B76A 2FWWA 2QYIA 1D6WA 1F5LA 1ELFA 2ULLA 3VB4A 1ZOMA 4ISOA 1TPSA 3QGJA 1DPOA 2B7DH 1HB0B 2Q6DA 3SBKA 1A5GH 2CGAA 3PB1E 8ESTE 1EZUC 1PYTC 2UUKB 5F8XA 5HMAA 1P9UA 3A84A 2PKSC 2F9VA 2P16A 2G5VA 2TGTA 2QF0A 3VXEH 3SU3A 1DSUA 2OBOA 1C2EA 2VIQA 1JIMA 5DPAA 3BEIB 1PJPA 3RXKA 1MKWH 3HGPA 2PHBA 1NO9H 2VVVA 4CH2B 1O5FH 1GVZA 1SL3A 1GBLA 3SGAE 2SGAA 1SQAA 3MHWU 1T31A 2UWPA 1G32B 1ZTKA 2O9QA 2AERH 1YPJH 1O5DH 1KTSB 5A09A 4INKA 2C8YB 1MD7A 1C5TA 1JOUB 3GDSA 4JK5A 5A0CA 4BXWA 3E90B 3RXCA 1EJMA 3ZVDA 1GI0A 3ESTA 1D4PB 2BDBA 3SJ9A 1W0ZU 3RP2A 4ZHLU 2EI8A 1NFYA 1XUFA 1Y3YA 2A7CA 1Y5AT 3K65B 4BXSA 4X8VH 5AFYH 3S7HB 5FPSA 4H4FA 4MNYA 3SOSA 1K21H 1V2ST 3T29A 2A45B 3LGTA 4ZXYH 2P93A 1ZMJA 1KLTA 1EASA 2ZFRH 1A1RA 1CGHA 4YLUA 1GI8B 1XUHA 1SGNE 4Y71A 3MOCA 1LKAA 5T6FA 3RM0H 2SGEE 3MU8A 1O3OA 3QZRA 3BTEE 3URDA 1ELTA 2QXHA 1MTWA 9LPRA 1GBEA 1D3TB 4IBLH 3MU1A 1O2TA 4HTCH 1VITH 1T8LA 6CHAB 1CGJE 2ZFSA 3STIA 2BTCE 3KL6A 1CA0C 5ETXA 5DK1A 1XKBC 1AZ8A 1Y59T 1T8OA 3OU0A 2PW8H 4UD9H 1SB1H 2NU4E 5JB9S 1O37A 1ELVA 3VFEA 3AAVA 1IQHA 3BG4C 1S0QA 3EE0B 2ZDKA 2WYJA 6LPRA 3P8NA 1EPTB 1C2LA 5K0HA 1C5ZB 1GBTA 5B6OA 2G55A 2PGBB 2VWMA 3LGVA 3BF6H 1YKTA 3TGKE 1MQ6A 3OY6U 1XXFA 2SNWA 1GVLA 1ESTA 2C4FH 1HYLA 1EX3A 4MQAA 1FY8E 1CHOF 4I8GA 2OD3B 1SGIB 2HALA 1OSSA 2CHAC 2F9PA 2P59A 2XBXA 1J15A 1O2NA 1NFWA 3T26A 1PPHE 1O3NA 1UK3A 2UUFB 3VB6A 4CRBA 3TNTA 4JZIA 3RXVA 3Q3KA 4YOJA 1BBRK 1KIGH 1OYTH 4YOGA 5A2MH 2RG3A 1Z7KA 5GPIB 3GICB 1CQQA 1MTNB 1P03A 3CS0A 3W94A 4XSKU 4IC6A 3RXLA 1ELBA 1Z8GA 1FUJA 5F6MA 1JXPA 1MKXK 1IQJA 1SQOA 1G3BA 1CE5A 3IG6B 2GDEH 5FCRA 5T3HA 2R9PA 1OP0A 1AZZA 2FOHA 4ZXXH 1VJAU 1UHBA 3F9EA 2BLQA 1S85A 3SJOA 1BA8B 4SGBE 3SUFA 1O3DA 2ZQ1A 1B7XB 1RTFB 1VR1H 5TJXA 2P95A 3Q77A 2TGDA 1LTOA 1ARCA 1SGEE 2ODYB 4HZHA 4O97A 3U69H 1QBOA 4FU7A 1B0EA 3ZZ6A 4FVDA 4RSPA 3NPSA 3M5MA 2TRMA 1DWEH 1INCA 2VGCB 1O39A 1HIAB 1PPCE 3UNSA 1D9IA 3QZQA 3E0NB 4FUBA 3T2NA 5I25A 4I8KA 4U32A 2ALPA 4RN6A 1C1QA 2F9BH 5HYOA 2XC4A 1F5RA 1KYNA 1LVBA 4LK4A 4XOJA 4NFEA 1UMAH 3KN2A 3OX7U 4DW2U 1HNEE 1OOKB 2ZU3A 2HPQH 2QF3A
chains in the Genus database with same CATH superfamily
1C1UH 1O2WA 3ATWA 4NFFA 5LPEA 2IJOB 3F9FA 3U1IB 2TBSA 5GXPA 2FX6A 1AQ7A 5GDSH 3E6PH 1ZJDA 2PKAA 4I7YH 1YLCA 1FN8A 1OWIA 2B0FA 5BRRE 2BVRH 2QC2A 4I31A 3C1KA 2XYAA 3GCTF 8GCHF 5ABWA 4R8TB 1C2JA 1UVTH 1HAZB 2VIOA 4WMDA 1PQ8A 1Z8IB 1TA6A 3ZZDA 3ZZCA 1BTXA 2A0QB 3H7OA 1TRYA 5A0AE 3K2UA 3SV7A 4X2YA 1O3PB 1W8BH 2Z3CA 3A7WA 2J98A 1C5YB 1LVOA 1UTOA 1Y3XA 3OTJE 4CHAC 4INHA 3RXJA 2ODQA 5PTPA 1M9UA 1RIWC 2GD4B 3M5OA 1L1GA 2VNTA 2I6SA 4B75A 3VB7A 1V2RT 3A88A 1GHYH 3QGNB 1E36B 1QIXB 3HATH 4FVBA 1VGCB 2HNTF 1C2DA 1O2UA 1P2NA 1A5IA 3PLBA 4Q7YA 1FZZA 2Z6BD 1IQEA 2QGRA 3HK3B 4MPUA 4Z0KA 3Q3XA 2GCHG 1QBNA 2ZHDA 3MWIU 1BITA 1EAIA 3V7TA 2GKVE 1K1IA 1V2VT 1DWCH 3IWMA 2ZCKP 4K60A 2ZI2H 1K1JA 3SNCA 3HKIB 1XUKA 1NT1A 3KQ5A 3Q76A 1J17T 2CXVA 4RI0A 1O3BA 1H9IE 2BZ6H 3UY9A 1TNJA 1Y3WA 2O8WA 5EQRA 1O3CA 4YT7H 3ZZ7A 1QURH 1BT7A 1QRZA 2V0BA 1DANH 1P2OA 2F43B 1QJ7B 4UE7H 5ESBA 1IQFA 1E37B 4RKJB 5FX6A 5H4IB 3CNRA 3TJUA 3DUXH 4A7IB 2XWBI 3ATLA 1GVKB 2AEIH 2K8IA 1V2JT 2PP6A 3EAJA 3MNXA 2P8OC 4O03A 4AOQA 1TBZH 2ZQ2A 3UTUH 2J92A 1ELCA 2PR3A 3SGQE 2BMGB 3RU4D 2GVFA 2OQ5A 1W7XH 2P3FH 3A81A 2JJ1D 1TIOA 3EDXB 1C5UA 4OS4A 2ASUB 1T4VH 5EU8A 5HIZA 4NWLA 3O8CA 3SGBE 5IK2D 1YPMH 1CO7E 1FY4A 3LONA 1G3CA 1WTHD 2Q1JA 4ZAEA 4YO9A 5LPFA 1MAYA 1ESBA 4IGDA 3T62A 4X1QU 1H4WA 1EXFA 2B5TB 1AN1E 1CHGA 1JMOH 1FIWA 4YTAA 4BOHA 2DUCA 3WW7A 2W6JD 3SI4H 5EW2H 2HLCA 1G30B 2ZFPH 3A80A 3P6ZB 1BMMH 2J4IA 1OX1A 3SQEE 1EZQA 3VEQB 1IAUA 1E38B 1HXFH 2WV4A 2BLWA 1FY5A 1BTPA 1Z1IA 4DURA 4ABGA 1YWUA 2A1DB 1TPOA 3LJOA 1T8NA 1O36A 1MMJN 4YXWD 3QDZB 2Y5GA 4ZKSU 1C5MD 1K2I1 4K3JA 1K28D 4D9RA 1N1LA 3D62A 4QT8C 2HVXA 1ZSKA 2OC8A 4AFQA 1UTJA 2C93B 1NTPA 1QL7A 3VG8A 1RRKA 3JZ2B 1EPTA 4TYDA 2R2MB 1YF4A 2C8ZB 3RMNH 1ID5H 1YPEH 2AH4X 1UTMA 2W6ID 1O3EA 2VH6A 1LQEA 2QF5A 2WPJS 3RXRA 4NZQA 1AD8H 1ZRKA 1CA8B 1DFPA 2XXLA 5FBEA 4NWKA 1VKYA 2ANYA 2QY0B 1GJ8B 2WPDD 1ANBA 4ABIA 5FPTA 1BTYA 3UNQA 3MMGA 4WXVA 4X6MA 3M3SA 3TGIE 5DO4H 4Y8XA 3PRDA 1VZQH 2QAAA 2WHXA 5HM9A 3N7OA 1K0HA 1A0LA 1S82A 1CHOG 2HGTH 4A1XA 4ISNA 1KXAA 4D8NA 4BAHB 2FI4E 1GPZA 1YLDA 1EAUA 1W0KD 3RXBA 4AORA 2G4UA 2F83A 1GBBA 1A46H 1YCPM 5JBTA 4TWYA 1V3XA 2ANWA 1C2MA 3P95A 5DG6A 2R2WU 1QNJA 2BD9A 2BX3A 1BBRE 1TALA 1NRPH 4X2VA 1UHBB 3RXTA 1DY8A 3SU2A 2OLGA 3PV4A 1HAOH 1DICA 1HDTH 1ZSJA 1MH0A 3L3TA 3G01A 1EPTC 4FUDA 4AC9A 4DJZB 1N8OB 3R3GB 1TGCA 3PWCA 1C1OA 1SVPA 1XMNB 2Y5HA 5HIYA 3H7TA 1PQ7A 5EODA 1O38A 2VIPA 1GJDB 3HKJB 2FMJA 1FNIA 3QTVH 2FP7B 1QZ8A 3K6ZA 4CR9A 1VITG 3Q00A 2AGEX 2NU0E 1TNIA 4D7GA 3ZVBA 3SZEA 3UQOA 4YM9A 4ZKOU 1DXWA 3F9GA 4DIHH 1J8AA 3SU1A 1C4U2 3UPEA 3O8DA 4Y8ZA 3OEHD 5EJ1A 1O3JA 5L6NH 4O3TA 5BPEA 2UUYA 1DLKB 5C0UA 1GHBF 1ELEE 3FAOA 3E0PB 4ZKRU 2QF4A 1EKBB 3AW1A 1LHEH 2FTLE 1GGDC 2D2DA 2V7QD 4PROA 1F92A 7LPRA 1GHAG 2P94A 3RXPA 2BD5A 3SW2B 2O8LA 2H6MA 1ANEA 1FPCH 4I8JA 2FI5E 1MTNC 4U30A 1ZMLA 2CK3D 2LELA 3O8BA 1B5GH 1GHZA 1C5VA 2FZZA 2FESH 3SZNA 1GI5A 3T28A 1X7AC 1DT2A 1TRNA 1O2QA 1BJVA 4CREA 1WCZA 2ZTYA 1HJAB 1XVOA 1S5SA 1HAYB 1MTUA 3RXIA 3SNEA 1JRSA 2XRCA 3V3MA 4ACBA 5LPRA 4F48B 3ATIA 4RKOB 5LH8A 2BVXH 4X2XA 3ZZ5A 4K8BA 4CR5A 4KELA 3SJ8A 2AFQB 3EA9A 1C2HA 1LHGH 4HGCA 1YGCH 1O2MA 2WYGA 3ZV9A 4NA8A 2V3OH 2FS9A 1YY3A 1V2PT 1HPGA 1TGNA 3FFGA 2FPZA 1TBRH 5EIYA 3A8BA 3SU4A 1PPGE 5CHAC 3M3VA 1CSOE 1LDTT 3KNXA 3UNRA 2FOEA 3JZ1B 1TAWA 1QRXA 2CF9H 5J4QA 2VGCC 3MNBA 1BQYA 1CBWB 2JH5D 2ZF0H 4GHQA 3TK6A 1O5CB 2GCHF 1L4ZA 2ZWLH 2ALVA 1SLWB 2FS8A 3T27A 3F6UH 2Y7XA 3UOUA 5DP8A 4CBOA 3SN8A 2BY9X 1HJ8A 2JKHA 4FUFA 1P2MA 2BLVA 1Q2WA 2H9EH 3PLKA 4P02A 1HAHH 1O5GH 2QV1A 3S69A 3V12A 2JIZD 2B9LA 1P8VC 2GCTB 4NA7A 4K1SA 3RC6A 2GDDA 1PPBH 4GLYA 4NGAH 2WV9A 5TCAA 2FOCA 4Y6DA 1HBTH 4ISIH 4Y11E 3KCGH 4WVPE 1ZYOA 2JH6D 1D6RA 3M7TA 4WMFA 1EATA 1HAXB 5C67A 4WF8A 3BIVH 5GWZA 4AGKA 3S9BA 1NRNH 2ZA5A 1MUEB 1OHHD 3UQVA 2FEQH 1IQGA 1FAXA 1ZTJA 3BEUA 1G3DA 3SV9A 2HVYB 3QLPH 1MBQA 2PWXA 1N6YA 2ZKSA 4HFPB 1EQ9A 1H1BA 1L4DA 1J9CH 1ZR0A 1O2VA 4XRNA 3DSGA 1GJ4H 2TPIZ 4GSOA 2PTNA 1MABB 2J2UA 3FP6E 2QXGA 3OEED 2LNCA 4Q63A 3ZZAA 1PFXC 3RXGA 4WY3A 2BD3A 1W7GH 3D65E 2ANKH 2BDAA 2HWLB 5AVDA 1KXDA 2AMDA 1AIXH 1Z71A 3SJIA 1AHTH 1SGFG 2VB0A 1BRCE 2DE9A 1H9HE 3GDVA 5DP6A 1DITH 3GCHB 1VGCC 2ZPSA 5FHTA 2EI6A 2TGAA 1XM1A 4MPVA 1ABIH 4VGCC 1HGTH 1DSTA 2ZU1A 3V0XA 2BLOA 2IPHA 5FXLA 1O2ZA 1TWXB 4FUHA 2Z9IA 1HV7A 1S83A 4KGAA 3ELAH 1CT0E 1RGQA 4HI3A 3E91A 3AAUA 2FYQA 5F8TA 3FO8D 2QXJA 3RXOA 1BIOA 1GI4A 1SGYE 1GI7B 1V2NT 2V6NA 2ZHQH 2BX4A 1HAGE 1TX7A 2F3CE 4H6TA 3A89A 2ZPQA 4FU9A 1H9LB 3NUMA 1J14A 2JJ2D 1L1JA 1XKAC 4AG2A 2B8OH 1HAPH 1IQLA 1QR3E 1ACBE 1MTSA 1TA2A 5JBCS 2XWAA 4K69A 4X1SU 5EW1H 1WV7H 3SUEA 3QTOH 1NZQH 3FP7E 1GBDA 2ZZUH 4ZROA 3PROA 1T7CA 3RUOA 1P11E 3GY4A 3GYLB 4FUEA 4A6LA 4AYYB 2VIVA 2OINA 1EJAA 3SNBA 1ZHRA 1BOQA 1AFQB 1BDAA 1DWBH 2DE8A 2XOKD 3M5NA 4X1NU 1WOFA 1MTVA 1MZAA 2F4LA 3ZVAA 2R0LA 1AU8A 2ZTXA 5E2OA 4DT4A 2IPQX 2BY5X 1A5HA 1GHVH 4ZKNU 4CH8B 5JDUB 1QB1A 3RLYH 4JYUH 3RDZA 1SPJA 1SG8B 4YLQH 5DP3A 1W13U 1F0UA 1GMHG 2P3TB 3AVZA 1BZXE 1P06A 4B2CA 5HKKD 1TNKA 2W3IA 4FUIA 4INLA 9ESTA 1C1NA 4AB9A 4FXGH 4GHTA 3VGCC 2CN0H 1YPLH 1O3MA 2VVUA 4GCHG 1B0FA 5DP9A 5C1YA 1BTHH 5A8ZA 3RLWH 1OKXA 3D49H 1ARBA 1FONA 1WAYB 1VITF 1ZLRA 1O3LA 3I77A 1V2WT 1GJ9B 4E7RG 1NRRH 1C5RA 1TQ0B 2ZO3H 1NRSH 2O8MA 1GMCG 3B9FH 2ZFTA 4MLFB 1GI1A 1E79D 1C2GA 5C2ZA 3FVFB 2VU8E 1DS2E 4GUXA 4JZEH 1NFUA 1TPPA 1OWHA 1BHXF 3UWIA 1P01A 1BCUH 1C4V2 1C5LH 1JIRA 2ZC9H 3D23A 4OS1A 1EZXC 1P3EA 3S0NA 1QL8A 1SKYE 2C3SA 1LCYA 2I6QA 2O8UA 5EXMA 1GHAF 1GJCB 2SGDE 1H8IH 3TH2H 1YPGH 1DWDH 1O35A 1ZGVA 3RXDA 5T6GA 1IQIA 3GOVB 2BDCA 4M9FA 3GY8A 4P00A 2FODA 4NSVA 1TONA 2AS9A 4OS5A 1GHBG 1QB9A 2ZDMA 4IW4E 4U01A 1D3QB 1GI6A 2ZGBH 1P9SA 1LHFH 1UTLM 1YCPK 1O3AA 2EA3A 3ENSB 3SU6A 3U9AH 4AX9H 1L1NA 1PYTD 4AN7A 1AI8H 5K7RA 1AVGH 1SGFA 3QO6A 4I8LA 1MBMA 4XDEA 4Y0ZE 1ZHMA 1QL9A 2ZPRA 3U8RH 3SU0A 2AMQA 1N8OC 1C9PA 2V35A 5JBAS 3WWFA 1TNHA 7GCHF 4F49A 2PV9B 2AGIX 5EGMA 4MVNA 2NU3E 3P8FA 4IMZA 2CJIA 3GISB 3P70B 8KME2 1O2GH 1O2IA 1ZPBA 2BM2A 1ZPCA 2ZU5A 1P2KA 2ZDAH 3BTTE 3W95A 2SGQE 1J16A 1SGPE 1DDJA 1AY6H 1BBRH 1TX8A 3ITIA 1TNGA 2G5NA 3PMJA 2XBYA 3EE7A 1C5XB 3F68H 3KF2A 1QA7A 4TY7A 1A2CH 4O3UA 3Q3YA 1DVAH 4ABBA 2BXTH 3RM2H 2VINA 1ZJKA 4KKDA 2ZGXH 1TRMA 1Z6JH 1MKXH 3M5LA 1GBIA 1Z6EA 4THNH 5HM2A 1O31A 2KFWA 1AWHB 4ISLA 1C5WB 1SQRA 3DCLA 4ABAA 2A4QA 2D8WA 1PPFE 3B8JA 3M35A 1SGTA 1TGTA 4JMYA 4BTIB 1FY3A 3BV9B 3IITA 1BMAA 3KEEA 1HJAC 3SV8A 4KTUA 3K9XB 1GDUA 1PPZA 2KCYA 2OK5A 1V2OT 2FLRH 4JYVH 2P3UB 3QX5H 5DGJA 3ZVCA 5C5OA 3U8OH 2GT8A 2H1UA 3M7QA 4AB8A 1AMHA 1L0ZA 3PMHB 3SV2H 4AYVB 5E0GA 3BEFB 1YPHC 3E1XB 1P57B 2WPIS 4Q4LA 2OBQA 4ZUHA 1WTGH 6GCHG 1KSNA 2JETB 1VCWA 4NG9H 3MYWA 3LGWA 1Y8TA 3A8DA 1LPZB 3VXFH 3H5CB 1AWFH 1LMWB 3ZZBA 1CBWC 1OWJA 1O30A 3T25A 1WBGB 2YMSB 1S81A 2XNIA 1YC0A 4M7GA 4O9VA 4I32A 2QXIA 2G81E 3LC3A 5AF9H 2BQ6B 1GBAA 2EI7A 2F9UA 2YMSD 1RJXB 4IN2A 1C1MA 1UVPA 2IJD1 1D3DB 4Y79A 1KXBA 2YNAA 1G2MA 2KM0A 3RXSA 3U1JB 1NS3A 3OY5U 2W5EA 1EZSC 3SUDA 3RU4T 1FLEE 3KQDA 4NIVA 5FAHA 1UCYK 1FY1A 2BQ7B 4AZ2B 5JB8S 1WXRA 1ETRH 3SUGA 3UIRA 1AFEH 3ZV8A 1RS0A 1ZZZA 1XUGA 1UK2A 4OS7A 4ASUD 1EJNA 2EY4C 2FYRA 1GJ5H 1RXPA 4X1PU 1BHXB 1SSXA 1NPMA 1A61H 1XUIA 3TIUA 1AO5A 4A1VA 3MH6A 3PV5A 1UVSH 3F2GA 1C5QA 4IC5A 2SGPE 4K2YA 3QK1A 1BTZA 1CGIE 2HRVA 3A8CA 2OQUA 1V6DA 1S6HA 1C4Y2 3NWUA 2XBWA 4ABJA 3E16B 1SI5H 2FOMB 1GCDA 3I29A 1UK4A 2XW9A 4SGAE 2Z3DA 3A7XA 2A5AA 2NU2E 3DA9B 1P3CA 3CP7A 1Z8RA 1KMHB 1MD8A 5GJ4B 1ZTLA 3GY2A 4Y7AA 3PRBA 3BTDE 2WPMS 2ZCLP 1SQTA 3GCHC 2FOAA 3F9HA 1O2LA 1GMHF 2Y7ZA 6CHAC 1F0TA 1UTPA 1WYKA 2GP9B 4TT3D 1MU8B 4GVUA 3AK5A 4ASHA 1BRUP 2XCFA 4NIWA 3LGUA 3S7KB 1D3PB 1SFIA 3ZZ9A 1EB1H 5EG4A 4JCNA 4GCHF 3M37A 3MU5A 5CE1A 1Y3UA 1SOTA 1HFDA 2WZQA 1NBME 1P2QA 2KCPA 1O2OA 1MU6B 2FLBH 1TB6H 4UFDH 4FETA 3STJA 1UW7A 1GBJA 1G37A 2J38A 3RXUA 4BAKB 3GDUA 3MH7A 1GMCF 4B2BA 2G8TA 1YPHE 1AB9B 3AASA 1RFNA 2W3KA 7ESTE 1BTUA 3OE7D 3UFAA 2PFEA 5IYTA 4K8YA 4ABHA 3PWBA 1LVYA 4J2YB 4NIYA 4ZHMU 3WY8A 1NU7B 2AIPA 1MZDA 2H9TH 2ZFQH 3R0FA 2Z9JA 3M36A 4I33A 1MKWK 3TJVA 1ZSLA 2L74A 1DLEA 4AFZA 1IOEA 4JYTA 4J1YA 1XXDA 1TX6A 5C20A 1GG6B 1F2SE 2VIWA 2J9NA 2HPPH 3PMAB 1A4WH 4KTSA 1ELGA 1FDPA 4UFGH 1A0JA 1OWDA 1KXCA 1NY22 1P04A 1SLUB 2R0KA 1KDQB 1G36A 1TGBA 2C8WB 1WQVH 1DUAA 1O3HA 1AFQC 4IMQA 2GJGA 1O5EH 2GV7A 3SV6A 1ANDA 1TPAE 3FOAA 4ZHAA 2PSYA 2OP9A 5CMXH 5C3NA 3M61U 5F03A 1GBFA 1K9OE 1LO6A 1THPB 4ZCNA 3C27B 4CHAB 2GTBA 1XVMA 2RCEA 1QB6A 4MPXA 1EB2A 2ZGJA 2Q6FA 4CRCA 4YT6H 5C1UA 3A7ZA 3LJJA 4MNWA 2ZHFH 2SNVA 1LKBA 1LPKB 4DVAU 2ZTZA 3DFJA 2CF8H 2KAIB 3U98H 1FV9A 2KCAA 3SU5A 3T5FH 3PO1B 3UR9A 5EPYA 1XUJA 3BTQE 1HJ9A 3AW0A 3UAIC 3MTYA 4DIIH 1P02A 2OXSA 4X2WA 1O5BB 1Q31A 3UREA 1THSH 1LHCH 3A87A 2G4TA 1P2IA 1UTKA 1SGRE 2WSSD 1C5SA 2J94A 4D7FA 5EXLA 3DHKH 2WV5A 3KQBA 1THRH 3BN9A 4Q7XA 2VWOA 1T8MA 3N7EA 2UWLA 2XC5A 5GIBA 2W26A 2STBE 1C5PA 1QBVH 2FIRH 3E8LA 3ODFA 4A92A 3GYMA 2BY7X 1H8DH 7GCHG 5L2ZH 1V2TT 1E0FD 1G9IE 3FZDA 4OS2A 3PLPA 1O2HA 2FX4A 2ZECA 2ZEBA 5E0JA 2BXUH 1QGFA 2G52A 2OCVB 1GDNA 4UFFH 1SC8U 4MTBA 3EQ0H 1BJUA 2H5DA 2SFAA 4E05H 5A8XA 1OYQA 2ESTE 3OTPA 4CRFA 3MO3A 4X1RU 1DE7H 3UWJH 1O2SA 3MO6A 4D76A 1Y5UT 4MDSA 1K1PA 2VIDA 4WH8A 3TJOA 2RDEA 1UTQA 3E3TA 4BTUB 1NM6A 1AVXA 3BTGE 1GCTB 4F4OC 1TBQH 3H09A 5L2YH 2A4OA 4FUGA 1LQDB 2ZHWH 1FJSA 1AKSA 1BTWA 3MH4A 4NA9H 4ABFA 2Y82A 1V2UT 1HRTH 2XNDD 4DCDA 1GMDG 1A3EH 3SNAA 1AE5A 3TK5A 2ILNA 5T6DA 3CENA 1G3EA 6GCHF 3BTHE 5KEDA 3GY7A 2XTTB 2PUXB 4LOYH 1GJBB 2V3MA 1CT2E 1QA0A 1YBWA 2BD4A 1O5AB 2BOKA 1BMFD 2GMTB 2ZNKH 5C1XA 1CVWH 3A82A 1BMLA 1SMFE 2EC9H 3S9AA 5FPYA 2GX4A 4LZ4B 1GHXH 2ZG0H 3ZVFA 1JWTA 4FOUC 3A7TA 1EOLA 3F3BA 1V2LT 5GCHF 1MCTA 5C5NA 4OS6A 1T4UH 3LH1A 1EAWA 1AGJA 4NZLA 1O2JA 5KECA 1Y5BT 1OPHB 5SGAE 5DKMA 1LHDH 2HLDD 4JK6A 1CT4E 2H9HA 2ZCHP 1FN6A 1QJ6B 4BAQB 4I86A 4B71A 2OC7A 2W7UA 2C8XB 4WH6A 1TQ7B 2OUAA 1COWD 1GBHA 1IHSH 1Y3VA 4Y7BA 2GZ9A 3OSYA 3I78A 3TPIZ 1PPEE 3TVJB 5I46H 4Y8YA 4E7NA 4UFEH 1ZGIA 3MNSA 4XFQA 5EXNA 2YOLA 4BAMB 5FX5A 2UUJB 2BD2A 1OP8A 1K1LA 2IOTA 4BTTB 3GY6A 1O2PA 2R3UA 4JZFH 1UJ1A 5E8EH 4WJG2 3DT0H 1MCVA 1O33A 2A5IA 2A7JA 2QN5T 5FBIA 1UCYE 2KCOA 1BRAA 4UEHH 3SHAH 1TOMH 4D9QA 4IN1A 4X6PA 3RXEA 3MNCA 1ESAA 3NZIA 1GDQA 2V3HH 2Q6GA 2RA3A 2JETC 2G00A 1Z1JA 1C1VH 3UUZA 4I8HA 3U8TH 1KLIH 4CRAA 2BOHB 2AMPA 2J34A 3BTFE 1NFXA 2JH0D 5DSFA 5JBBS 2YMSC 5A8YA 3ZYEA 1ETSH 2Z7FE 4X8UH 3P17H 2ZGCA 1OP2A 3F2HA 4ZH8A 3P92A 1L2EA 2VVCA 4AGJA 2UWOA 3DSPA 1WUNH 2J95A 3RXAA 2BZAA 3PMBB 2M5TA 4XD7D 3M7UA 3F1SB 1C2IA 4ZMAH 2FOGA 5KGOA 1IQNA 3SO3A 4FU8A 2M2AA 3TH4H 2BVSH 2YNBA 1HXEH 1C1TA 1FPHH 3NXPA 2PGQB 2BB4A 3SYJA 3GY5A 4UONA 2WUCA 5A0BA 5FCKA 1YM0A 1SR5C 2VH0A 1BRBE 3GS9A 1S6FA 2HOBA 1TMUH 1SBWA 2STAE 4H42U 4K5ZA 1GGDB 3ZZ8A 3TH3H 2AHME 5J4SA 2FOBA 1HAVA 3L33A 4B1TA 4MPWA 4Q80A 1A3BH 5GNDA 4K1TA 2XCNA 1EP6A 1KLJH 3KGPA 1QQ4A 2GZ7A 3PTNA 1ABJH 2JDID 2Y81A 1DOJA 1GBMA 1OWEA 5DP7A 1O2XA 2WPLS 2GV6A 1KTTB 1RTKA 3A85A 4OGYA 3A86A 2RFKC 3LPRA 2D1JA 1E1QD 4CRDA 2ZGHA 2K0QA 2A4RA 2VWNA 5G4BA 3SQHE 1WSSH 4X6NA 1ANCA 3TNSA 3UOPA 1W14U 3B23B 1C5NH 2FO9A 4GPGA 1MAXA 3F0OA 1KDQA 2Z3EA 1NROH 3ZIAD 1DY9A 3HK6B 2BY8X 4Z6AH 3LGIA 2WPHS 3EA8A 1NN6A 2PLXA 4LXBH 3RC4A 5CHAB 2BD8A 1O3IA 2FM2A 2AYWA 3LGYA 4BANB 2A32A 4UDWH 2A31A 2Z9KA 1Z8JB 2LPRA 2GZ8A 1GBCA 3W1EA 4B6FA 1C2KA 1O2YA 1YPKH 1GL1A 2PKSB 1GI2A 1SHHB 1P10A 2Y80A 4Y0YE 3RU4E 5IDKA 4Q2KA 2WUBA 1TYNA 1S0RA 4AG1A 2XBVA 2KAIA 1U6QA 2F9OA 2F91A 1AB9C 4X6OA 3O8RA 4YESB 1HUTH 1SGDE 1E34B 1O3FA 3GY3A 1C1PA 3P8GA 1KXEA 3RXHA 1HAIH 1GBKA 2BDYA 2HNTC 3TITA 1O3GA 4XBCA 2Y5FA 2H2ZA 1P2JA 2THFB 3QUMP 2BD7A 2D26C 5E2PA 5DP4A 1QFKH 1EP5A 1UTNA 4K1EA 4B2AA 2BHGA 3RXMA 1GG6C 1T32A 3KQEA 2A4GA 4TPIZ 4TPYA 3OAAD 3URCA 3LKWA 5LGOA 4RT1A 4ESTE 3BTKE 4CBNA 4B73A 2QE7D 1O34A 1SHYA 2NU1E 1ETTH 1P12E 1FXYA 2IN2A 2QIQA 3LDXH 1S6LA 4MG3A 2PSXA 1QHRB 3VPKA 1UVUH 2PTCE 2R3YA 4TWWA 1ZHPA 1ORFA 1OWKA 4BAOB 2RDLA 2ZIQH 1JRTA 2FTMA 2GT7A 3NCLA 3V13A 1TOCB 2RA0A 2C90B 5F8ZA 1HLTH 2BQWB 2FXRA 3ATMA 1WU1A 2BY6X 4JZDH 4R0IA 2AGGX 1P09A 2EQNA 3MI4A 1AKSB 3ATKA 3KYFA 1ELDE 1GMDF 2PUQH 1ZMNA 3PO1C 3QN7A 1TNLA 4VGCB 4XBBA 3TJNA 1QY6A 3SJKA 3EGKH 1CA0B 2A2XH 2TIOA 2VJ1A 2ODPA 2WPKS 1S84A 1UO6A 1GL0E 3BTME 3FP8E 1FAKH 1PQ5A 2KZ4A 3SI3H 3BG8A 1FMGA 1VCQA 1AUJA 5HXFA 1YLNA 3BIUH 1GI9B 3NKKA 3KYGA 4H6SB 5EQQA 1GHWH 3HGNA 3ZZ4A 3BG4B 1TMTH 4Y76A 2L6OA 1YYY1 3GCOA 1A7SA 3MU4A 4GAWA 2XC0A 5C94A 4MNVA 1GJ6A 1EUFA 2G51A 2Z9GA 5CDFE 2BDHA 2OC1A 1GI3A 1NESE 1WQSA 2Y6TA 1W12U 4Q7ZA 3LT3A 8LPRA 1FI8A 5HGGA 4AFUA 1GJAB 2J5UA 3CS7A 3A7VA 3TK9A 1EOJA 1YCPH 3F0PA 5JYIA 5GCHG 4DGJA 3LH3A 1GJ7B 2ZDNA 3WWBA 1K1MA 3LOXA 2A7HA 2GCTC 1DXPA 2AIQA 3PYHA 5E0HA 5EOKA 4Y10E 1RD3B 2CHAB 3EYDA 1V2KT 3SHCH 3A83A 5EJLA 1P05A 2W7SA 5FL7D 2QCYA 5EPNA 1HCGA 3U28C 3RMMH 2OTVA 4X8SH 3NK8A 1XX9A 1GCTC 4NCYA 2KR7A 1MQ5A 2HNTE 1O3KA 1YP9A 2QA9E 1SLVB 2O8TA 2A5KA 3MO9A 3MFJA 4WXIA 1SGQE 3KQCA 5TCCA 4DT7B 2F9NA 1QCPA 4ABDA 3GCNA 1PQAA 4XBDA 3SORA 2ZHEH 2VWLA 2ANMH 1DX5M 3VGCB 1LVMA 4JZ1A 3ZZ3A 3QWCH 1JBUH 1F7ZA 1QJ1B 3EA7A 1QRWA 2GMTC 5DN6D 1Q3XA 3NRLA 2ZU2A 3M3TA 3TU7H 5F53A 1ZRBA 1C5OH 3BSQA 1TGSZ 4X0WU 5DP5A 5L30H 4WMEA 1W11U 3F2FA 4F55A 3MU0A 4KP0A 1SLXB 3FZZA 2GGVB 2OC0A 4IS5A 3LC5A 1F5KU 3RXQA 5EQSA 3ZVGA 5B6LA 2H5CA 1IHTH 1F0RA 3TLOA 1TABE 4DOQA 1AUTC 3ZYDA 2ZU4A 1G2LA 5C0TA 1TE0A 1TLDA 1P0SH 4LZ1H 1N6XA 4WWYA 1C1RA 1V2MT 2CV3A 1AVWA 2ZDVH 1F0SA 4YZUA 1HAVB 1FIZA 1K1OA 3ZVEA 6ESTA 1W3CA 1DUEA 2NWNA 2A2QH 3LIWA 1NU9A 3KHVA 4X8TH 2ZP0H 3UR6A 2TGPZ 3N7DA 1TFXA 4ACAA 3PTBA 2EEKA 3PM3A 4HG6A 4FUCA 1CU1A 1VJ9U 1VCPA 1W2KH 3RMOH 5AHGH 1SGCA 1OXGA 3KIDU 2ZDLA 1K1NA 1BUIA 3OYPA 1W10U 1OS8A 4B6EA 1O32A 2KX4A 3L6PA 4YOIA 2WINI 1QTFA 4Z1MD 1EAXA 5AFZH 1UCYH 7KMEH 1LPGB 4OGXA 5EJZA 1V2QT 3S9CA 3A7YA 2FOFA 4XE4A 3VB3A 1RIWB 4FUJA 4BNRA 4ABEA 3RXFA 3HPTB 4TY6A 2BDIA 1O0DH 1RTLA 3DD2H 1IQMA 1IQKA 2Z9LA 3FKSD 2ZFFH 4E06H 1ELAA 3OFND 4AFSA 1GWAA 3BTWE 1HIAA 5DJ7A 1C2FA 4A5TS 2SGFE 3SNDA 5JPMH 2BDGA 2Z94A 1O2KA 3P8OA 3DFLA 4B74A 3LU9B 1NC6A 1C1WH 2PKAB 4DG4A 2FDAA 1E35B 1NRQH 1BMNH 1KXFA 4NIXA 3RMLH 5C17A 4ISHH 4MNXA 3MH5A 1UVOA 1ZPZA 3FANA 1K22H 1O2RA 4A1TA 1A0HB 1C1SA 3ODDA 1SOZA 4DY7B 2CMYA 1C9TA 3A8AA 2FI3E 2K1QA 4KTCA 1KY9A 4NSYA 3RC5A 1W0YH 1QQUA 4U2WA 1AE8H 1TMBH 3GCTG 1W0JD 1FQ3A 1SFQB 3K6YA 5ESTE 8GCHG 2J98B 3TGJE 2BYAX 4CRGA 3VB5A 1NBMD 1WDIA 1DM4B 1BB0B 2P8OB 4B76A 2FWWA 2QYIA 1D6WA 1F5LA 1ELFA 2ULLA 3VB4A 1ZOMA 4ISOA 1TPSA 3QGJA 1DPOA 2B7DH 1HB0B 2Q6DA 3SBKA 1A5GH 2CGAA 3PB1E 8ESTE 1EZUC 1PYTC 2UUKB 5F8XA 5CHBA 5HMAA 1P9UA 3A84A 2PKSC 2F9VA 2P16A 2G5VA 2TGTA 2QF0A 3VXEH 3SU3A 1DSUA 2OBOA 1C2EA 2VIQA 1JIMA 5DPAA 3BEIB 1PJPA 3RXKA 1MKWH 1H8HD 2PHBA 3HGPA 1NO9H 2VVVA 4CH2B 1O5FH 1GVZA 1SL3A 1GBLA 3SGAE 2SGAA 1SQAA 3MHWU 1T31A 2UWPA 1G32B 1ZTKA 2O9QA 2AERH 1YPJH 1O5DH 1KTSB 5A09A 4INKA 2C8YB 1MD7A 1C5TA 1JOUB 3GDSA 4JK5A 5A0CA 4BXWA 3E90B 3RXCA 1EJMA 3ZVDA 1GI0A 3ESTA 1D4PB 2BDBA 3SJ9A 3UB0A 1W0ZU 3RP2A 4ZHLU 2EI8A 1NFYA 1XUFA 1Y3YA 2A7CA 1Y5AT 3K65B 3MQKC 4BXSA 4X8VH 5AFYH 3S7HB 5FPSA 4H4FA 4MNYA 3SOSA 1K21H 1V2ST 3T29A 2A45B 3LGTA 4ZXYH 2P93A 1ZMJA 3N99A 1KLTA 1EASA 2ZFRH 1A1RA 1CGHA 4YLUA 1GI8B 1XUHA 1SGNE 4Y71A 3MOCA 1LKAA 5T6FA 3RM0H 2SGEE 3MU8A 1O3OA 3QZRA 3BTEE 3URDA 1ELTA 2QXHA 1MTWA 9LPRA 1GBEA 1D3TB 4IBLH 3MU1A 1O2TA 4HTCH 1VITH 1T8LA 6CHAB 1CGJE 2ZFSA 3STIA 2BTCE 3KL6A 1CA0C 5ETXA 5DK1A 1XKBC 3FN8A 1AZ8A 1Y59T 1T8OA 3OU0A 1EFRD 2PW8H 4UD9H 1SB1H 2NU4E 5JB9S 1O37A 1ELVA 3VFEA 3AAVA 1IQHA 3BG4C 1S0QA 3EE0B 2ZDKA 5T1VA 2VBCA 2WYJA 1H8ED 6LPRA 3P8NA 1EPTB 1C2LA 5K0HA 1C5ZB 1GBTA 5B6OA 2G55A 2PGBB 2VWMA 3LGVA 4TSFD 3BF6H 1YKTA 3TGKE 1MQ6A 3OY6U 1XXFA 3PV2A 2SNWA 1GVLA 1ESTA 2C4FH 1HYLA 1EX3A 4MQAA 1FY8E 1CHOF 2J97A 4I8GA 2OD3B 1SGIB 2HALA 1OSSA 2CHAC 2F9PA 2P59A 2XBXA 1J15A 1O2NA 1NFWA 3T26A 1PPHE 3DSOA 1O3NA 1UK3A 2UUFB 3VB6A 4CRBA 3TNTA 4JZIA 3RXVA 3Q3KA 4YOJA 1BBRK 1KIGH 1OYTH 4YOGA 5A2MH 2RG3A 1Z7KA 5GPIB 3GICB 1CQQA 1MTNB 1P03A 2LP6A 3CS0A 3W94A 4XSKU 4IC6A 3RXLA 1ELBA 1Z8GA 1E1RD 1FUJA 5F6MA 1JXPA 1MKXK 1IQJA 1SQOA 1G3BA 1CE5A 3IG6B 2GDEH 5FCRA 5T3HA 2R9PA 1OP0A 1AZZA 2FOHA 4ZXXH 1VJAU 1UHBA 3F9EA 2BLQA 1S85A 3SJOA 1BA8B 4SGBE 3SUFA 1O3DA 2ZQ1A 1FX0B 1B7XB 1RTFB 1VR1H 5TJXA 2P95A 3Q77A 2TGDA 1LTOA 1ARCA 1SGEE 2ODYB 4HZHA 4O97A 3U69H 1QBOA 4FU7A 1B0EA 3ZZ6A 4FVDA 4RSPA 3NPSA 3M5MA 2TRMA 1DWEH 1INCA 2VGCB 1O39A 1HIAB 1PPCE 3UNSA 1D9IA 3QZQA 3E0NB 4FUBA 3T2NA 4RT0A 5I25A 4I8KA 4U32A 2ALPA 4RN6A 1C1QA 2F9BH 4OM9A 5HYOA 2XC4A 1F5RA 1KYNA 1LVBA 4LK4A 4XOJA 4NFEA 1UMAH 3KN2A 3OX7U 4DW2U 1HNEE 1OOKB 2ZU3A 2HPQH 2QF3A
chains in the Genus database with same CATH topology
1C1UH 1O2WA 3ATWA 4NFFA 5LPEA 2IJOB 3F9FA 3U1IB 2TBSA 5GXPA 2FX6A 1AQ7A 5GDSH 3E6PH 1ZJDA 2PKAA 4I7YH 1YLCA 1FN8A 1OWIA 2B0FA 5BRRE 2BVRH 2QC2A 4I31A 3C1KA 2XYAA 3GCTF 8GCHF 5ABWA 4R8TB 1C2JA 1UVTH 1HAZB 2VIOA 4WMDA 1PQ8A 1Z8IB 1TA6A 3ZZDA 3ZZCA 1BTXA 2A0QB 3H7OA 1TRYA 5A0AE 3K2UA 3SV7A 4X2YA 1O3PB 1W8BH 2Z3CA 3A7WA 1C5YB 1LVOA 1UTOA 1Y3XA 3OTJE 4CHAC 4INHA 3RXJA 2ODQA 5PTPA 1M9UA 1RIWC 2GD4B 3M5OA 1L1GA 2VNTA 2I6SA 4B75A 3VB7A 1V2RT 3A88A 1GHYH 3QGNB 1E36B 1QIXB 3HATH 4FVBA 1VGCB 2HNTF 1C2DA 1O2UA 1P2NA 1A5IA 3PLBA 4Q7YA 1FZZA 2Z6BD 1IQEA 2QGRA 3HK3B 4MPUA 4Z0KA 3Q3XA 2GCHG 1QBNA 2ZHDA 3MWIU 1BITA 1EAIA 3V7TA 2GKVE 1K1IA 1V2VT 1DWCH 3IWMA 2ZCKP 4K60A 2ZI2H 1K1JA 3SNCA 3HKIB 1XUKA 1NT1A 3Q76A 1J17T 2CXVA 1O3BA 1H9IE 2BZ6H 3UY9A 1TNJA 1Y3WA 2O8WA 5EQRA 1O3CA 4YT7H 3ZZ7A 1QURH 1BT7A 1QRZA 2V0BA 1DANH 1P2OA 1QJ7B 4UE7H 5ESBA 1IQFA 1E37B 4RKJB 5FX6A 5H4IB 3TJUA 3DUXH 4A7IB 2XWBI 3ATLA 1GVKB 2AEIH 1V2JT 3EAJA 3MNXA 2P8OC 4O03A 4AOQA 1TBZH 2ZQ2A 3UTUH 2J92A 1ELCA 2PR3A 3SGQE 2BMGB 3RU4D 2GVFA 2OQ5A 1W7XH 2P3FH 3A81A 1TIOA 3EDXB 1C5UA 4OS4A 2ASUB 1T4VH 5EU8A 4NWLA 3O8CA 3SGBE 1YPMH 1CO7E 1FY4A 3LONA 1G3CA 1WTHD 2Q1JA 4ZAEA 4YO9A 5LPFA 1MAYA 1ESBA 4IGDA 3T62A 4X1QU 1H4WA 1EXFA 2B5TB 1AN1E 1CHGA 1JMOH 1FIWA 4YTAA 4BOHA 2DUCA 3SI4H 5EW2H 2HLCA 1G30B 2ZFPH 3A80A 3P6ZB 1BMMH 2J4IA 1OX1A 3SQEE 1EZQA 3VEQB 1IAUA 1E38B 1HXFH 2WV4A 2BLWA 1FY5A 1BTPA 1Z1IA 4DURA 4ABGA 2A1DB 1TPOA 3LJOA 1T8NA 1O36A 1MMJN 3QDZB 2Y5GA 4ZKSU 1C5MD 1K2I1 4K3JA 1K28D 4D9RA 1N1LA 3D62A 4QT8C 2HVXA 1ZSKA 2OC8A 4AFQA 1UTJA 2C93B 1NTPA 1QL7A 1RRKA 3JZ2B 1EPTA 4TYDA 2R2MB 1YF4A 2C8ZB 3RMNH 1ID5H 1YPEH 2AH4X 1UTMA 1O3EA 2VH6A 1LQEA 2WPJS 3RXRA 4NZQA 1AD8H 1ZRKA 1CA8B 1DFPA 2XXLA 5FBEA 4NWKA 2ANYA 2QY0B 1GJ8B 4ABIA 1ANBA 5FPTA 1BTYA 3UNQA 3MMGA 4WXVA 4X6MA 3M3SA 3TGIE 5DO4H 4Y8XA 1VZQH 2QAAA 5HM9A 3N7OA 1A0LA 1S82A 1CHOG 2HGTH 4A1XA 4ISNA 1KXAA 4D8NA 4BAHB 2FI4E 1GPZA 1YLDA 1EAUA 3RXBA 4AORA 2G4UA 2F83A 1GBBA 1A46H 1YCPM 5JBTA 4TWYA 1V3XA 2ANWA 1C2MA 3P95A 5DG6A 2R2WU 1QNJA 2BD9A 2BX3A 1BBRE 1TALA 1NRPH 4X2VA 1UHBB 3RXTA 1DY8A 3SU2A 2OLGA 3PV4A 1HAOH 1DICA 1HDTH 1ZSJA 1MH0A 3L3TA 3G01A 1EPTC 4FUDA 4DJZB 1N8OB 3R3GB 1TGCA 3PWCA 1C1OA 1SVPA 1XMNB 2Y5HA 3H7TA 1PQ7A 5EODA 1O38A 2VIPA 1GJDB 3HKJB 2FMJA 1FNIA 3QTVH 2FP7B 3K6ZA 4CR9A 1VITG 3Q00A 2AGEX 2NU0E 1TNIA 4D7GA 3ZVBA 4YM9A 3UQOA 4ZKOU 1DXWA 3F9GA 4DIHH 1J8AA 3SU1A 1C4U2 3UPEA 3O8DA 4Y8ZA 1O3JA 5L6NH 4O3TA 5BPEA 2UUYA 1DLKB 1GHBF 1ELEE 3FAOA 3E0PB 4ZKRU 1EKBB 3AW1A 1LHEH 2FTLE 1GGDC 2D2DA 4PROA 1F92A 7LPRA 1GHAG 2P94A 3RXPA 2BD5A 3SW2B 2O8LA 2H6MA 1ANEA 1FPCH 4I8JA 2FI5E 1MTNC 4U30A 1ZMLA 3O8BA 1B5GH 1GHZA 1C5VA 2FZZA 2FESH 3SZNA 1GI5A 3T28A 1X7AC 1DT2A 1TRNA 1O2QA 1BJVA 4CREA 1WCZA 2ZTYA 1HJAB 1XVOA 1S5SA 1HAYB 1MTUA 3RXIA 3SNEA 1JRSA 2XRCA 3V3MA 5LPRA 3ATIA 4RKOB 5LH8A 2BVXH 4X2XA 3ZZ5A 4K8BA 4CR5A 4KELA 3SJ8A 2AFQB 3EA9A 1C2HA 1LHGH 4HGCA 1YGCH 1O2MA 2WYGA 3ZV9A 4NA8A 2V3OH 2FS9A 1V2PT 1HPGA 1TGNA 3FFGA 2FPZA 1TBRH 3A8BA 3SU4A 1PPGE 5CHAC 3M3VA 1CSOE 1LDTT 3KNXA 3UNRA 2FOEA 3JZ1B 1TAWA 1QRXA 2CF9H 5J4QA 2VGCC 3MNBA 1BQYA 1CBWB 2JH5D 2ZF0H 4GHQA 3TK6A 1O5CB 2GCHF 1L4ZA 2ZWLH 2ALVA 1SLWB 2FS8A 3T27A 3F6UH 2Y7XA 3UOUA 5DP8A 4CBOA 3SN8A 2BY9X 1HJ8A 2JKHA 4FUFA 1P2MA 2BLVA 1Q2WA 2H9EH 3PLKA 1HAHH 1O5GH 2QV1A 3S69A 3V12A 2B9LA 1P8VC 2GCTB 4NA7A 4K1SA 3RC6A 2GDDA 1PPBH 4GLYA 4NGAH 5TCAA 2FOCA 4Y6DA 1HBTH 4ISIH 4Y11E 3KCGH 4WVPE 1ZYOA 2JH6D 1D6RA 3M7TA 4WMFA 1EATA 1HAXB 5C67A 4WF8A 3BIVH 5GWZA 4AGKA 3S9BA 1NRNH 2ZA5A 1MUEB 3UQVA 2FEQH 1IQGA 1FAXA 1ZTJA 3BEUA 1G3DA 3SV9A 3QLPH 1MBQA 2PWXA 1N6YA 2ZKSA 4HFPB 1EQ9A 1H1BA 1L4DA 1J9CH 1ZR0A 1O2VA 4GSOA 1GJ4H 2TPIZ 2PTNA 2J2UA 3FP6E 2QXGA 2LNCA 3ZZAA 1PFXC 3RXGA 4WY3A 2BD3A 1W7GH 3D65E 2ANKH 2BDAA 2HWLB 5AVDA 1KXDA 2AMDA 1AIXH 1Z71A 3SJIA 1AHTH 1SGFG 2VB0A 1BRCE 2DE9A 1H9HE 3GDVA 5DP6A 1DITH 3GCHB 1VGCC 2ZPSA 5FHTA 2EI6A 2TGAA 1XM1A 4MPVA 1ABIH 4VGCC 1HGTH 1DSTA 2ZU1A 3V0XA 2BLOA 2IPHA 5FXLA 1O2ZA 1TWXB 4FUHA 2Z9IA 1HV7A 1S83A 4KGAA 3ELAH 1CT0E 1RGQA 4HI3A 3E91A 3AAUA 2FYQA 5F8TA 2QXJA 3RXOA 1BIOA 1GI4A 1SGYE 1GI7B 1V2NT 2V6NA 2ZHQH 2BX4A 1HAGE 1TX7A 2F3CE 4H6TA 3A89A 2ZPQA 4FU9A 1H9LB 3NUMA 1J14A 1L1JA 1XKAC 4AG2A 2B8OH 1HAPH 1IQLA 1QR3E 1ACBE 1MTSA 1TA2A 5JBCS 2XWAA 4K69A 4X1SU 5EW1H 1WV7H 3SUEA 3QTOH 1NZQH 3FP7E 1GBDA 2ZZUH 4ZROA 3PROA 1T7CA 3RUOA 1P11E 3GY4A 3GYLB 4FUEA 4A6LA 4AYYB 2VIVA 2OINA 1EJAA 3SNBA 1ZHRA 1BOQA 1AFQB 1BDAA 1DWBH 2DE8A 3M5NA 4X1NU 1WOFA 1MTVA 1MZAA 3ZVAA 2R0LA 1AU8A 2ZTXA 5E2OA 2BY5X 1A5HA 1GHVH 4ZKNU 4CH8B 5JDUB 1QB1A 3RLYH 4JYUH 3RDZA 1SPJA 1SG8B 4YLQH 5DP3A 1W13U 1F0UA 1GMHG 2P3TB 3AVZA 1BZXE 1P06A 4B2CA 1TNKA 2W3IA 4FUIA 4INLA 9ESTA 1C1NA 4AB9A 4FXGH 4GHTA 3VGCC 2CN0H 1YPLH 1O3MA 2VVUA 4GCHG 1B0FA 5DP9A 5C1YA 1BTHH 5A8ZA 3RLWH 1OKXA 3D49H 1ARBA 1FONA 1WAYB 1VITF 1ZLRA 1O3LA 3I77A 1V2WT 1GJ9B 4E7RG 1NRRH 1C5RA 1TQ0B 2ZO3H 1NRSH 2O8MA 1GMCG 3B9FH 2ZFTA 4MLFB 1GI1A 1C2GA 5C2ZA 3FVFB 2VU8E 1DS2E 4GUXA 4JZEH 1NFUA 1TPPA 1OWHA 1BHXF 3UWIA 1P01A 1BCUH 1C4V2 1C5LH 1JIRA 2ZC9H 3D23A 4OS1A 1EZXC 1P3EA 3S0NA 1QL8A 5EXMA 2C3SA 1LCYA 2I6QA 2O8UA 1GHAF 1GJCB 2SGDE 1H8IH 3TH2H 1YPGH 1DWDH 1O35A 1ZGVA 3RXDA 5T6GA 1IQIA 3GOVB 2BDCA 3GY8A 2FODA 4NSVA 1TONA 2AS9A 4OS5A 1GHBG 1QB9A 2ZDMA 4IW4E 4U01A 1D3QB 1GI6A 2ZGBH 1P9SA 1LHFH 1UTLM 1YCPK 1O3AA 2EA3A 3ENSB 3SU6A 3U9AH 4AX9H 1L1NA 1PYTD 4AN7A 1AI8H 5K7RA 1AVGH 1SGFA 3QO6A 4I8LA 1MBMA 4XDEA 4Y0ZE 1ZHMA 1QL9A 2ZPRA 3U8RH 3SU0A 2AMQA 1N8OC 1C9PA 2V35A 5JBAS 1TNHA 7GCHF 4F49A 2PV9B 2AGIX 5EGMA 4MVNA 2NU3E 3P8FA 4IMZA 2CJIA 3GISB 3P70B 8KME2 1O2GH 1O2IA 1ZPBA 2BM2A 1ZPCA 2ZU5A 1P2KA 2ZDAH 3BTTE 3W95A 2SGQE 1J16A 1SGPE 1DDJA 1AY6H 1BBRH 1TX8A 3ITIA 1TNGA 2G5NA 3PMJA 2XBYA 1C5XB 3F68H 3KF2A 1QA7A 4TY7A 1A2CH 4O3UA 3Q3YA 1DVAH 4ABBA 2BXTH 3RM2H 2VINA 1ZJKA 4KKDA 2ZGXH 1TRMA 1Z6JH 1MKXH 3M5LA 1GBIA 1Z6EA 4THNH 5HM2A 1O31A 1AWHB 4ISLA 1C5WB 4ABAA 2A4QA 2D8WA 1PPFE 3B8JA 3M35A 1SGTA 1TGTA 4JMYA 4BTIB 1FY3A 3BV9B 3IITA 1BMAA 3KEEA 1HJAC 3SV8A 4KTUA 3K9XB 1GDUA 1PPZA 1V2OT 2FLRH 4JYVH 2P3UB 3QX5H 5DGJA 3ZVCA 5C5OA 3U8OH 2GT8A 2H1UA 3M7QA 4AB8A 1AMHA 1L0ZA 3PMHB 3SV2H 4AYVB 5E0GA 3BEFB 1YPHC 3E1XB 1P57B 2WPIS 2OBQA 4ZUHA 1WTGH 6GCHG 1KSNA 2JETB 1VCWA 4NG9H 3MYWA 3LGWA 1Y8TA 3A8DA 1LPZB 3VXFH 3H5CB 1AWFH 1LMWB 3ZZBA 1CBWC 1OWJA 1O30A 3T25A 1WBGB 1S81A 2XNIA 1YC0A 4M7GA 4O9VA 4I32A 2QXIA 2G81E 3LC3A 5AF9H 2BQ6B 1GBAA 2EI7A 2F9UA 1RJXB 4IN2A 1C1MA 1UVPA 1D3DB 4Y79A 1KXBA 2YNAA 1G2MA 3RXSA 3U1JB 1NS3A 3OY5U 2W5EA 1EZSC 3SUDA 3RU4T 1FLEE 3KQDA 4NIVA 5FAHA 1UCYK 1FY1A 2BQ7B 4AZ2B 5JB8S 1ETRH 3SUGA 3UIRA 1AFEH 3ZV8A 1RS0A 1ZZZA 1XUGA 1UK2A 4OS7A 1EJNA 2FYRA 1GJ5H 1RXPA 4X1PU 1BHXB 1SSXA 1NPMA 1A61H 1XUIA 3TIUA 1AO5A 4A1VA 3MH6A 1UVSH 1C5QA 4IC5A 2SGPE 4K2YA 3QK1A 1BTZA 1CGIE 2HRVA 3A8CA 2OQUA 1V6DA 1S6HA 1C4Y2 3NWUA 2XBWA 4ABJA 3E16B 1SI5H 2FOMB 1GCDA 3I29A 1UK4A 2XW9A 4SGAE 2Z3DA 3A7XA 2A5AA 2NU2E 3DA9B 1P3CA 3CP7A 1Z8RA 1MD8A 5GJ4B 1ZTLA 3GY2A 4Y7AA 3BTDE 2WPMS 2ZCLP 1SQTA 3GCHC 2FOAA 3F9HA 1O2LA 1GMHF 2Y7ZA 6CHAC 1F0TA 1UTPA 1WYKA 2GP9B 1MU8B 4GVUA 4ASHA 1BRUP 2XCFA 4NIWA 3LGUA 3S7KB 1D3PB 1SFIA 3ZZ9A 1EB1H 5EG4A 4JCNA 4GCHF 3M37A 3MU5A 5CE1A 1Y3UA 1SOTA 1HFDA 1P2QA 1O2OA 1MU6B 2FLBH 1TB6H 4UFDH 3STJA 2J38A 1GBJA 1G37A 3RXUA 4BAKB 3GDUA 3MH7A 1GMCF 4B2BA 2G8TA 1YPHE 1AB9B 3AASA 1RFNA 2W3KA 7ESTE 1BTUA 3UFAA 2PFEA 5IYTA 4K8YA 4ABHA 3PWBA 1LVYA 4J2YB 4NIYA 4ZHMU 3WY8A 1NU7B 2AIPA 1MZDA 2H9TH 2ZFQH 3R0FA 2Z9JA 3M36A 4I33A 1MKWK 3TJVA 1ZSLA 1DLEA 4AFZA 1IOEA 4JYTA 4J1YA 1XXDA 1TX6A 5C20A 1GG6B 1F2SE 2VIWA 2J9NA 2HPPH 3PMAB 1A4WH 4KTSA 1ELGA 1FDPA 4UFGH 1A0JA 1OWDA 1KXCA 1NY22 1P04A 1SLUB 2R0KA 1KDQB 1G36A 1TGBA 2C8WB 1WQVH 1DUAA 1O3HA 1AFQC 4IMQA 1O5EH 2GV7A 3SV6A 1ANDA 1TPAE 4ZHAA 2PSYA 2OP9A 5CMXH 5C3NA 3M61U 5F03A 1GBFA 1K9OE 1LO6A 1THPB 3C27B 4CHAB 2GTBA 1XVMA 2RCEA 1QB6A 4MPXA