1G9RA

Crystal structure of galactosyltransferase lgtc in complex with mn and udp-2f-galactose
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
282
structure length
278
Chain Sequence
MDIVFAADDNYAAYLCVAAKSVEAAHPDTEIRFHVLDAGISEANRAAVAANLRGGGGNIRFIDVNPEDFAGFPLNIRHISITTYARLKLGEYIADCDKVLYLDIDVLVRDSLTPLWDTDLGDNWLGASIDLFVERQEGYKQKIGMADGEYYFNAGVLLINLKKWRRHDIFKMSSEWVEQYKDVMQYQDQDILNGLFKGGVCYANSRFNFMPTNYAFMASRHTDPLYRDRTNTVMPVAVSHYCGPAKPWHRDCTAWGAERFTELAGSLTTVPEEWRGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSYL TRANSFERASE
publication title Crystal structure of the retaining galactosyltransferase LgtC from Neisseria meningitidis in complex with donor and acceptor sugar analogs.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
total genus 92
structure length 278
sequence length 282
ec nomenclature ec 2.4.1.-:
pdb deposition date 2000-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1g9rA00
1VZTA 3OH2A 2UX8A 3SXGA 4B4MA 3TZTA 1H4EA 2Q4JA 4B5BA 1GQ9A 1VICA 3O3PA 2DPWA 4GBPA 1EZIA 4HO5A 1INIA 5C36A 2RIXA 4KPZA 4NALA 1R7YA 2VFZA 3Q4SA 2JCKA 3PKPA 1HM0A 1ZCYA 4Y9XA 1H5RB 2OEGA 4P00A 4EE3A 1JYLA 4DDZA 3V8YA 1VGTA 1FOAA 4B3UA 3R3IA 3V0NA 3CKOA 2V0KA 4ASJA 3OH3A 1LZJA 3PNNA 4DECA 4D0ZA 2GGQA 1GA8A 2VD4A 1LZ0A 2YQHA 3Q7UA 5C47A 2ICYA 4FRPA 1GWVA 1NHEB 1VGWA 2JCJA 5C4EA 3K8EA 1ZI1A 1QWJA 4KRVA 2RJ8A 2FFUA 1ZI5A 2O1FA 1YP4A 3SPTA 5EIYA 1W57A 2BO7A 2RJ9A 1ZDFA 1H5TA 2RJ1A 2O1GA 5CMGX 3USRA 4FCUA 2PA4A 2ICXA 3F1YA 1R7TA 2GGOA 2JCLA 5FU8A 5CMJA 1IIMA 2BO8A 1QGQA 4G3QA 4LW3A 1LZIA 1TW1A 3K8DA 1WVCA 1G1LA 3U0YA 1FR8A 1H5SA 4G3SA 4P02A 3U0XA 1ZHJA 1H7LA 5C1LA 3LW6A 3SXCA 5FV9A 1ON8A 5FTVA 4AAWA 1R7UA 3V0OA 1WT1A 2WE9A 1FXOA 2PGYA 2Y4MA 2P72A 3DK5A 3POLA 1H5TB 5C1HA 1HJJA 4ASYA 5EJ1A 4HO9A 1H7EA 3I0HA 5IDSA 4Y62A 5C4BA 1VGUA 1FWYA 1GX0A 3V90A 1VM8A 4J18A 1H4CA 1ZI3A 1G3LA 1XZ6A 2Z87A 1G8OA 2FYCB 2VS4A 1H5SD 1G2VA 2JCOA 4FRQA 4YS8A 1H5SB 2FYDB 3Q80A 2AM5A 5C4DA 5C38A 3V0PA 2A8UA 4NAIA 3HL3A 5C4FA 2YQCA 4AYLA 2AECA 1R82A 2AM4A 5CQPA 2RIZA 1O23B 2YQSA 1HJLA 4M2BA 1V83A 1HM9A 3DUVA 2CU2A 1GX4A 2E8BA 2AM3A 1R80A 4FRAA 4LW6A 3BRKX 4MNDA 4B4GA 1FG5N 1FXJA 1VH1A 3D98A 4Y7UA 4B42A 4ECMA 2NXVA 3I0LA 1YP3A 3I0FA 4EE4A 3OKRA 3CKJA 3CU0A 2Y7AA 1WSZA 2FFVA 2APCA 3I0DA 1V82A 1E5KA 2PGVA 3BCVA 3U2UA 4KNXA 4B2XA 4HO4A 5BXCA 2A8WA 3SX3A 5CMIA 2ZU9A 1G93A 1O7OA 3SXEA 2WVLA 3I0EA 1ZCUA 1FGXA 1WT0A 3SXDA 3USQA 2WVMA 1JYKA 4KXOA 1R7XA 4FQWA 4HO3A 3F1CA 1GQCA 3JUKA 4IRPA 4FRLA 5AJOA 2YQJA 4EEAA 1EYRA 1KWSA 3SX7A 1PZYB 3IOIA 1VGZA 1WT3A 2XWLA 5J49A 1VZXA 4KPXA 2RJ4A 2WAWA 3CGXA 4KNRA 3V0LA 1JV3A 5C49A 4C2SA 5C3AA 2YCMA 1TVYA 1ZCVA 2P6WA 4FRMA 4HO8A 1FR9A 4KC4A 4HG6A 5C3DA 4Y7FA 5C48A 3ST8A 3IOHA 2AH9A 4FRHA 3FWWA 5CMFX 2P73A 3U2WA 5CMHA 1S4OA 3CKQA 1HM8A 1FGGA 2XMHA 2I5EA 1O7QA 1PZTA 3V8ZA 1SS9A 2W0WA 2Y4KA 2D7IA 4E1KA 2OI6A 5HS2A 1LL0A 2WVKA 3RSBA 4HO6A 1JVGA 2I5KA 1H7FA 4KQLA 2V0IA 1ZI4A 1R7VA 3CKNA 2OEFA 4CJ8A 5IFYA 4Y63A 1OMZA 5JQQA 1LL3A 5CQOA 1JVDA 4MYBA 5EJZA 1ZIZA 4M28A 1I52A 2D0JA 1G0RA 2ZU7A 1ZJ0A 2RITA 4AYJA 1MP5A 2X5SA 4HO0A 4JD0A 1LZ7A 2XWMA 2XWNA 3OH1A 2V0LA 3V0MA 1GWWA 1H7GA 1S4PA 3E25A 3OAMA 3SX8A 4D11C 1HV9A 4UEGA 2BO6A 1R81A 3RMVA 3NGWA 1NKHB 5CQNX 2X65A 2V0HA 4FREA 1G23A 1MC3A 3ZGFA 1K4VA 3I0JA 5FU0A 3OH0A 3V0QA 4EVWA 4FRBA 4K6RA 2WEEA 1V84A 4EEGA 5L6VA 4Y7TA 1NF5B 1ZJ3A 2RJ0A 2XMEA 1ZJ2A 1QGSA 3FOQA 4NAKA 3R2WA 1JV1A 1FRWA 4EEMA 2OI5A 3RMWA 2AESA 1WT2A 4FCEA 1W77A 4EE5A 3JTJA 3ZLKA 1OQMB 3SXBA 2BO4A 3T7MA 1NQIB 4M2AA 3T7NA 2RIYA 2VSIA 1IINA 2FYAA 3I0CA 3QVBA 4XWIA 2VS3A 1TW5A 3KIAA 3U2XA 2Z86A 2RJ5A 1QG8A 2ZU8A 5CQLX 2X5ZA 1H7HA 3IOJA 5DDTA 1NMMB 3E26A 2YC3A 1H7TA 4Y7VA 3OGZA 3I0KA 4FRDA 2V0JA 2VXMA 4Y7GA 2E3DA 2MZBA 4HOCA 5FYEA 1Z90A 4KC1A 4KC2A 2VSHA 1G9RA 3JUJA 5C3BA 3T7OA 4ZDQA 5DDVA 3V91A 5AJPA 4Y64A 3SX5A 2QKXA 4B4BA 1MP4A 4D48A 4G3PA 4D0TA 5FUHA 2Y4JA 2AE7A 1VZUA 2D7RA 2X60A 1VPAA 4DE7A 1XHBA 3I0IX 5C8RA 1LL2A 1S4NA 3D5NA 4ARWA 2QGIA 3U2TA 3I0GA 3OH4A 4IRQA 3TQDA 1FO8A 3U2VA 4R7PA 1H7QA 2O1HA 4CJBA 4G87A 1ZJ1A 2Y4LA 2Y6PA 1ON6A 1TZFA 5L6SA 4BMAA 1OMXA 3ZGGA 4KT7A 4HO2A 4JISA 3DJ4A 2PX7A 5AJNA 5I1FA 4BQHA 1H5SC 3CKVA 2RJ6A 4CJCA 5C1GA 2RJ7A 3SXAA 4D11A 1LVWA 2YESA 3GUEA 2OI7A 1VH3A 1ZCTA 1H3MA 3D8VA 1ZDGA 5CQMX 2VXLA 1MP3A 1H4DA 2FYBA 3ZF8A 4L41C 4NANA 1FZWA 2W0VA 1ZJOA 1INJA 4Y6NA 2YC5A 4B2WA 2AGDA 2FY7A 5FTSA 3PKQA 5C4CA 4Y6UA 4AC3A 1G95A 1YP2A 1W55A 2WGZA 4FROA 2I7BA 1FO9A 1H5RA 5IDTA 1G97A 1NWGB 1O0RA 2QH5A 4M4KA 4EEOA 4CVHA 2VS5A 3EE5A 1ZJPA 1YROB 3N9WA 3ZLLA 4HCQA 3OC9A
chains in the Genus database with same CATH superfamily
1VZTA 3OH2A 2UX8A 3SXGA 4B4MA 3TZTA 1H4EA 2Q4JA 4B5BA 1GQ9A 1VICA 3O3PA 2DPWA 4GBPA 1EZIA 4HO5A 1INIA 5C36A 2RIXA 4KPZA 4NALA 1R7YA 2VFZA 3Q4SA 2JCKA 3PKPA 1HM0A 1ZCYA 4Y9XA 1H5RB 2OEGA 4P00A 4EE3A 1JYLA 4DDZA 3V8YA 1VGTA 1FOAA 4B3UA 3R3IA 3V0NA 3CKOA 2V0KA 4ASJA 3OH3A 1LZJA 3PNNA 4DECA 4D0ZA 2GGQA 1GA8A 2VD4A 1LZ0A 2YQHA 3Q7UA 5C47A 2ICYA 4FRPA 1GWVA 1NHEB 1VGWA 2JCJA 5C4EA 3K8EA 1ZI1A 1QWJA 4KRVA 2RJ8A 2FFUA 1ZI5A 2O1FA 1YP4A 3SPTA 5EIYA 1W57A 2BO7A 2RJ9A 1ZDFA 1H5TA 2RJ1A 2O1GA 5CMGX 3USRA 4FCUA 2PA4A 2ICXA 3F1YA 1R7TA 2GGOA 2JCLA 5FU8A 5CMJA 1IIMA 2BO8A 1QGQA 4G3QA 4LW3A 1LZIA 1TW1A 3K8DA 1WVCA 1G1LA 3U0YA 1FR8A 1H5SA 4G3SA 4P02A 3U0XA 1ZHJA 1H7LA 5C1LA 3LW6A 3SXCA 5FV9A 1ON8A 5FTVA 4AAWA 1R7UA 3V0OA 1WT1A 2WE9A 1FXOA 2PGYA 2Y4MA 2P72A 3DK5A 3POLA 1H5TB 5C1HA 1HJJA 4ASYA 5EJ1A 4HO9A 1H7EA 3I0HA 5IDSA 4Y62A 5C4BA 1VGUA 1FWYA 1GX0A 3V90A 1VM8A 4J18A 1H4CA 1ZI3A 1G3LA 1XZ6A 2Z87A 1G8OA 2FYCB 2VS4A 1H5SD 1G2VA 2JCOA 4FRQA 4YS8A 2J0AA 1H5SB 2FYDB 3Q80A 2AM5A 5C4DA 5C38A 3V0PA 2A8UA 4NAIA 3HL3A 5C4FA 2YQCA 4AYLA 2AECA 1R82A 2AM4A 5CQPA 2RIZA 1O23B 2YQSA 1HJLA 4M2BA 1V83A 1HM9A 3DUVA 2CU2A 1GX4A 2E8BA 2AM3A 1R80A 4FRAA 4LW6A 3BRKX 4MNDA 4B4GA 1FG5N 1FXJA 1VH1A 3D98A 5D91A 4Y7UA 4B42A 4ECMA 2NXVA 3I0LA 1YP3A 3I0FA 4EE4A 3OKRA 3CKJA 3CU0A 2Y7AA 1WSZA 2FFVA 2APCA 3I0DA 1V82A 1E5KA 2PGVA 3BCVA 3U2UA 4KNXA 4Q7CA 4B2XA 4HO4A 5BXCA 2A8WA 3SX3A 5CMIA 4O6MA 2ZU9A 1G93A 1O7OA 3SXEA 2WVLA 3I0EA 1ZCUA 1FGXA 1WT0A 3SXDA 3USQA 2WVMA 1JYKA 4KXOA 1R7XA 4FQWA 4HO3A 3F1CA 1GQCA 3JUKA 4IRPA 4FRLA 5AJOA 2YQJA 4EEAA 1EYRA 1KWSA 3SX7A 1PZYB 3IOIA 1VGZA 1WT3A 2XWLA 5J49A 1VZXA 4KPXA 2RJ4A 2WAWA 3CGXA 4KNRA 3V0LA 1JV3A 5C49A 4C2SA 5C3AA 2YCMA 1TVYA 1ZCVA 2P6WA 4FRMA 4HO8A 1FR9A 4KC4A 4HG6A 5C3DA 4Y7FA 5C48A 3ST8A 3IOHA 2AH9A 4FRHA 3FWWA 5CMFX 2P73A 3U2WA 5CMHA 1S4OA 3CKQA 1HM8A 1FGGA 2XMHA 2I5EA 1O7QA 1PZTA 3V8ZA 1SS9A 2W0WA 2Y4KA 2D7IA 4E1KA 2OI6A 5HS2A 1LL0A 2WVKA 3RSBA 4HO6A 1JVGA 2I5KA 1H7FA 4KQLA 2V0IA 1ZI4A 1R7VA 3CKNA 2OEFA 4CJ8A 5IFYA 4Y63A 1OMZA 5JQQA 1LL3A 5CQOA 1JVDA 4MYBA 5EJZA 1ZIZA 4M28A 1I52A 2D0JA 1G0RA 2ZU7A 1ZJ0A 2RITA 4AYJA 1MP5A 2X5SA 4HO0A 4JD0A 1LZ7A 2XWMA 2XWNA 3OH1A 2V0LA 3V0MA 1GWWA 1H7GA 1S4PA 3E25A 3OAMA 3SX8A 4D11C 1HV9A 4UEGA 2BO6A 1R81A 3RMVA 3NGWA 1NKHB 5CQNX 2X65A 2V0HA 4FREA 1G23A 1MC3A 3ZGFA 1K4VA 3I0JA 5FU0A 3OH0A 3V0QA 4EVWA 4FRBA 4K6RA 2WEEA 1V84A 4EEGA 5L6VA 4Y7TA 1NF5B 1ZJ3A 2RJ0A 2XMEA 1ZJ2A 1QGSA 3FOQA 4NAKA 3R2WA 1JV1A 1FRWA 4EEMA 2OI5A 3RMWA 2AESA 5D92A 1WT2A 4FCEA 1W77A 4EE5A 3JTJA 3ZLKA 1OQMB 4FIYA 3SXBA 2BO4A 3T7MA 1NQIB 4M2AA 3T7NA 2RIYA 2VSIA 1IINA 2FYAA 3I0CA 3QVBA 4XWIA 2VS3A 1TW5A 3KIAA 3U2XA 2Z86A 2RJ5A 1QG8A 2ZU8A 5CQLX 2X5ZA 1H7HA 3IOJA 5DDTA 1NMMB 3E26A 2YC3A 1H7TA 4Y7VA 3OGZA 3I0KA 4FRDA 2V0JA 2VXMA 4Y7GA 2E3DA 2MZBA 4HOCA 5FYEA 1Z90A 4KC1A 4KC2A 2VSHA 1G9RA 4O6NA 3JUJA 2J0BA 5C3BA 3T7OA 4ZDQA 5DDVA 3V91A 5AJPA 4Y64A 3SX5A 2QKXA 4B4BA 1MP4A 4D48A 4G3PA 4D0TA 2C0NA 5FUHA 2Y4JA 2AE7A 1VZUA 2D7RA 2X60A 1VPAA 4DE7A 1XHBA 3I0IX 5C8RA 1LL2A 1S4NA 3D5NA 4ARWA 2QGIA 3U2TA 3I0GA 3OH4A 4IRQA 3TQDA 1FO8A 3U2VA 4R7PA 1H7QA 2O1HA 4CJBA 4G87A 1ZJ1A 2Y4LA 2Y6PA 1ON6A 1TZFA 5L6SA 4BMAA 1OMXA 3ZGGA 4KT7A 4HO2A 4MIXA 4JISA 3DJ4A 2PX7A 5AJNA 5I1FA 4BQHA 1H5SC 3CKVA 2RJ6A 4CJCA 5C1GA 2RJ7A 3SXAA 4D11A 1LVWA 2YESA 4FIXA 2VK9A 3GUEA 2OI7A 1VH3A 1ZCTA 1H3MA 3D8VA 1ZDGA 5CQMX 2VXLA 1MP3A 1H4DA 2FYBA 3ZF8A 4L41C 4NANA 1FZWA 2W0VA 1ZJOA 1INJA 4Y6NA 2YC5A 4B2WA 2AGDA 2FY7A 5FTSA 3PKQA 5C4CA 4Y6UA 4AC3A 1G95A 1YP2A 1W55A 2WGZA 4FROA 2I7BA 1FO9A 1H5RA 5IDTA 1G97A 1NWGB 1O0RA 2QH5A 4M4KA 4EEOA 4CVHA 2VS5A 3EE5A 1ZJPA 1YROB 3N9WA 3ZLLA 4HCQA 3OC9A
chains in the Genus database with same CATH topology
1VZTA 3OH2A 2UX8A 3SXGA 4B4MA 3TZTA 1H4EA 2Q4JA 4B5BA 1GQ9A 1VICA 3O3PA 2DPWA 4GBPA 1EZIA 4HO5A 1INIA 5C36A 2RIXA 4KPZA 4NALA 1R7YA 2VFZA 3Q4SA 2JCKA 3PKPA 1HM0A 1ZCYA 4Y9XA 1H5RB 2OEGA 4P00A 4EE3A 1JYLA 4DDZA 3V8YA 1VGTA 1FOAA 4B3UA 3R3IA 3V0NA 3CKOA 2V0KA 4ASJA 3OH3A 1LZJA 3PNNA 4DECA 4D0ZA 2GGQA 1GA8A 2VD4A 1LZ0A 2YQHA 3Q7UA 5C47A 2ICYA 4FRPA 1GWVA 1NHEB 1VGWA 2JCJA 5C4EA 3K8EA 1ZI1A 1QWJA 4KRVA 2RJ8A 2FFUA 1ZI5A 2O1FA 1YP4A 3SPTA 5EIYA 1W57A 2BO7A 2RJ9A 1ZDFA 1H5TA 2RJ1A 2O1GA 5CMGX 3USRA 4FCUA 2PA4A 2ICXA 3F1YA 1R7TA 2GGOA 2JCLA 5FU8A 5CMJA 1IIMA 2BO8A 1QGQA 4G3QA 4LW3A 1LZIA 1TW1A 3K8DA 1WVCA 1G1LA 3U0YA 1FR8A 1H5SA 4G3SA 4P02A 3U0XA 1ZHJA 1H7LA 5C1LA 3LW6A 3SXCA 5FV9A 1ON8A 5FTVA 4AAWA 1R7UA 3V0OA 1WT1A 2WE9A 1FXOA 2PGYA 2Y4MA 2P72A 3DK5A 3POLA 1H5TB 5C1HA 1HJJA 4ASYA 5EJ1A 4HO9A 1H7EA 3I0HA 5IDSA 4Y62A 5C4BA 1VGUA 1FWYA 1GX0A 3V90A 1VM8A 4J18A 1H4CA 1ZI3A 1G3LA 1XZ6A 2Z87A 1G8OA 2FYCB 2VS4A 1H5SD 1G2VA 2JCOA 4FRQA 4YS8A 2J0AA 1H5SB 2FYDB 3Q80A 2AM5A 5C4DA 5C38A 3V0PA 2A8UA 4NAIA 3HL3A 5C4FA 2YQCA 4AYLA 2AECA 1R82A 2AM4A 5CQPA 2RIZA 1O23B 2YQSA 1HJLA 4M2BA 1V83A 1HM9A 3DUVA 2CU2A 1GX4A 2E8BA 2AM3A 1R80A 4FRAA 4LW6A 3BRKX 4MNDA 4B4GA 1FG5N 1FXJA 1VH1A 3D98A 5D91A 4Y7UA 4B42A 4ECMA 2NXVA 3I0LA 1YP3A 3I0FA 4EE4A 3OKRA 3CKJA 3CU0A 2Y7AA 1WSZA 2FFVA 2APCA 3I0DA 1V82A 1E5KA 2PGVA 3BCVA 3U2UA 4KNXA 4Q7CA 4B2XA 4HO4A 5BXCA 2A8WA 3SX3A 5CMIA 4O6MA 2ZU9A 1G93A 1O7OA 3SXEA 2WVLA 3I0EA 1ZCUA 1FGXA 1WT0A 3SXDA 3USQA 2WVMA 1JYKA 4KXOA 1R7XA 4FQWA 4HO3A 3F1CA 1GQCA 3JUKA 4IRPA 4FRLA 5AJOA 2YQJA 4EEAA 1EYRA 1KWSA 3SX7A 1PZYB 3IOIA 1VGZA 1WT3A 2XWLA 5J49A 1VZXA 4KPXA 2RJ4A 2WAWA 3CGXA 4KNRA 3V0LA 1JV3A 5C49A 4C2SA 5C3AA 2YCMA 1TVYA 1ZCVA 2P6WA 4FRMA 4HO8A 1FR9A 4KC4A 4HG6A 5C3DA 4Y7FA 5C48A 3ST8A 3IOHA 2AH9A 4FRHA 3FWWA 5CMFX 2P73A 3U2WA 5CMHA 1S4OA 3CKQA 1HM8A 1FGGA 2XMHA 2I5EA 1O7QA 1PZTA 3V8ZA 1SS9A 2W0WA 2Y4KA 2D7IA 4E1KA 2OI6A 5HS2A 1LL0A 2WVKA 3RSBA 4HO6A 1JVGA 2I5KA 1H7FA 4KQLA 2V0IA 1ZI4A 1R7VA 3CKNA 2OEFA 4CJ8A 5IFYA 4Y63A 1OMZA 5JQQA 1LL3A 5CQOA 1JVDA 4MYBA 5EJZA 1ZIZA 4M28A 1I52A 2D0JA 1G0RA 2ZU7A 1ZJ0A 2RITA 4AYJA 1MP5A 2X5SA 4HO0A 4JD0A 1LZ7A 2XWMA 2XWNA 3OH1A 2V0LA 3V0MA 1GWWA 1H7GA 1S4PA 3E25A 3OAMA 3SX8A 4D11C 1HV9A 4UEGA 2BO6A 1R81A 3RMVA 3NGWA 1NKHB 5CQNX 2X65A 2V0HA 4FREA 1G23A 1MC3A 3ZGFA 1K4VA 3I0JA 5FU0A 3OH0A 3V0QA 4EVWA 4FRBA 4K6RA 2WEEA 1V84A 4EEGA 5L6VA 4Y7TA 1NF5B 1ZJ3A 2RJ0A 2XMEA 1ZJ2A 1QGSA 3FOQA 4NAKA 3R2WA 1JV1A 1FRWA 4EEMA 2OI5A 3RMWA 2AESA 5D92A 1WT2A 4FCEA 1W77A 4EE5A 3JTJA 3ZLKA 1OQMB 4FIYA 3SXBA 2BO4A 3T7MA 1NQIB 4M2AA 3T7NA 2RIYA 2VSIA 1IINA 2FYAA 3I0CA 3QVBA 4XWIA 2VS3A 1TW5A 3KIAA 3U2XA 2Z86A 2RJ5A 1QG8A 2ZU8A 5CQLX 2X5ZA 1H7HA 3IOJA 5DDTA 1NMMB 3E26A 2YC3A 1H7TA 4Y7VA 3OGZA 3I0KA 4FRDA 2V0JA 2VXMA 4Y7GA 2E3DA 2MZBA 4HOCA 5FYEA 1Z90A 4KC1A 4KC2A 2VSHA 1G9RA 4O6NA 3JUJA 2J0BA 5C3BA 3T7OA 4ZDQA 5DDVA 3V91A 5AJPA 4Y64A 3SX5A 2QKXA 4B4BA 1MP4A 4D48A 4G3PA 4D0TA 2C0NA 5FUHA 2Y4JA 2AE7A 1VZUA 2D7RA 2X60A 1VPAA 4DE7A 1XHBA 3I0IX 5C8RA 1LL2A 1S4NA 3D5NA 4ARWA 2QGIA 3U2TA 3I0GA 3OH4A 4IRQA 3TQDA 1FO8A 3U2VA 4R7PA 1H7QA 2O1HA 4CJBA 4G87A 1ZJ1A 2Y4LA 2Y6PA 1ON6A 1TZFA 5L6SA 4BMAA 1OMXA 3ZGGA 4KT7A 4HO2A 4MIXA 4JISA 3DJ4A 2PX7A 5AJNA 5I1FA 4BQHA 1H5SC 3CKVA 2RJ6A 4CJCA 5C1GA 2RJ7A 3SXAA 4D11A 1LVWA 2YESA 4FIXA 2VK9A 3GUEA 2OI7A 1VH3A 1ZCTA 1H3MA 3D8VA 1ZDGA 5CQMX 2VXLA 1MP3A 1H4DA 2FYBA 3ZF8A 4L41C 4NANA 1FZWA 2W0VA 1ZJOA 1INJA 4Y6NA 2YC5A 4B2WA 2AGDA 2FY7A 5FTSA 3PKQA 5C4CA 4Y6UA 4AC3A 1G95A 1YP2A 1W55A 2WGZA 4FROA 2I7BA 1FO9A 1H5RA 5IDTA 1G97A 1NWGB 1O0RA 2QH5A 4M4KA 4EEOA 4CVHA 2VS5A 3EE5A 1ZJPA 1YROB 3N9WA 3ZLLA 4HCQA 3OC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VZT A;  3OH2 A;  2UX8 A;  3SXG A;  4B4M A;  3TZT A;  1H4E A;  2Q4J A;  4B5B A;  1GQ9 A;  1VIC A;  3O3P A;  2DPW A;  4GBP A;  1EZI A;  4HO5 A;  1INI A;  5C36 A;  2RIX A;  4KPZ A;  4NAL A;  1R7Y A;  2VFZ A;  3Q4S A;  2JCK A;  3PKP A;  1HM0 A;  1ZCY A;  4Y9X A;  1H5R B;  2OEG A;  4P00 A;  4EE3 A;  1JYL A;  4DDZ A;  3V8Y A;  1VGT A;  1FOA A;  4B3U A;  3R3I A;  3V0N A;  3CKO A;  2V0K A;  4ASJ A;  3OH3 A;  1LZJ A;  3PNN A;  4DEC A;  4D0Z A;  2GGQ A;  1GA8 A;  2VD4 A;  1LZ0 A;  2YQH A;  3Q7U A;  5C47 A;  2ICY A;  4FRP A;  1GWV A;  1NHE B;  1VGW A;  2JCJ A;  5C4E A;  3K8E A;  1ZI1 A;  1QWJ A;  4KRV A;  2RJ8 A;  2FFU A;  1ZI5 A;  2O1F A;  1YP4 A;  3SPT A;  5EIY A;  1W57 A;  2BO7 A;  2RJ9 A;  1ZDF A;  1H5T A;  2RJ1 A;  2O1G A;  5CMG X;  3USR A;  4FCU A;  2PA4 A;  2ICX A;  3F1Y A;  1R7T A;  2GGO A;  2JCL A;  5FU8 A;  5CMJ A;  1IIM A;  2BO8 A;  1QGQ A;  4G3Q A;  4LW3 A;  1LZI A;  1TW1 A;  3K8D A;  1WVC A;  1G1L A;  3U0Y A;  1FR8 A;  1H5S A;  4G3S A;  4P02 A;  3U0X A;  1ZHJ A;  1H7L A;  5C1L A;  3LW6 A;  3SXC A;  5FV9 A;  1ON8 A;  5FTV A;  4AAW A;  1R7U A;  3V0O A;  1WT1 A;  2WE9 A;  1FXO A;  2PGY A;  2Y4M A;  2P72 A;  3DK5 A;  3POL A;  1H5T B;  5C1H A;  1HJJ A;  4ASY A;  5EJ1 A;  4HO9 A;  1H7E A;  3I0H A;  5IDS A;  4Y62 A;  5C4B A;  1VGU A;  1FWY A;  1GX0 A;  3V90 A;  1VM8 A;  4J18 A;  1H4C A;  1ZI3 A;  1G3L A;  1XZ6 A;  2Z87 A;  1G8O A;  2FYC B;  2VS4 A;  1H5S D;  1G2V A;  2JCO A;  4FRQ A;  4YS8 A;  1H5S B;  2FYD B;  3Q80 A;  2AM5 A;  5C4D A;  5C38 A;  3V0P A;  2A8U A;  4NAI A;  3HL3 A;  5C4F A;  2YQC A;  4AYL A;  2AEC A;  1R82 A;  2AM4 A;  5CQP A;  2RIZ A;  1O23 B;  2YQS A;  1HJL A;  4M2B A;  1V83 A;  1HM9 A;  3DUV A;  2CU2 A;  1GX4 A;  2E8B A;  2AM3 A;  1R80 A;  4FRA A;  4LW6 A;  3BRK X;  4MND A;  4B4G A;  1FG5 N;  1FXJ A;  1VH1 A;  3D98 A;  4Y7U A;  4B42 A;  4ECM A;  2NXV A;  3I0L A;  1YP3 A;  3I0F A;  4EE4 A;  3OKR A;  3CKJ A;  3CU0 A;  2Y7A A;  1WSZ A;  2FFV A;  2APC A;  3I0D A;  1V82 A;  1E5K A;  2PGV A;  3BCV A;  3U2U A;  4KNX A;  4B2X A;  4HO4 A;  5BXC A;  2A8W A;  3SX3 A;  5CMI A;  2ZU9 A;  1G93 A;  1O7O A;  3SXE A;  2WVL A;  3I0E A;  1ZCU A;  1FGX A;  1WT0 A;  3SXD A;  3USQ A;  2WVM A;  1JYK A;  4KXO A;  1R7X A;  4FQW A;  4HO3 A;  3F1C A;  1GQC A;  3JUK A;  4IRP A;  4FRL A;  5AJO A;  2YQJ A;  4EEA A;  1EYR A;  1KWS A;  3SX7 A;  1PZY B;  3IOI A;  1VGZ A;  1WT3 A;  2XWL A;  5J49 A;  1VZX A;  4KPX A;  2RJ4 A;  2WAW A;  3CGX A;  4KNR A;  3V0L A;  1JV3 A;  5C49 A;  4C2S A;  5C3A A;  2YCM A;  1TVY A;  1ZCV A;  2P6W A;  4FRM A;  4HO8 A;  1FR9 A;  4KC4 A;  4HG6 A;  5C3D A;  4Y7F A;  5C48 A;  3ST8 A;  3IOH A;  2AH9 A;  4FRH A;  3FWW A;  5CMF X;  2P73 A;  3U2W A;  5CMH A;  1S4O A;  3CKQ A;  1HM8 A;  1FGG A;  2XMH A;  2I5E A;  1O7Q A;  1PZT A;  3V8Z A;  1SS9 A;  2W0W A;  2Y4K A;  2D7I A;  4E1K A;  2OI6 A;  5HS2 A;  1LL0 A;  2WVK A;  3RSB A;  4HO6 A;  1JVG A;  2I5K A;  1H7F A;  4KQL A;  2V0I A;  1ZI4 A;  1R7V A;  3CKN A;  2OEF A;  4CJ8 A;  5IFY A;  4Y63 A;  1OMZ A;  5JQQ A;  1LL3 A;  5CQO A;  1JVD A;  4MYB A;  5EJZ A;  1ZIZ A;  4M28 A;  1I52 A;  2D0J A;  1G0R A;  2ZU7 A;  1ZJ0 A;  2RIT A;  4AYJ A;  1MP5 A;  2X5S A;  4HO0 A;  4JD0 A;  1LZ7 A;  2XWM A;  2XWN A;  3OH1 A;  2V0L A;  3V0M A;  1GWW A;  1H7G A;  1S4P A;  3E25 A;  3OAM A;  3SX8 A;  4D11 C;  1HV9 A;  4UEG A;  2BO6 A;  1R81 A;  3RMV A;  3NGW A;  1NKH B;  5CQN X;  2X65 A;  2V0H A;  4FRE A;  1G23 A;  1MC3 A;  3ZGF A;  1K4V A;  3I0J A;  5FU0 A;  3OH0 A;  3V0Q A;  4EVW A;  4FRB A;  4K6R A;  2WEE A;  1V84 A;  4EEG A;  5L6V A;  4Y7T A;  1NF5 B;  1ZJ3 A;  2RJ0 A;  2XME A;  1ZJ2 A;  1QGS A;  3FOQ A;  4NAK A;  3R2W A;  1JV1 A;  1FRW A;  4EEM A;  2OI5 A;  3RMW A;  2AES A;  1WT2 A;  4FCE A;  1W77 A;  4EE5 A;  3JTJ A;  3ZLK A;  1OQM B;  3SXB A;  2BO4 A;  3T7M A;  1NQI B;  4M2A A;  3T7N A;  2RIY A;  2VSI A;  1IIN A;  2FYA A;  3I0C A;  3QVB A;  4XWI A;  2VS3 A;  1TW5 A;  3KIA A;  3U2X A;  2Z86 A;  2RJ5 A;  1QG8 A;  2ZU8 A;  5CQL X;  2X5Z A;  1H7H A;  3IOJ A;  5DDT A;  1NMM B;  3E26 A;  2YC3 A;  1H7T A;  4Y7V A;  3OGZ A;  3I0K A;  4FRD A;  2V0J A;  2VXM A;  4Y7G A;  2E3D A;  2MZB A;  4HOC A;  5FYE A;  1Z90 A;  4KC1 A;  4KC2 A;  2VSH A;  1G9R A;  3JUJ A;  5C3B A;  3T7O A;  4ZDQ A;  5DDV A;  3V91 A;  5AJP A;  4Y64 A;  3SX5 A;  2QKX A;  4B4B A;  1MP4 A;  4D48 A;  4G3P A;  4D0T A;  5FUH A;  2Y4J A;  2AE7 A;  1VZU A;  2D7R A;  2X60 A;  1VPA A;  4DE7 A;  1XHB A;  3I0I X;  5C8R A;  1LL2 A;  1S4N A;  3D5N A;  4ARW A;  2QGI A;  3U2T A;  3I0G A;  3OH4 A;  4IRQ A;  3TQD A;  1FO8 A;  3U2V A;  4R7P A;  1H7Q A;  2O1H A;  4CJB A;  4G87 A;  1ZJ1 A;  2Y4L A;  2Y6P A;  1ON6 A;  1TZF A;  5L6S A;  4BMA A;  1OMX A;  3ZGG A;  4KT7 A;  4HO2 A;  4JIS A;  3DJ4 A;  2PX7 A;  5AJN A;  5I1F A;  4BQH A;  1H5S C;  3CKV A;  2RJ6 A;  4CJC A;  5C1G A;  2RJ7 A;  3SXA A;  4D11 A;  1LVW A;  2YES A;  3GUE A;  2OI7 A;  1VH3 A;  1ZCT A;  1H3M A;  3D8V A;  1ZDG A;  5CQM X;  2VXL A;  1MP3 A;  1H4D A;  2FYB A;  3ZF8 A;  4L41 C;  4NAN A;  1FZW A;  2W0V A;  1ZJO A;  1INJ A;  4Y6N A;  2YC5 A;  4B2W A;  2AGD A;  2FY7 A;  5FTS A;  3PKQ A;  5C4C A;  4Y6U A;  4AC3 A;  1G95 A;  1YP2 A;  1W55 A;  2WGZ A;  4FRO A;  2I7B A;  1FO9 A;  1H5R A;  5IDT A;  1G97 A;  1NWG B;  1O0R A;  2QH5 A;  4M4K A;  4EEO A;  4CVH A;  2VS5 A;  3EE5 A;  1ZJP A;  1YRO B;  3N9W A;  3ZLL A;  4HCQ A;  3OC9 A; 
#chains in the Genus database with same CATH topology
 1VZT A;  3OH2 A;  2UX8 A;  3SXG A;  4B4M A;  3TZT A;  1H4E A;  2Q4J A;  4B5B A;  1GQ9 A;  1VIC A;  3O3P A;  2DPW A;  4GBP A;  1EZI A;  4HO5 A;  1INI A;  5C36 A;  2RIX A;  4KPZ A;  4NAL A;  1R7Y A;  2VFZ A;  3Q4S A;  2JCK A;  3PKP A;  1HM0 A;  1ZCY A;  4Y9X A;  1H5R B;  2OEG A;  4P00 A;  4EE3 A;  1JYL A;  4DDZ A;  3V8Y A;  1VGT A;  1FOA A;  4B3U A;  3R3I A;  3V0N A;  3CKO A;  2V0K A;  4ASJ A;  3OH3 A;  1LZJ A;  3PNN A;  4DEC A;  4D0Z A;  2GGQ A;  1GA8 A;  2VD4 A;  1LZ0 A;  2YQH A;  3Q7U A;  5C47 A;  2ICY A;  4FRP A;  1GWV A;  1NHE B;  1VGW A;  2JCJ A;  5C4E A;  3K8E A;  1ZI1 A;  1QWJ A;  4KRV A;  2RJ8 A;  2FFU A;  1ZI5 A;  2O1F A;  1YP4 A;  3SPT A;  5EIY A;  1W57 A;  2BO7 A;  2RJ9 A;  1ZDF A;  1H5T A;  2RJ1 A;  2O1G A;  5CMG X;  3USR A;  4FCU A;  2PA4 A;  2ICX A;  3F1Y A;  1R7T A;  2GGO A;  2JCL A;  5FU8 A;  5CMJ A;  1IIM A;  2BO8 A;  1QGQ A;  4G3Q A;  4LW3 A;  1LZI A;  1TW1 A;  3K8D A;  1WVC A;  1G1L A;  3U0Y A;  1FR8 A;  1H5S A;  4G3S A;  4P02 A;  3U0X A;  1ZHJ A;  1H7L A;  5C1L A;  3LW6 A;  3SXC A;  5FV9 A;  1ON8 A;  5FTV A;  4AAW A;  1R7U A;  3V0O A;  1WT1 A;  2WE9 A;  1FXO A;  2PGY A;  2Y4M A;  2P72 A;  3DK5 A;  3POL A;  1H5T B;  5C1H A;  1HJJ A;  4ASY A;  5EJ1 A;  4HO9 A;  1H7E A;  3I0H A;  5IDS A;  4Y62 A;  5C4B A;  1VGU A;  1FWY A;  1GX0 A;  3V90 A;  1VM8 A;  4J18 A;  1H4C A;  1ZI3 A;  1G3L A;  1XZ6 A;  2Z87 A;  1G8O A;  2FYC B;  2VS4 A;  1H5S D;  1G2V A;  2JCO A;  4FRQ A;  4YS8 A;  2J0A A;  1H5S B;  2FYD B;  3Q80 A;  2AM5 A;  5C4D A;  5C38 A;  3V0P A;  2A8U A;  4NAI A;  3HL3 A;  5C4F A;  2YQC A;  4AYL A;  2AEC A;  1R82 A;  2AM4 A;  5CQP A;  2RIZ A;  1O23 B;  2YQS A;  1HJL A;  4M2B A;  1V83 A;  1HM9 A;  3DUV A;  2CU2 A;  1GX4 A;  2E8B A;  2AM3 A;  1R80 A;  4FRA A;  4LW6 A;  3BRK X;  4MND A;  4B4G A;  1FG5 N;  1FXJ A;  1VH1 A;  3D98 A;  5D91 A;  4Y7U A;  4B42 A;  4ECM A;  2NXV A;  3I0L A;  1YP3 A;  3I0F A;  4EE4 A;  3OKR A;  3CKJ A;  3CU0 A;  2Y7A A;  1WSZ A;  2FFV A;  2APC A;  3I0D A;  1V82 A;  1E5K A;  2PGV A;  3BCV A;  3U2U A;  4KNX A;  4Q7C A;  4B2X A;  4HO4 A;  5BXC A;  2A8W A;  3SX3 A;  5CMI A;  4O6M A;  2ZU9 A;  1G93 A;  1O7O A;  3SXE A;  2WVL A;  3I0E A;  1ZCU A;  1FGX A;  1WT0 A;  3SXD A;  3USQ A;  2WVM A;  1JYK A;  4KXO A;  1R7X A;  4FQW A;  4HO3 A;  3F1C A;  1GQC A;  3JUK A;  4IRP A;  4FRL A;  5AJO A;  2YQJ A;  4EEA A;  1EYR A;  1KWS A;  3SX7 A;  1PZY B;  3IOI A;  1VGZ A;  1WT3 A;  2XWL A;  5J49 A;  1VZX A;  4KPX A;  2RJ4 A;  2WAW A;  3CGX A;  4KNR A;  3V0L A;  1JV3 A;  5C49 A;  4C2S A;  5C3A A;  2YCM A;  1TVY A;  1ZCV A;  2P6W A;  4FRM A;  4HO8 A;  1FR9 A;  4KC4 A;  4HG6 A;  5C3D A;  4Y7F A;  5C48 A;  3ST8 A;  3IOH A;  2AH9 A;  4FRH A;  3FWW A;  5CMF X;  2P73 A;  3U2W A;  5CMH A;  1S4O A;  3CKQ A;  1HM8 A;  1FGG A;  2XMH A;  2I5E A;  1O7Q A;  1PZT A;  3V8Z A;  1SS9 A;  2W0W A;  2Y4K A;  2D7I A;  4E1K A;  2OI6 A;  5HS2 A;  1LL0 A;  2WVK A;  3RSB A;  4HO6 A;  1JVG A;  2I5K A;  1H7F A;  4KQL A;  2V0I A;  1ZI4 A;  1R7V A;  3CKN A;  2OEF A;  4CJ8 A;  5IFY A;  4Y63 A;  1OMZ A;  5JQQ A;  1LL3 A;  5CQO A;  1JVD A;  4MYB A;  5EJZ A;  1ZIZ A;  4M28 A;  1I52 A;  2D0J A;  1G0R A;  2ZU7 A;  1ZJ0 A;  2RIT A;  4AYJ A;  1MP5 A;  2X5S A;  4HO0 A;  4JD0 A;  1LZ7 A;  2XWM A;  2XWN A;  3OH1 A;  2V0L A;  3V0M A;  1GWW A;  1H7G A;  1S4P A;  3E25 A;  3OAM A;  3SX8 A;  4D11 C;  1HV9 A;  4UEG A;  2BO6 A;  1R81 A;  3RMV A;  3NGW A;  1NKH B;  5CQN X;  2X65 A;  2V0H A;  4FRE A;  1G23 A;  1MC3 A;  3ZGF A;  1K4V A;  3I0J A;  5FU0 A;  3OH0 A;  3V0Q A;  4EVW A;  4FRB A;  4K6R A;  2WEE A;  1V84 A;  4EEG A;  5L6V A;  4Y7T A;  1NF5 B;  1ZJ3 A;  2RJ0 A;  2XME A;  1ZJ2 A;  1QGS A;  3FOQ A;  4NAK A;  3R2W A;  1JV1 A;  1FRW A;  4EEM A;  2OI5 A;  3RMW A;  2AES A;  5D92 A;  1WT2 A;  4FCE A;  1W77 A;  4EE5 A;  3JTJ A;  3ZLK A;  1OQM B;  4FIY A;  3SXB A;  2BO4 A;  3T7M A;  1NQI B;  4M2A A;  3T7N A;  2RIY A;  2VSI A;  1IIN A;  2FYA A;  3I0C A;  3QVB A;  4XWI A;  2VS3 A;  1TW5 A;  3KIA A;  3U2X A;  2Z86 A;  2RJ5 A;  1QG8 A;  2ZU8 A;  5CQL X;  2X5Z A;  1H7H A;  3IOJ A;  5DDT A;  1NMM B;  3E26 A;  2YC3 A;  1H7T A;  4Y7V A;  3OGZ A;  3I0K A;  4FRD A;  2V0J A;  2VXM A;  4Y7G A;  2E3D A;  2MZB A;  4HOC A;  5FYE A;  1Z90 A;  4KC1 A;  4KC2 A;  2VSH A;  1G9R A;  4O6N A;  3JUJ A;  2J0B A;  5C3B A;  3T7O A;  4ZDQ A;  5DDV A;  3V91 A;  5AJP A;  4Y64 A;  3SX5 A;  2QKX A;  4B4B A;  1MP4 A;  4D48 A;  4G3P A;  4D0T A;  2C0N A;  5FUH A;  2Y4J A;  2AE7 A;  1VZU A;  2D7R A;  2X60 A;  1VPA A;  4DE7 A;  1XHB A;  3I0I X;  5C8R A;  1LL2 A;  1S4N A;  3D5N A;  4ARW A;  2QGI A;  3U2T A;  3I0G A;  3OH4 A;  4IRQ A;  3TQD A;  1FO8 A;  3U2V A;  4R7P A;  1H7Q A;  2O1H A;  4CJB A;  4G87 A;  1ZJ1 A;  2Y4L A;  2Y6P A;  1ON6 A;  1TZF A;  5L6S A;  4BMA A;  1OMX A;  3ZGG A;  4KT7 A;  4HO2 A;  4MIX A;  4JIS A;  3DJ4 A;  2PX7 A;  5AJN A;  5I1F A;  4BQH A;  1H5S C;  3CKV A;  2RJ6 A;  4CJC A;  5C1G A;  2RJ7 A;  3SXA A;  4D11 A;  1LVW A;  2YES A;  4FIX A;  2VK9 A;  3GUE A;  2OI7 A;  1VH3 A;  1ZCT A;  1H3M A;  3D8V A;  1ZDG A;  5CQM X;  2VXL A;  1MP3 A;  1H4D A;  2FYB A;  3ZF8 A;  4L41 C;  4NAN A;  1FZW A;  2W0V A;  1ZJO A;  1INJ A;  4Y6N A;  2YC5 A;  4B2W A;  2AGD A;  2FY7 A;  5FTS A;  3PKQ A;  5C4C A;  4Y6U A;  4AC3 A;  1G95 A;  1YP2 A;  1W55 A;  2WGZ A;  4FRO A;  2I7B A;  1FO9 A;  1H5R A;  5IDT A;  1G97 A;  1NWG B;  1O0R A;  2QH5 A;  4M4K A;  4EEO A;  4CVH A;  2VS5 A;  3EE5 A;  1ZJP A;  1YRO B;  3N9W A;  3ZLL A;  4HCQ A;  3OC9 A; 
#chains in the Genus database with same CATH homology
 1VZT A;  3OH2 A;  2UX8 A;  3SXG A;  4B4M A;  3TZT A;  1H4E A;  2Q4J A;  4B5B A;  1GQ9 A;  1VIC A;  3O3P A;  2DPW A;  4GBP A;  1EZI A;  4HO5 A;  1INI A;  5C36 A;  2RIX A;  4KPZ A;  4NAL A;  1R7Y A;  2VFZ A;  3Q4S A;  2JCK A;  3PKP A;  1HM0 A;  1ZCY A;  4Y9X A;  1H5R B;  2OEG A;  4P00 A;  4EE3 A;  1JYL A;  4DDZ A;  3V8Y A;  1VGT A;  1FOA A;  4B3U A;  3R3I A;  3V0N A;  3CKO A;  2V0K A;  4ASJ A;  3OH3 A;  1LZJ A;  3PNN A;  4DEC A;  4D0Z A;  2GGQ A;  1GA8 A;  2VD4 A;  1LZ0 A;  2YQH A;  3Q7U A;  5C47 A;  2ICY A;  4FRP A;  1GWV A;  1NHE B;  1VGW A;  2JCJ A;  5C4E A;  3K8E A;  1ZI1 A;  1QWJ A;  4KRV A;  2RJ8 A;  2FFU A;  1ZI5 A;  2O1F A;  1YP4 A;  3SPT A;  5EIY A;  1W57 A;  2BO7 A;  2RJ9 A;  1ZDF A;  1H5T A;  2RJ1 A;  2O1G A;  5CMG X;  3USR A;  4FCU A;  2PA4 A;  2ICX A;  3F1Y A;  1R7T A;  2GGO A;  2JCL A;  5FU8 A;  5CMJ A;  1IIM A;  2BO8 A;  1QGQ A;  4G3Q A;  4LW3 A;  1LZI A;  1TW1 A;  3K8D A;  1WVC A;  1G1L A;  3U0Y A;  1FR8 A;  1H5S A;  4G3S A;  4P02 A;  3U0X A;  1ZHJ A;  1H7L A;  5C1L A;  3LW6 A;  3SXC A;  5FV9 A;  1ON8 A;  5FTV A;  4AAW A;  1R7U A;  3V0O A;  1WT1 A;  2WE9 A;  1FXO A;  2PGY A;  2Y4M A;  2P72 A;  3DK5 A;  3POL A;  1H5T B;  5C1H A;  1HJJ A;  4ASY A;  5EJ1 A;  4HO9 A;  1H7E A;  3I0H A;  5IDS A;  4Y62 A;  5C4B A;  1VGU A;  1FWY A;  1GX0 A;  3V90 A;  1VM8 A;  4J18 A;  1H4C A;  1ZI3 A;  1G3L A;  1XZ6 A;  2Z87 A;  1G8O A;  2FYC B;  2VS4 A;  1H5S D;  1G2V A;  2JCO A;  4FRQ A;  4YS8 A;  2J0A A;  1H5S B;  2FYD B;  3Q80 A;  2AM5 A;  5C4D A;  5C38 A;  3V0P A;  2A8U A;  4NAI A;  3HL3 A;  5C4F A;  2YQC A;  4AYL A;  2AEC A;  1R82 A;  2AM4 A;  5CQP A;  2RIZ A;  1O23 B;  2YQS A;  1HJL A;  4M2B A;  1V83 A;  1HM9 A;  3DUV A;  2CU2 A;  1GX4 A;  2E8B A;  2AM3 A;  1R80 A;  4FRA A;  4LW6 A;  3BRK X;  4MND A;  4B4G A;  1FG5 N;  1FXJ A;  1VH1 A;  3D98 A;  5D91 A;  4Y7U A;  4B42 A;  4ECM A;  2NXV A;  3I0L A;  1YP3 A;  3I0F A;  4EE4 A;  3OKR A;  3CKJ A;  3CU0 A;  2Y7A A;  1WSZ A;  2FFV A;  2APC A;  3I0D A;  1V82 A;  1E5K A;  2PGV A;  3BCV A;  3U2U A;  4KNX A;  4Q7C A;  4B2X A;  4HO4 A;  5BXC A;  2A8W A;  3SX3 A;  5CMI A;  4O6M A;  2ZU9 A;  1G93 A;  1O7O A;  3SXE A;  2WVL A;  3I0E A;  1ZCU A;  1FGX A;  1WT0 A;  3SXD A;  3USQ A;  2WVM A;  1JYK A;  4KXO A;  1R7X A;  4FQW A;  4HO3 A;  3F1C A;  1GQC A;  3JUK A;  4IRP A;  4FRL A;  5AJO A;  2YQJ A;  4EEA A;  1EYR A;  1KWS A;  3SX7 A;  1PZY B;  3IOI A;  1VGZ A;  1WT3 A;  2XWL A;  5J49 A;  1VZX A;  4KPX A;  2RJ4 A;  2WAW A;  3CGX A;  4KNR A;  3V0L A;  1JV3 A;  5C49 A;  4C2S A;  5C3A A;  2YCM A;  1TVY A;  1ZCV A;  2P6W A;  4FRM A;  4HO8 A;  1FR9 A;  4KC4 A;  4HG6 A;  5C3D A;  4Y7F A;  5C48 A;  3ST8 A;  3IOH A;  2AH9 A;  4FRH A;  3FWW A;  5CMF X;  2P73 A;  3U2W A;  5CMH A;  1S4O A;  3CKQ A;  1HM8 A;  1FGG A;  2XMH A;  2I5E A;  1O7Q A;  1PZT A;  3V8Z A;  1SS9 A;  2W0W A;  2Y4K A;  2D7I A;  4E1K A;  2OI6 A;  5HS2 A;  1LL0 A;  2WVK A;  3RSB A;  4HO6 A;  1JVG A;  2I5K A;  1H7F A;  4KQL A;  2V0I A;  1ZI4 A;  1R7V A;  3CKN A;  2OEF A;  4CJ8 A;  5IFY A;  4Y63 A;  1OMZ A;  5JQQ A;  1LL3 A;  5CQO A;  1JVD A;  4MYB A;  5EJZ A;  1ZIZ A;  4M28 A;  1I52 A;  2D0J A;  1G0R A;  2ZU7 A;  1ZJ0 A;  2RIT A;  4AYJ A;  1MP5 A;  2X5S A;  4HO0 A;  4JD0 A;  1LZ7 A;  2XWM A;  2XWN A;  3OH1 A;  2V0L A;  3V0M A;  1GWW A;  1H7G A;  1S4P A;  3E25 A;  3OAM A;  3SX8 A;  4D11 C;  1HV9 A;  4UEG A;  2BO6 A;  1R81 A;  3RMV A;  3NGW A;  1NKH B;  5CQN X;  2X65 A;  2V0H A;  4FRE A;  1G23 A;  1MC3 A;  3ZGF A;  1K4V A;  3I0J A;  5FU0 A;  3OH0 A;  3V0Q A;  4EVW A;  4FRB A;  4K6R A;  2WEE A;  1V84 A;  4EEG A;  5L6V A;  4Y7T A;  1NF5 B;  1ZJ3 A;  2RJ0 A;  2XME A;  1ZJ2 A;  1QGS A;  3FOQ A;  4NAK A;  3R2W A;  1JV1 A;  1FRW A;  4EEM A;  2OI5 A;  3RMW A;  2AES A;  5D92 A;  1WT2 A;  4FCE A;  1W77 A;  4EE5 A;  3JTJ A;  3ZLK A;  1OQM B;  4FIY A;  3SXB A;  2BO4 A;  3T7M A;  1NQI B;  4M2A A;  3T7N A;  2RIY A;  2VSI A;  1IIN A;  2FYA A;  3I0C A;  3QVB A;  4XWI A;  2VS3 A;  1TW5 A;  3KIA A;  3U2X A;  2Z86 A;  2RJ5 A;  1QG8 A;  2ZU8 A;  5CQL X;  2X5Z A;  1H7H A;  3IOJ A;  5DDT A;  1NMM B;  3E26 A;  2YC3 A;  1H7T A;  4Y7V A;  3OGZ A;  3I0K A;  4FRD A;  2V0J A;  2VXM A;  4Y7G A;  2E3D A;  2MZB A;  4HOC A;  5FYE A;  1Z90 A;  4KC1 A;  4KC2 A;  2VSH A;  1G9R A;  4O6N A;  3JUJ A;  2J0B A;  5C3B A;  3T7O A;  4ZDQ A;  5DDV A;  3V91 A;  5AJP A;  4Y64 A;  3SX5 A;  2QKX A;  4B4B A;  1MP4 A;  4D48 A;  4G3P A;  4D0T A;  2C0N A;  5FUH A;  2Y4J A;  2AE7 A;  1VZU A;  2D7R A;  2X60 A;  1VPA A;  4DE7 A;  1XHB A;  3I0I X;  5C8R A;  1LL2 A;  1S4N A;  3D5N A;  4ARW A;  2QGI A;  3U2T A;  3I0G A;  3OH4 A;  4IRQ A;  3TQD A;  1FO8 A;  3U2V A;  4R7P A;  1H7Q A;  2O1H A;  4CJB A;  4G87 A;  1ZJ1 A;  2Y4L A;  2Y6P A;  1ON6 A;  1TZF A;  5L6S A;  4BMA A;  1OMX A;  3ZGG A;  4KT7 A;  4HO2 A;  4MIX A;  4JIS A;  3DJ4 A;  2PX7 A;  5AJN A;  5I1F A;  4BQH A;  1H5S C;  3CKV A;  2RJ6 A;  4CJC A;  5C1G A;  2RJ7 A;  3SXA A;  4D11 A;  1LVW A;  2YES A;  4FIX A;  2VK9 A;  3GUE A;  2OI7 A;  1VH3 A;  1ZCT A;  1H3M A;  3D8V A;  1ZDG A;  5CQM X;  2VXL A;  1MP3 A;  1H4D A;  2FYB A;  3ZF8 A;  4L41 C;  4NAN A;  1FZW A;  2W0V A;  1ZJO A;  1INJ A;  4Y6N A;  2YC5 A;  4B2W A;  2AGD A;  2FY7 A;  5FTS A;  3PKQ A;  5C4C A;  4Y6U A;  4AC3 A;  1G95 A;  1YP2 A;  1W55 A;  2WGZ A;  4FRO A;  2I7B A;  1FO9 A;  1H5R A;  5IDT A;  1G97 A;  1NWG B;  1O0R A;  2QH5 A;  4M4K A;  4EEO A;  4CVH A;  2VS5 A;  3EE5 A;  1ZJP A;  1YRO B;  3N9W A;  3ZLL A;  4HCQ A;  3OC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...