1G9RA

Crystal structure of galactosyltransferase lgtc in complex with mn and udp-2f-galactose
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
282
structure length
278
Chain Sequence
MDIVFAADDNYAAYLCVAAKSVEAAHPDTEIRFHVLDAGISEANRAAVAANLRGGGGNIRFIDVNPEDFAGFPLNIRHISITTYARLKLGEYIADCDKVLYLDIDVLVRDSLTPLWDTDLGDNWLGASIDLFVERQEGYKQKIGMADGEYYFNAGVLLINLKKWRRHDIFKMSSEWVEQYKDVMQYQDQDILNGLFKGGVCYANSRFNFMPTNYAFMASRHTDPLYRDRTNTVMPVAVSHYCGPAKPWHRDCTAWGAERFTELAGSLTTVPEEWRGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSYL TRANSFERASE
publication title Crystal structure of the retaining galactosyltransferase LgtC from Neisseria meningitidis in complex with donor and acceptor sugar analogs.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
total genus 92
structure length 278
sequence length 282
ec nomenclature ec 2.4.1.-:
pdb deposition date 2000-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1g9rA00
2V0LA 2JCLA 4E1KA 5CMIA 3ZGFA 3T7OA 2ICYA 3IOJA 3V8YA 5EJ1A 5FU8A 3K8DA 1ZIZA 4ASJA 1IIMA 5FTSA 2FY7A 2I5KA 3USRA 3I0JA 3ZLLA 5DDVA 1H4EA 1W55A 2AM5A 3CKVA 1OMZA 4K6RA 1ZHJA 1IINA 4HG6A 4Y7UA 4EEMA 4AYJA 1VZUA 1R7YA 1ZDGA 2VD4A 4EEOA 5C8RA 1V83A 3BCVA 3SX3A 4B2WA 1H5RB 1H7HA 4FROA 1MC3A 1EYRA 1O23B 1XHBA 3PKQA 1G0RA 2RIXA 2OI5A 1G8OA 3V0NA 4B42A 5CMHA 1H7QA 2OEFA 3V0MA 1V82A 2WE9A 4IRQA 1G23A 2O1FA 5CMFX 1VZTA 1FO8A 1H7EA 3GUEA 3SPTA 3V0OA 1H5TB 2JCOA 3Q80A 1ZJ1A 1H7LA 3DUVA 3R2WA 5FTVA 4Y7TA 5CQMX 3IOIA 1PZTA 1JV1A 3OAMA 1FGXA 5AJPA 2X60A 1VGUA 4M4KA 3OH0A 3JUJA 4G87A 1ON8A 2RJ6A 4HO2A 5FU0A 2AE7A 1MP3A 4FRMA 5C4EA 1TVYA 1G97A 1Z90A 2RJ7A 1OMXA 3R3IA 2YCMA 4KC1A 1JYKA 3SXCA 3RMVA 4AC3A 4B3UA 1JYLA 1ZI1A 4FRPA 3QVBA 5BXCA 2PX7A 2W0WA 3D98A 1FR8A 1K4VA 3CKOA 4HO9A 5CQNX 1GWVA 2D0JA 2D7RA 3I0CA 1PZYB 1LVWA 1TW5A 2W0VA 2RIZA 1FR9A 3ZLKA 3PKPA 2ICXA 2V0JA 3OH4A 3SXGA 1HM0A 5L6VA 2X5ZA 3V90A 3V91A 4B4MA 4M28A 4ARWA 3ZF8A 2O1GA 4Y6UA 1LZJA 4IRPA 5C4FA 4ECMA 1HJLA 3T7MA 1FXJA 1H5SC 1E5KA 1WT0A 1G95A 4UEGA 1LZIA 2XMEA 2YC5A 5C3DA 2AESA 3I0GA 3RMWA 4HCQA 4B4BA 5C1GA 3CKJA 1H7GA 4L41C 1FOAA 1ZI5A 2XWLA 1WVCA 1HM9A 2UX8A 1ZI3A 5C47A 3CKNA 3I0LA 1GX4A 2ZU9A 2E3DA 4M2BA 4EEGA 1NMMB 1GQCA 2RJ0A 2RITA 4HOCA 1EZIA 5C3BA 4ZDQA 4R7PA 4FRAA 1YP4A 4FCEA 2Y4JA 4HO6A 3CGXA 1FRWA 4NAIA 1FZWA 2Y4MA 4KC2A 2RJ5A 3U2UA 1TZFA 5IDTA 2WEEA 3I0FA 2VS5A 1INIA 2VXLA 1O0RA 3U0YA 4HO8A 5C4DA 4MNDA 1O7OA 2GGQA 1ZJ0A 1I52A 2GGOA 5DDTA 4FRDA 5C38A 1H5SA 1VPAA 1MP4A 2YC3A 2Y6PA 3E25A 5CMJA 3Q4SA 5EIYA 1FXOA 4NALA 2FFUA 1WSZA 2P73A 3NGWA 2JCJA 4NANA 1VZXA 1H7TA 3OH3A 2V0KA 4JD0A 1H4CA 3ZGGA 5CMGX 3IOHA 5FUHA 2MZBA 3SXDA 3I0EA 1QGSA 4DE7A 1FGGA 4JISA 4FRHA 1GA8A 1R7TA 1R7XA 1R81A 1W77A 1S4PA 1ZDFA 3OH2A 5FYEA 3SX5A 1VGZA 3D5NA 5I1FA 1HJJA 3OKRA 2AECA 5IDSA 3I0KA 2VSHA 3KIAA 4P02A 4XWIA 5FV9A 2OI6A 2XWMA 4Y62A 1R7VA 4Y63A 1H3MA 4P00A 1H5RA 3F1YA 3EE5A 1GX0A 2QGIA 1GWWA 3I0IX 4B4GA 4FRLA 1OQMB 3HL3A 3T7NA 4EVWA 4KNRA 3PNNA 4HO0A 4HO3A 1S4OA 2Y4KA 3F1CA 4BQHA 2FYCB 4KC4A 1WT2A 4EE3A 1HM8A 1ZCTA 1TW1A 3D8VA 4G3QA 2QH5A 3OH1A 2DPWA 2RJ1A 2V0HA 3K8EA 2BO8A 3SXBA 3JTJA 1ZCVA 1NWGB 2Q4JA 4MYBA 3LW6A 1S4NA 2AGDA 3Q7UA 1ZI4A 2RJ4A 5HS2A 5L6SA 1QG8A 2VS3A 1NKHB 2JCKA 2D7IA 3JUKA 1R82A 4CVHA 4KRVA 4D11C 3U2XA 5IFYA 4Y7GA 1JVDA 1YP2A 5EJZA 2FYDB 2WGZA 5C36A 2O1HA 5C48A 2APCA 1G9RA 1ZJ2A 1ZCYA 5AJOA 2ZU7A 2VSIA 2I7BA 3USQA 1W57A 3N9WA 4KNXA 4KPZA 1V84A 5CQLX 2QKXA 1SS9A 3FWWA 1R7UA 2X5SA 5JQQA 3V8ZA 4FREA 2RJ8A 4CJCA 4Y7VA 2WAWA 2V0IA 2BO4A 2P6WA 1FG5N 1VH1A 4FQWA 2AM3A 1WT1A 2E8BA 3OGZA 2BO7A 2PGVA 4HO5A 4LW3A 4Y6NA 3SXAA 1MP5A 1NF5B 2XWNA 2NXVA 4G3SA 1JVGA 4HO4A 4D0TA 2YQHA 3V0QA 3DJ4A 1LZ7A 2RJ9A 2ZU8A 4KPXA 5C49A 2RIYA 3U2VA 1NQIB 1ZJOA 4FRQA 1VM8A 2I5EA 4D0ZA 1R80A 4G3PA 4D11A 3E26A 2WVKA 3TQDA 4DECA 5C1LA 1VGWA 1VGTA 1ZCUA 4EEAA 1ON6A 3TZTA 2Y7AA 1HV9A 1G3LA 4B5BA 3SX7A 1LL3A 2YQSA 1H4DA 1YROB 2Z87A 1QGQA 4J18A 4KXOA 4EE5A 2XMHA 2Y4LA 1G1LA 5C4CA 2AH9A 2FYAA 2VXMA 5J49A 4FRBA 5C3AA 5AJNA 3BRKX 4LW6A 2X65A 4BMAA 1H7FA 1NHEB 1LL0A 2YQCA 3SXEA 1ZJ3A 5C4BA 1G2VA 2P72A 4CJBA 1YP3A 3U2TA 1H5SD 4Y9XA 4D48A 3U2WA 2BO6A 1FWYA 1H5TA 3U0XA 1KWSA 2OEGA 4KQLA 4YS8A 3DK5A 2A8WA 3POLA 4ASYA 3SX8A 2FFVA 4EE4A 4KT7A 4GBPA 1WT3A 1GQ9A 1O7QA 3CU0A 4C2SA 4DDZA 3RSBA 2CU2A 2AM4A 2A8UA 2YESA 2PA4A 2VS4A 5C1HA 3ST8A 3CKQA 4AAWA 3V0LA 1H5SB 4FCUA 4B2XA 2WVLA 3I0HA 2YQJA 4Y7FA 1LL2A 3I0DA 1INJA 4M2AA 2VFZA 2Z86A 1VICA 3V0PA 3O3PA 1JV3A 1ZJPA 2OI7A 1G93A 2FYBA 5CQPA 2PGYA 3FOQA 1XZ6A 4Y64A 1FO9A 3OC9A 1LZ0A 1VH3A 4NAKA 4AYLA 1QWJA 5CQOA 2WVMA 4CJ8A
chains in the Genus database with same CATH superfamily
2V0LA 2JCLA 4E1KA 5CMIA 3ZGFA 3T7OA 2ICYA 3IOJA 3V8YA 5EJ1A 5FU8A 3K8DA 1ZIZA 4O6NA 1IIMA 4ASJA 5FTSA 2FY7A 2I5KA 3USRA 3I0JA 3ZLLA 5DDVA 1H4EA 1W55A 2AM5A 3CKVA 1OMZA 4K6RA 1ZHJA 1IINA 4HG6A 4Y7UA 4EEMA 4AYJA 1VZUA 1R7YA 1ZDGA 2VD4A 4EEOA 5C8RA 1V83A 3BCVA 3SX3A 4B2WA 1H5RB 1H7HA 4FROA 1MC3A 1EYRA 1O23B 1XHBA 3PKQA 1G0RA 2RIXA 2OI5A 1G8OA 3V0NA 4B42A 5CMHA 1H7QA 2OEFA 3V0MA 1V82A 2WE9A 4IRQA 1G23A 2O1FA 5CMFX 1VZTA 1FO8A 1H7EA 3GUEA 3SPTA 2J0AA 3V0OA 1H5TB 2JCOA 3Q80A 1ZJ1A 1H7LA 3DUVA 3R2WA 5FTVA 4Y7TA 5CQMX 3IOIA 1PZTA 1JV1A 3OAMA 1FGXA 5AJPA 2X60A 1VGUA 4M4KA 3OH0A 3JUJA 4G87A 1ON8A 2RJ6A 4HO2A 5FU0A 2AE7A 1MP3A 4FRMA 5C4EA 1TVYA 1G97A 1Z90A 2RJ7A 1OMXA 3R3IA 2YCMA 4KC1A 1JYKA 3SXCA 3RMVA 4AC3A 4B3UA 1JYLA 1ZI1A 4FRPA 3QVBA 5BXCA 2PX7A 2W0WA 3D98A 1FR8A 1K4VA 3CKOA 4HO9A 5CQNX 1GWVA 2D0JA 2D7RA 3I0CA 1PZYB 1LVWA 1TW5A 2W0VA 2RIZA 1FR9A 3ZLKA 3PKPA 2ICXA 2V0JA 3OH4A 3SXGA 1HM0A 5L6VA 2X5ZA 3V90A 4O6MA 5D91A 3V91A 4B4MA 4M28A 4ARWA 3ZF8A 2O1GA 4Y6UA 1LZJA 4IRPA 5C4FA 4ECMA 1HJLA 3T7MA 1FXJA 1H5SC 1E5KA 1WT0A 1G95A 4UEGA 1LZIA 2XMEA 2YC5A 5C3DA 2AESA 3I0GA 3RMWA 4HCQA 4B4BA 5C1GA 3CKJA 1H7GA 4L41C 1FOAA 1ZI5A 2XWLA 1WVCA 1HM9A 2UX8A 1ZI3A 5C47A 3CKNA 3I0LA 1GX4A 2ZU9A 2E3DA 4M2BA 4EEGA 1NMMB 1GQCA 2RJ0A 2RITA 4HOCA 1EZIA 5C3BA 4ZDQA 4R7PA 4FRAA 1YP4A 4FCEA 2Y4JA 4HO6A 3CGXA 1FRWA 4NAIA 1FZWA 2Y4MA 4KC2A 2RJ5A 3U2UA 1TZFA 5IDTA 2WEEA 3I0FA 2VS5A 1INIA 2VXLA 1O0RA 3U0YA 4HO8A 5C4DA 4MNDA 1O7OA 2GGQA 4MIXA 1ZJ0A 1I52A 2GGOA 5DDTA 4FRDA 5C38A 1H5SA 1VPAA 1MP4A 2YC3A 2Y6PA 3E25A 5CMJA 3Q4SA 5EIYA 1FXOA 4NALA 2FFUA 1WSZA 2P73A 3NGWA 2JCJA 4NANA 1VZXA 1H7TA 3OH3A 2V0KA 4JD0A 1H4CA 3ZGGA 5CMGX 3IOHA 5FUHA 2MZBA 3SXDA 3I0EA 1QGSA 4DE7A 1FGGA 4JISA 4FRHA 1GA8A 1R7TA 1R7XA 1R81A 1W77A 1S4PA 1ZDFA 3OH2A 5FYEA 3SX5A 1VGZA 3D5NA 5I1FA 1HJJA 3OKRA 5D92A 2AECA 5IDSA 3I0KA 2VSHA 3KIAA 4P02A 4XWIA 5FV9A 2OI6A 2XWMA 4Y62A 1R7VA 4Y63A 1H3MA 4P00A 1H5RA 3F1YA 3EE5A 1GX0A 2QGIA 1GWWA 3I0IX 4B4GA 4FRLA 1OQMB 3HL3A 3T7NA 4EVWA 4KNRA 3PNNA 4HO0A 4HO3A 1S4OA 2Y4KA 4Q7CA 3F1CA 4BQHA 2FYCB 4KC4A 1WT2A 4EE3A 1HM8A 1ZCTA 1TW1A 3D8VA 4FIYA 4G3QA 2C0NA 2QH5A 3OH1A 2DPWA 2RJ1A 2V0HA 4FIXA 3K8EA 2BO8A 3SXBA 3JTJA 1ZCVA 1NWGB 2Q4JA 4MYBA 3LW6A 1S4NA 2AGDA 3Q7UA 1ZI4A 2RJ4A 5HS2A 5L6SA 1QG8A 2VS3A 1NKHB 2JCKA 2D7IA 3JUKA 1R82A 4CVHA 4KRVA 4D11C 3U2XA 5IFYA 4Y7GA 1JVDA 1YP2A 5EJZA 2FYDB 2WGZA 5C36A 2O1HA 5C48A 2APCA 1G9RA 1ZJ2A 1ZCYA 5AJOA 2ZU7A 2VSIA 2I7BA 3USQA 1W57A 3N9WA 4KNXA 4KPZA 1V84A 5CQLX 2QKXA 1SS9A 3FWWA 1R7UA 2X5SA 5JQQA 3V8ZA 4FREA 2RJ8A 4CJCA 4Y7VA 2VK9A 2V0IA 2WAWA 2BO4A 2P6WA 1FG5N 1VH1A 4FQWA 2AM3A 1WT1A 2E8BA 3OGZA 2J0BA 2BO7A 2PGVA 4HO5A 4LW3A 4Y6NA 3SXAA 1MP5A 1NF5B 2XWNA 2NXVA 4G3SA 1JVGA 4HO4A 4D0TA 2YQHA 3V0QA 3DJ4A 1LZ7A 2RJ9A 2ZU8A 4KPXA 5C49A 2RIYA 3U2VA 1NQIB 1ZJOA 4FRQA 1VM8A 2I5EA 4D0ZA 1R80A 4G3PA 4D11A 3E26A 2WVKA 3TQDA 4DECA 5C1LA 1VGWA 1VGTA 1ZCUA 4EEAA 1ON6A 3TZTA 2Y7AA 1HV9A 1G3LA 4B5BA 3SX7A 1LL3A 2YQSA 1H4DA 1YROB 2Z87A 1QGQA 4J18A 4KXOA 4EE5A 2XMHA 2Y4LA 1G1LA 5C4CA 2AH9A 2FYAA 2VXMA 5J49A 4FRBA 5C3AA 5AJNA 3BRKX 4LW6A 2X65A 4BMAA 1H7FA 1NHEB 1LL0A 2YQCA 3SXEA 1ZJ3A 5C4BA 1G2VA 2P72A 4CJBA 1YP3A 3U2TA 1H5SD 4Y9XA 4D48A 3U2WA 2BO6A 1FWYA 1H5TA 3U0XA 1KWSA 2OEGA 4KQLA 4YS8A 3DK5A 2A8WA 3POLA 4ASYA 3SX8A 2FFVA 4EE4A 4KT7A 4GBPA 1WT3A 1GQ9A 1O7QA 3CU0A 4C2SA 4DDZA 3RSBA 2CU2A 2AM4A 2A8UA 2YESA 2PA4A 2VS4A 5C1HA 3ST8A 3CKQA 4AAWA 3V0LA 1H5SB 4FCUA 4B2XA 2WVLA 3I0HA 2YQJA 4Y7FA 1LL2A 3I0DA 1INJA 4M2AA 2VFZA 2Z86A 1VICA 3V0PA 3O3PA 1JV3A 1ZJPA 2OI7A 1G93A 2FYBA 5CQPA 2PGYA 3FOQA 1XZ6A 4Y64A 1FO9A 3OC9A 1LZ0A 1VH3A 4NAKA 4AYLA 1QWJA 5CQOA 2WVMA 4CJ8A
chains in the Genus database with same CATH topology
2V0LA 2JCLA 4E1KA 5CMIA 3ZGFA 3T7OA 2ICYA 3IOJA 3V8YA 5EJ1A 5FU8A 3K8DA 1ZIZA 4O6NA 1IIMA 4ASJA 5FTSA 2FY7A 2I5KA 3USRA 3I0JA 3ZLLA 5DDVA 1H4EA 1W55A 2AM5A 3CKVA 1OMZA 4K6RA 1ZHJA 1IINA 4HG6A 4Y7UA 4EEMA 4AYJA 1VZUA 1R7YA 1ZDGA 2VD4A 4EEOA 5C8RA 1V83A 3BCVA 3SX3A 4B2WA 1H5RB 1H7HA 4FROA 1MC3A 1EYRA 1O23B 1XHBA 3PKQA 1G0RA 2RIXA 2OI5A 1G8OA 3V0NA 4B42A 5CMHA 1H7QA 2OEFA 3V0MA 1V82A 2WE9A 4IRQA 1G23A 2O1FA 5CMFX 1VZTA 1FO8A 1H7EA 3GUEA 3SPTA 2J0AA 3V0OA 1H5TB 2JCOA 3Q80A 1ZJ1A 1H7LA 3DUVA 3R2WA 5FTVA 4Y7TA 5CQMX 3IOIA 1PZTA 1JV1A 3OAMA 1FGXA 5AJPA 2X60A 1VGUA 4M4KA 3OH0A 3JUJA 4G87A 1ON8A 2RJ6A 4HO2A 5FU0A 2AE7A 1MP3A 4FRMA 5C4EA 1TVYA 1G97A 1Z90A 2RJ7A 1OMXA 3R3IA 2YCMA 4KC1A 1JYKA 3SXCA 3RMVA 4AC3A 4B3UA 1JYLA 1ZI1A 4FRPA 3QVBA 5BXCA 2PX7A 2W0WA 3D98A 1FR8A 1K4VA 3CKOA 4HO9A 5CQNX 1GWVA 2D0JA 2D7RA 3I0CA 1PZYB 1LVWA 1TW5A 2W0VA 2RIZA 1FR9A 3ZLKA 3PKPA 2ICXA 2V0JA 3OH4A 3SXGA 1HM0A 5L6VA 2X5ZA 3V90A 4O6MA 5D91A 3V91A 4B4MA 4M28A 4ARWA 3ZF8A 2O1GA 4Y6UA 1LZJA 4IRPA 5C4FA 4ECMA 1HJLA 3T7MA 1FXJA 1H5SC 1E5KA 1WT0A 1G95A 4UEGA 1LZIA 2XMEA 2YC5A 5C3DA 2AESA 3I0GA 3RMWA 4HCQA 4B4BA 5C1GA 3CKJA 1H7GA 4L41C 1FOAA 1ZI5A 2XWLA 1WVCA 1HM9A 2UX8A 1ZI3A 5C47A 3CKNA 3I0LA 1GX4A 2ZU9A 2E3DA 4M2BA 4EEGA 1NMMB 1GQCA 2RJ0A 2RITA 4HOCA 1EZIA 5C3BA 4ZDQA 4R7PA 4FRAA 1YP4A 4FCEA 2Y4JA 4HO6A 3CGXA 1FRWA 4NAIA 1FZWA 2Y4MA 4KC2A 2RJ5A 3U2UA 1TZFA 5IDTA 2WEEA 3I0FA 2VS5A 1INIA 2VXLA 1O0RA 3U0YA 4HO8A 5C4DA 4MNDA 1O7OA 2GGQA 4MIXA 1ZJ0A 1I52A 2GGOA 5DDTA 4FRDA 5C38A 1H5SA 1VPAA 1MP4A 2YC3A 2Y6PA 3E25A 5CMJA 3Q4SA 5EIYA 1FXOA 4NALA 2FFUA 1WSZA 2P73A 3NGWA 2JCJA 4NANA 1VZXA 1H7TA 3OH3A 2V0KA 4JD0A 1H4CA 3ZGGA 5CMGX 3IOHA 5FUHA 2MZBA 3SXDA 3I0EA 1QGSA 4DE7A 1FGGA 4JISA 4FRHA 1GA8A 1R7TA 1R7XA 1R81A 1W77A 1S4PA 1ZDFA 3OH2A 5FYEA 3SX5A 1VGZA 3D5NA 5I1FA 1HJJA 3OKRA 5D92A 2AECA 5IDSA 3I0KA 2VSHA 3KIAA 4P02A 4XWIA 5FV9A 2OI6A 2XWMA 4Y62A 1R7VA 4Y63A 1H3MA 4P00A 1H5RA 3F1YA 3EE5A 1GX0A 2QGIA 1GWWA 3I0IX 4B4GA 4FRLA 1OQMB 3HL3A 3T7NA 4EVWA 4KNRA 3PNNA 4HO0A 4HO3A 1S4OA 2Y4KA 4Q7CA 3F1CA 4BQHA 2FYCB 4KC4A 1WT2A 4EE3A 1HM8A 1ZCTA 1TW1A 3D8VA 4FIYA 4G3QA 2C0NA 2QH5A 3OH1A 2DPWA 2RJ1A 2V0HA 4FIXA 3K8EA 2BO8A 3SXBA 3JTJA 1ZCVA 1NWGB 2Q4JA 4MYBA 3LW6A 1S4NA 2AGDA 3Q7UA 1ZI4A 2RJ4A 5HS2A 5L6SA 1QG8A 2VS3A 1NKHB 2JCKA 2D7IA 3JUKA 1R82A 4CVHA 4KRVA 4D11C 3U2XA 5IFYA 4Y7GA 1JVDA 1YP2A 5EJZA 2FYDB 2WGZA 5C36A 2O1HA 5C48A 2APCA 1G9RA 1ZJ2A 1ZCYA 5AJOA 2ZU7A 2VSIA 2I7BA 3USQA 1W57A 3N9WA 4KNXA 4KPZA 1V84A 5CQLX 2QKXA 1SS9A 3FWWA 1R7UA 2X5SA 5JQQA 3V8ZA 4FREA 2RJ8A 4CJCA 4Y7VA 2VK9A 2V0IA 2WAWA 2BO4A 2P6WA 1FG5N 1VH1A 4FQWA 2AM3A 1WT1A 2E8BA 3OGZA 2J0BA 2BO7A 2PGVA 4HO5A 4LW3A 4Y6NA 3SXAA 1MP5A 1NF5B 2XWNA 2NXVA 4G3SA 1JVGA 4HO4A 4D0TA 2YQHA 3V0QA 3DJ4A 1LZ7A 2RJ9A 2ZU8A 4KPXA 5C49A 2RIYA 3U2VA 1NQIB 1ZJOA 4FRQA 1VM8A 2I5EA 4D0ZA 1R80A 4G3PA 4D11A 3E26A 2WVKA 3TQDA 4DECA 5C1LA 1VGWA 1VGTA 1ZCUA 4EEAA 1ON6A 3TZTA 2Y7AA 1HV9A 1G3LA 4B5BA 3SX7A 1LL3A 2YQSA 1H4DA 1YROB 2Z87A 1QGQA 4J18A 4KXOA 4EE5A 2XMHA 2Y4LA 1G1LA 5C4CA 2AH9A 2FYAA 2VXMA 5J49A 4FRBA 5C3AA 5AJNA 3BRKX 4LW6A 2X65A 4BMAA 1H7FA 1NHEB 1LL0A 2YQCA 3SXEA 1ZJ3A 5C4BA 1G2VA 2P72A 4CJBA 1YP3A 3U2TA 1H5SD 4Y9XA 4D48A 3U2WA 2BO6A 1FWYA 1H5TA 3U0XA 1KWSA 2OEGA 4KQLA 4YS8A 3DK5A 2A8WA 3POLA 4ASYA 3SX8A 2FFVA 4EE4A 4KT7A 4GBPA 1WT3A 1GQ9A 1O7QA 3CU0A 4C2SA 4DDZA 3RSBA 2CU2A 2AM4A 2A8UA 2YESA 2PA4A 2VS4A 5C1HA 3ST8A 3CKQA 4AAWA 3V0LA 1H5SB 4FCUA 4B2XA 2WVLA 3I0HA 2YQJA 4Y7FA 1LL2A 3I0DA 1INJA 4M2AA 2VFZA 2Z86A 1VICA 3V0PA 3O3PA 1JV3A 1ZJPA 2OI7A 1G93A 2FYBA 5CQPA 2PGYA 3FOQA 1XZ6A 4Y64A 1FO9A 3OC9A 1LZ0A 1VH3A 4NAKA 4AYLA 1QWJA 5CQOA 2WVMA 4CJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V0L A;  2JCL A;  4E1K A;  5CMI A;  3ZGF A;  3T7O A;  2ICY A;  3IOJ A;  3V8Y A;  5EJ1 A;  5FU8 A;  3K8D A;  1ZIZ A;  4ASJ A;  1IIM A;  5FTS A;  2FY7 A;  2I5K A;  3USR A;  3I0J A;  3ZLL A;  5DDV A;  1H4E A;  1W55 A;  2AM5 A;  3CKV A;  1OMZ A;  4K6R A;  1ZHJ A;  1IIN A;  4HG6 A;  4Y7U A;  4EEM A;  4AYJ A;  1VZU A;  1R7Y A;  1ZDG A;  2VD4 A;  4EEO A;  5C8R A;  1V83 A;  3BCV A;  3SX3 A;  4B2W A;  1H5R B;  1H7H A;  4FRO A;  1MC3 A;  1EYR A;  1O23 B;  1XHB A;  3PKQ A;  1G0R A;  2RIX A;  2OI5 A;  1G8O A;  3V0N A;  4B42 A;  5CMH A;  1H7Q A;  2OEF A;  3V0M A;  1V82 A;  2WE9 A;  4IRQ A;  1G23 A;  2O1F A;  5CMF X;  1VZT A;  1FO8 A;  1H7E A;  3GUE A;  3SPT A;  3V0O A;  1H5T B;  2JCO A;  3Q80 A;  1ZJ1 A;  1H7L A;  3DUV A;  3R2W A;  5FTV A;  4Y7T A;  5CQM X;  3IOI A;  1PZT A;  1JV1 A;  3OAM A;  1FGX A;  5AJP A;  2X60 A;  1VGU A;  4M4K A;  3OH0 A;  3JUJ A;  4G87 A;  1ON8 A;  2RJ6 A;  4HO2 A;  5FU0 A;  2AE7 A;  1MP3 A;  4FRM A;  5C4E A;  1TVY A;  1G97 A;  1Z90 A;  2RJ7 A;  1OMX A;  3R3I A;  2YCM A;  4KC1 A;  1JYK A;  3SXC A;  3RMV A;  4AC3 A;  4B3U A;  1JYL A;  1ZI1 A;  4FRP A;  3QVB A;  5BXC A;  2PX7 A;  2W0W A;  3D98 A;  1FR8 A;  1K4V A;  3CKO A;  4HO9 A;  5CQN X;  1GWV A;  2D0J A;  2D7R A;  3I0C A;  1PZY B;  1LVW A;  1TW5 A;  2W0V A;  2RIZ A;  1FR9 A;  3ZLK A;  3PKP A;  2ICX A;  2V0J A;  3OH4 A;  3SXG A;  1HM0 A;  5L6V A;  2X5Z A;  3V90 A;  3V91 A;  4B4M A;  4M28 A;  4ARW A;  3ZF8 A;  2O1G A;  4Y6U A;  1LZJ A;  4IRP A;  5C4F A;  4ECM A;  1HJL A;  3T7M A;  1FXJ A;  1H5S C;  1E5K A;  1WT0 A;  1G95 A;  4UEG A;  1LZI A;  2XME A;  2YC5 A;  5C3D A;  2AES A;  3I0G A;  3RMW A;  4HCQ A;  4B4B A;  5C1G A;  3CKJ A;  1H7G A;  4L41 C;  1FOA A;  1ZI5 A;  2XWL A;  1WVC A;  1HM9 A;  2UX8 A;  1ZI3 A;  5C47 A;  3CKN A;  3I0L A;  1GX4 A;  2ZU9 A;  2E3D A;  4M2B A;  4EEG A;  1NMM B;  1GQC A;  2RJ0 A;  2RIT A;  4HOC A;  1EZI A;  5C3B A;  4ZDQ A;  4R7P A;  4FRA A;  1YP4 A;  4FCE A;  2Y4J A;  4HO6 A;  3CGX A;  1FRW A;  4NAI A;  1FZW A;  2Y4M A;  4KC2 A;  2RJ5 A;  3U2U A;  1TZF A;  5IDT A;  2WEE A;  3I0F A;  2VS5 A;  1INI A;  2VXL A;  1O0R A;  3U0Y A;  4HO8 A;  5C4D A;  4MND A;  1O7O A;  2GGQ A;  1ZJ0 A;  1I52 A;  2GGO A;  5DDT A;  4FRD A;  5C38 A;  1H5S A;  1VPA A;  1MP4 A;  2YC3 A;  2Y6P A;  3E25 A;  5CMJ A;  3Q4S A;  5EIY A;  1FXO A;  4NAL A;  2FFU A;  1WSZ A;  2P73 A;  3NGW A;  2JCJ A;  4NAN A;  1VZX A;  1H7T A;  3OH3 A;  2V0K A;  4JD0 A;  1H4C A;  3ZGG A;  5CMG X;  3IOH A;  5FUH A;  2MZB A;  3SXD A;  3I0E A;  1QGS A;  4DE7 A;  1FGG A;  4JIS A;  4FRH A;  1GA8 A;  1R7T A;  1R7X A;  1R81 A;  1W77 A;  1S4P A;  1ZDF A;  3OH2 A;  5FYE A;  3SX5 A;  1VGZ A;  3D5N A;  5I1F A;  1HJJ A;  3OKR A;  2AEC A;  5IDS A;  3I0K A;  2VSH A;  3KIA A;  4P02 A;  4XWI A;  5FV9 A;  2OI6 A;  2XWM A;  4Y62 A;  1R7V A;  4Y63 A;  1H3M A;  4P00 A;  1H5R A;  3F1Y A;  3EE5 A;  1GX0 A;  2QGI A;  1GWW A;  3I0I X;  4B4G A;  4FRL A;  1OQM B;  3HL3 A;  3T7N A;  4EVW A;  4KNR A;  3PNN A;  4HO0 A;  4HO3 A;  1S4O A;  2Y4K A;  3F1C A;  4BQH A;  2FYC B;  4KC4 A;  1WT2 A;  4EE3 A;  1HM8 A;  1ZCT A;  1TW1 A;  3D8V A;  4G3Q A;  2QH5 A;  3OH1 A;  2DPW A;  2RJ1 A;  2V0H A;  3K8E A;  2BO8 A;  3SXB A;  3JTJ A;  1ZCV A;  1NWG B;  2Q4J A;  4MYB A;  3LW6 A;  1S4N A;  2AGD A;  3Q7U A;  1ZI4 A;  2RJ4 A;  5HS2 A;  5L6S A;  1QG8 A;  2VS3 A;  1NKH B;  2JCK A;  2D7I A;  3JUK A;  1R82 A;  4CVH A;  4KRV A;  4D11 C;  3U2X A;  5IFY A;  4Y7G A;  1JVD A;  1YP2 A;  5EJZ A;  2FYD B;  2WGZ A;  5C36 A;  2O1H A;  5C48 A;  2APC A;  1G9R A;  1ZJ2 A;  1ZCY A;  5AJO A;  2ZU7 A;  2VSI A;  2I7B A;  3USQ A;  1W57 A;  3N9W A;  4KNX A;  4KPZ A;  1V84 A;  5CQL X;  2QKX A;  1SS9 A;  3FWW A;  1R7U A;  2X5S A;  5JQQ A;  3V8Z A;  4FRE A;  2RJ8 A;  4CJC A;  4Y7V A;  2WAW A;  2V0I A;  2BO4 A;  2P6W A;  1FG5 N;  1VH1 A;  4FQW A;  2AM3 A;  1WT1 A;  2E8B A;  3OGZ A;  2BO7 A;  2PGV A;  4HO5 A;  4LW3 A;  4Y6N A;  3SXA A;  1MP5 A;  1NF5 B;  2XWN A;  2NXV A;  4G3S A;  1JVG A;  4HO4 A;  4D0T A;  2YQH A;  3V0Q A;  3DJ4 A;  1LZ7 A;  2RJ9 A;  2ZU8 A;  4KPX A;  5C49 A;  2RIY A;  3U2V A;  1NQI B;  1ZJO A;  4FRQ A;  1VM8 A;  2I5E A;  4D0Z A;  1R80 A;  4G3P A;  4D11 A;  3E26 A;  2WVK A;  3TQD A;  4DEC A;  5C1L A;  1VGW A;  1VGT A;  1ZCU A;  4EEA A;  1ON6 A;  3TZT A;  2Y7A A;  1HV9 A;  1G3L A;  4B5B A;  3SX7 A;  1LL3 A;  2YQS A;  1H4D A;  1YRO B;  2Z87 A;  1QGQ A;  4J18 A;  4KXO A;  4EE5 A;  2XMH A;  2Y4L A;  1G1L A;  5C4C A;  2AH9 A;  2FYA A;  2VXM A;  5J49 A;  4FRB A;  5C3A A;  5AJN A;  3BRK X;  4LW6 A;  2X65 A;  4BMA A;  1H7F A;  1NHE B;  1LL0 A;  2YQC A;  3SXE A;  1ZJ3 A;  5C4B A;  1G2V A;  2P72 A;  4CJB A;  1YP3 A;  3U2T A;  1H5S D;  4Y9X A;  4D48 A;  3U2W A;  2BO6 A;  1FWY A;  1H5T A;  3U0X A;  1KWS A;  2OEG A;  4KQL A;  4YS8 A;  3DK5 A;  2A8W A;  3POL A;  4ASY A;  3SX8 A;  2FFV A;  4EE4 A;  4KT7 A;  4GBP A;  1WT3 A;  1GQ9 A;  1O7Q A;  3CU0 A;  4C2S A;  4DDZ A;  3RSB A;  2CU2 A;  2AM4 A;  2A8U A;  2YES A;  2PA4 A;  2VS4 A;  5C1H A;  3ST8 A;  3CKQ A;  4AAW A;  3V0L A;  1H5S B;  4FCU A;  4B2X A;  2WVL A;  3I0H A;  2YQJ A;  4Y7F A;  1LL2 A;  3I0D A;  1INJ A;  4M2A A;  2VFZ A;  2Z86 A;  1VIC A;  3V0P A;  3O3P A;  1JV3 A;  1ZJP A;  2OI7 A;  1G93 A;  2FYB A;  5CQP A;  2PGY A;  3FOQ A;  1XZ6 A;  4Y64 A;  1FO9 A;  3OC9 A;  1LZ0 A;  1VH3 A;  4NAK A;  4AYL A;  1QWJ A;  5CQO A;  2WVM A;  4CJ8 A; 
#chains in the Genus database with same CATH topology
 2V0L A;  2JCL A;  4E1K A;  5CMI A;  3ZGF A;  3T7O A;  2ICY A;  3IOJ A;  3V8Y A;  5EJ1 A;  5FU8 A;  3K8D A;  1ZIZ A;  4O6N A;  1IIM A;  4ASJ A;  5FTS A;  2FY7 A;  2I5K A;  3USR A;  3I0J A;  3ZLL A;  5DDV A;  1H4E A;  1W55 A;  2AM5 A;  3CKV A;  1OMZ A;  4K6R A;  1ZHJ A;  1IIN A;  4HG6 A;  4Y7U A;  4EEM A;  4AYJ A;  1VZU A;  1R7Y A;  1ZDG A;  2VD4 A;  4EEO A;  5C8R A;  1V83 A;  3BCV A;  3SX3 A;  4B2W A;  1H5R B;  1H7H A;  4FRO A;  1MC3 A;  1EYR A;  1O23 B;  1XHB A;  3PKQ A;  1G0R A;  2RIX A;  2OI5 A;  1G8O A;  3V0N A;  4B42 A;  5CMH A;  1H7Q A;  2OEF A;  3V0M A;  1V82 A;  2WE9 A;  4IRQ A;  1G23 A;  2O1F A;  5CMF X;  1VZT A;  1FO8 A;  1H7E A;  3GUE A;  3SPT A;  2J0A A;  3V0O A;  1H5T B;  2JCO A;  3Q80 A;  1ZJ1 A;  1H7L A;  3DUV A;  3R2W A;  5FTV A;  4Y7T A;  5CQM X;  3IOI A;  1PZT A;  1JV1 A;  3OAM A;  1FGX A;  5AJP A;  2X60 A;  1VGU A;  4M4K A;  3OH0 A;  3JUJ A;  4G87 A;  1ON8 A;  2RJ6 A;  4HO2 A;  5FU0 A;  2AE7 A;  1MP3 A;  4FRM A;  5C4E A;  1TVY A;  1G97 A;  1Z90 A;  2RJ7 A;  1OMX A;  3R3I A;  2YCM A;  4KC1 A;  1JYK A;  3SXC A;  3RMV A;  4AC3 A;  4B3U A;  1JYL A;  1ZI1 A;  4FRP A;  3QVB A;  5BXC A;  2PX7 A;  2W0W A;  3D98 A;  1FR8 A;  1K4V A;  3CKO A;  4HO9 A;  5CQN X;  1GWV A;  2D0J A;  2D7R A;  3I0C A;  1PZY B;  1LVW A;  1TW5 A;  2W0V A;  2RIZ A;  1FR9 A;  3ZLK A;  3PKP A;  2ICX A;  2V0J A;  3OH4 A;  3SXG A;  1HM0 A;  5L6V A;  2X5Z A;  3V90 A;  4O6M A;  5D91 A;  3V91 A;  4B4M A;  4M28 A;  4ARW A;  3ZF8 A;  2O1G A;  4Y6U A;  1LZJ A;  4IRP A;  5C4F A;  4ECM A;  1HJL A;  3T7M A;  1FXJ A;  1H5S C;  1E5K A;  1WT0 A;  1G95 A;  4UEG A;  1LZI A;  2XME A;  2YC5 A;  5C3D A;  2AES A;  3I0G A;  3RMW A;  4HCQ A;  4B4B A;  5C1G A;  3CKJ A;  1H7G A;  4L41 C;  1FOA A;  1ZI5 A;  2XWL A;  1WVC A;  1HM9 A;  2UX8 A;  1ZI3 A;  5C47 A;  3CKN A;  3I0L A;  1GX4 A;  2ZU9 A;  2E3D A;  4M2B A;  4EEG A;  1NMM B;  1GQC A;  2RJ0 A;  2RIT A;  4HOC A;  1EZI A;  5C3B A;  4ZDQ A;  4R7P A;  4FRA A;  1YP4 A;  4FCE A;  2Y4J A;  4HO6 A;  3CGX A;  1FRW A;  4NAI A;  1FZW A;  2Y4M A;  4KC2 A;  2RJ5 A;  3U2U A;  1TZF A;  5IDT A;  2WEE A;  3I0F A;  2VS5 A;  1INI A;  2VXL A;  1O0R A;  3U0Y A;  4HO8 A;  5C4D A;  4MND A;  1O7O A;  2GGQ A;  4MIX A;  1ZJ0 A;  1I52 A;  2GGO A;  5DDT A;  4FRD A;  5C38 A;  1H5S A;  1VPA A;  1MP4 A;  2YC3 A;  2Y6P A;  3E25 A;  5CMJ A;  3Q4S A;  5EIY A;  1FXO A;  4NAL A;  2FFU A;  1WSZ A;  2P73 A;  3NGW A;  2JCJ A;  4NAN A;  1VZX A;  1H7T A;  3OH3 A;  2V0K A;  4JD0 A;  1H4C A;  3ZGG A;  5CMG X;  3IOH A;  5FUH A;  2MZB A;  3SXD A;  3I0E A;  1QGS A;  4DE7 A;  1FGG A;  4JIS A;  4FRH A;  1GA8 A;  1R7T A;  1R7X A;  1R81 A;  1W77 A;  1S4P A;  1ZDF A;  3OH2 A;  5FYE A;  3SX5 A;  1VGZ A;  3D5N A;  5I1F A;  1HJJ A;  3OKR A;  5D92 A;  2AEC A;  5IDS A;  3I0K A;  2VSH A;  3KIA A;  4P02 A;  4XWI A;  5FV9 A;  2OI6 A;  2XWM A;  4Y62 A;  1R7V A;  4Y63 A;  1H3M A;  4P00 A;  1H5R A;  3F1Y A;  3EE5 A;  1GX0 A;  2QGI A;  1GWW A;  3I0I X;  4B4G A;  4FRL A;  1OQM B;  3HL3 A;  3T7N A;  4EVW A;  4KNR A;  3PNN A;  4HO0 A;  4HO3 A;  1S4O A;  2Y4K A;  4Q7C A;  3F1C A;  4BQH A;  2FYC B;  4KC4 A;  1WT2 A;  4EE3 A;  1HM8 A;  1ZCT A;  1TW1 A;  3D8V A;  4FIY A;  4G3Q A;  2C0N A;  2QH5 A;  3OH1 A;  2DPW A;  2RJ1 A;  2V0H A;  4FIX A;  3K8E A;  2BO8 A;  3SXB A;  3JTJ A;  1ZCV A;  1NWG B;  2Q4J A;  4MYB A;  3LW6 A;  1S4N A;  2AGD A;  3Q7U A;  1ZI4 A;  2RJ4 A;  5HS2 A;  5L6S A;  1QG8 A;  2VS3 A;  1NKH B;  2JCK A;  2D7I A;  3JUK A;  1R82 A;  4CVH A;  4KRV A;  4D11 C;  3U2X A;  5IFY A;  4Y7G A;  1JVD A;  1YP2 A;  5EJZ A;  2FYD B;  2WGZ A;  5C36 A;  2O1H A;  5C48 A;  2APC A;  1G9R A;  1ZJ2 A;  1ZCY A;  5AJO A;  2ZU7 A;  2VSI A;  2I7B A;  3USQ A;  1W57 A;  3N9W A;  4KNX A;  4KPZ A;  1V84 A;  5CQL X;  2QKX A;  1SS9 A;  3FWW A;  1R7U A;  2X5S A;  5JQQ A;  3V8Z A;  4FRE A;  2RJ8 A;  4CJC A;  4Y7V A;  2VK9 A;  2V0I A;  2WAW A;  2BO4 A;  2P6W A;  1FG5 N;  1VH1 A;  4FQW A;  2AM3 A;  1WT1 A;  2E8B A;  3OGZ A;  2J0B A;  2BO7 A;  2PGV A;  4HO5 A;  4LW3 A;  4Y6N A;  3SXA A;  1MP5 A;  1NF5 B;  2XWN A;  2NXV A;  4G3S A;  1JVG A;  4HO4 A;  4D0T A;  2YQH A;  3V0Q A;  3DJ4 A;  1LZ7 A;  2RJ9 A;  2ZU8 A;  4KPX A;  5C49 A;  2RIY A;  3U2V A;  1NQI B;  1ZJO A;  4FRQ A;  1VM8 A;  2I5E A;  4D0Z A;  1R80 A;  4G3P A;  4D11 A;  3E26 A;  2WVK A;  3TQD A;  4DEC A;  5C1L A;  1VGW A;  1VGT A;  1ZCU A;  4EEA A;  1ON6 A;  3TZT A;  2Y7A A;  1HV9 A;  1G3L A;  4B5B A;  3SX7 A;  1LL3 A;  2YQS A;  1H4D A;  1YRO B;  2Z87 A;  1QGQ A;  4J18 A;  4KXO A;  4EE5 A;  2XMH A;  2Y4L A;  1G1L A;  5C4C A;  2AH9 A;  2FYA A;  2VXM A;  5J49 A;  4FRB A;  5C3A A;  5AJN A;  3BRK X;  4LW6 A;  2X65 A;  4BMA A;  1H7F A;  1NHE B;  1LL0 A;  2YQC A;  3SXE A;  1ZJ3 A;  5C4B A;  1G2V A;  2P72 A;  4CJB A;  1YP3 A;  3U2T A;  1H5S D;  4Y9X A;  4D48 A;  3U2W A;  2BO6 A;  1FWY A;  1H5T A;  3U0X A;  1KWS A;  2OEG A;  4KQL A;  4YS8 A;  3DK5 A;  2A8W A;  3POL A;  4ASY A;  3SX8 A;  2FFV A;  4EE4 A;  4KT7 A;  4GBP A;  1WT3 A;  1GQ9 A;  1O7Q A;  3CU0 A;  4C2S A;  4DDZ A;  3RSB A;  2CU2 A;  2AM4 A;  2A8U A;  2YES A;  2PA4 A;  2VS4 A;  5C1H A;  3ST8 A;  3CKQ A;  4AAW A;  3V0L A;  1H5S B;  4FCU A;  4B2X A;  2WVL A;  3I0H A;  2YQJ A;  4Y7F A;  1LL2 A;  3I0D A;  1INJ A;  4M2A A;  2VFZ A;  2Z86 A;  1VIC A;  3V0P A;  3O3P A;  1JV3 A;  1ZJP A;  2OI7 A;  1G93 A;  2FYB A;  5CQP A;  2PGY A;  3FOQ A;  1XZ6 A;  4Y64 A;  1FO9 A;  3OC9 A;  1LZ0 A;  1VH3 A;  4NAK A;  4AYL A;  1QWJ A;  5CQO A;  2WVM A;  4CJ8 A; 
#chains in the Genus database with same CATH homology
 2V0L A;  2JCL A;  4E1K A;  5CMI A;  3ZGF A;  3T7O A;  2ICY A;  3IOJ A;  3V8Y A;  5EJ1 A;  5FU8 A;  3K8D A;  1ZIZ A;  4O6N A;  1IIM A;  4ASJ A;  5FTS A;  2FY7 A;  2I5K A;  3USR A;  3I0J A;  3ZLL A;  5DDV A;  1H4E A;  1W55 A;  2AM5 A;  3CKV A;  1OMZ A;  4K6R A;  1ZHJ A;  1IIN A;  4HG6 A;  4Y7U A;  4EEM A;  4AYJ A;  1VZU A;  1R7Y A;  1ZDG A;  2VD4 A;  4EEO A;  5C8R A;  1V83 A;  3BCV A;  3SX3 A;  4B2W A;  1H5R B;  1H7H A;  4FRO A;  1MC3 A;  1EYR A;  1O23 B;  1XHB A;  3PKQ A;  1G0R A;  2RIX A;  2OI5 A;  1G8O A;  3V0N A;  4B42 A;  5CMH A;  1H7Q A;  2OEF A;  3V0M A;  1V82 A;  2WE9 A;  4IRQ A;  1G23 A;  2O1F A;  5CMF X;  1VZT A;  1FO8 A;  1H7E A;  3GUE A;  3SPT A;  2J0A A;  3V0O A;  1H5T B;  2JCO A;  3Q80 A;  1ZJ1 A;  1H7L A;  3DUV A;  3R2W A;  5FTV A;  4Y7T A;  5CQM X;  3IOI A;  1PZT A;  1JV1 A;  3OAM A;  1FGX A;  5AJP A;  2X60 A;  1VGU A;  4M4K A;  3OH0 A;  3JUJ A;  4G87 A;  1ON8 A;  2RJ6 A;  4HO2 A;  5FU0 A;  2AE7 A;  1MP3 A;  4FRM A;  5C4E A;  1TVY A;  1G97 A;  1Z90 A;  2RJ7 A;  1OMX A;  3R3I A;  2YCM A;  4KC1 A;  1JYK A;  3SXC A;  3RMV A;  4AC3 A;  4B3U A;  1JYL A;  1ZI1 A;  4FRP A;  3QVB A;  5BXC A;  2PX7 A;  2W0W A;  3D98 A;  1FR8 A;  1K4V A;  3CKO A;  4HO9 A;  5CQN X;  1GWV A;  2D0J A;  2D7R A;  3I0C A;  1PZY B;  1LVW A;  1TW5 A;  2W0V A;  2RIZ A;  1FR9 A;  3ZLK A;  3PKP A;  2ICX A;  2V0J A;  3OH4 A;  3SXG A;  1HM0 A;  5L6V A;  2X5Z A;  3V90 A;  4O6M A;  5D91 A;  3V91 A;  4B4M A;  4M28 A;  4ARW A;  3ZF8 A;  2O1G A;  4Y6U A;  1LZJ A;  4IRP A;  5C4F A;  4ECM A;  1HJL A;  3T7M A;  1FXJ A;  1H5S C;  1E5K A;  1WT0 A;  1G95 A;  4UEG A;  1LZI A;  2XME A;  2YC5 A;  5C3D A;  2AES A;  3I0G A;  3RMW A;  4HCQ A;  4B4B A;  5C1G A;  3CKJ A;  1H7G A;  4L41 C;  1FOA A;  1ZI5 A;  2XWL A;  1WVC A;  1HM9 A;  2UX8 A;  1ZI3 A;  5C47 A;  3CKN A;  3I0L A;  1GX4 A;  2ZU9 A;  2E3D A;  4M2B A;  4EEG A;  1NMM B;  1GQC A;  2RJ0 A;  2RIT A;  4HOC A;  1EZI A;  5C3B A;  4ZDQ A;  4R7P A;  4FRA A;  1YP4 A;  4FCE A;  2Y4J A;  4HO6 A;  3CGX A;  1FRW A;  4NAI A;  1FZW A;  2Y4M A;  4KC2 A;  2RJ5 A;  3U2U A;  1TZF A;  5IDT A;  2WEE A;  3I0F A;  2VS5 A;  1INI A;  2VXL A;  1O0R A;  3U0Y A;  4HO8 A;  5C4D A;  4MND A;  1O7O A;  2GGQ A;  4MIX A;  1ZJ0 A;  1I52 A;  2GGO A;  5DDT A;  4FRD A;  5C38 A;  1H5S A;  1VPA A;  1MP4 A;  2YC3 A;  2Y6P A;  3E25 A;  5CMJ A;  3Q4S A;  5EIY A;  1FXO A;  4NAL A;  2FFU A;  1WSZ A;  2P73 A;  3NGW A;  2JCJ A;  4NAN A;  1VZX A;  1H7T A;  3OH3 A;  2V0K A;  4JD0 A;  1H4C A;  3ZGG A;  5CMG X;  3IOH A;  5FUH A;  2MZB A;  3SXD A;  3I0E A;  1QGS A;  4DE7 A;  1FGG A;  4JIS A;  4FRH A;  1GA8 A;  1R7T A;  1R7X A;  1R81 A;  1W77 A;  1S4P A;  1ZDF A;  3OH2 A;  5FYE A;  3SX5 A;  1VGZ A;  3D5N A;  5I1F A;  1HJJ A;  3OKR A;  5D92 A;  2AEC A;  5IDS A;  3I0K A;  2VSH A;  3KIA A;  4P02 A;  4XWI A;  5FV9 A;  2OI6 A;  2XWM A;  4Y62 A;  1R7V A;  4Y63 A;  1H3M A;  4P00 A;  1H5R A;  3F1Y A;  3EE5 A;  1GX0 A;  2QGI A;  1GWW A;  3I0I X;  4B4G A;  4FRL A;  1OQM B;  3HL3 A;  3T7N A;  4EVW A;  4KNR A;  3PNN A;  4HO0 A;  4HO3 A;  1S4O A;  2Y4K A;  4Q7C A;  3F1C A;  4BQH A;  2FYC B;  4KC4 A;  1WT2 A;  4EE3 A;  1HM8 A;  1ZCT A;  1TW1 A;  3D8V A;  4FIY A;  4G3Q A;  2C0N A;  2QH5 A;  3OH1 A;  2DPW A;  2RJ1 A;  2V0H A;  4FIX A;  3K8E A;  2BO8 A;  3SXB A;  3JTJ A;  1ZCV A;  1NWG B;  2Q4J A;  4MYB A;  3LW6 A;  1S4N A;  2AGD A;  3Q7U A;  1ZI4 A;  2RJ4 A;  5HS2 A;  5L6S A;  1QG8 A;  2VS3 A;  1NKH B;  2JCK A;  2D7I A;  3JUK A;  1R82 A;  4CVH A;  4KRV A;  4D11 C;  3U2X A;  5IFY A;  4Y7G A;  1JVD A;  1YP2 A;  5EJZ A;  2FYD B;  2WGZ A;  5C36 A;  2O1H A;  5C48 A;  2APC A;  1G9R A;  1ZJ2 A;  1ZCY A;  5AJO A;  2ZU7 A;  2VSI A;  2I7B A;  3USQ A;  1W57 A;  3N9W A;  4KNX A;  4KPZ A;  1V84 A;  5CQL X;  2QKX A;  1SS9 A;  3FWW A;  1R7U A;  2X5S A;  5JQQ A;  3V8Z A;  4FRE A;  2RJ8 A;  4CJC A;  4Y7V A;  2VK9 A;  2V0I A;  2WAW A;  2BO4 A;  2P6W A;  1FG5 N;  1VH1 A;  4FQW A;  2AM3 A;  1WT1 A;  2E8B A;  3OGZ A;  2J0B A;  2BO7 A;  2PGV A;  4HO5 A;  4LW3 A;  4Y6N A;  3SXA A;  1MP5 A;  1NF5 B;  2XWN A;  2NXV A;  4G3S A;  1JVG A;  4HO4 A;  4D0T A;  2YQH A;  3V0Q A;  3DJ4 A;  1LZ7 A;  2RJ9 A;  2ZU8 A;  4KPX A;  5C49 A;  2RIY A;  3U2V A;  1NQI B;  1ZJO A;  4FRQ A;  1VM8 A;  2I5E A;  4D0Z A;  1R80 A;  4G3P A;  4D11 A;  3E26 A;  2WVK A;  3TQD A;  4DEC A;  5C1L A;  1VGW A;  1VGT A;  1ZCU A;  4EEA A;  1ON6 A;  3TZT A;  2Y7A A;  1HV9 A;  1G3L A;  4B5B A;  3SX7 A;  1LL3 A;  2YQS A;  1H4D A;  1YRO B;  2Z87 A;  1QGQ A;  4J18 A;  4KXO A;  4EE5 A;  2XMH A;  2Y4L A;  1G1L A;  5C4C A;  2AH9 A;  2FYA A;  2VXM A;  5J49 A;  4FRB A;  5C3A A;  5AJN A;  3BRK X;  4LW6 A;  2X65 A;  4BMA A;  1H7F A;  1NHE B;  1LL0 A;  2YQC A;  3SXE A;  1ZJ3 A;  5C4B A;  1G2V A;  2P72 A;  4CJB A;  1YP3 A;  3U2T A;  1H5S D;  4Y9X A;  4D48 A;  3U2W A;  2BO6 A;  1FWY A;  1H5T A;  3U0X A;  1KWS A;  2OEG A;  4KQL A;  4YS8 A;  3DK5 A;  2A8W A;  3POL A;  4ASY A;  3SX8 A;  2FFV A;  4EE4 A;  4KT7 A;  4GBP A;  1WT3 A;  1GQ9 A;  1O7Q A;  3CU0 A;  4C2S A;  4DDZ A;  3RSB A;  2CU2 A;  2AM4 A;  2A8U A;  2YES A;  2PA4 A;  2VS4 A;  5C1H A;  3ST8 A;  3CKQ A;  4AAW A;  3V0L A;  1H5S B;  4FCU A;  4B2X A;  2WVL A;  3I0H A;  2YQJ A;  4Y7F A;  1LL2 A;  3I0D A;  1INJ A;  4M2A A;  2VFZ A;  2Z86 A;  1VIC A;  3V0P A;  3O3P A;  1JV3 A;  1ZJP A;  2OI7 A;  1G93 A;  2FYB A;  5CQP A;  2PGY A;  3FOQ A;  1XZ6 A;  4Y64 A;  1FO9 A;  3OC9 A;  1LZ0 A;  1VH3 A;  4NAK A;  4AYL A;  1QWJ A;  5CQO A;  2WVM A;  4CJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...