1G9IE

Crystal structure of beta-trysin complex in cyclohexane
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN, CATIONIC
publication title X-Ray study on an artificial mung bean inhibitor complex with bovine beta-trypsin in neat cyclohexane.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1g9iE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1g9iE02
4I8LA 1AVWA 4WVPE 1C5YB 2BD8A 1C5MD 4J2YB 1E0FD 1C5XB 4MPUA 4AYYB 1GI2A 3F9GA 4GCHG 1PQAA 1D3QB 5T6DA 1OX1A 2BVSH 3MU0A 5C67A 1UJ1A 1CGIE 2F3CE 1UTJA 5EW2H 4TY6A 1IQJA 3RC5A 1HAVA 4GUXA 2JKHA 1LTOA 1AVXA 1SFIA 5HGGA 1DWEH 2H9HA 2F83A 3TGJE 1C5QA 2H2ZA 3M5OA 4WWYA 1SHHB 1ZPZA 3VB6A 1ELEE 2ZHDA 3RUOA 1KDQB 1MKWK 2WYJA 1SVPA 2VIVA 4ESTE 1GPZA 1UCYK 3CS7A 4IN2A 1W12U 2A4RA 3V13A 4YT6H 4NA9H 4AFQA 5FX6A 4MPWA 1FONA 4NIYA 3SNBA 1NU7B 2BDHA 3SHAH 1TQ0B 5HM2A 1SQAA 4DIHH 1OWIA 1T4VH 2A4QA 3W95A 5FHTA 1O3LA 2XRCA 5E2PA 2Z94A 4FU8A 2SGPE 3GY2A 1PPCE 1DWDH 2RG3A 2B7DH 1A0LA 3A8CA 2ZQ1A 2FWWA 4GLYA 1WV7H 3LJJA 1BTUA 3TK9A 1Q31A 1A46H 2BX3A 2QN5T 1OS8A 4H6SB 1BMMH 2BY7X 1X7AC 5H4IB 1PPBH 1BJVA 2G55A 1LPZB 4ZKNU 1RIWC 2FOMB 1BQYA 1NFXA 1N8OB 2GV6A 4INLA 1TGSZ 1K1LA 3U69H 1EJMA 1Z8GA 1BBRH 5JPMH 1C5LH 2G00A 4AFZA 1FXYA 2G8TA 2PGQB 2BX4A 1UK2A 2Z3EA 1WBGB 2ZDLA 3KEEA 4JYUH 5A8XA 1C5NH 4WMEA 1O2XA 4NGAH 2FXRA 4I8JA 2GDDA 2GKVE 2VGCC 4OS4A 2H6MA 3I77A 1O2IA 4B75A 3E1XB 4JZEH 2ZCKP 1QHRB 1VGCC 1C5OH 3RXHA 2UWOA 3FP8E 2R9PA 1F0UA 3NWUA 1F0TA 5AVDA 3EE0B 3RU4D 2Q6FA 2HALA 1K1JA 2FP7B 1HFDA 5HYOA 2XC4A 1P04A 3DFJA 2BDGA 1IAUA 4AZ2B 3UWJH 1HLTH 2BY8X 3E90B 1LPKB 1QBOA 1FQ3A 3T62A 1H1BA 2C8XB 3M5LA 2FTMA 5LGOA 2BDYA 4ZUHA 1V2NT 1KLJH 2G4UA 2OTVA 1HIAB 3BTHE 4B73A 3K6ZA 1QBNA 4TWYA 2OCVB 3GY3A 2TGAA 3LGTA 4GPGA 6GCHG 4OS6A 1EOLA 1UTMA 1C5UA 2V3OH 4UFGH 1FIZA 5GCHG 2SFAA 2TIOA 1V2MT 4VGCB 3BTME 1K2I1 2PWXA 2ODYB 2C8ZB 3ZZ3A 2V3HH 1O31A 2Q6GA 1SGNE 1QRZA 5EQRA 4E05H 5AFYH 1TOCB 5C5NA 3ZYDA 1NM6A 1GI5A 3RXEA 2DUCA 2GZ7A 2LNCA 1ANDA 1PPHE 2HOBA 1DY9A 2ZTXA 2ZGHA 2F9PA 3S69A 4Y7BA 1O2MA 4Q7YA 2WINI 1RJXB 1M9UA 1PYTD 5GJ4B 1KXDA 5C5OA 3LJOA 1UK3A 2ZP0H 3RXJA 2VIPA 4X6PA 1WTHD 3RLWH 3SU2A 3UQOA 1BTWA 3UREA 3E3TA 1A3EH 4JYVH 1MBQA 1MQ6A 1V2PT 2ZO3H 1IQKA 2FODA 3QN7A 1LKBA 3BV9B 1QB6A 5GWZA 1NRPH 1UVPA 2ZNKH 1EAXA 1SGTA 4R0IA 1KDQA 1ZMLA 4X6NA 2ZFRH 3T27A 2ZGJA 2PTCE 2HNTE 2FS8A 4GVUA 3UFAA 1DX5M 4AOQA 1QCPA 2BY9X 1V2WT 4X1NU 1GHXH 1IQHA 2ANMH 2AS9A 3RXDA 4K5ZA 2Z9KA 4FUHA 4Q2KA 2FMJA 2CF8H 4FUEA 2BLVA 1L1GA 4K1EA 1EZUC 1HJ8A 1S0RA 3SJ9A 1YPEH 3OU0A 4ZXXH 2EI6A 3V0XA 1KXBA 4AB8A 1C1TA 1O3DA 1GBCA 2CHAB 1UK4A 4I7YH 2C8YB 2GMTB 1TRNA 1P11E 1C2HA 4TYDA 1RTFB 1QFKH 5I46H 4NIVA 1TX8A 3PTNA 3NK8A 1OOKB 1XKAC 2VVVA 5EG4A 1RGQA 1LHCH 2XW9A 3PMHB 1IQNA 1C1RA 4MNYA 3DA9B 1EQ9A 1P2NA 3UUZA 1ZR0A 1P03A 3A80A 5JB8S 1ZGVA 2BZAA 2HVXA 1C1UH 4H42U 2FOCA 4B2AA 1FMGA 4WJG2 4KKDA 4VGCC 1VITG 4LXBH 1F0RA 1SR5C 1YPHE 4GSOA 3F6UH 3DUXH 4LK4A 2GCTB 1T7CA 3PB1E 2CXVA 1FUJA 1O5BB 2HNTC 3ZV9A 2SGEE 3O8DA 2H9EH 1O3AA 1U6QA 5FPTA 1SLVB 3ZZDA 1GHBG 4ZKRU 1E35B 1ELBA 2W3KA 2W7UA 1K21H 2Z9GA 2ZKSA 2BLWA 2UWLA 3SV8A 4ZKSU 5LPRA 2B5TB 1G37A 4WY3A 1QR3E 1NRNH 4WXVA 1TGTA 3A85A 2EI7A 5EOKA 1CGHA 1ETRH 4ABFA 2R3YA 2OQ5A 3WY8A 3MH7A 4H4FA 3I78A 3PTBA 4BOHA 1FPCH 1XKBC 1WU1A 3ATWA 4JZDH 1QJ6B 1ZRKA 2XNIA 2Z6BD 1GVZA 1HXFH 2WPMS 2VH0A 4XFQA 2TPIZ 2ZU2A 2JH0D 1KXAA 2LPRA 3M36A 2XTTB 1HIAA 3Q3XA 4XOJA 2BDIA 2OD3B 3BG8A 1O3EA 1YPHC 4ZH8A 1O2PA 2BZ6H 1H9LB 3RM0H 3MI4A 1GL1A 3V3MA 1O0DH 4AFUA 1ELVA 1J15A 1G9IE 1N6YA 1Y5BT 2P3UB 2THFB 5CHAB 3PLBA 2IN2A 1G2MA 1IQFA 5F8TA 1HXEH 4CRAA 2NU4E 1GMCF 5FCKA 1BBRE 3M35A 5EU8A 1GMDG 1QB9A 3K9XB 4YLUA 4D8NA 1C1QA 3PLKA 5GXPA 3SV9A 1TIOA 5EGMA 3D23A 5FPSA 1SGPE 4X8VH 2F91A 4K60A 1BRUP 1WAYB 3UR9A 4DG4A 4AGJA 3E0PB 1TNKA 1XUJA 2SGDE 3P8GA 3E0NB 2FOAA 2OP9A 1GI3A 2A2XH 2QXGA 1KXFA 1AIXH 3RXAA 5DO4H 5DP8A 2VVCA 2VH6A 1GJ9B 1YPGH 4MNXA 2V35A 2GCTC 3M3TA 1C1VH 2XC5A 1JIRA 2PUXB 2Q6DA 4K8YA 3RXVA 1YBWA 1DXPA 1V2ST 1UTPA 1GJ7B 2SGFE 1AUJA 1GMHG 1DWBH 1LVMA 1O3HA 5K0HA 1UTKA 5B6OA 4JZIA 4Z0KA 1W10U 1MU6B 4CR5A 4DVAU 2AEIH 4HTCH 1C5TA 4I8GA 2Z3DA 1GGDC 2Y81A 1GL0E 1SLUB 1NN6A 1O3OA 1C2LA 3AAUA 2IPHA 2ILNA 1MTNC 3RXQA 2TGPZ 2ZC9H 4O9VA 1C5ZB 1TB6H 1TPOA 2G52A 1BUIA 2GD4B 1NROH 1G30B 1ZPCA 3C27B 2SGQE 5EQQA 1JWTA 1VCPA 3FZDA 1CHGA 2AH4X 2B9LA 2FO9A 4X1SU 1QQ4A 2Y5FA 1GI1A 1ZSJA 1LVYA 2J92A 3A82A 2FOBA 2ALPA 1TBRH 2HWLB 2ZG0H 4TPIZ 4KGAA 3ESTA 2CMYA 3GCOA 1YGCH 4CRDA 3NCLA 4ZXYH 5JB9S 5HM9A 1A1RA 1XUIA 1W0ZU 1YPKH 1HYLA 4WXIA 4GCHF 4UD9H 1PQ5A 2NU0E 1OKXA 2BD3A 1Z71A 1C4V2 1P10A 1GBIA 1GDUA 4B71A 4BNRA 1NFYA 1XUHA 2ANWA 5A09A 5L6NH 2FLBH 6LPRA 2HPQH 2XBWA 3ZVGA 1GHAG 1FV9A 2Y82A 1ABJH 5ESBA 1WOFA 1HB0B 3TH2H 3LC3A 2OC1A 5T6GA 2J4IA 1GBAA 5E2OA 2G5NA 4CR9A 2A31A 3SI4H 2CF9H 1J17T 2FESH 1BRCE 1Z8JB 3STJA 2FYRA 4BTUB 3BTTE 3EQ0H 1SGEE 1AFQC 1C2IA 4NCYA 2OUAA 4ZHAA 2XCNA 1HAPH 4X8UH 1JBUH 1EXFA 4Q7ZA 1OP8A 1HNEE 4MPVA 3RXMA 3U8TH 1S0QA 3VXFH 1HAOH 1GI9B 1YPMH 1Q2WA 3SGBE 4BAQB 1F7ZA 1V3XA 3TITA 1A5GH 4WMDA 3ATIA 2A2QH 1C2KA 3GCTF 1XXFA 1C1NA 1C9TA 3R3GB 3HGNA 4K3JA 3VGCC 5EPNA 2ZDVH 3ZV8A 3F9EA 1B5GH 1P57B 4CH8B 1P2MA 1SSXA 1G32B 3DHKH 3LGWA 1KLTA 1JMOH 3URCA 3TNTA 3RXSA 3IWMA 3GCHB 3TK6A 1TBZH 4DGJA 3SUDA 1O2SA 3QDZB 2QY0B 1OWDA 4RKOB 2W7SA 1VR1H 2ZU4A 3SGAE 4WH8A 1A7SA 1ZTJA 3RXLA 3D62A 1L2EA 1YCPH 2P3FH 3UTUH 2CJIA 3MYWA 1TPSA 3ELAH 3BTQE 3VFEA 4XDEA 1P09A 1RIWB 1QURH 3ZVAA 3E6PH 1IQEA 1FY8E 1O5AB 3OX7U 3URDA 2R0LA 3ITIA 4KELA 1NT1A 1GJ8B 1FY3A 3GICB 1IQIA 2EI8A 4FVBA 2EA3A 1ZOMA 1DSUA 3CS0A 3RDZA 1C5WB 1O36A 4U2WA 2BD4A 5L30H 3GYLB 3P95A 1Z1JA 1TAWA 3F9FA 1P01A 1C2MA 2WUCA 1E36B 3SI3H 1BHXF 2HNTF 5HXFA 3M5NA 2ZIQH 2VGCB 2A1DB 4E06H 4NG9H 3SU1A 1G36A 1WCZA 3MTYA 2ZF0H 1S83A 1SHYA 3FP6E 1VGCB 1UO6A 4K1SA 6GCHF 1INCA 1VJAU 3ZZ8A 1G3CA 4Y6DA 1J8AA 1GI7B 2P59A 3EDXB 5GCHF 1NY22 1WQSA 3QZRA 1DT2A 3DFLA 2FX6A 2FX4A 1LO6A 4KTSA 1O3IA 4X1RU 3ZVCA 2GP9B 3QGNB 1AQ7A 2UUJB 3H7OA 1QNJA 4U32A 1NRRH 1O3BA 4KP0A 4XBDA 5LH8A 2ANKH 3CENA 4ABAA 3T25A 1ZSLA 2YNBA 4K69A 1C4Y2 3ATMA 4RKJB 1BMNH 3HK3B 3AASA 1GJCB 2QIQA 1TNIA 1Y3VA 2ZECA 1T32A 3MH6A 1GI4A 3GCHC 4FU9A 1CA8B 2RA3A 2OXSA 4YLQH 1JXPA 1QB1A 1VCWA 2SNWA 4JZ1A 2ZDKA 2WPHS 3UPEA 2NU1E 4B1TA 8ESTE 2P94A 2D1JA 2ZEBA 2A7CA 1AWHB 1C2GA 2WPLS 3QO6A 2BOKA 1H8IH 1OXGA 2XCFA 3RXRA 1TALA 2QAAA 1C5PA 2UWPA 1VITH 4MDSA 5E0HA 1SFQB 2EC9H 1MD7A 1V2OT 2PTNA 2P8OC 3FAOA 2QXIA 2PFEA 1SGFG 3BEUA 1ANEA 3SV2H 1P05A 3H5CB 1BMLA 3F1SB 3VB5A 2FI5E 3G01A 3PM3A 1KYNA 1HV7A 1TLDA 1H4WA 3RXFA 2FM2A 1P2QA 3PMAB 1V2TT 1SG8B 2AGGX 6CHAC 1AB9C 1OYQA 3EGKH 4TPYA 1EAUA 3HK6B 1ESBA 1O5GH 2D8WA 2P93A 4X0WU 2VJ1A 3M7QA 4FUJA 2C93B 4YTAA 2ZFSA 1B0FA 4NIWA 3SNAA 5A0CA 4WF8A 2ESTE 3E16B 3O8RA 3TIUA 3VEQB 3STIA 3SO3A 3ZZAA 3ZVDA 4ABEA 2DE9A 1VITF 1O2GH 1QRWA 1HJAC 1P2OA 1DOJA 2Z9LA 3FANA 3JZ1B 1ZLRA 2ZHEH 4ISNA 4Z6AH 5JBBS 1DM4B 1L4ZA 1SMFE 2QXHA 3O8BA 1DWCH 2BOHB 1UMAH 3AW1A 3T5FH 1NFUA 1AE8H 3RXUA 1P06A 1HCGA 2DE8A 2K1QA 1KXEA 1TFXA 3BG4B 1SL3A 1EP5A 1MMJN 4B74A 1O37A 4LZ4B 4KTCA 1F5RA 4Y0ZE 1BHXB 3KQDA 1HDTH 4A1TA 1DITH 1A0HB 1NU9A 3U9AH 1TA6A 3GY8A 1BTZA 1FI8A 5GPIB 4ASHA 3SUGA 4ABJA 1F2SE 1SGRE 3RP2A 4NIXA 4UONA 2TBSA 1XMNB 1CHOF 3VXEH 2BLOA 2ZGXH 1C1PA 1O3KA 4JK6A 1DS2E 1MKWH 1UVUH 1QA0A 1AWFH 1EB2A 1FY1A 2WUBA 1UCYH 2FDAA 2P16A 3A81A 1EPTC 3ZVBA 1EAIA 1ELCA 1MUEB 1TRYA 4AFSA 4THNH 2ZTZA 1N1LA 2A0QB 1UTLM 1B0EA 2BVRH 3BEFB 1Z7KA 4ZMAH 5JBCS 2XBXA 1HAZB 4FU7A 4CRFA 2GX4A 2BMGB 4KTUA 4FXGH 1QJ7B 2OC8A 4A1XA 2HGTH 1W0YH 3ZZCA 1OYTH 1HRTH 1TX6A 4OS7A 1T8MA 1D3PB 4FUIA 1IQGA 2PSYA 2XYAA 1HAYB 1P02A 4OS2A 1IQLA 3UNRA 2J34A 2WPIS 3VB3A 3BTEE 1DANH 1AMHA 2ODQA 4NA7A 1J16A 2I6QA 4INKA 5FPYA 4HGCA 3LGVA 3QWCH 4FUFA 2XWAA 1UTQA 2STAE 1ZTKA 2CGAA 1SGIB 5E8EH 3TJVA 2BYAX 1GMHF 2BVXH 1Y5AT 3A87A 3BIUH 3QK1A 1EJAA 1L1NA 1Y5UT 1C5VA 3ZVEA 1GBFA 3BG4C 2G5VA 3A8DA 1EP6A 1UHBB 1D3DB 1MCTA 1UVTH 3MH5A 1KLIH 3ATKA 4DY7B 1B7XB 3FVFB 1LPGB 1MAYA 5SGAE 3RMLH 5AHGH 2BD9A 1P0SH 1GHWH 1CT0E 1LHEH 1GBKA 1H9IE 1O2WA 8GCHG 3U98H 4AORA 1JIMA 3P92A 4MQAA 4Q80A 3SHCH 3P6ZB 1QTFA 5DKMA 3LC5A 3Q3YA 1CO7E 3BTGE 1A3BH 2WV4A 1MD8A 5DP5A 3PROA 3B9FH 3SV6A 4BAMB 1OSSA 3L6PA 2GGVB 3BIVH 3SJ8A 1PQ8A 2BXTH 1AKSB 1YC0A 4BXWA 2ZA5A 5F03A 3SU5A 4FUDA 3NKKA 2OQUA 1BDAA 3D65E 3GY6A 3LU9B 1O3CA 1GGDB 1F0SA 1TA2A 1T4UH 4YOGA 3SW2B 1O34A 2H5DA 1G2LA 5G4BA 4PROA 4IGDA 1QGFA 1FY5A 3RC4A 1MTNB 3LDXH 3HPTB 1P3EA 4CBNA 1AU8A 3RMOH 3OTJE 5E0JA 4K1TA 4Y76A 2BY5X 2IOTA 2F9OA 3MO6A 1C1MA 2AFQB 4X8TH 2W26A 2FPZA 3HKJB 2AIQA 4D9QA 1O2LA 1W8BH 4X2XA 5C1YA 2A5IA 4BAOB 1TONA 1DLEA 1PPZA 2PLXA 3UIRA 3EAJA 2ZFTA 2ZU3A 1Y59T 1AY6H 4F49A 3SJKA 2Z9IA 1O2NA 3TGKE 3T29A 1D3TB 5FX5A 1NFWA 1ANBA 1AVGH 1WUNH 5E0GA 1HUTH 1TNHA 4AB9A 4O97A 3LGUA 2B0FA 2J38A 1C2DA 2ZHFH 1CT2E 1YKTA 5I25A 3NXPA 3LIWA 1NPMA 1UTOA 3TNSA 5EXLA 1AZ8A 4K2YA 1AGJA 2CV3A 4UFFH 4IS5A 4X2WA 2O8MA 2ZWLH 1D4PB 2ZFFH 4NWKA 1V2JT 5DG6A 1RTLA 1XX9A 2VVUA 1HAHH 1V6DA 3EYDA 1YPLH 2TGTA 4YM9A 1YM0A 3GOVB 1ABIH 1E34B 5BRRE 1O5EH 2BDBA 5A8YA 1GVLA 3A89A 1CBWC 4X2YA 2R0KA 1GBEA 1AD8H 1CU1A 4J1YA 3BTWE 1EX3A 2VU8E 2ZDAH 1EJNA 3ODDA 3Q76A 1JOUB 2VINA 1BIOA 1AFQB 1TWXB 2VIDA 3D49H 2O8LA 5K7RA 5C20A 1FNIA 1MKXH 1C2FA 4XBCA 4K8BA 2R3UA 1HAIH 2C8WB 1XVOA 2H1UA 3VB7A 2JH5D 1S81A 2ZHQH 2Y7ZA 1ELAA 4M7GA 2FYQA 1SB1H 1C4U2 1ID5H 1CA0C 2O8WA 3A86A 4ZAEA 4Y11E 1UVOA 1C2JA 2BY6X 1TOMH 1TMTH 1Z1IA 1BTXA 1O3NA 3KN2A 5DP7A 1FY4A 1SLWB 7LPRA 2JETC 3MNSA 4JCNA 1PFXC 1YCPM 1ZRBA 5JBAS 3Q00A 1V2KT 1OWKA 3VGCB 2ASUB 1Y3WA 1SOTA 1PJPA 2GZ9A 3RXKA 4IBLH 1GJBB 1CGJE 1ZMNA 5EODA 5JBTA 3SNDA 5C1UA 3Q77A 1TGCA 2A5AA 3ZVFA 1A5HA 3KCGH 1OWJA 1UHBA 5AFZH 1EASA 3GISB 1HJ9A 2VWMA 3LKWA 3BTDE 2QA9E 1CQQA 2C90B 3OYPA 3A7WA 1UCYE 2QV1A 1F5KU 3M5MA 1V2RT 2FI4E 1W2KH 2WV5A 5TCAA 1FJSA 2AYWA 1KSNA 1K9OE 1THSH 2GT8A 1O2KA 4NFEA 1GJ4H 1LHGH 1LHDH 3BEIB 1SQTA 6ESTA 1MZDA 1O2UA 2NU3E 2ZDNA 2A45B 2ZGCA 4FUBA 2BDAA 4NZLA 4ABIA 1ELFA 3QUMP 1AKSA 1AE5A 3L33A 5A0AE 1P2KA 2BD7A 4A7IB 4HI3A 1J14A 3P17H 3ZZ4A 1KIGH 3PYHA 1TNLA 1S5SA 3MWIU 1PYTC 4MPXA 5A0BA 2O8TA 1H9HE 2QYIA 1OWEA 3RXBA 2PGBB 4D7GA 1DY8A 3A8AA 4D76A 2C3SA 3ODFA 1K1PA 1Q3XA 1T31A 5AF9H 1YLCA 4UE7H 1TBQH 1ARBA 5F8XA 4DIIH 1E38B 3N7OA 3S7HB 5EPYA 1S84A 1AHTH 1ZHPA 1SPJA 1Y3UA 2OINA 2G81E 3UNSA 4MLFB 4YESB 2ZU5A 4TY7A 4JK5A 3GDUA 2HRVA 1FZZA 5FBEA 3SORA 1O5CB 4ZHLU 1O38A 1DSTA 1EZXC 2AMDA 4I31A 1GBMA 3NPSA 3M3SA 1GCDA 2FOGA 3E8LA 4NWLA 1GCTC 1O5DH 1BOQA 1SC8U 1NO9H 3A84A 2A7JA 2TRMA 1GVKB 1ZJDA 4IW4E 4BXSA 3KQEA 1ZHRA 3SZNA 1LQEA 3H7TA 1O2OA 2OLGA 4X1QU 1GBHA 1BBRK 2AERH 1GG6C 2BM2A 1LVOA 2PKSB 7GCHG 1GDQA 4I33A 1V2LT 3MU8A 4NA8A 1LQDB 4A5TS 1AN1E 2FS9A 2XBVA 3KIDU 1G3DA 1RXPA 1DE7H 2QXJA 4DURA 5CMXH 1LMWB 1T8OA 1E37B 2FEQH 1DXWA 2PHBA 2ZPSA 1ZHMA 1O2QA 2G4TA 1FPHH 1IHSH 1HGTH 5BPEA 2P8OB 3P70B 1NESE 2VNTA 4X6OA 3SUFA 3IG6B 1W7GH 1O2TA 1ETSH 2R2WU 3SNCA 4D9RA 1RTKA 1K28D 3QX5H 1KTSB 6CHAB 3EA8A 4ISOA 1AB9B 2FOFA 3UNQA 2BB4A 3MU4A 3U8RH 1TABE 2Q1JA 1A61H 2QF3A 1O2HA 5HMAA 1ORFA 1P12E 2GZ8A 4ZROA 2ZZUH 2OC0A 3SU3A 1HJAB 5T6FA 2CN0H 3RMMH 3OY6U 1EZQA 1ZMJA 5DP9A 5IYTA 5TJXA 8LPRA 3U1IB 3I29A 3M7UA 4OS1A 3K2UA 1NRQH 1BB0B 1GJ6A 2J94A 1WSSH 4INHA 2O8UA 4AG1A 3FZZA 4CRBA 5EXMA 1PPEE 5GDSH 4JZFH 3SNEA 1GJ5H 2GDEH 4H6TA 4X6MA 3PO1C 1ZJKA 2ZQ2A 4Y8YA 4BANB 2GV7A 2C4FH 2XBYA 3NUMA 1NTPA 3PWBA 1TE0A 2EEKA 3ZYEA 3S7KB 3PLPA 4ISHH 3MO3A 4WH6A 1TMBH 2IJOB 4MVNA 5T3HA 1RD3B 2AMQA 1ARCA 2PKSC 3VPKA 1K1NA 4U01A 4IN1A 2QF0A 5FXLA 1IHTH 2GT7A 2W3IA 2BD5A 3LOXA 1XVMA 1QL7A 3A7TA 3RLYH 2WPKS 4FVDA 4AYVB 1Y8TA 1O32A 1KTTB 3RXTA 2ZCHP 2GCHG 4DT7B 1SGQE 2V6NA 2A4OA 1XUKA 4NSVA 1CSOE 2ZDMA 3TK5A 1EPTB 1D9IA 3F68H 1FN8A 4MG3A 3KNXA 4CRCA 5CE1A 1ELDE 2G51A 1T8NA 2QC2A 3PMJA 4ABDA 3GCTG 2O9QA 3GY4A 2FIRH 1SQOA 4A92A 1O33A 7KMEH 3SUEA 2RA0A 4LZ1H 3LONA 2BQ6B 1P2JA 5LPEA 1QBVH 2RDLA 1GDNA 2A7HA 2AMPA 3RM2H 1AO5A 1J9CH 2A4GA 2I6SA 1Z6JH 3A83A 3GY5A 2PKAB 3LPRA 3OSYA 1TMUH 2BHGA 3ZZ7A 1IQMA 2UUYA 3RC6A 4JMYA 1MBMA 1MCVA 1C1OA 8GCHF 5L2ZH 4Y10E 1EUFA 2KAIB 3A7VA 4IC5A 1YLDA 1EAWA 1SOZA 1GHBF 4GAWA 5F8ZA 2ALVA 2ZPRA 4E7RG 4YOIA 3MNCA 3SJIA 4BTIB 4GHTA 4I8HA 4CHAB 3VB4A 1CVWH 1ESAA 4FUCA 4MNVA 1ZYOA 1G3EA 1EKBB 2ZTYA 2FTLE 1S6FA 5ETXA 4XSKU 5DK1A 1O3MA 4YOJA 1LKAA 1D6WA 5JYIA 3OY5U 4UFDH 1F92A 1C5SA 3GDVA 2YOLA 1UVSH 1SI5H 1FN6A 2ZGBH 3RXOA 1FAXA 1VJ9U 4JYTA 4ZHMU 3RXIA 1AI8H 4AG2A 3MU1A 4Y8ZA 3QTVH 3UWIA 3PV4A 2VWNA 3P8OA 4I32A 5EW1H 3A88A 4HFPB 2R2MB 4DOQA 1K1MA 2PSXA 3TJOA 3T2NA 4X2VA 3SU0A 1NRSH 2ZCLP 2ANYA 3TVJB 2ZFQH 1V2UT 2D26C 2J95A 2SGAA 1DFPA 3ZZ9A 1Z6EA 1OP0A 3B23B 5J4SA 1TNJA 1GMDF 2RCEA 4HZHA 3M7TA 3ATLA 3BF6H 3SU4A 4BTTB 1N8OC 2XWBI 1L1JA 1ANCA 3L3TA 1CT4E 1SBWA 1DUEA 1KXCA 5ESTE 3HKIB 3QZQA 2WYGA 3KQCA 2F9NA 1UTNA 3RU4T 3TJUA 4ABHA 3K65B 4RN6A 1BRAA 1TRMA 4MNWA 2PW8H 5A8ZA 1IOEA 3P8NA 4BAKB 1GHZA 1RRKA 1P9UA 4U30A 1LVBA 1O2RA 1QRXA 4B2BA 1HBTH 3GDSA 1O2ZA 2Z3CA 3TPIZ 1YF4A 1MQ5A 4IC6A 3SBKA 3U8OH 5GIBA 2NWNA 3CP7A 1QL9A 4DJZB 1RFNA 4CHAC 3T28A 2FOEA 1MKXK 1SGCA 3M61U 1OWHA 3MOCA 2Z7FE 1Z8IB 3K6YA 3HGPA 1VZQH 1GBDA 1ZPBA 1FLEE 1ELGA 1EPTA 1WQVH 1CBWB 3ZZ5A 2BLQA 1O3JA 1GBBA 2UUFB 5ABWA 2OC7A 1TX7A 1HAXB 1A5IA 3BSQA 1GBJA 1OP2A 3JZ2B 3MNXA 4Y8XA 1O35A 2V0BA 5F6MA 1GWAA 3RXPA 1JRSA 2OBOA 5A2MH 1GBLA 1XXDA 3ENSB 3V12A 1CA0B 5IDKA 2PKAA 4R8TB 1NZQH 3SJOA 1SGFA 2Z9JA 5DP6A 1AFEH 2ULLA 9LPRA 2FLRH 2F9BH 1ETTH 2Y80A 2KAIA 3SOSA 2JETB 3QTOH 5TCCA 1O2JA 2VIWA 1ESTA 7ESTE 1AZZA 1JRTA 3FP7E 3R0FA 2BDCA 1GJAB 4UFEH 2HPPH 1GHAF 4B76A 4OS5A 5L2YH 1TQ7B 4E7NA 3C1KA 1C1WH 3S9CA 1OPHB 8KME2 2AGEX 2PUQH 1P2IA 3KF2A 1BT7A 2Y6TA 2ZU1A 5EQSA 2BXUH 1BTHH 3TH4H 3TU7H 4Y71A 1Y3YA 1V2VT 3A8BA 2VB0A 1YYY1 2F9VA 1MZAA 1CHOG 1GBTA 4A1VA 2XC0A 1O5FH 1GHVH 2GVFA 1SGDE 3RU4E 1W7XH 4WMFA 4O3UA 4X1PU 1XM1A 2QGRA 2STBE 1FAKH 3KL6A 3MU5A 9ESTA 3KQBA 3KHVA 1F5LA 2CHAC 1PPFE 2J9NA 2GMTC 1MAXA 3S9AA 1QY6A 3B8JA 3GY7A 1W11U 3GCNA 1DICA 4ISIH 4Y7AA 1K1OA 3T26A 1LHFH 3LH3A 1AUTC 2M5TA 4AX9H 3S9BA 4AN7A 1C2EA 1D6RA 5DPAA 1L4DA 2H5CA 4OGXA 4D7FA 4YO9A 3BTKE 2Y5GA 3MMGA 4FUGA 4X8SH 1HAGE 2NU2E 4DW2U 3MO9A 1EB1H 2FZZA 1TGNA 3A7ZA 5LPFA 1N6XA 3PWCA 3KGPA 7GCHF 1BCUH 1K1IA 1O39A 1TYNA 3TH3H 2OBQA 1ZSKA 2FI3E 1O30A 4SGAE 1GCTB 1QA7A 1BRBE 4YT7H 2BQWB 1YCPK 1XUFA 4MTBA 1BTPA 4LOYH 2ZFPH 1TPAE 3RXGA 4CRGA 1NS3A 4BAHB 3QLPH 2QCYA 5FBIA 2FOHA 1BMAA 2PR3A 1PPGE 1NC6A 3MH4A 1C1SA 3ZZBA 1GG6B 1VCQA 4IMQA 1C9PA 1HAVB 3AVZA 4QT8C 3UOUA 2A5KA 3AW0A 5J4QA 3LT3A 1QJ1B 4ISLA 2A32A 3DT0H 1TGBA 3M3VA 1MH0A 1THRH 2XXLA 3SQHE 2BTCE 1O3GA 1P9SA 4CBOA 1S85A 1K22H 5C1XA 3S0NA 1P8VC 3P8FA 2Y7XA 3F9HA 1Z8RA 2AIPA 2VWLA 3FFGA 4I8KA 1LCYA 4Y0YE 5CHAC 5FAHA 1CE5A 2D2DA 1SGYE 3ZZ6A 3UR6A 1GHYH 1MU8B 4YZUA 5DP4A 2VWOA 3MFJA 1MTVA 3PMBB 4NSYA 2ODPA 5DJ7A 3IITA 1BTYA 3SGQE 4GHQA 3E91A 4UEHH 5C3NA 2P95A 5JDUB 2GTBA 2J2UA 3LGYA 1DDJA 4F4OC 1FIWA 1YPJH 1GJDB 3UOPA 1MTSA 2ZI2H 2W5EA 1QIXB 1EATA 3NZIA 4NZQA 3A7XA 4SGBE 4ZKOU 1THPB 4Q7XA 3W94A 1MTWA 1G3BA 1TPPA 1W13U 1GMCG 3HATH 3RXCA 4CH2B 1GI8B 1QQUA 1GI6A 3LH1A 3BN9A 1WTGH 1ELTA 1BZXE 1HPGA 1A0JA 1DPOA 3V7TA 1V2QT 2ZHWH 1LDTT 2UUKB 1TNGA 3PO1B 1DLKB 1QL8A 4O03A 1FDPA 1YP9A 3DD2H 2BQ7B 2GCHF 3TJNA 3BTFE 2AGIX 3GYMA 1ACBE 4OGYA 1S82A 2YNAA 1KY9A 1T8LA 4ABGA 1BJUA 4IMZA 3LGIA 1S6HA 2ZPQA 4O3TA 2TGDA 1SLXB 5C2ZA 3SV7A 4AGKA 3MNBA 1DUAA 4NFFA 3MHWU 1EZSC 1XUGA 3SN8A 2P3TB 1O3FA 4A6LA 4B2CA 4DCDA 4TWWA 1BA8B 5FCRA 1MTUA 4XE4A 3UQVA 2B8OH 4RSPA 2F9UA 3UY9A 3EA9A 3U1JB 3O8CA 2VIQA 5DP3A 1O2VA 4UDWH 2SNVA 1L0ZA 3QGJA 1A4WH 3EA7A 4CREA 1W14U 5EXNA 3AAVA 1P3CA 5PTPA 1Y3XA 1PQ7A 1BITA 5DGJA 2BD2A 3A7YA 1RS0A 2H9TH 3SQEE 1GI0A 4Y79A 2WPJS 1ZGIA 4XBBA 1O3PB 1C5RA 1WYKA 3RMNH 2VIOA 1EOJA 3TGIE 4ABBA 1A2CH 1DVAH 3M37A 1ZZZA 2HLCA 1H8DH 3TLOA 1ZTLA 2JH6D 3Q3KA 2PV9B 3SU6A 2Y5HA 1W3CA 1O2YA
chains in the Genus database with same CATH superfamily
4I8LA 1AVWA 4WVPE 1C5YB 2BD8A 1C5MD 4J2YB 1E0FD 1C5XB 4MPUA 4AYYB 1GI2A 3F9GA 4GCHG 1PQAA 1D3QB 5T6DA 1OX1A 2BVSH 3MU0A 5C67A 1UJ1A 1CGIE 2F3CE 1UTJA 3KYFA 1WDIA 5EW2H 4TY6A 1IQJA 3RC5A 1HAVA 4GUXA 2JKHA 1LTOA 1AVXA 1SFIA 5HGGA 1DWEH 2H9HA 2F83A 3TGJE 1C5QA 2H2ZA 3M5OA 4WWYA 1SHHB 1ZPZA 3VB6A 2YMSB 1ELEE 2ZHDA 4Q63A 3RUOA 1KDQB 1MKWK 2WYJA 1SVPA 2VIVA 4ESTE 1GPZA 1UCYK 3CS7A 4IN2A 1W12U 2A4RA 3V13A 4YT6H 4NA9H 4AFQA 5FX6A 4MPWA 1FONA 4NIYA 3SNBA 1NU7B 5KGOA 2BDHA 3SHAH 2K0QA 1TQ0B 5HM2A 1SQAA 2M2AA 4DIHH 1OWIA 1T4VH 2A4QA 3W95A 5FHTA 1O3LA 2XRCA 5E2PA 2Z94A 4FU8A 2SGPE 3GY2A 1PPCE 1DWDH 2RG3A 2B7DH 1A0LA 3A8CA 2WPDD 2ZQ1A 2FWWA 4GLYA 1WV7H 3LJJA 1BTUA 3TK9A 1Q31A 1A46H 2BX3A 2QN5T 1OS8A 4H6SB 1BMMH 2BY7X 1X7AC 5H4IB 1PPBH 1BJVA 2G55A 1LPZB 4ZKNU 1RIWC 2FOMB 1BQYA 1NFXA 1N8OB 2GV6A 4INLA 1TGSZ 1K1LA 3U69H 1EJMA 1Z8GA 1BBRH 5JPMH 1C5LH 2G00A 4AFZA 1FXYA 2G8TA 2PGQB 2BX4A 3DSOA 1UK2A 2Z3EA 1WBGB 2ZDLA 3KEEA 4JYUH 4ACBA 5A8XA 1C5NH 4RT0A 4WMEA 1O2XA 4NGAH 2FXRA 4I8JA 2GDDA 2GKVE 2VGCC 4OS4A 2H6MA 3I77A 1O2IA 4B75A 3E1XB 4JZEH 2ZCKP 1QHRB 1VGCC 1C5OH 3RXHA 2UWOA 3FP8E 2R9PA 1F0UA 3NWUA 1F0TA 5AVDA 3EE0B 3RU4D 2Q6FA 2HALA 4AC9A 1K1JA 2FP7B 3SYJA 1HFDA 5HYOA 2XC4A 1P04A 3DFJA 2BDGA 1IAUA 4AZ2B 3UWJH 1HLTH 2BY8X 3WW7A 3E90B 1LPKB 1QBOA 1FQ3A 3T62A 1H1BA 2C8XB 3M5LA 2FTMA 2KCAA 5LGOA 2BDYA 4ZUHA 1V2NT 1KLJH 2G4UA 2OTVA 1HIAB 1WXRA 3BTHE 4B73A 3K6ZA 1QBNA 1BMFD 4TWYA 2OCVB 3GY3A 2TGAA 3LGTA 4GPGA 6GCHG 4OS6A 1EOLA 1UTMA 1C5UA 2V3OH 4UFGH 1FIZA 5GCHG 2SFAA 2TIOA 1V2MT 4VGCB 3BTME 1K2I1 2PWXA 2ODYB 2C8ZB 3ZZ3A 2V3HH 1O31A 3FOAA 2Q6GA 1SGNE 1QRZA 5EQRA 4E05H 3N7DA 5AFYH 1TOCB 5C5NA 3ZYDA 3F2HA 1NM6A 1GI5A 3RXEA 2DUCA 2GZ7A 3NRLA 3MQKC 2LNCA 1ANDA 1PPHE 2HOBA 1DY9A 2ZTXA 2ZGHA 2F9PA 3S69A 4Y7BA 1O2MA 4Q7YA 2WINI 1RJXB 1M9UA 1PYTD 5GJ4B 5C0UA 1KXDA 5C5OA 3LJOA 1UK3A 2ZP0H 3RXJA 4ACAA 2VIPA 4X6PA 1WTHD 3RLWH 3SU2A 2KX4A 3UQOA 1BTWA 3UREA 3E3TA 1A3EH 4JYVH 1MBQA 1MQ6A 1V2PT 2ZO3H 1IQKA 2FODA 3OTPA 3QN7A 1LKBA 3BV9B 1QB6A 5GWZA 1NRPH 1UVPA 2ZNKH 1EAXA 1SGTA 4R0IA 1KDQA 1ZMLA 4X6NA 2ZFRH 3T27A 2ZGJA 2PTCE 2HNTE 2FS8A 4GVUA 3UFAA 1DX5M 4AOQA 1QCPA 2BY9X 1V2WT 4X1NU 1GHXH 1IQHA 2ANMH 2JDID 2AS9A 3RXDA 4K5ZA 2Z9KA 4FUHA 4Q2KA 2FMJA 2CF8H 4FUEA 2BLVA 1L1GA 4P02A 4K1EA 1EZUC 1HJ8A 1S0RA 3SJ9A 1YPEH 3OU0A 4Q4LA 4ZXXH 2EI6A 3V0XA 1KXBA 4AB8A 2QF5A 1C1TA 1O3DA 2WSSD 1GBCA 2CHAB 3H09A 1UK4A 4I7YH 2C8YB 2GMTB 1TRNA 1P11E 1C2HA 4TYDA 1RTFB 1QFKH 5I46H 4NIVA 1TX8A 3PTNA 3NK8A 1OOKB 1XKAC 2VVVA 5EG4A 1RGQA 1LHCH 2XW9A 3PMHB 1IQNA 1C1RA 4MNYA 3DA9B 1EQ9A 1P2NA 3UUZA 1ZR0A 1P03A 3A80A 5JB8S 1ZGVA 2BZAA 2HVXA 1C1UH 4H42U 2FOCA 4B2AA 1FMGA 4WJG2 4KKDA 1QZ8A 4VGCC 1VITG 4LXBH 1F0RA 1SR5C 1YPHE 4GSOA 3F6UH 3DUXH 4LK4A 3FO8D 2GCTB 1T7CA 3PB1E 2CXVA 1FUJA 1O5BB 2HNTC 3ZV9A 2SGEE 3O8DA 2H9EH 1O3AA 3PRBA 1U6QA 5FPTA 1SLVB 3ZZDA 1GHBG 4ZKRU 1E35B 1ELBA 2W3KA 2W7UA 1K21H 2Z9GA 2ZKSA 2BLWA 2UWLA 3SV8A 4ZKSU 5LPRA 2B5TB 1G37A 4WY3A 1QR3E 1NRNH 4WXVA 1TGTA 3A85A 2EI7A 5EOKA 1CGHA 1ETRH 4ABFA 2R3YA 3DSGA 2OQ5A 3WY8A 3MH7A 4H4FA 3I78A 3PRDA 3PTBA 4BOHA 1FPCH 1XKBC 1WU1A 3ATWA 4JZDH 1QJ6B 1E79D 1ZRKA 2XNIA 2Z6BD 1GVZA 1HXFH 2WPMS 2VH0A 4XFQA 2TPIZ 2ZU2A 2JH0D 1YWUA 1KXAA 2LPRA 3M36A 2XTTB 1HIAA 3Q3XA 4XOJA 2BDIA 2OD3B 3BG8A 3FN8A 1O3EA 1YPHC 4ZH8A 1O2PA 2BZ6H 1H9LB 3RM0H 3MI4A 1GL1A 3V3MA 1O0DH 4AFUA 1ELVA 2QF4A 1J15A 1G9IE 1N6YA 1Y5BT 2P3UB 2THFB 5CHAB 3PLBA 2IN2A 1G2MA 1IQFA 5F8TA 1HXEH 4CRAA 2NU4E 1GMCF 5FCKA 1BBRE 3M35A 5EU8A 1GMDG 1QB9A 3K9XB 4YLUA 4D8NA 1C1QA 3PLKA 5GXPA 3SV9A 2LP6A 1TIOA 5EGMA 3D23A 2KM0A 5FPSA 1SGPE 4X8VH 2F91A 4K60A 1BRUP 1WAYB 3UR9A 4DG4A 4AGJA 3E0PB 1TNKA 1XUJA 2SGDE 3P8GA 3E0NB 2FOAA 2OP9A 1GI3A 2A2XH 2QXGA 1KXFA 1AIXH 2GJGA 3RXAA 5DO4H 5DP8A 2VVCA 2VH6A 1GJ9B 1YPGH 4MNXA 2V35A 2GCTC 3M3TA 1C1VH 2XC5A 1JIRA 2WZQA 2PUXB 2Q6DA 4K8YA 3RXVA 1YBWA 1DXPA 1V2ST 3AK5A 1UTPA 1GJ7B 2SGFE 1AUJA 1GMHG 1DWBH 1LVMA 1O3HA 5K0HA 1UTKA 5B6OA 4JZIA 4OM9A 4Z0KA 1W10U 1MU6B 4CR5A 4DVAU 2AEIH 2QE7D 4HTCH 1C5TA 4I8GA 2Z3DA 1GGDC 2Y81A 1GL0E 1SLUB 1NN6A 1O3OA 1C2LA 3AAUA 2IPHA 2ILNA 1MTNC 3RXQA 2TGPZ 2ZC9H 4O9VA 1C5ZB 1TB6H 1TPOA 2LELA 2G52A 1BUIA 2GD4B 1NROH 1G30B 1ZPCA 3C27B 2SGQE 5EQQA 1JWTA 1VCPA 3FZDA 1CHGA 2AH4X 2B9LA 4RT1A 2FO9A 4X1SU 1QQ4A 2Y5FA 1GI1A 1ZSJA 1LVYA 2J92A 3A82A 2FOBA 2ALPA 1TBRH 2HWLB 2ZG0H 4TPIZ 4KGAA 3ESTA 2CMYA 3GCOA 1YGCH 4CRDA 3NCLA 4ZXYH 5JB9S 5HM9A 1A1RA 1XUIA 1W0ZU 1YPKH 1HYLA 4WXIA 4GCHF 4UD9H 1PQ5A 2NU0E 1OKXA 2BD3A 1Z71A 1C4V2 1P10A 1GBIA 1GDUA 4B71A 4BNRA 1NFYA 2VBCA 1XUHA 2ANWA 5A09A 5L6NH 2FLBH 6LPRA 2HPQH 2XBWA 3ZVGA 1GHAG 1FV9A 2Y82A 1ABJH 5ESBA 1WOFA 1HB0B 1UW7A 3TH2H 3LC3A 2OC1A 5T6GA 2J4IA 1GBAA 5E2OA 2G5NA 4CR9A 2A31A 2IJD1 3SI4H 2CF9H 1J17T 2FESH 1BRCE 1Z8JB 3STJA 2FYRA 4BTUB 3BTTE 3EQ0H 1SGEE 1AFQC 1C2IA 4NCYA 2OUAA 4ZHAA 2XCNA 1HAPH 4X8UH 1JBUH 3OEED 1EXFA 4Q7ZA 1OP8A 1HNEE 4MPVA 3RXMA 3U8TH 1S0QA 3VXFH 1HAOH 1GI9B 1YPMH 1Q2WA 3SGBE 4BAQB 1F7ZA 1V3XA 2WHXA 3TITA 1A5GH 4WMDA 3ATIA 2A2QH 1C2KA 3GCTF 1XXFA 1C1NA 1C9TA 3R3GB 3HGNA 4K3JA 3VGCC 5EPNA 2ZDVH 5EJZA 3PV2A 3ZV8A 3F9EA 1B5GH 1P57B 4CH8B 1P2MA 5HIYA 1SSXA 1G32B 3DHKH 3LGWA 1KLTA 1JMOH 3URCA 3TNTA 3RXSA 3IWMA 3GCHB 3TK6A 1TBZH 4DGJA 3SUDA 1O2SA 3QDZB 2QY0B 1OWDA 4RKOB 2W7SA 1VR1H 2ZU4A 3SGAE 4WH8A 1A7SA 1ZTJA 3RXLA 3D62A 1L2EA 1YCPH 2P3FH 3UTUH 2CJIA 1KMHB 3MYWA 1TPSA 3ELAH 3BTQE 3VFEA 4XDEA 1P09A 1RIWB 1QURH 3ZVAA 3E6PH 1IQEA 1FY8E 1O5AB 3OX7U 3URDA 2R0LA 3ITIA 4KELA 1NT1A 1GJ8B 1FY3A 3GICB 1IQIA 2EI8A 4FVBA 2EA3A 1ZOMA 1DSUA 3CS0A 3RDZA 1C5WB 1O36A 4U2WA 2BD4A 5L30H 3GYLB 3P95A 1Z1JA 1TAWA 3F9FA 1P01A 1C2MA 2WUCA 1E36B 3SI3H 1BHXF 2HNTF 5HXFA 3M5NA 2ZIQH 2VGCB 2A1DB 4E06H 4NG9H 3SU1A 1G36A 1WCZA 3MTYA 2ZF0H 3ZIAD 1S83A 1SHYA 3FP6E 1VGCB 1UO6A 4K1SA 6GCHF 1INCA 1VJAU 3ZZ8A 1G3CA 4Y6DA 1J8AA 1GI7B 2HLDD 2P59A 3EDXB 5GCHF 1NY22 1WQSA 4F48B 1YY3A 2J97A 3QZRA 1DT2A 3DFLA 1E1QD 2FX6A 2FX4A 1LO6A 4KTSA 1O3IA 4X1RU 3ZVCA 2GP9B 3QGNB 1AQ7A 2UUJB 3H7OA 1QNJA 4U32A 1NRRH 1O3BA 4KP0A 4XBDA 5LH8A 2ANKH 3CENA 4ABAA 3T25A 1ZSLA 2YNBA 4K69A 1C4Y2 3ATMA 4RKJB 1SQRA 1BMNH 3HK3B 4RI0A 3AASA 1GJCB 2QIQA 2KCPA 1TNIA 1Y3VA 2ZECA 1T32A 3MH6A 1GI4A 3GCHC 4FU9A 1CA8B 2RA3A 2OXSA 4YLQH 1JXPA 1QB1A 1VCWA 2SNWA 4JZ1A 2ZDKA 2WPHS 3UPEA 2NU1E 4B1TA 8ESTE 2P94A 2D1JA 2ZEBA 2A7CA 2PP6A 1AWHB 1C2GA 2WPLS 3QO6A 2BOKA 1H8IH 1OXGA 2XCFA 3RXRA 1TALA 2QAAA 2L6OA 1C5PA 2UWPA 1VITH 4MDSA 5E0HA 1SFQB 2EC9H 1MD7A 1V2OT 2PTNA 2P8OC 3FAOA 2QXIA 2PFEA 1SGFG 3BEUA 1ANEA 3SV2H 1P05A 3H5CB 5EJLA 1BMLA 3F1SB 3VB5A 2FI5E 3G01A 3PM3A 1KYNA 1HV7A 1TLDA 1H4WA 3RXFA 2FM2A 1P2QA 3PMAB 1V2TT 1SG8B 2AGGX 6CHAC 1AB9C 1OYQA 3EGKH 4TPYA 1EAUA 3HK6B 1ESBA 1O5GH 2D8WA 2P93A 4X0WU 2VJ1A 3M7QA 4FUJA 2C93B 4YTAA 2ZFSA 1B0FA 4NIWA 3SNAA 5A0CA 4WF8A 2ESTE 3E16B 3O8RA 3TIUA 3VEQB 3STIA 3SO3A 3ZZAA 3ZVDA 4ABEA 2DE9A 1VITF 1O2GH 1QRWA 1HJAC 1P2OA 1DOJA 2Z9LA 3FANA 3JZ1B 1ZLRA 2ZHEH 4ISNA 4Z6AH 5JBBS 1DM4B 1L4ZA 1SMFE 3EE7A 2KCOA 2QXHA 3O8BA 1DWCH 2BOHB 1UMAH 3AW1A 3T5FH 1NFUA 1AE8H 3RXUA 1P06A 1HCGA 2DE8A 2K1QA 1KXEA 1TFXA 3BG4B 1SL3A 1EP5A 1MMJN 4B74A 1O37A 4LZ4B 4KTCA 1F5RA 4Y0ZE 5DSFA 4YXWD 1BHXB 3KQDA 1HDTH 4A1TA 1DITH 1A0HB 1NU9A 3U9AH 1TA6A 3GY8A 1BTZA 1FI8A 5GPIB 4ASHA 3SUGA 4ABJA 1F2SE 1SGRE 3RP2A 4NIXA 4UONA 3CNRA 2TBSA 1XMNB 1CHOF 3VXEH 2BLOA 2ZGXH 1C1PA 1O3KA 4JK6A 1DS2E 1MKWH 1UVUH 1QA0A 2J5UA 1AWFH 1VKYA 2KZ4A 1EB2A 1FY1A 2WUBA 1UCYH 2FDAA 2P16A 3A81A 1EPTC 3ZVBA 1EAIA 1ELCA 1MUEB 1TRYA 3VG8A 4AFSA 4THNH 2ZTZA 1N1LA 2A0QB 2KR7A 1UTLM 1B0EA 2BVRH 3BEFB 1Z7KA 4ZMAH 5JBCS 2XBXA 1HAZB 4FU7A 4CRFA 2GX4A 2BMGB 4KTUA 4FXGH 1QJ7B 2OC8A 4A1XA 2HGTH 1W0YH 3ZZCA 1OYTH 1HRTH 1TX6A 5F53A 3UAIC 4OS7A 1COWD 1T8MA 1D3PB 4FUIA 1IQGA 2PSYA 2XYAA 1HAYB 1P02A 4OS2A 1IQLA 3UNRA 2J34A 2WPIS 3VB3A 3BTEE 1DANH 1AMHA 2ODQA 4NA7A 1J16A 2I6QA 4INKA 4B6EA 5FPYA 4HGCA 3LGVA 3QWCH 4FUFA 2XWAA 1UTQA 2STAE 1ZTKA 2CGAA 1SGIB 5E8EH 3TJVA 2BYAX 1GMHF 2BVXH 1Y5AT 3A87A 3BIUH 3QK1A 1EJAA 1L1NA 1Y5UT 1MABB 1C5VA 3ZVEA 1H8ED 1GBFA 3BG4C 2G5VA 3A8DA 1EP6A 1UHBB 1D3DB 1MCTA 1UVTH 3MH5A 1KLIH 3ATKA 4DY7B 1B7XB 3FVFB 1LPGB 1MAYA 5SGAE 3RMLH 5AHGH 2BD9A 1P0SH 1GHWH 4FOUC 1CT0E 1LHEH 1GBKA 1H9IE 1O2WA 5KEDA 8GCHG 3U98H 4AORA 1JIMA 3P92A 4MQAA 4Q80A 3SHCH 3P6ZB 1QTFA 5DKMA 3LC5A 3Q3YA 1CO7E 3BTGE 1A3BH 2WV4A 1MD8A 2IPQX 5DP5A 3PROA 3B9FH 3SV6A 4BAMB 1OSSA 3L6PA 2GGVB 3BIVH 3SJ8A 1PQ8A 2BXTH 1AKSB 1YC0A 4BXWA 2ZA5A 5F03A 3SU5A 4FUDA 3NKKA 2OQUA 1BDAA 3D65E 3GY6A 3LU9B 1O3CA 1GGDB 1F0SA 1TA2A 1T4UH 1W0JD 4YOGA 1O34A 3SW2B 2H5DA 1G2LA 5G4BA 4PROA 4IGDA 1QGFA 1FY5A 3RC4A 1MTNB 3LDXH 3HPTB 1P3EA 4CBNA 3N99A 1AU8A 3RMOH 3OTJE 4Z1MD 5E0JA 4K1TA 4Y76A 2BY5X 2IOTA 2F9OA 3MO6A 1C1MA 2AFQB 4X8TH 2W26A 5FL7D 2FPZA 3HKJB 2AIQA 4D9QA 1O2LA 1W8BH 4X2XA 5C1YA 5B6LA 2A5IA 4BAOB 1TONA 1DLEA 1PPZA 2PLXA 3UIRA 3EAJA 2ZFTA 2ZU3A 1Y59T 1AY6H 4F49A 3SJKA 2Z9IA 1O2NA 3TGKE 2J98B 3T29A 1D3TB 5FX5A 1NFWA 1ANBA 1AVGH 1WUNH 5E0GA 1HUTH 1TNHA 4AB9A 4O97A 3LGUA 2B0FA 2J38A 1C2DA 2ZHFH 1CT2E 1YKTA 5I25A 3NXPA 3LIWA 1NPMA 1UTOA 3TNSA 5EXLA 1AZ8A 4K2YA 1AGJA 2CV3A 4UFFH 4IS5A 4X2WA 2O8MA 2ZWLH 1D4PB 2ZFFH 4NWKA 1V2JT 5DG6A 1RTLA 1XX9A 2VVUA 1HAHH 1V6DA 3EYDA 1YPLH 4P00A 2TGTA 4YM9A 1YM0A 3GOVB 1ABIH 1E34B 5BRRE 1O5EH 2BDBA 5A8YA 1GVLA 3A89A 1CBWC 3F2GA 4X2YA 2R0KA 1GBEA 1AD8H 3F0OA 1CU1A 4J1YA 3BTWE 1EX3A 2VU8E 2ZDAH 2WV9A 1EJNA 3ODDA 3Q76A 1JOUB 1W0KD 2VINA 1BIOA 1AFQB 1TWXB 2VIDA 3D49H 2O8LA 5K7RA 5C20A 1FNIA 1MKXH 1C2FA 4XBCA 4K8BA 2R3UA 1HAIH 2C8WB 1XVOA 2H1UA 3VB7A 2JH5D 1S81A 2ZHQH 2Y7ZA 1ELAA 4M7GA 2FYQA 1SB1H 1C4U2 1ID5H 1CA0C 2O8WA 3A86A 4ZAEA 4Y11E 1SKYE 1UVOA 1C2JA 2BY6X 1TOMH 1TMTH 1Z1IA 1BTXA 1O3NA 3KN2A 5DP7A 1FY4A 1SLWB 7LPRA 2JETC 3MNSA 4JCNA 1PFXC 1YCPM 1ZRBA 5JBAS 2RDEA 2V7QD 3Q00A 1V2KT 4ASUD 1OWKA 3VGCB 2ASUB 1Y3WA 1SOTA 1PJPA 2GZ9A 3RXKA 4IBLH 1GJBB 1CGJE 1ZMNA 5EODA 5JBTA 3SNDA 5C1UA 3Q77A 1TGCA 2A5AA 3ZVFA 1A5HA 3KCGH 1OWJA 1UHBA 5AFZH 1EASA 3GISB 1HJ9A 2VWMA 3LKWA 4TSFD 3BTDE 2QA9E 5KECA 1CQQA 2C90B 2EY4C 3OYPA 3A7WA 1UCYE 2QV1A 1F5KU 3M5MA 1V2RT 2FI4E 1W2KH 2WV5A 5TCAA 1FJSA 2AYWA 1KSNA 1K9OE 1THSH 2GT8A 1O2KA 4NFEA 1GJ4H 1LHGH 1LHDH 1NBME 3BEIB 1SQTA 6ESTA 1MZDA 1O2UA 2NU3E 2ZDNA 2A45B 2ZGCA 4FUBA 2BDAA 4NZLA 4ABIA 5CDFE 3OFND 1ELFA 3QUMP 1AKSA 1AE5A 3L33A 5A0AE 1P2KA 2BD7A 4A7IB 4HI3A 1J14A 2KCYA 3P17H 2RFKC 3ZZ4A 1KIGH 3PYHA 3PV5A 1TNLA 1S5SA 3MWIU 1PYTC 1S6LA 4MPXA 5A0BA 2O8TA 1H9HE 2QYIA 1OWEA 3RXBA 2PGBB 4D7GA 1DY8A 3A8AA 4D76A 1EFRD 2C3SA 2JJ2D 1K1PA 1Q3XA 1T31A 3ODFA 5AF9H 1YLCA 4UE7H 1TBQH 1ARBA 5F8XA 4DIIH 1E38B 3N7OA 3S7HB 5EPYA 1S84A 1AHTH 1ZHPA 1SPJA 1Y3UA 2OINA 2G81E 3UNSA 4MLFB 4YESB 2ZU5A 4TY7A 4JK5A 3GDUA 2HRVA 4TT3D 1FZZA 5FBEA 3KYGA 3SORA 1O5CB 4ZHLU 1O38A 1DSTA 1EZXC 5IK2D 2AMDA 4I31A 1GBMA 3NPSA 4M9FA 3M3SA 1GCDA 2FOGA 2J98A 3E8LA 4NWLA 1GCTC 1O5DH 1BOQA 1SC8U 1NO9H 3A84A 2A7JA 2TRMA 1GVKB 1ZJDA 4IW4E 4BXSA 3KQEA 1ZHRA 3SZNA 1LQEA 3H7TA 1O2OA 2OLGA 4X1QU 1GBHA 3U28C 2F43B 1BBRK 2AERH 1GG6C 2EQNA 2BM2A 1LVOA 2PKSB 7GCHG 1GDQA 4I33A 1V2LT 2KFWA 3MU8A 4NA8A 1LQDB 1K0HA 1OHHD 4A5TS 1AN1E 2FS9A 2V3MA 2XBVA 3KIDU 1G3DA 1RXPA 1DE7H 2QXJA 4DURA 5CMXH 1LMWB 1T8OA 1E37B 2FEQH 1DXWA 2PHBA 2ZPSA 1ZHMA 1O2QA 2G4TA 1FPHH 1IHSH 1HGTH 5BPEA 2P8OB 3P70B 1NESE 2VNTA 4X6OA 3SUFA 3IG6B 1W7GH 1O2TA 1ETSH 2R2WU 3SNCA 4D9RA 1RTKA 1K28D 3QX5H 1KTSB 6CHAB 3EA8A 4ISOA 1AB9B 2FOFA 3UNQA 2BB4A 3MU4A 3U8RH 1TABE 2Q1JA 1A61H 2QF3A 1O2HA 5HMAA 1ORFA 1P12E 3GS9A 2GZ8A 4ZROA 2ZZUH 2OC0A 3SU3A 1HJAB 1H8HD 2CN0H 5T6FA 3RMMH 3OY6U 1EZQA 1ZMJA 5DP9A 5IYTA 5TJXA 8LPRA 3U1IB 3I29A 3M7UA 4OS1A 3K2UA 1NRQH 1BB0B 1GJ6A 2J94A 1WSSH 4INHA 2O8UA 4AG1A 3FZZA 4CRBA 5EXMA 1PPEE 5GDSH 4JZFH 3SNEA 1GJ5H 3F2FA 2CK3D 2GDEH 4H6TA 4X6MA 3PO1C 1ZJKA 2ZQ2A 4Y8YA 2XOKD 4BANB 2GV7A 2C4FH 2HVYB 2XBYA 3NUMA 1NTPA 3PWBA 1TE0A 2EEKA 3ZYEA 3S7KB 3PLPA 4ISHH 3MO3A 4WH6A 1TMBH 2IJOB 4MVNA 5T3HA 1RD3B 2AMQA 1ARCA 2PKSC 3VPKA 1K1NA 4U01A 4IN1A 2QF0A 5FXLA 1IHTH 2GT7A 2W3IA 2BD5A 2W6JD 3LOXA 1XVMA 1QL7A 3A7TA 3RLYH 2WPKS 4FVDA 4AYVB 1Y8TA 1O32A 1KTTB 3RXTA 2ZCHP 2GCHG 4DT7B 1SGQE 2V6NA 2A4OA 1XUKA 4NSVA 1CSOE 2ZDMA 3TK5A 1EPTB 1D9IA 3F68H 1FN8A 4MG3A 3KNXA 4CRCA 5CE1A 1ELDE 5EIYA 2G51A 1T8NA 2QC2A 3PMJA 4ABDA 3GCTG 2O9QA 3GY4A 4B6FA 2FIRH 1SQOA 4A92A 1O33A 7KMEH 3SUEA 2RA0A 4LZ1H 3LONA 2BQ6B 1P2JA 5LPEA 1QBVH 2RDLA 3OAAD 1GDNA 2A7HA 2AMPA 5T1VA 3UB0A 3RM2H 1AO5A 1J9CH 2A4GA 2I6SA 1Z6JH 3A83A 3GY5A 2PKAB 3LPRA 3OSYA 1TMUH 2BHGA 5HIZA 1IQMA 3ZZ7A 2UUYA 3RC6A 4JMYA 1MBMA 1MCVA 1C1OA 8GCHF 3F0PA 4Y10E 1EUFA 2KAIB 5L2ZH 3A7VA 4IC5A 1YLDA 5DN6D 1EAWA 3FKSD 1SOZA 1GHBF 5C94A 4GAWA 5F8ZA 2ALVA 2ZPRA 4E7RG 4YOIA 3MNCA 3SJIA 4BTIB 4GHTA 4I8HA 3WWBA 4CHAB 3VB4A 1CVWH 1ESAA 4FUCA 4MNVA 1ZYOA 1G3EA 1EKBB 2ZTYA 2FTLE 1S6FA 5GNDA 2YMSC 5ETXA 4XSKU 5DK1A 1O3MA 4YOJA 1LKAA 1D6WA 5JYIA 3OY5U 4UFDH 1F92A 1C5SA 3GDVA 2YOLA 1UVSH 1SI5H 1FN6A 2ZGBH 3RXOA 1FAXA 1VJ9U 4JYTA 4ZHMU 3RXIA 1AI8H 4AG2A 3MU1A 4Y8ZA 3QTVH 3UWIA 3PV4A 2VWNA 3P8OA 4I32A 5EW1H 3A88A 4HFPB 2R2MB 4DOQA 1K1MA 2PSXA 3TJOA 3T2NA 4X2VA 3SU0A 1NRSH 2ZCLP 2ANYA 3N7EA 4FETA 3TVJB 2ZFQH 1V2UT 2D26C 2J95A 2SGAA 1DFPA 3ZZ9A 1Z6EA 1OP0A 3B23B 5J4SA 1TNJA 1GMDF 2RCEA 4HZHA 3M7TA 3ATLA 3BF6H 3SU4A 4BTTB 1N8OC 2XWBI 1L1JA 1ANCA 3L3TA 1CT4E 1SBWA 1DUEA 1KXCA 5ESTE 3HKIB 3QZQA 2WYGA 3KQCA 2F9NA 1UTNA 3RU4T 3TJUA 4ABHA 3K65B 4RN6A 1BRAA 1TRMA 4MNWA 2PW8H 5A8ZA 1IOEA 3P8NA 4BAKB 1GHZA 1RRKA 1P9UA 4U30A 1LVBA 1O2RA 1QRXA 4B2BA 1HBTH 3GDSA 1O2ZA 2Z3CA 3TPIZ 1YF4A 1MQ5A 4IC6A 3SBKA 3U8OH 5GIBA 2NWNA 3CP7A 1QL9A 4DJZB 1NBMD 1RFNA 4CHAC 3T28A 2FOEA 1MKXK 1SGCA 3M61U 1OWHA 3MOCA 2Z7FE 1Z8IB 3K6YA 3HGPA 1VZQH 1GBDA 2XNDD 1ZPBA 1FLEE 2F4LA 1ELGA 4ZCNA 1EPTA 1WQVH 1CBWB 3ZZ5A 2BLQA 1O3JA 1GBBA 2UUFB 5ABWA 2OC7A 1TX7A 1HAXB 1A5IA 3BSQA 1GBJA 1OP2A 3JZ2B 3MNXA 4Y8XA 1O35A 2V0BA 5F6MA 1GWAA 3RXPA 1JRSA 2OBOA 5A2MH 1GBLA 1XXDA 1FX0B 3ENSB 3V12A 1CA0B 5IDKA 2PKAA 4R8TB 1NZQH 3SJOA 1SGFA 2Z9JA 5DP6A 3OEHD 1AFEH 2ULLA 9LPRA 2FLRH 2F9BH 1ETTH 2Y80A 2KAIA 3SOSA 2JETB 3QTOH 5TCCA 1O2JA 2VIWA 1ESTA 7ESTE 1AZZA 1JRTA 3FP7E 3R0FA 2BDCA 1GJAB 4UFEH 2HPPH 1GHAF 4B76A 4OS5A 5L2YH 3W1EA 1TQ7B 4E7NA 3C1KA 1C1WH 3S9CA 1OPHB 8KME2 2AGEX 2PUQH 1P2IA 3KF2A 1BT7A 2Y6TA 2ZU1A 5EQSA 2BXUH 1BTHH 3TH4H 3TU7H 4Y71A 1Y3YA 1V2VT 3A8BA 2VB0A 1YYY1 2F9VA 3F3BA 1MZAA 1CHOG 1GBTA 4A1VA 2XC0A 1O5FH 1GHVH 2GVFA 1SGDE 3RU4E 1W7XH 4WMFA 4O3UA 5EJ1A 4X1PU 1XM1A 2QGRA 2STBE 1FAKH 3KL6A 3MU5A 9ESTA 3KQBA 3KHVA 1F5LA 2CHAC 1PPFE 2J9NA 2GMTC 3DCLA 1MAXA 3S9AA 1QY6A 3B8JA 3GY7A 1W11U 3GCNA 1DICA 4HG6A 4ISIH 4Y7AA 4XRNA 1K1OA 3T26A 1LHFH 3LH3A 1AUTC 2M5TA 4AX9H 3S9BA 4AN7A 1C2EA 1D6RA 5HKKD 5DPAA 4DT4A 1L4DA 2H5CA 4OGXA 4D7FA 4YO9A 3BTKE 2Y5GA 3MMGA 4FUGA 4X8SH 1HAGE 2NU2E 4DW2U 3MO9A 1EB1H 2FZZA 1TGNA 3A7ZA 5LPFA 1N6XA 3PWCA 3KGPA 7GCHF 1BCUH 1K1IA 1O39A 1TYNA 3TH3H 2OBQA 1ZSKA 3KQ5A 2FI3E 1O30A 2JJ1D 4SGAE 1GCTB 1QA7A 1BRBE 4I86A 2BQWB 4YT7H 1YCPK 1XUFA 4MTBA 5CHBA 1BTPA 4LOYH 2ZFPH 5C17A 1TPAE 3RXGA 4CRGA 1NS3A 4BAHB 3QLPH 2QCYA 5FBIA 2FOHA 1BMAA 2PR3A 1PPGE 1NC6A 3MH4A 1C1SA 3ZZBA 1GG6B 1VCQA 4IMQA 1C9PA 1HAVB 3AVZA 4QT8C 3UOUA 2A5KA 3AW0A 5J4QA 3LT3A 1QJ1B 4ISLA 2A32A 3DT0H 1TGBA 3M3VA 1MH0A 1THRH 2XXLA 3SQHE 2BTCE 1O3GA 3DSPA 1P9SA 4CBOA 1S85A 1K22H 5C1XA 3S0NA 1P8VC 3P8FA 2Y7XA 3F9HA 1Z8RA 2AIPA 2VWLA 3FFGA 4I8KA 1LCYA 4Y0YE 5CHAC 5FAHA 1CE5A 2D2DA 1SGYE 3ZZ6A 3UR6A 1GHYH 1MU8B 4YZUA 2JIZD 5DP4A 2VWOA 3MFJA 1MTVA 3PMBB 4NSYA 2ODPA 2YMSD 5DJ7A 3IITA 1E1RD 1BTYA 3SGQE 4GHQA 3E91A 4UEHH 5C3NA 2P95A 5JDUB 2GTBA 2J2UA 3LGYA 1DDJA 4F4OC 4XD7D 2OK5A 1FIWA 1YPJH 1GJDB 3UOPA 1MTSA 2ZI2H 2W5EA 1QIXB 2K8IA 1EATA 3NZIA 4NZQA 3A7XA 4SGBE 4ZKOU 1THPB 4Q7XA 3W94A 1MTWA 1G3BA 1TPPA 1W13U 1GMCG 3HATH 2W6ID 3RXCA 4CH2B 1GI8B 1QQUA 1GI6A 3LH1A 3BN9A 1WTGH 1ELTA 1BZXE 1HPGA 1A0JA 1DPOA 3V7TA 1V2QT 2ZHWH 1LDTT 2UUKB 1TNGA 3PO1B 1DLKB 1QL8A 4O03A 1FDPA 1YP9A 3DD2H 2BQ7B 2GCHF 3TJNA 3BTFE 2AGIX 3GYMA 1ACBE 4OGYA 1S82A 2YNAA 1KY9A 1T8LA 2AHME 4ABGA 1BJUA 4IMZA 2L74A 3LGIA 1S6HA 2ZPQA 4O3TA 2TGDA 1SLXB 5C2ZA 3SV7A 4AGKA 3MNBA 1DUAA 4NFFA 3MHWU 1EZSC 1XUGA 3SN8A 2P3TB 1O3FA 4A6LA 4B2CA 4DCDA 4TWWA 1BA8B 5FCRA 1YLNA 1MTUA 4XE4A 3UQVA 2B8OH 4RSPA 2F9UA 3UY9A 3EA9A 3U1JB 3O8CA 2VIQA 5DP3A 1O2VA 4UDWH 2SNVA 1L0ZA 3QGJA 1A4WH 3EA7A 4CREA 1W14U 5EXNA 3AAVA 1P3CA 5PTPA 1Y3XA 1PQ7A 1BITA 5DGJA 2BD2A 5C0TA 3A7YA 1RS0A 2H9TH 3SQEE 1GI0A 4Y79A 2WPJS 1ZGIA 4XBBA 1O3PB 1C5RA 1WYKA 3OE7D 4F55A 3SZEA 3RMNH 2VIOA 1EOJA 3TGIE 4ABBA 1A2CH 1DVAH 3M37A 1ZZZA 2HLCA 1H8DH 3TLOA 1ZTLA 2JH6D 3Q3KA 2PV9B 3SU6A 3WWFA 2Y5HA 1W3CA 1O2YA
chains in the Genus database with same CATH topology
4I8LA 1AVWA 4WVPE 1C5YB 2BD8A 1C5MD 4J2YB 1E0FD 1C5XB 4MPUA 4AYYB 1GI2A 3F9GA 4GCHG 1PQAA 1D3QB 5T6DA 1OX1A 2BVSH 3MU0A 5C67A 1UJ1A 1CGIE 2F3CE 1UTJA 5EW2H 4TY6A 1IQJA 3RC5A 1HAVA 4GUXA 2JKHA 1LTOA 1AVXA 1SFIA 5HGGA 1DWEH 2H9HA 2F83A 3TGJE 1C5QA 2H2ZA 3M5OA 4WWYA 1SHHB 1ZPZA 3VB6A 1ELEE 2ZHDA 3RUOA 1KDQB 1MKWK 2WYJA 1SVPA 2VIVA 4ESTE 1GPZA 1UCYK 3CS7A 4IN2A 1W12U 2A4RA 3V13A 4YT6H 4NA9H 4AFQA 5FX6A 4MPWA 1FONA 4NIYA 3SNBA 1NU7B 2BDHA 3SHAH 1TQ0B 5HM2A 1SQAA 4DIHH 1OWIA 1T4VH 2A4QA 3W95A 5FHTA 1O3LA 2XRCA 5E2PA 2Z94A 4FU8A 2SGPE 3GY2A 1PPCE 1DWDH 2RG3A 2B7DH 1A0LA 3A8CA 2ZQ1A 2FWWA 4GLYA 1WV7H 3LJJA 1BTUA 3TK9A 1Q31A 1A46H 2BX3A 2QN5T 1OS8A 4H6SB 1BMMH 2BY7X 1X7AC 5H4IB 1PPBH 1BJVA 2G55A 1LPZB 4ZKNU 1RIWC 2FOMB 1BQYA 1NFXA 1N8OB 2GV6A 4INLA 1TGSZ 1K1LA 3U69H 1EJMA 1Z8GA 1BBRH 5JPMH 1C5LH 2G00A 4AFZA 1FXYA 2G8TA 2PGQB 2BX4A 1UK2A 2Z3EA 1WBGB 2ZDLA 3KEEA 4JYUH 5A8XA 1C5NH 4WMEA 1O2XA 4NGAH 2FXRA 4I8JA 2GDDA 2GKVE 2VGCC 4OS4A 2H6MA 3I77A 1O2IA 4B75A 3E1XB 4JZEH 2ZCKP 1QHRB 1VGCC 1C5OH 3RXHA 2UWOA 3FP8E 2R9PA 1F0UA 3NWUA 1F0TA 5AVDA 3EE0B 3RU4D 2Q6FA 2HALA 1K1JA 2FP7B 1HFDA 5HYOA 2XC4A 1P04A 3DFJA 2BDGA 1IAUA 4AZ2B 3UWJH 1HLTH 2BY8X 3E90B 1LPKB 1QBOA 1FQ3A 3T62A 1H1BA 2C8XB 3M5LA 2FTMA 5LGOA 2BDYA 4ZUHA 1V2NT 1KLJH 2G4UA 2OTVA 1HIAB 3BTHE 4B73A 3K6ZA 1QBNA 4TWYA 2OCVB 3GY3A 2TGAA 3LGTA 4GPGA 6GCHG 4OS6A 1EOLA 1UTMA 1C5UA 2V3OH 4UFGH 1FIZA 5GCHG 2SFAA 2TIOA 1V2MT 4VGCB 3BTME 1K2I1 2PWXA 2ODYB 2C8ZB 3ZZ3A 2V3HH 1O31A 2Q6GA 1SGNE 1QRZA 5EQRA 4E05H 5AFYH 1TOCB 5C5NA 3ZYDA 1NM6A 1GI5A 3RXEA 2DUCA 2GZ7A 2LNCA 1ANDA 1PPHE 2HOBA 1DY9A 2ZTXA 2ZGHA 2F9PA 3S69A 4Y7BA 1O2MA 4Q7YA 2WINI 1RJXB 1M9UA 1PYTD 5GJ4B 1KXDA 5C5OA 3LJOA 1UK3A 2ZP0H 3RXJA 2VIPA 4X6PA 1WTHD 3RLWH 3SU2A 3UQOA 1BTWA 3UREA 3E3TA 1A3EH 4JYVH 1MBQA 1MQ6A 1V2PT 2ZO3H 1IQKA 2FODA 3QN7A 1LKBA 3BV9B 1QB6A 5GWZA 1NRPH 1UVPA 2ZNKH 1EAXA 1SGTA 4R0IA 1KDQA 1ZMLA 4X6NA 2ZFRH 3T27A 2ZGJA 2PTCE 2HNTE 2FS8A 4GVUA 3UFAA 1DX5M 4AOQA 1QCPA 2BY9X 1V2WT 4X1NU 1GHXH 1IQHA 2ANMH 2AS9A 3RXDA 4K5ZA 2Z9KA 4FUHA 4Q2KA 2FMJA 2CF8H 4FUEA 2BLVA 1L1GA 4K1EA 1EZUC 1HJ8A 1S0RA 3SJ9A 1YPEH 3OU0A 4ZXXH 2EI6A 3V0XA 1KXBA 4AB8A 1C1TA 1O3DA 1GBCA 2CHAB 1UK4A 4I7YH 2C8YB 2GMTB 1TRNA 1P11E 1C2HA 4TYDA 1RTFB 1QFKH 5I46H 4NIVA 1TX8A 3PTNA 3NK8A 1OOKB 1XKAC 2VVVA 5EG4A 1RGQA 1LHCH 2XW9A 3PMHB 1IQNA 1C1RA 4MNYA 3DA9B 1EQ9A 1P2NA 3UUZA 1ZR0A 1P03A 3A80A 5JB8S 1ZGVA 2BZAA 2HVXA 1C1UH 4H42U 2FOCA 4B2AA 1FMGA 4WJG2 4KKDA 4VGCC 1VITG 4LXBH 1F0RA 1SR5C 1YPHE 4GSOA 3F6UH 3DUXH 4LK4A 2GCTB 1T7CA 3PB1E 2CXVA 1FUJA 1O5BB 2HNTC 3ZV9A 2SGEE 3O8DA 2H9EH 1O3AA 1U6QA 5FPTA 1SLVB 3ZZDA 1GHBG 4ZKRU 1E35B 1ELBA 2W3KA 2W7UA 1K21H 2Z9GA 2ZKSA 2BLWA 2UWLA 3SV8A 4ZKSU 5LPRA 2B5TB 1G37A 4WY3A 1QR3E 1NRNH 4WXVA 1TGTA 3A85A 2EI7A 5EOKA 1CGHA 1ETRH 4ABFA 2R3YA 2OQ5A 3WY8A 3MH7A 4H4FA 3I78A 3PTBA 4BOHA 1FPCH 1XKBC 1WU1A 3ATWA 4JZDH 1QJ6B 1ZRKA 2XNIA 2Z6BD 1GVZA 1HXFH 2WPMS 2VH0A 4XFQA 2TPIZ 2ZU2A 2JH0D 1KXAA 2LPRA 3M36A 2XTTB 1HIAA 3Q3XA 4XOJA 2BDIA 2OD3B 3BG8A 1O3EA 1YPHC 4ZH8A 1O2PA 2BZ6H 1H9LB 3RM0H 3MI4A 1GL1A 3V3MA 1O0DH 4AFUA 1ELVA 1J15A 1G9IE 1N6YA 1Y5BT 2P3UB 2THFB 5CHAB 3PLBA 2IN2A 1G2MA 1IQFA 5F8TA 1HXEH 4CRAA 2NU4E 1GMCF 5FCKA 1BBRE 3M35A 5EU8A 1GMDG 1QB9A 3K9XB 4YLUA 4D8NA 1C1QA 3PLKA 5GXPA 3SV9A 1TIOA 5EGMA 3D23A 5FPSA 1SGPE 4X8VH 2F91A 4K60A 1BRUP 1WAYB 3UR9A 4DG4A 4AGJA 3E0PB 1TNKA 1XUJA 2SGDE 3P8GA 3E0NB 2FOAA 2OP9A 1GI3A 2A2XH 2QXGA 1KXFA 1AIXH 3RXAA 5DO4H 5DP8A 2VVCA 2VH6A 1GJ9B 1YPGH 4MNXA 2V35A 2GCTC 3M3TA 1C1VH 2XC5A 1JIRA 2PUXB 2Q6DA 4K8YA 3RXVA 1YBWA 1DXPA 1V2ST 1UTPA 1GJ7B 2SGFE 1AUJA 1GMHG 1DWBH 1LVMA 1O3HA 5K0HA 1UTKA 5B6OA 4JZIA 4Z0KA 1W10U 1MU6B 4CR5A 4DVAU 2AEIH 4HTCH 1C5TA 4I8GA 2Z3DA 1GGDC 2Y81A 1GL0E 1SLUB 1NN6A 1O3OA 1C2LA 3AAUA 2IPHA 2ILNA 1MTNC 3RXQA 2TGPZ 2ZC9H 4O9VA 1C5ZB 1TB6H 1TPOA 2G52A 1BUIA 2GD4B 1NROH 1G30B 1ZPCA 3C27B 2SGQE 5EQQA 1JWTA 1VCPA 3FZDA 1CHGA 2AH4X 2B9LA 2FO9A 4X1SU 1QQ4A 2Y5FA 1GI1A 1ZSJA 1LVYA 2J92A 3A82A 2FOBA 2ALPA 1TBRH 2HWLB 2ZG0H 4TPIZ 4KGAA 3ESTA 2CMYA 3GCOA 1YGCH 4CRDA 3NCLA 4ZXYH 5JB9S 5HM9A 1A1RA 1XUIA 1W0ZU 1YPKH 1HYLA 4WXIA 4GCHF 4UD9H 1PQ5A 2NU0E 1OKXA 2BD3A 1Z71A 1C4V2 1P10A 1GBIA 1GDUA 4B71A 4BNRA 1NFYA 1XUHA 2ANWA 5A09A 5L6NH 2FLBH 6LPRA 2HPQH 2XBWA 3ZVGA 1GHAG 1FV9A 2Y82A 1ABJH 5ESBA 1WOFA 1HB0B 3TH2H 3LC3A 2OC1A 5T6GA 2J4IA 1GBAA 5E2OA 2G5NA 4CR9A 2A31A 3SI4H 2CF9H 1J17T 2FESH 1BRCE 1Z8JB 3STJA 2FYRA 4BTUB 3BTTE 3EQ0H 1SGEE 1AFQC 1C2IA 4NCYA 2OUAA 4ZHAA 2XCNA 1HAPH 4X8UH 1JBUH 1EXFA 4Q7ZA 1OP8A 1HNEE 4MPVA 3RXMA 3U8TH 1S0QA 3VXFH 1HAOH 1GI9B 1YPMH 1Q2WA 3SGBE 4BAQB 1F7ZA 1V3XA 3TITA 1A5GH 4WMDA 3ATIA 2A2QH 1C2KA 3GCTF 1XXFA 1C1NA 1C9TA 3R3GB 3HGNA 4K3JA 3VGCC 5EPNA 2ZDVH 3ZV8A 3F9EA 1B5GH 1P57B 4CH8B 1P2MA 1SSXA 1G32B 3DHKH 3LGWA 1KLTA 1JMOH 3URCA 3TNTA 3RXSA 3IWMA 3GCHB 3TK6A 1TBZH 4DGJA 3SUDA 1O2SA 3QDZB 2QY0B 1OWDA 4RKOB 2W7SA 1VR1H 2ZU4A 3SGAE 4WH8A 1A7SA 1ZTJA 3RXLA 3D62A 1L2EA 1YCPH 2P3FH 3UTUH 2CJIA 3MYWA 1TPSA 3ELAH 3BTQE 3VFEA 4XDEA 1P09A 1RIWB 1QURH 3ZVAA 3E6PH 1IQEA 1FY8E 1O5AB 3OX7U 3URDA 2R0LA 3ITIA 4KELA 1NT1A 1GJ8B 1FY3A 3GICB 1IQIA 2EI8A 4FVBA 2EA3A 1ZOMA 1DSUA 3CS0A 3RDZA 1C5WB 1O36A 4U2WA 2BD4A 5L30H 3GYLB 3P95A 1Z1JA 1TAWA 3F9FA 1P01A 1C2MA 2WUCA 1E36B 3SI3H 1BHXF 2HNTF 5HXFA 3M5NA 2ZIQH 2VGCB 2A1DB 4E06H 4NG9H 3SU1A 1G36A 1WCZA 3MTYA 2ZF0H 1S83A 1SHYA 3FP6E 1VGCB 1UO6A 4K1SA 6GCHF 1INCA 1VJAU 3ZZ8A 1G3CA 4Y6DA 1J8AA 1GI7B 2P59A 3EDXB 5GCHF 1NY22 1WQSA 3QZRA 1DT2A 3DFLA 2FX6A 2FX4A 1LO6A 4KTSA 1O3IA 4X1RU 3ZVCA 2GP9B 3QGNB 1AQ7A 2UUJB 3H7OA 1QNJA 4U32A 1NRRH 1O3BA 4KP0A 4XBDA 5LH8A 2ANKH 3CENA 4ABAA 3T25A 1ZSLA 2YNBA 4K69A 1C4Y2 3ATMA 4RKJB 1BMNH 3HK3B 3AASA 1GJCB 2QIQA 1TNIA 1Y3VA 2ZECA 1T32A 3MH6A 1GI4A 3GCHC 4FU9A 1CA8B 2RA3A 2OXSA 4YLQH 1JXPA 1QB1A 1VCWA 2SNWA 4JZ1A 2ZDKA 2WPHS 3UPEA 2NU1E 4B1TA 8ESTE 2P94A 2D1JA 2ZEBA 2A7CA 1AWHB 1C2GA 2WPLS 3QO6A 2BOKA 1H8IH 1OXGA 2XCFA 3RXRA 1TALA 2QAAA 1C5PA 2UWPA 1VITH 4MDSA 5E0HA 1SFQB 2EC9H 1MD7A 1V2OT 2PTNA 2P8OC 3FAOA 2QXIA 2PFEA 1SGFG 3BEUA 1ANEA 3SV2H 1P05A 3H5CB 1BMLA 3F1SB 3VB5A 2FI5E 3G01A 3PM3A 1KYNA 1HV7A 1TLDA 1H4WA 3RXFA 2FM2A 1P2QA 3PMAB 1V2TT 1SG8B 2AGGX 6CHAC 1AB9C 1OYQA 3EGKH 4TPYA 1EAUA 3HK6B 1ESBA 1O5GH 2D8WA 2P93A 4X0WU 2VJ1A 3M7QA 4FUJA 2C93B 4YTAA 2ZFSA 1B0FA 4NIWA 3SNAA 5A0CA 4WF8A 2ESTE 3E16B 3O8RA 3TIUA 3VEQB 3STIA 3SO3A 3ZZAA 3ZVDA 4ABEA 2DE9A 1VITF 1O2GH 1QRWA 1HJAC 1P2OA 1DOJA 2Z9LA 3FANA 3JZ1B 1ZLRA 2ZHEH 4ISNA 4Z6AH 5JBBS 1DM4B 1L4ZA 1SMFE 2QXHA 3O8BA 1DWCH 2BOHB 1UMAH 3AW1A 3T5FH 1NFUA 1AE8H 3RXUA 1P06A 1HCGA 2DE8A 2K1QA 1KXEA 1TFXA 3BG4B 1SL3A 1EP5A 1MMJN 4B74A 1O37A 4LZ4B 4KTCA 1F5RA 4Y0ZE 1BHXB 3KQDA 1HDTH 4A1TA 1DITH 1A0HB 1NU9A 3U9AH 1TA6A 3GY8A 1BTZA 1FI8A 5GPIB 4ASHA 3SUGA 4ABJA 1F2SE 1SGRE 3RP2A 4NIXA 4UONA 2TBSA 1XMNB 1CHOF 3VXEH 2BLOA 2ZGXH 1C1PA 1O3KA 4JK6A 1DS2E 1MKWH 1UVUH 1QA0A 1AWFH 1EB2A 1FY1A 2WUBA 1UCYH 2FDAA 2P16A 3A81A 1EPTC 3ZVBA 1EAIA 1ELCA 1MUEB 1TRYA 4AFSA 4THNH 2ZTZA 1N1LA 2A0QB 1UTLM 1B0EA 2BVRH 3BEFB 1Z7KA 4ZMAH 5JBCS 2XBXA 1HAZB 4FU7A 4CRFA 2GX4A 2BMGB 4KTUA 4FXGH 1QJ7B 2OC8A 4A1XA 2HGTH 1W0YH 3ZZCA 1OYTH 1HRTH 1TX6A 4OS7A 1T8MA 1D3PB 4FUIA 1IQGA 2PSYA 2XYAA 1HAYB 1P02A 4OS2A 1IQLA 3UNRA 2J34A 2WPIS 3VB3A 3BTEE 1DANH 1AMHA 2ODQA 4NA7A 1J16A 2I6QA 4INKA 5FPYA 4HGCA 3LGVA 3QWCH 4FUFA 2XWAA 1UTQA 2STAE 1ZTKA 2CGAA 1SGIB 5E8EH 3TJVA 2BYAX 1GMHF 2BVXH 1Y5AT 3A87A 3BIUH 3QK1A 1EJAA 1L1NA 1Y5UT 1C5VA 3ZVEA 1GBFA 3BG4C 2G5VA 3A8DA 1EP6A 1UHBB 1D3DB 1MCTA 1UVTH 3MH5A 1KLIH 3ATKA 4DY7B 1B7XB 3FVFB 1LPGB 1MAYA 5SGAE 3RMLH 5AHGH 2BD9A 1P0SH 1GHWH 1CT0E 1LHEH 1GBKA 1H9IE 1O2WA 8GCHG 3U98H 4AORA 1JIMA 3P92A 4MQAA 4Q80A 3SHCH 3P6ZB 1QTFA 5DKMA 3LC5A 3Q3YA 1CO7E 3BTGE 1A3BH 2WV4A 1MD8A 5DP5A 3PROA 3B9FH 3SV6A 4BAMB 1OSSA 3L6PA 2GGVB 3BIVH 3SJ8A 1PQ8A 2BXTH 1AKSB 1YC0A 4BXWA 2ZA5A 5F03A 3SU5A 4FUDA 3NKKA