1GA1A

Crystal structure analysis of pscp (pseudomonas serine-carboxyl proteinase) complexed with a fragment of iodotyrostatin (this enzyme renamed "sedolisin" in 2003)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
370
structure length
370
Chain Sequence
GTAKGHNPTEFPTIYDASSAPTAANTTVGIITIGGVSQTLQDLQQFTSANGLASVNTQTIQTGSSNGDYSDDQQGQGEWDLDSQSIVGSAGGAVQQLLFYMADQSASGNTGLTQAFNQAVSDNVAKVINVSLGWCEADANADGTLQAEDRIFATAAAQGQTFSVSSGDEGVYECNNRGYPDGSTYSVSWPASSPNVIAVGGTTLYTTSAGAYSNETVWNEGLDSNGKLWATGGGYSVYESKPSWQSVVSGTPGRRLLPDISFDAAQGTGALIYNYGQLQQIGGTSLASPIFVGLWARLQSANSNSLGFPAASFYSAISSTPSLVHDVKSGNNGYGGYGYNAGTGWDYPTGWGSLDIAKLSAYIRSNGFGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Practical experience with the use of halides for phasing macromolecular structures: a powerful tool for structural genomics.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords SERINE-CARBOXYL PROTEINASE
total genus 139
structure length 370
sequence length 370
ec nomenclature ec 3.4.21.100: Sedolisin.
pdb deposition date 2000-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1ga1A00
3EDYA 3D9QX 2E1PA 4B5LA 1OT5A 4DJ5X 1GT91 1ZVKA 5CW1A 1KDYA 3AJ8A 3I34X 1TM5E 1Y48E 3LXUX 2DUJA 1WMEA 3VV3A 2W2NA 1BE8A 3I30X 1GNVA 1PJ8A 1THMA 3QFHA 4RYDA 5ARCA 3DE1X 3QMPA 1GTG1 2SNIE 3WIVA 1R0RE 5SICE 1ZVJA 4ZOQI 1AQNA 3OSZA 2ZRQA 5JMOA 1AF4A 1NDUA 1S02A 1NDQA 1SCDA 2Z2YA 4NMXB 4OMDA 4KB5A 2ZWPA 2Z30A 1V5IA 4J94A 1P8JA 2PKCA 2PMWB 3A3PA 4LVOA 3TI7A 3VTAA 1AV7A 1TM3E 3VV2A 4ZARA 1BH6A 3SICE 1SN7A 2HPZA 4YN3A 1ST3A 2ST1A 4C3VA 1SCBA 1PFGA 1JEAA 1BFUA 1MEEA 1T1IA 2P4EA 2WUVA 3DW3X 3GCXA 3F49S 3QTLA 4H6VA 3DE5X 1ST2A 3DE7X 1SBNE 1SBCA 1MPTA 1KE2A 1PTKA 1KE1A 5ARDA 5JXIA 3DE3X 5AMXA 1SVNA 3A3OA 1S2NA 2W2QA 3EE6A 3EIFA 3Q40A 4MZDA 4WOCA 3LPAA 1GTL1 4GI3A 3PRKE 3L1KA 1V6CA 3F7MA 1T1EA 4OMCA 3DE0X 5I9SA 2G4VA 1TM4E 4CFYA 1A2QA 1CNMA 5B1EA 2PWAA 4NE9A 2DQKA 3TI9A 1EA7A 3DVRX 4M1ZA 5JXHA 2XRMA 1Y33E 2IXTA 1Y3DE 5FBZA 1AK9A 3BPSA 2PYZA 3CO0S 1OYVA 3VYVA 1TM1E 2X8JA 1Y4DE 2QTWB 3T41A 4AKSA 1SUBA 1TECE 1SUDA 4FONA 4CG0A 4AKTA 3DYBA 3DDZX 1XF1A 4LVNA 3DE6X 3WHIA 2V8BA 4WOBA 5AVJA 2Z56A 5ARBA 2W2PA 4HX2A 1SIOA 1TMGE 1YU6A 1Y3FE 2DP4E 5JXJA 1TO1E 1YJCA 2IY9A 3AJ9A 3DWEX 4DWWA 5K7SA 2PRKA 2W2OA 1AH2A 1DUIA 1T1GA 1SPBS 1WMFA 3DE4X 4Z2AA 4OV6B 1SUCA 1AU9A 2Z58A 3GT4A 2B6NA 3SQOA 2X8JB 1GNSA 2WUWE 2WWTA 1UBNA 3D43A 1AVTA 4I0WB 1BJRE 4KG7A 2HD4A 3I37X 1WSDA 2TECE 1R6VA 5AQEA 4BWGA 3P5BA 5FAXA 2ID8A 1VSBA 3ZXYA 4CFZA 1P7WA 1C9NA 1YJBA 1YJAA 3DVSX 3LPDA 1Y9ZA 4K8RB 1PEKE 1SIUA 3AFGA 5JXGA 3CNQS 1WMDA 3BGOS 1HT3A 2WV7A 3A3NA 2SBTA 1SBHA 3H42B 3Q5GA 1IC6A 3GT3A 1SCAA 1TO2E 1TM7E 2ID4A 3BX1A 1DBIA 3DE2X 3LPCA 4NE7A 3DW1X 1GCIA 2Z2XA 2XTJA 3TECE 1C3LA 1Y4AE 1IAVA 5B1DA 1SCJA 2Z57A 1GA4A 1SCNE 3PTLA 2GKOA 3I2YX 4H6XA 4DZTA 1TK2A 1SH7A 1SUPA 3F7OA 5AVKA 4C3UA 1C9MA 1SBIA 1SELA 2PWBA 1Y3BE 1LW6E 1S01A 2ZWOA 1SBTA 2Z2ZA 2W2MA 1C9JA 1SUAA 1WVMA 3DVQX 4JP8A 1NLUA 1KDVA 3WQBA 3ZXXA 1OYOA 3VSBA 3GCWA 4HVLA 1Q5PA 1SUEA 1KDZA 1GA1A 1Y34E 1BE6A 1Y3CE 2PQ2A 3VHQA 2SECE 1R64A 2SICE 1EGQA 1Y1KE 4H6WA 1CSEE 3HJRA 3WIUA 1GTJ1 1SIBE 5FFNA 3UNXA 1GA6A 1P7VA 1BFKA 4KPGA
chains in the Genus database with same CATH superfamily
5CDSA 2VYVD 1CIJA 4FU0A 2B94A 5K0ZA 3E4CA 2R6DA 1YRHA 5EKUA 3ZBPA 2WMYA 2XVMA 5WRFA 3ZW9A 5CW1A 1MZPA 3CLRC 2H1IA 4K9PA 3FNIA 2P90A 3G2JA 1H3NA 2OGSA 2I5PO 5CAEB 4F85A 1W8DA 3PJGA 1J0EA 2QG6A 5CCXA 1S2DA 2R5WA 5ALDA 2EP8A 4YRIA 1SXHA 2OHGA 3D3KA 3OCVA 4OUDA 4EJ0A 5JFOA 2RHMA 1QIJA 4AULA 1D9XA 4O4HA 5DHUA 2OFFA 4WE3A 4FHEA 4JSRA 3AJRA 4D4LA 4TMKA 1DRUA 2WMDA 2Z30A 5B7GA 5JDCA 3KQMA 3W2TA 3E15A 2FP4B 4QOHA 3H75A 4LHYA 4QKQA 2WIDA 1KMNA 4KFSA 2B8TA 4L78A 1GLVA 3EDOA 3SZRA 1W88A 3P9CA 1WY5A 5KC9A 2VNHA 3P9RA 3OZVA 2TMGA 1TEVA 1PFVA 2WU0A 2YZ7A 4UAJA 3UGKA 5DYGA 5BURA 5FYDA 3Q9SA 1FBTA 5B53A 3AVOA 1XVUA 3DNPA 3TBKA 4ZFNA 1DNPA 1G63A 1YQTA 2HA4A 3H18A 5DASA 4Z3OA 3GPDG 1MVLA 3L6EA 2YV4A 3Q12A 4LJ9A 4DLZA 5FH9A 1F8FA 2WD8A 5C81A 2HJRA 4TWIA 4HRXA 1QPGA 4I4TA 1MXHA 2N0SA 5F2KA 1P80A 3G8DA 1GEGA 3DUFB 3RRXA 1CTQA 2F3TA 5FWNA 4RPCA 3UB4A 5LJIA 1DGQA 4JJ6A 1I5EA 3R7WB 4F3KA 1PV2A 1N3IA 4FDMA 4JUBA 3HZOA 1IUOA 1LVHA 3LTEA 4HDRB 4F46A 4HFRA 5CBPB 1N9GA 4CHTA 2ZRMA 2ZCUA 4XPIA 2D0IA 3O26A 2CT8A 1MOPA 2W6QA 3M5PA 1MKYA 3DDZX 4A0SA 2WJIA 2KYRA 4DJAA 5LIRA 3I8OA 4HH3C 1WKVA 4NESA 1CZKA 2IPAB 4JLMA 1NM5A 4DV1B 3J7AC 4Z4FA 2R6CA 1BWPA 3W90A 4MMYB 4WNYA 3TE7A 3X3HA 3A4TA 3HCEA 1YL5A 5LXTF 2X4IA 4GS5A 2V0NA 4HWGA 4WRRA 4DIKA 4YRPA 5SY4A 3LLMA 2QLNA 3E84A 3GAFA 4TMTA 3ZHRA 1GCAA 3GZNA 4M83A 5EFZA 4YPVA 1C7JA 2SHKA 5HFNA 1R5NA 1HNNA 5I6DA 1P4RA 1R9NA 4O2RA 3HWRA 5CNJA 1S8FA 3IP3A 4FLEA 2MINA 3V1TC 1WA5A 3MTBA 3NJ4A 2HK9A 5KDOA 5LP6B 1D9ZA 1F4VA 1PW5A 3UB3A 3QXGA 4RTLA 4R69A 2BHNA 3QM1A 3QYPA 3UWMA 4TLAA 3GLIE 1PWHA 4IHJA 1QYIA 2RH9B 2VJDA 3JXEA 4I4TB 4XOIA 4DDKA 2RBGA 2DWQA 2HJHA 3AT1A 3TECE 3LDUA 1ZOPA 1L5LA 4X44A 3F3KA 1SCNE 3ZBUA 3ZU3A 4UHFA 4BNUA 1IM2A 1CB7A 2QG4A 4GLLA 4PSDA 2ZLBA 3UFBA 1BHQ1 3DOOA 2KHZA 3EZ6A 1VOTA 2EKLA 5GONB 4ZAVA 2Z2ZA 1CUUA 1TZMA 4PIVA 4ZCLA 1E1YA 1YOVB 1J23A 2JIZD 4XDHA 5C8YA 2K5UA 3RVLA 3ZWDA 3VKWA 1WXFA 3IUPA 4GLBA 1E9AA 1PBNA 3TEJA 1IJKA 2I66A 4CNQA 5A3QA 2WI8A 3SX4A 1SZPA 4HD8A 1TI7A 3A26A 5KYUB 3AJ8A 2AG6A 3GDWA 4JBNA 1QMPA 2BBTA 1BQ3A 5HCUA 2MMGA 4AS3A 4R7GA 1XRMA 1UDRA 3AB3A 4GF5A 5KQRA 2Q9AA 5D2CA 2BMJA 2HA5A 3F5DA 4PGHA 3HQ4O 1WPGA 3T7SA 2CL7X 4OQXA 3VNSA 2E6KA 3OOJA 2XAUA 3HCNA 4TVBA 3WDLA 5LOVB 2CYBA 4TS4A 1P2SA 2FHPA 2ZRKA 2XNDD 3H4MA 4UBKA 5SYAA 3IVMA 3KRTA 4CIBA 1DAFA 4GDMA 5H3CA 1Y6ZA 4DR1B 4AJIA 1FY2A 1YVDA 1W4ZA 3U61B 2AEJA 3ZXUB 2HPVA 2K2QB 2MSLA 4GPTA 5JAQA 1YVEI 4DJEC 1DX9A 4OM7A 1RTTA 1TUGA 4HFNA 3G0OA 2GCPA 2NZYA 4LZAA 2QZ4A 1I6LA 3JQGB 2HFJA 3TL2A 2IUSA 4RY8A 5CPFA 1G8JA 5AHWA 3O8OA 3T9EA 3WMWA 4V0ME 2BWJA 3AVWA 2VHCA 3E22B 3F6RA 3GYGA 3OURA 2JHGA 5DYTA 3WGJA 3AUYA 2GZSA 2L82A 4NJOA 2DUMA 1GL9B 2JFBA 1L3BA 2O8FB 3ZNPA 1VL0A 4BMSA 1MF7A 2FK7A 3DDSA 4WFJA 5I9SA 1FDWA 1E2JA 1TM4E 5BUQA 1NVKA 2ECOA 2OILA 2Q8NA 1PJCA 5DIFA 2IXTA 2WICA 3I6BA 3RK0A 1MW9X 3RK4A 1P0CA 5JS6A 3A1VA 3HZZA 3JRWA 4Z0HO 1JAIA 1ZWKA 2E5LB 1RP7A 1CY7A 1JRLA 3WX0A 4KZPA 2CVHA 4WY2A 1CEQA 1IVNA 3S2GA 1XCJA 4ZTUB 2BMDA 1XCPA 4M0CA 3C5VA 5EHZA 3VPBA 3VNQA 1HV8A 2B8JA 2FQYA 4TKMA 4MI1A 4E4RA 1M34B 3DLCA 4O1MA 3CJTA 2H1HA 1JHPA 2JI7A 1JJIA 4GC5A 3NHPA 4RIEA 4C89A 3LVQE 1E61A 3A7DA 2J3HA 2WSMA 4N5NA 2QROA 1KA9H 3DE4X 3B3FA 1SPBS 1FTYA 3PQ2A 4UJ3A 5BYBA 5A3JA 2GK4A 4H35A 4HDOB 5G2OA 3G02A 1CLEA 4PRZA 4HWKA 4QNMA 5BN5B 1FFBA 5BSVA 3QELA 3KHUA 4PANA 2MYNA 2ZR0A 2WC1A 3IVGA 5HG0A 5MF6A 1HTWA 2JL1A 3RG8A 1DQRA 4B6EA 2X7JA 2HU2A 2AA3A 3U4DA 1XROA 1O5OA 3DLPX 1NVXQ 2GEFA 3G1WA 1A9YA 2BAGA 2Q99A 5IUJC 4QOJA 2BIFA 2GARA 2PGDA 4BJHB 2B30A 3ZE2B 3I42A 1ZD4A 4EJFA 1V8PA 3QY0A 4YV1A 2DLCX 3CEMA 4BN5A 2LGJA 5EG5A 3CG4A 3F7TA 1XRRA 3PTAA 3P5SA 3U39A 2BISA 4HDQB 1YB5A 1NXVA 2HBYA 2H5EA 3ZOZA 4PYNA 2Z6UA 4M8NE 3JTEA 3C8ZA 1Q5PA 3AY3A 1CQJA 3OZAA 1ZMRA 4KSCA 1WB9A 5AR1A 1RCFA 1SXGA 1CDDA 1A69A 1WPRA 2OBMA 3H5WA 4HNSA 4E4YA 3HADA 4IDQA 4YBZA 5BOSA 3G7NA 4PLTA 4ZVNA 3JVEA 4B3BA 1KFEB 1Z33A 3U09A 1KAGA 4GZMA 1EIZA 4FS3A 4HN9A 1H5QA 2W98A 1M10A 3KOZA 3R75A 5CM2Z 1UWCA 4AZVA 2W42A 4BTEA 4S05A 3AUKA 1I4LD 3BMNB 3QMPA 3T94A 3VKGA 2O59A 1VJ1A 2QN8A 1HETA 5HRUA 2REOA 3ITEA 3G0HA 1DAIA 3KB1A 3TTVA 1J4AA 1CUAA 1HDOA 5IABA 3OICA 1TTPB 5CJ2A 5JH7A 4R8MA 2WF8A 3MILA 3GLFB 1AQ6A 1MQSA 1WNFA 3KELA 3KQOA 2HMWA 2I3AA 4OTZA 3UHPA 3U3KA 2OLJA 5IZCC 1A76A 1LD3A 4YBRA 3GK3A 4C3VA 1NBME 4LOJA 4PCLA 2PQMA 5G0UA 4D3ZA 4DNPA 3E1SA 4AMGA 5HKBA 1WETA 2ZSHA 1FUUA 1VLLA 1YIAA 1KYWA 2BONA 1BE0A 4QUIA 4U02A 3PC6A 4OHUA 3L41A 5K4AA 2X0DA 2XQVA 2ATVA 1YC2A 1SEPA 2W48A 1G21A 1G60A 1X9HA 1NW5A 2RB4A 1O8BA 3DMNA 3DT8A 3L84A 3QBDA 2C3UA 3GMTA 5JCOA 5HILA 1EHIA 4N9QA 2XCSB 1ZHHA 3U0VA 1XB2A 1KRXA 3WLIA 3A9RA 1UKEA 2HSZA 1VG0B 2VSFA 3GC6A 3KAJA 5CT8A 2R1TB 3KBBA 1GL3A 1EUCA 2O23A 3OX2A 4G1MB 2IYVA 1K08A 2DEUA 1Z0JA 3H11B 4JBHA 4RMIA 4OBXA 4LOAA 3U81A 3FNRA 1EFUA 2IY7A 1OFUA 3FWPA 5K6AA 4BHTA 1EWRA 2IGBA 5DBOA 5IZCA 2L0XA 4R2LA 4D99A 1RAIA 2FSFA 3K9WA 1DRVA 4MQUA 4EKIA 4YRTA 5F23A 4FGJA 2ZPUA 3EEOA 4D8VA 1WXGA 1QP8A 2RHOA 2C00A 4HGQA 4R83A 3PQEA 4G8CA 2YN4A 2VQDA 3IEPA 3AR5A 5AT1A 3WNQA 5I3ZA 2PUHA 1WJGA 2NSLA 1CE8A 2PZFA 4UHKA 3KQNA 3R2JA 2ZGVA 4KCGA 3DTVD 3EXFB 4KO3S 4C6TB 5IYZB 4LVCA 3KDSE 3IA7A 2NO0A 2J3IA 3PQ5A 4KAJA 3R3JA 4MB6A 3RLIA 4W82A 3ZLVA 3SNHA 3VNAA 3FGNA 5KNBH 2VZ8A 3SZLA 5KSZA 2GLTA 4A16A 4ZI7B 4NRDA 1ZGJA 3ABSB 3ZU4A 4CUZA 2AB0A 2YWXA 3UT5B 2VJLA 3ZVNA 2YUIA 4I36A 1N1DA 4QGFA 5CNKA 3SU8A 1RW4A 4PAWA 2NTJA 2WU4A 3BIFA 5K3EA 1YBFA 1P60A 3T9CA 2PG3A 2OENG 4Q02A 821PA 1M7BA 4UAGA 2BZ0A 1GRRA 5LYJA 4XQ9A 4P5DA 3C97A 1WW3A 4D3DA 4YV0A 5JCXA 1J8FA 2H8KA 4EI9A 3R3UA 5FOVA 1FXWA 3TFQA 5B2ZA 1N7HA 4IIJB 3WYGA 1LX7A 3WK5A 2GM9A 1O6BA 3Q3JB 1RYZA 4OUDB 3ZDRA 2Y1KA 4IUCS 3BFXA 2QK4A 4LMRA 1I4OA 1A9XA 3GN1A 3ZU2A 3ZLTA 2JLCA 3GJQA 3IAM1 1T2NA 1ZXBA 3QJYA 4UZFA 1FS4A 4BBZA 2IS4A 1P2UA 1EX1A 2GRJA 3Q10A 4A4DA 1W76A 4QEZA 3UCXA 1UBCA 4CKWA 3PL1A 3WL7A 3CNOA 4JR2A 2F3QA 3RUHA 2AFHE 1B42A 3KCQA 3R76A 3RVSA 3ZR4B 4ESEA 2QJOA 4JI3B 5CDFE 2AVNA 1RPZA 2YDYA 3STYA 2XGJA 1RWQA 5BUZA 4WK6A 2DY0A 3EF0A 1VP9A 2B6HA 2D2VA 5BMVB 1AQJA 3U13A 3CVUA 3KB6A 2W00A 5F1PA 1NXPA 4DM3A 1B74A 2IZ0A 3GVHA 3R8CA 4NMXB 1VJGA 3GJ6A 2JH3A 3SEQA 4BPRA 2AJTA 5IXSA 2O50A 1U8EA 4BNIA 4QDXA 4EZIA 2AW5A 1GNTA 2VSNA 1V5FA 3AF2A 3CT4A 4DUZB 4BP9A 1JFSA 2VJBA 2XA9A 1PTJC 4KHZA 1Z6YA 5A62A 2P69A 5ADUS 2QM0A 3LQYA 5JDIA 3QTBA 4XQCA 2RHBA 2ZT5A 3DOHA 4I46A 2HHLA 5ARDA 3PC7A 3OPYB 3UZUA 4B71A 5FBWB 4EK9A 1RJDA 2X0EA 3GPCA 1KMHA 3SZGA 3OWOA 3ABRB 3W2HA 2GLUA 1OXUA 2FWJA 1A2BA 4JIMA 4ZA2A 2O2XA 1A9XB 3K73O 1GQRA 2EQAA 4EG0A 2WUDA 5E1BA 1FNSA 2O4UX 1FS6A 2Q6TA 3HCRA 3UICA 3T5BA 4BFUA 2HDOA 2H92A 3L4BC 3NWOA 2JLWA 4M36A 1PNVA 4TYYA 1YI8A 1P9WA 2Y71A 1E1LA 3LRXA 2ZTVA 4HLDA 3WFIA 1D2GA 1LJ8A 2GF9A 4PAMA 2UYHA 1OU0A 3LQQA 4QT0A 4E88A 3QX9A 2UZ4A 3CCBA 3KFLA 2JB9A 1BWSA 2XZTA 3JZDA 3UJ7A 2Q1WA 4TXMA 3VHXA 3ABQB 3O84A 3ZI7A 4MVJH 4MVJF 5FWXA 3REGA 1O87A 3V8BA 3X1MA 5C5CA 4EEXA 3NGLA 1H05A 4MQEA 3H3FA 5A3RA 4O4IA 1C9EA 2DVMA 4U00A 3IXMA 1TFUA 1IZYA 3ZIDA 3T54A 5K99A 4PSCA 3QWIA 5FBVB 1XAIA 3H1EA 3UJNA 3ZZMA 2D5LA 2FH5B 3X1DA 3H17A 4KXVA 4PPQA 3LNCA 3S2UA 4FZVA 4EBBA 3ZK7A 4D3FA 5EKSA 4NENB 3QI7A 3QJ5A 1JIVA 3WR5A 1JHZA 2Q07A 3BSYA 1NNI1 1SKMA 3GLRA 3LKVA 2RK3A 4AJ1A 2YV2A 4Z7JA 2Y1WA 1T1RA 4JVMA 1XZQA 3TVTA 4N7RA 3GJ3A 5B3AA 1YK1A 1A2KC 2DH5A 3CRVA 4U6QA 5H4HA 5B4TA 5K0BA 1PHRA 2A5DA 3DXXA 4LHXA 4EYKA 2VFAA 4COOA 1VJCA 3BE5A 3B1YA 3FPGA 3UMSA 1WHTA 1XJQA 2QZPA 1NRWA 5C52B 1S7CA 2ILVA 1VRWA 3MT7A 5A7GA 3WQBA 5IJ9A 2WDZA 4AIRA 1UK7A 4FFSA 2DBZA 2IHUA 2JBAB 2J9YB 5B3KA 1XQ1A 2Y05A 4TM7A 5ICCA 2R8EA 4LNUB 3B5JA 4MW5A 3H19A 1C0KA 4EECA 3VKHA 3JQ8B 1PKEA 3AINA 2QLLA 3DZ8A 3EIOA 4FILA 4O4IF 5B7NA 1W5EA 3RIXA 2ZT6A 1R5OA 3T7RA 4AZTA 1LWNA 1SWWA 2D5IA 2OTCA 2YY7A 4I1OA 2ZB2A 1W36D 5FD8A 3BCSA 1QVRA 2IQ5A 2KBEA 3LXRA 5B7QA 4PO1A 3H0EA 2ZYAA 3VOBA 3TLBA 2RHHA 3IVRA 4LVUA 3RS3A 3T99A 1Y1SA 1PT9A 1G7RA 3EZYA 2IEAA 1B15A 3IV9A 3HKBB 1VYHA 5KPJA 5TMPA 3LW8A 4X8OA 2FPLA 2IOYA 2R96A 1WTAA 2W6OA 1JGTA 2HPZA 1YI1A 3BMQA 4FB5A 5KWEA 3A3YA 2CUTA 4UATA 2ASEA 4H08A 4G2NA 3VR3A 1HK7A 2Z5VA 3TIFA 1FMTA 3ZD7A 4XM1A 4NSNA 4F45A 1CCWA 1KBOA 2NYRA 5D87A 5EIWA 5AVWA 5KMGA 3DMDA 3S1AB 1ZUIA 3ETLA 3KXDA 1JHOA 5CIYA 3FF4A 1P5JA 4M0KA 3VC7A 1KC1A 2CL5A 1Y1PA 5EIOA 5CLFA 2GEBA 4WKOA 2E4VA 2PUJA 3ZLBA 4Q1VA 3QVGA 3STWA 2WQZA 3ZTWA 3GFSA 1LUAA 4HXYA 3IE0A 1W0KD 4X20A 2V1XA 1DXHA 3H2KA 4RTRA 4C22A 2ONYA 1J0AA 1N2IA 2R6JA 2QLFA 2XT6A 5FADA 1FNDA 3UUEA 2JIQA 1XZ8A 4U2GA 4B75A 3GFPA 3GLHE 2PU5A 4FKZA 4ZDJA 1VL5A 1FFEA 3NH9A 4HLNA 1Q7CA 5IMBA 3AJAA 1U94A 3ZJVA 2CLDX 2QUBA 4WXRA 1UZLA 4F04A 1JHXA 3GG2A 4WA7A 3SI7A 4US1R 5A6SB 4ZOAA 4BECA 1PX0A 7MHTA 1RD4A 1U0JA 4Y2QA 2QTFA 3TLJA 3R0ZA 3KR0A 3W7AA 2YFHA 3AOEC 3H83A 5K0EA 1PG5A 2VTEA 4PR0A 3Q9LA 3ELYA 1KRWA 4F8YA 3IIKA 1QGDA 4QJ3A 1UJCA 2HXYA 5CEFA 1KO7A 3MF4A 4MJ7A 4WJZA 2FN4A 1CQJB 4ZHQF 1P1KA 4KN5A 4W1RA 2DT8A 4CUKA 4AZ0B 3GLKA 1A77A 3Q72A 4NAUA 1U0TA 5CLQA 5CUQA 3X2EA 2W43A 2XRZA 2ODBA 1YXMA 2YN0A 1CUIA 1LI7A 3UK7A 4QOFA 4TLBA 2XGOA 4OD0A 4BQSA 4F2WA 1F0NA 4RABA 1G3IA 5AP9A 3IP7A 3AIKA 3WJ7A 2HDHA 1KSJA 4RLFA 5JYEA 4ZRDA 2A9OA 2PXHA 3E03A 2PRZA 2ZS9A 1E6WA 1UBMS 3JQEA 1S01A 3ELDA 4GYKA 1QX4A 4NE2A 2X58A 1NLUA 5ALPA 2WF5A 4WBNB 5K3FB 4PLVA 5JWHA 3B9BA 3A14A 4CKEB 3JALB 4FFBA 1K8QA 2MSCB 4Q4HB 3RKUA 3TINA 4HDSB 4EWLA 3FTCA 5J40A 2H1SA 1MJHA 3BIXA 4RAOA 1OLUA 4HB2A 3EDYA 3G8AA 4KBGA 4ID3A 4ND5A 4ZEXA 1H2XA 4FNOA 4DJ5X 1M72A 1AX9A 5DTEA 1KDYA 1IXKA 4F6LA 2E4XA 1IY2A 5BWCA 1U0GA 2BE9A 1SQFA 1CUWA 2WVHA 4HAIA 1T4CA 2FRDC 5KCZA 1K9VF 1D6NA 3N75A 2JJ2A 1PZNA 1S8NA 1TUIA 5E7MA 5EKDA 1KZHA 4KXXA 1VZ2A 2HLDA 3WTCA 4DA4A 4LZLA 4MB2A 1PD1A 3DZHA 2NU9A 2C5SA 1SCKA 1Q1AA 2XTAA 5T41A 4G67A 3LWBA 4NBWA 2X5XA 4H1TA 4S12A 5F98A 1JI3A 3K53A 1VXOA 1XHFA 2F64A 5EJGA 4X3CA 5CLLA 4OSEA 1TLTA 2JK0A 3B1XA 3OECA 3PQFA 2PH3A 3ITKA 4L4YA 5EP3A 2C2ZA 3K5IA 4MV4A 3L7JA 3ERCA 2RONA 4QYIB 2OPBA 3PRKE 1HFJA 4GOMD 2CJPA 2FHSA 2AXEA 5CHEA 1JTEA 1UKYA 1RQRA 2FN9A 3INGA 4B5KA 1KHTA 1ZN7A 2QR3A 2WJZB 4DLRA 4ZHQA 2ODNA 1JALA 3FOAA 5H7XA 4D4GA 1WCXA 3VR3D 4OHWA 3QX3A 5H59A 4KXQA 5DBGA 4I9FA 4NHOA 3NKFA 4KRYA 5JV5A 3EISA 1RZUA 5E7IA 1N8TA 5FUVA 1NXOA 1BXGB 4FD2A 3AP3A 4Q1FA 3I6YA 4XB2A 1BHSA 3VDRA 4UBIA 1U0NA 1Y89A 3AW8A 4QT4A 3HA7A 4U2EA 1JEQA 1U31A 2PAFA 4WL0A 3G2NA 2IW1A 4MVWA 3UUGA 1N3BA 1GYPA 1YDGA 2J87A 2VF4X 1CJUC 1U28A 3KLPX 2V5VA 4K03A 4M60A 1SKYB 2VH2A 1WZ2A 1CQPA 1GGEA 1UMCB 2XMZA 3PHJA 2BGJA 4X71A 4ZO6A 4ARAA 2R6ZA 1O9HA 4BBJA 2RGXA 1H6AA 1RWVA 3TM5A 3DFZA 2YRFA 1IU9A 4RDHA 1C1DA 1XEWX 3L5OA 3T52A 5EZYB 4J7CA 2X5KO 2CSUA 3U49A 2FCAA 1FL9A 2I99A 2VH1A 3HJAA 4X90A 3KQHA 5BN3B 1RRVA 1QGZA 2XH8A 1PFKA 2RMKA 3ND8A 4Q1EA 2QVXX 3FZGA 3NBQA 4GX1A 3JVUA 4ZVPA 4YP7A 3FOBA 5BSTA 1A4IA 2G70A 4OKNA 2JASA 1FFGA 1L6IA 1KY4A 3GELA 3G0IA 3AEXA 3O4JA 2O1XA 4ZAWA 4RYLA 1DE0A 1RZ3A 4L15A 1RM4A 4UCQA 3TG8A 1HZZA 4LV5B 3MT9A 2BP7A 2IU6A 3PNYA 2HA3A 1N2OA 4M9RA 3O92A 3QW4B 4LBYA 5LXTA 2FEAA 3VSBA 2JD0A 2Q2WA 3CCFA 2XODA 3CJRA 7YASA 1PU2A 2OUIA 3A6ZA 3ZE8A 3VNBA 4UEOA 1D0VA 3HKEA 2OCDA 2XNJA 3LECA 4IQ4A 1QNFA 2R4QA 4H6WA 5ECYA 1Q19A 3IRVA 4YP0A 3GRKA 2HCRA 3G9UA 4JLBA 4JJ4A 2W11A 3ABZA 2NM0A 4AAYA 1BXKA 3FSGD 3U56A 1GPMA 4JCOA 5CB6A 4DRYA 1TQ8A 1KK0A 4R1SA 3BCRA 1L8XA 1L5SA 1PJ2A 1ZGGA 1JG6A 1JYFA 1LLCA 3CKKA 3UQZA 4GGPA 3F3SA 3OF3A 3PGVA 4WZBE 1L4UA 1G2PA 3W8DA 3U9TA 4EG3A 5COAA 4LKRA 3FE2A 2MR6A 4MVJP 4QU8A 2IPNA 3RYCA 4C9BA 2ZRQA 2W6MA 3BDVA 4Q6WA 3QVLA 5JR3A 1JA1A 4PSAA 5AOBA 2O19A 1ZH0A 2A7XA 1K0UA 3A3PA 1R5JA 2FMXA 1L5HB 1N9GB 1EP3B 1SXJB 2IZ7A 4UDOA 3W77A 1IPEA 2BGNA 1CDZA 4QQ8A 4C0WA 1ZK4A 3T9FA 1W75A 2GCGA 3ZDXB 4QDZA 1FU7A 5CHYA 1CY2A 4RK1A 4OL0A 2ZYIA 2ERCA 3DPUA 2QRVB 3QUBA 4IIYA 3ONDA 2YFYA 3IJEB 3LTNC 1ZVMA 3EQZA 2QN6A 4XYLA 3DEYX 4BMXA 3ZGLA 4M99A 1TZJA 1QQAA 3IPAA 4EG8A 5DM0A 3EVZA 5KU7A 3AUUA 2JKVA 2F9MA 4R81A 4EL0A 5K3FA 3ZQKA 1KSGA 3D4BA 4DEVA 1C3JA 1SPXA 2CLCX 2L19A 1AHHA 1M66A 2VH5R 1HZJA 4H7IA 5JAUA 2IYPA 4EUKA 3GLGA 3S8EA 3G49A 4CM6A 5CA1B 2VHTA 4MUYA 4ZGGA 4JI6B 2MSWA 3KBOA 3OBBA 1QB8A 3ADDA 2AS0A 4L9AA 4U9HS 2XRFA 4JJEA 4EGSA 3UV3A 2HUPA 2OO7A 3EIEA 2ADFA 5AW9A 3ANLA 1QORA 4MCJA 5ARBA 1OB2A 5DHTA 4EDHA 2L18A 4QUHA 3NOXA 2UZ3A 1NASA 2OBYA 2PO7A 1SQGA 2G5PA 3C5WP 5EAIA 5JZVA 1E1CB 1PEAA 3TTSA 3J81A 3K1AA 1G16A 2PH5A 3DLIA 4LZWA 2CDCA 3PX2A 3KQYA 4PFQA 3DYIA 4ZQEA 4F2GA 1J1ZA 3S28A 3R3HA 5DT9A 3P5BA 5DWDA 1SJ9A 4NNJA 3KKEA 3NBYC 3WK6A 3H84A 2ZI5A 1ZD8A 1DBWA 4L4RA 4RD1A 4RV5A 4FM9A 2PJRA 4KQ2A 2UVPA 1JXAA 2ZR9A 4MKZA 1AZLA 3IOMA 5E1MA 3HV0A 1CUBA 1J2EA 5L4LA 2J7PD 1IIRA 2WM9B 4D5EA 3H7IA 2D0DA 1NBEA 4IEFB 4G97A 1NNSA 3GL9A 3AETB 3I01M 3FNGA 5HDBB 1UC9A 3RC1A 4CQMB 1ENZA 4YUWA 3CB4A 1COWA 3R7WA 4D45A 3PP8A 4FUQA 3TRJA 1KP2A 4UC0A 1E2QA 2EJWA 1XQWA 2DAPA 2V9PA 3EZXA 3ZX5A 3ZGXA 4IHQA 5A4FS 2X86A 1NOKA 2HJ9A 3MGCA 1O89A 4NMMA 2HLNA 4CG2A 1SUEA 3DF7A 1XNGA 2AI2A 3KVRA 3MK31 3BRCA 4M9ZA 4AO8A 2VP5A 3I9FA 1NRIA 1UFKA 2JJMA 3P45A 4GPEA 4P3YA 1I2MA 1E3IA 3OWHA 3X1ZA 2A0KA 3P4UA 1E79D 3D81A 3P94A 2ZOSA 3HDJA 1M73E 3PT5A 5D3QA 3OQPA 3ESXA 5CT6A 5F73A 3W3AD 1U4OA 3ICVA 1L7PA 5JNLA 1KYVA 1XU9A 4PTYA 2WWHA 3MZ0A 3WWDA 3BILA 3VUFA 4XB6B 4A8HA 3QEMB 5G0TA 2YWDA 4RQBA 4RPIA 4FZ5A 1YI0A 1TJ4A 4NZYA 2Y4NA 3KDAA 4FMBB 5EJ9A 3M1AA 2M6KA 4FI3C 2FF7A 4N6NA 5PNTA 4DJFC 2VQEB 1H1DA 1GV1A 1RJGA 3C6KA 2ZKIA 2B8EA 1Z5VA 2CFOA 3TTTA 2PS1A 4GPD1 2JGFA 3QU4A 1YNSA 4E6PA 1C7RA 5GMOA 3VO9A 3L8ZA 1JHMA 1Z5ZA 1QWOA 3ANNA 3LOPA 5EWLA 5J2TA 1N9ZA 4BVGA 1Y7PA 4CMIB 1YB6A 2SKEA 2PCJA 3A1SA 1IEWA 2YN2A 3B6ZA 4REMA 3VVBA 1CR4A 5ER6A 4RTMA 2NG1A 4R7TA 4WW0A 1QV9A 1BH2A 3IELA 4CEIA 3ZIAA 4A10A 2E4WA 5JXIA 1YZHA 1UT6A 4AMBA 1MGOA 1ZOIA 3EIFA 4KIWA 4Q3NA 2WFMA 4CN9A 1L8LA 1LS6A 1SC4A 2ZPTX 4IQ0A 4NX2A 3LS2A 2XADA 4L8YA 1KZ6A 2HIMA 4W9NA 4JIGA 5CGZA 2ODQA 3L92A 5BYJA 3JAKB 5BR8B 1Z4OA 3LWZA 3REOA 1MJFA 1MH9A 1YL7A 1AUPA 2O1SA 2QTRA 3DTVB 3OZUA 4CV2A 5H8WA 3EH1A 3L8GA 4MVJI 2G28A 4Z51A 5ALWA 3PB3A 2JIMA 1GZHB 1EX9A 2OZLA 4AG6A 2FVXA 2E21A 1PR6A 3TQQA 3RYFB 5HNKA 2IS2A 1E2HA 2P4UA 3DYBA 2Q5OA 2WT4A 2XNCA 3RRMA 4FK8A 1FDUA 1DC8A 3QVUA 4AK9A 1LPOA 2BJHA 4AY5A 3TSZA 1Z5OA 4BE7B 4AJNA 2CNNA 2HJSA 3ESBA 3PIRA 1G0OA 5ALMA 5H68A 1XEAA 3SF8A 3CWZA 5IH7A 1RXVA 4P3KA 2PRKA 4YJGB 4F2PA 2CN1A 4ZCPA 1M2VA 2C8VA 1FDTA 3D5TA 2XI4A 3D8HA 5FOUA 4OJYA 1GT6A 1HX7A 4JYAB 2AXQA 3K1YA 4Q4JB 1FMLA 2MTBA 3M4JA 2KW5A 5E4TA 5A2QA 3LVBA 3K0CA 1NGSA 3HXKA 1AS2A 4B3XA 1QIKA 2ZJOA 3TTUA 1PNTA 4F5WA 1TZKA 3EXHC 4IDAA 1YBHA 3W06A 3GCZA 1S0UA 4Z7NB 4BTLA 3U5TA 2Q4BA 1LNZA 2RG7A 1P1HA 3ZVKA 4UXHA 2HHHB 3BRWA 2O5RA 3EZ2A 4IGIA 3FPEA 3I9NA 4JLUA 3ZHOA 4QRDA 5FWAA 2FFQA 2GAJA 3RFUA 2JHPA 4HBGA 2P9ZA 2QRMA 3LQ4A 2C4MA 3AVQA 3E7WA 3I73A 1SELA 3SQOA 3BDAA 3O8CA 1DO8A 1JWLA 2DPLA 1EK1A 3UK2A 3S0JA 2R1ZA 1UANA 1P9RA 1XGKA 2ZS7A 3MTEA 4RLQA 4YAIA 1U0BB 5JSFA 4CTMA 4W4TA 2A0FA 1FVFA 4HNUA 5A4MS 4DLWA 5DNDA 1Q92A 1M74A 4TLCA 2RIPA 5JJKA 4LFAB 3QA9A 2WTBA 1XMSA 4UBJA 3G79A 3MTIA 4RZIA 3S4YA 3BGWA 1VBMA 4EF6A 4UVEA 5HA5A 3WSTA 5KB3A 3B5EA 1ZM3A 3G0DA 3OESA 3MJVA 3RBZA 3OZ7A 2NXCA 1CPYA 2XAAA 4PLWA 1WABA 2VIIA 3TUJC 4E4TA 2C83A 2XUHA 4JP5A 5EJFA 2RGEA 4YQEA 1QSGA 3HUTA 3RADC 3DE1X 3BYZA 2AEEA 2DXIA 4N5DA 3QPDA 4QXPA 1L4FA 3TMKA 2DH6A 4WJLA 1TVMA 3A37A 3BGIA 2R8RA 3F90A 3G2PA 4EUFA 3NORA 4HQLA 2CWWA 4LJ6A 4UFNA 5DHRA 3ZDAA 3GD5A 4NYJR 5E7JA 2OCPA 2FSGA 4RL4A 4RJKA 3OFKA 4GU5A 16PKA 2BGTA 3NIGB 4D79A 2PUEA 3HEMA 1Z7GA 4Q34A 5JSKA 1GRQA 3NC0C 4MWEA 3SDSA 1ISHA 3QIAA 4AF6A 1SFRA 1XKXA 2P3LA 3GH1A 4PYKA 1JPJA 1ADYA 4Y2UA 4B4UA 3IAFA 1HWYA 5LQKA 1XZDA 1YA4A 4RTJA 3K5PA 3C1TA 5HFJA 2GWRA 5HP4A 1VL2A 4KJZA 2VAXA 5B1SA 2QWXA 3LLSA 2QA5A 2C99A 3G5AA 1X1QA 5H82A 3DE0X 2V9ZA 2W7TA 3PLRA 2VYQA 4MRVA 4NCIA 2QD3A 4W6ZA 3U16A 1JHRA 1VBKA 5LQJA 1DP4A 2NVWA 3T3NA 2DTXA 2QGZA 1O6ZA 1EDEA 1Y3AA 3LVRE 5ES3A 4DDVA 3D1VA 2MU1A 4BLQA 3PF9A 2ODPA 2R11A 5FCDA 4OH7A 3BHIA 5F33A 1JMVA 5HS4A 4B8ZA 1M0WA 5J2UB 3CEPB 1VHWA 4PSVA 4TMVA 4S1WA 5ECWA 3GR6A 2GK7A 3NTOA 3T12A 2CJFA 3ZK9A 1TCUA 3F4KA 3AZOA 5DTRA 5DYWA 3FVQA 1UPXA 2OEPA 1QQBA 3UA3A 4DG8A 3WQSB 1R0BA 2YVQA 1DG3A 3DBLA 1B6RA 3LT4A 3CT6A 3I9V1 1V95A 3INTA 2ZTMA 1FUKA 1WMFA 2P0YA 2VAVA 3OM0A 3A6GA 2O3SA 3ZDBA 3WLQA 4IHAA 2RI1A 1ESEA 4U2BA 2PZBA 3PQ6A 1THZA 4TV9B 3TK1A 3H5OA 5FO0A 4D9FA 1SIWA 1E3TA 1OC2A 5EE5B 2JLBA 4U2KA 1WXIA 3AFGA 2Q41A 2W9XA 3WLNA 1HEUA 1DG1G 3HKEB 4R2JA 4LWPA 2QY6A 2PZGA 1N2JA 3HJFA 2SBTA 2GBIA 1O7JA 3IQIX 3QBTA 3TR5A 1YC5A 2QTCA 2VVTA 3NWJA 2DTDA 3TQIA 1GU1A 4C7OA 3TW8A 5AW2A 1KI9A 2GA9A 4N8DA 2JJ1A 1V0JA 3KWFA 4TS3A 3PC8A 4RVDA 3SQNA 3VPFA 4EFMA 2PGOA 3K32A 3QX7A 3DC7A 2O2GA 2RARA 3R3WA 3AERA 3GEDA 2CHUA 2DFVA 3W05A 1LPAB 3EVCA 2Z98A 1SKYE 2Y27A 2P6UA 3ES9A 1N5RA 1M7HA 3ORQA 3B5IA 1I0IA 4AYWA 2SICE 2VRWA 4MQBA 3ZZTA 1WPQA 4REQB 2NLOA 3AF1A 3G0CA 1U7DA 5IJZA 2BZSA 3ZK8A 4LRQA 3CUSA 1DPGA 5J1SB 2ENWA 5E4YA 1RLOA 2NOAA 5LYYA 5BV7A 5KTOA 1ZRSA 3U17A 4PX3A 1RJFA 1MIOB 3EGDB 4PAGA 3G2LA 3GJYA 3GF4A 3T3PB 4BLUA 5KTNA 3OQNA 2JCSA 3PNVA 4FEGA 4BFZA 1ABEA 4YMWA 4AYTA 3GW8A 4Y1FA 3QVTA 4LDZA 2YJTD 4Q3AA 4XCQA 1M76A 1QE5A 1T5IA 2ZRPA 3OLCX 3QFTA 3Q8WA 2YRXA 3TL3A 5KWIA 1UJ4A 2K7ZA 1KR5A 1WXEA 3QHPA 4Z4IA 2QT9A 4EI2A 4ZN6A 2EU8A 3OUTA 3CZ4A 3MPUA 4JT9A 4O3FA 4PYOA 4F21A 1M8KA 4F8EA 4TRRA 5DW0A 1GM5A 2Q49A 2WD7A 1SHTX 3BXEA 2Q3DA 5CXSA 4BZXA 4CLEA 2BMAA 2BM0A 2H4WA 4JI7B 5BNTA 5DXAA 2POQX 2WWGA 1QTQA 3KE8A 2VDOB 1N34B 1RCTE 4NZOA 4C7JA 1XVVA 3R0QA 4BZWA 3E9ZA 2F8LA 2PX6A 5FWXB 1E96A 3L4SO 4J75A 3F98A 4AZSA 4QU0A 1G5PA 1T10A 3GJTA 1UDCA 2ZB8A 3GDHA 2CXPA 1OTXA 4LC9A 4X7RA 1W5FA 1FP6A 1SD1A 3LCJA 2ZS8A 4JYPA 2QSJA 2VKQA 2ZE6A 1M5RA 4JOBA 1EGVB 1Z8DA 3KKNA 2IW3A 1G4AE 3IO5A 2CLEB 3EFOA 1FNBA 3DO5A 2OBBA 4N0MA 4N40A 3OTOB 3LHSA 2XXJA 3ETDA 4BFSA 3UGJA 1EFTA 1G20E 2EJUA 3W6ZA 1YFJA 3PGKA 3GA7A 3S68A 1O9GA 4PXSA 3MMNA 3T5GA 2PX0A 2R79A 4H7PA 3HLKA 1EWVA 4OSPA 1P4AA 4P81A 3MVEA 1JV2B 1H2YA 3CW8X 4WCFC 4UULA 3ESCA 3VNRA 2O2CA 2GJKA 2Z04A 2D5BA 4PNEA 4L74A 4ENSA 3O93A 1C8BA 5K7SA 3OHMA 2OCKA 2A59A 1WHTB 4D82A 1FYDA 2XTMA 2FPMA 5L4SA 1DKNA 1YRWA 2N9UA 3OM9A 3PNPA 4MDYA 5LLSA 4JKYA 1AU9A 3QA3E 4M87A 2OAQ1 3FHTA 4X3PA 2H63A 1X1EA 1FUEA 2AR7A 2JIRA 2VDLB 1QXSA 1V3UA 2AJLI 1V25A 1UF9A 1YJAA 3I04A 3IDSA 4YK7A 5JMTA 1R4ZA 1PEKE 1R9GA 1QPBA 3LFTA 4CT5A 3WO0A 3FAZA 1E3LA 4OKIA 3BZBA 3EZLA 1LDBA 3PUHA 1J09A 4GMHA 3P2EA 4MAFA 4J0HA 2C3PA 3SZ3A 3VU1A 3R3VA 4A7PA 4I4TF 4HL6A 1ZFNA 1SEVA 4R7ZA 5DM70 1PLKA 2FEPA 4Z4CA 2IE0A 4MHOA 1XJ5A 2BC9A 4BL5A 1A5ZA 2R8XA 1GXSA 4X64B 2R4UA 2O14A 4UUAA 5E2AA 4XH9B 2G76A 2R1TA 2B35A 3FPAA 1DCFA 1SBIA 4ZK2A 4A26A 5CNMA 1TIPA 2EL9A 2G08A 2YVAA 5AKYA 3AEKA 3PD0A 2O4CA 4QFCA 2V6MA 2AI1A 4RO0A 2D13A 3MUOA 2HMUA 2TYSB 1E6LA 1MO3A 4MINA 2ZBFA 4UOZA 2JFPA 5LDDC 1SULA 1Y3CE 3U3DA 3FOEC 2CKDA 4LYFA 5C3MA 1U8FO 4UARA 1ACMA 4G81A 2W4MA 4IVRA 1MT0A 3RSGA 3U4QA 3R8FA 2RHJA 1DU4A 3BXOA 3LQRA 2BEWB 2ATCA 2EP7A 2IX9A 4PLPA 4O2BF 3FUVA 5CK4A 3FKSD 2LKDA 2CVQA 1TW2A 5AIBA 4WK4B 3HCAA 1KWKA 4JJFA 1BE8A 2HZ7A 4CETA 2VS1A 3OLQA 4HNRA 3V2HA 5I47A 4XWWA 1VI2A 4FGUA 1M6HA 4FYHA 2AOWA 1UFRA 1W581 2EHJA 1MC4A 3TVYA 3FTQA 3EIQA 3HJCA 2GWHA 3NO4A 5L95A 4Z6KA 1CG6A 4GQBA 5DLDA 1F8GA 5JNVA 1HT2E 2FPIA 5GJBA 2JLZA 1VCIA 2P6NA 4E2XA 3BA1A 3ICWA 2TSYB 1KO5A 4BQQA 2QMUA 1CRZA 3KM0A 5CIQA 5DGIA 3GVPA 5A3VA 4LHVA 2H3HA 4EA9A 1B6SA 1CHDA 2XMPA 3CX3A 5ICMA 2HWXA 3JSXA 4TL8A 1KWGA 1XZLA 1B0ZA 2B5VA 3LPNA 3WGMA 3HP7A 3FKQA 1NN5A 3U9SA 2OO3A 3I5YA 4RHEA 3H5NA 3FY4A 3E3AA 3IUBA 2EV9A 3UTCA 3AJEA 5HF9A 3NC4A 5KTTA 1H65A 2R25B 3DEZA 5T5QA 3NDJA 2RI6A 4OH1A 4UXJA 4CFYA 1B43A 1Z0AA 2VT3A 3EFBA 4LMAA 4C03A 2OOKA 1G19A 5AOAA 4UEJA 3MPOA 4EAQA 2XY4A 3PFFA 4MR9B 1A2OA 1N5LA 3HYTA 1Q11A 4HLCA 2ZBGA 1ZK2A 3UWOA 1O5IA 4EHHA 1GN8A 9LDTA 4WERA 3NCHA 5EY5B 3R6LA 1AHPA 2OP1A 4FFDA 3W6NA 2BLNA 4IDDA 2GCOB 1C81A 2FW0A 4MPPA 5DP1A 4LC0A 4CIDA 4YYZA 1XZBA 2D62A 1FPMA 1X19A 4PN7A 3TEFA 3ZZ0A 3C41J 1JYSA 4XD2A 1AO3A 3KXPA 2J9FB 2KPOA 3NETA 1SWVA 3PFGA 4CL0A 2OD9A 2NAPA 5CEJA 2J59A 2C5FA 1VHJA 2BE7A 4KO1S 4RA6A 1QF7A 3DOCA 4Y0VA 1QS0B 2DHDA 2ZUVA 3W8NA 4XE5A 4JY7A 4XM0A 4BKUA 1J24A 5DIZA 3EGVA 3D4NA 3AETA 4ZRMA 3NBAA 3I9KA 4H7FA 3L0YA 3OQBA 2PL5A 4YC7A 2EIXA 2K4MA 5CCBA 4JV5B 4YV7A 1ZK1A 2ZK7A 5FWYA 3UCEA 2FY8A 3DT9A 3P9PA 4RAQA 4TTSA 3D3JA 3K4HA 4X84A 5D3MB 3M6VA 4YAGA 4CF6A 4Z0TA 2HDNB 5IYZF 1LV8A 2C9CA 1RI2A 3N7TA 2ABWA 3OMXA 4FD3A 4G89A 4MJXA 2P77A 2IRWA 3I2KA 1JAHA 2XE8A 3RSLA 4C4RA 3WK7A 3R6TA 3DZDA 3DMPA 3N6XA 4URHA 1MNAA 3RAEC 4LYHA 2WP8J 1VG9B 4JSTA 2ODWA 4URWR 3N87A 1KDPA 2G7MC 2WIJA 3FG9A 2VAPA 4LTNA 1QJ4A 3F7OA 3EZ7A 4MB0A 4B79A 1GSIA 1EFHA 1YULA 3F9CA 5ICEA 5JXGA 2XKKA 3L46A 4PG5A 1ZJ6A 3L0IB 1EKXA 2OQRA 2P9FA 1U6JA 3O73A 4Q3OA 5L7YA 1LDGA 1P0QA 1GKKA 2Q4RA 4QTZA 4FGLA 2C31A 3L06A 5JE8A 2GAOA 3IC5A 4OAQA 3TB4A 5SY6A 4AUNA 2EDCA 2VHQA 3KFVA 3RSCA 1CNEA 2EJCA 5CPBA 1AURA 1KAQA 2A3RA 1RYYA 3V48A 4E3WA 4UNQA 4LZPA 5T8KC 5B5SA 2DBYA 4Q7JB 3W5UA 1PS9A 3GGPA 5SZIA 1U3GA 4X63A 4BV2A 5K6TA 2CW5A 1GPDG 1RYHA 1UFVA 3M89A 5DNVA 4YHHB 1RAHA 4XQEA 5CDUA 1RLJA 4ZRNA 2YJNA 4DIBA 4Q9DA 3TPFA 4EVSA 4N6GA 2VBGA 4B6PA 4C0JA 4E15A 1E9EA 2IZOA 3IB3A 3WKDA 4KNYA 1AQNA 5M7EA 5CTAA 1F3OA 2GJ8A 4CQNA 5LZ7A 2RCNA 3IBGA 4M7RA 3WWCA 1GWNA 4X62B 1JU4A 2X2PA 5ILGA 5I4IA 1TU0A 4BU0A 1O2DA 3TKAA 1J0BA 1KFKB 1YJQA 1ENOA 1SC6A 4CKZA 2AG1A 2BM1A 1O97D 3RGGA 4FW8A 3DOEA 4A6XA 2QW0X 1JLLB 1I1OA 3MYRA 4WASA 1XEWY 5E6SB 2CXXA 1CBUA 5LP6C 5T8KA 3TB6A 2VYCA 3AUAA 3IHWA 3U1TA 4BIMA 5BV0A 3IBSA 4IQGA 3PE3A 2AOVA 2OBNA 2W37A 3GRYA 4O08A 1Y5MA 2W2KB 4D8UA 2FUG1 1VE1A 4F84A 5C37A 2IDMA 3H5TA 2YTZA 5IBPA 1WW2A 2O5CA 2B7LA 3TI9A 4HGNA 2W8BA 4P3OA 4A82A 1EFAA 2WR8A 1A96A 4HRVA 5J47A 4BZQA 2G8NA 4MR7B 2ZUWA 5C1OA 4NCNA 5EC8A 2R5NA 3LUPA 2XWPA 1JQKA 4FP9A 5BRNA 3JZFA 3TX2A 5AXBA 4CG0A 1LBEA 2NU6B 2I6XA 2EX0A 1V5WA 2R86A 4M1QA 1G8HA 2JHFA 1JDTA 3OC6A 4ITVA 5F3RA 2C94A 3KB8A 1M5TA 1RAEA 3PHHA 4TOIA 5I7AA 3FD8A 1R4MB 3KSAC 4PWYA 1NVEA 1HLDA 3AM5A 3O21A 4TXNA 1DMSA 2Z5GA 4F56A 3A4YA 2OM6A 3WKEA 3I0ZA 3EQ8A 4GO1A 2EG5A 1QZUA 3ZE6A 1DKQA 3L3BA 3JD1A 2BEJA 3R0XA 4Q82A 1MFZA 2VG8A 3WO1A 4DEYA 4ETMA 1AE1A 4CIWA 5IKXA 2AG8A 4UQOA 3WVNA 2VWPA 4BZZA 4IFTA 2GNAA 1HNXB 4GKJB 3RS8A 1U0RA 5IN4A 4X7BA 1S89A 1CJBA 2DFLA 3H8WA 4LXXA 1F9AA 3ACDA 2CV0A 3C5CA 5LU9A 4QDKA 1IXYA 4RFSA 5D3KA 2QIOA 4EEKA 3KIPA 2RG1A 1Q77A 1XIVA 3CUVA 4LX8A 2FUEA 5LBIA 1Y9JA 3TIXB 1KI6B 2WAMA 4YRNA 2H51A 4RPLA 2CJWA 4FYYA 4DDMA 1RWKA 2FGKA 4IDEA 4JVSB 4R3NA 4ON9A 4TS1A 5LOVA 3FROA 1S1CA 4RD4A 2I2WA 3H9GA 1MDBA 2UUOA 1VYTA 3OEHD 4K81B 3GUZA 1KI7A 3LT1A 3GEIA 4TXJA 4CODB 5JAIA 2AF4C 1XMPA 3BSSA 3NPMA 3OKCA 1G8YA 4M1OA 4X85A 4AN0A 4Z2AA 2WIBA 2A9VA 3R1IA 1ZIOA 1PRYA 5HCNA 4AROA 4CTKA 4MR9A 4YIKA 4FJ2A 4KLCA 2JH8A 1I0ZA 1Q20A 1P4GA 1UC5B 2ZJAA 3X2FA 3VC1A 4CM5A 4E5PA 4HVLA 4G1FA 1EFPA 3C7TA 1G3QA 4Y6RA 1WCIA 3SC4A 4OP3A 4PRLA 4C4AA 4RJTA 4CTNA 3F2VA 2A30A 4ZOLA 4RHYA 4J90A 1DKMA 1U2RA 1RAAA 2DCMA 4V2UA 4WH0A 2OB2A 5BW8A 4INZA 4NVRA 4NPAA 1TAQA 2QS9A 4JN6B 1NULA 1PJ3A 3BHMA 4RA6B 2CWDA 3VV3A 5IVPA 2V0GA 3HVUA 1PJ8A 2H2WA 1KKLA 2C0QA 2X22A 4YGYA 3DUFA 1KJJA 1DELA 1PWYE 1N6PA 1PVDA 2MHCA 3OF5A 3C98A 1QGED 4L4ZA 3PEWA 3QSYA 3G2HA 4C4ZA 3LA8A 2Y1OA 2GEDA 1TX4B 3QWHA 4WN9A 1HOTA 1HRDA 2O7NA 3R7DA 1DAGA 1Y8CA 1L1QA 3VOSA 4AO6A 4CDRA 4PM4A 1TO6A 3DQQA 5C51B 3CVVA 2GEVA 1H5UA 4IO1A 1RZRD 2DSNA 1WQ4A 2CNBA 2VNJA 1GNRA 5HCIA 3G9TA 4QICA 4Q9HA 3HKCA 2IYWA 2XXBA 4GGMX 5LQCA 1DQPA 3BK2A 3FUWA 4K9SA 3SBDA 3CRZA 3C4QA 4NU0A 3IOBA 1KPGA 3QPUA 4W99A 3OLXA 4DA8A 2DQSA 2OCLA 2O0MA 4TRMA 3P4YA 2DY1A 4JXJA 1WSAA 3AUFA 1E1CA 3VHXB 4DABA 2F1IA 2FPUA 1H4TA 3DNFA 3EEFA 1P62B 3SHTA 1PR4A 1VBNA 1DCMA 3QXCA 1W1UA 3A2KA 2CMDA 4U5QA 4WQMA 1J70A 3ZPXA 3KQPA 3W4IA 2C4WA 1Y1RA 4YUAA 5MGBA 4K9DA 5DK6A 1GV0A 4LOHA 3COJA 1XZCA 5JNTA 1U0SY 4YCCA 4Z7OB 3FUTA 3P2JA 2QEQA 1BA3A 2Q3LA 1LH0A 2V4UA 3DV0A 4HH1A 3PF8A 1WF3A 2OV6A 1X0VA 5I4BA 1N5KA 3BL6A 4JEMA 1NYLA 1CVRA 4NENA 1GKIA 1QOPB 1XCGB 2FZKA 3FFAA 2TMKA 4O2BB 4YGXB 2HQRA 1PFUA 3L8DA 1DKOA 2FCRA 3ZIAD 3AW9A 3LT0A 1E2NA 1PZMA 2WLTA 1TD1A 4LE1A 2XMQA 3AY0A 1YASA 3FPBA 2DZDA 1YJCA 1ZU5A 1KFJB 4MRMA 4RD0A 2VAWA 3LBNA 4QLAA 4B3MB 2ROQA 3WHKA 2CD9A 2Q0QA 1GHTA 5HGJA 3DEKA 4LIPD 3TNLA 1PO7A 4W6QA 5LC1A 3CZRA 4P4SA 2VNKA 4IZOA 5BSHA 4GXNA 1EQAA 4CGZA 1P2GA 1F8XA 4Y2VA 1C9NA 2ZYVX 2GD6A 4EYEA 4V0NA 1FRNA 3OTWA 1PP4A 3LZDA 4QEDA 4N4AA 3BJRA 4JLSA 2VEOA 4MCAA 1IBKB 3DTNA 2FZ5A 3KTAB 4KDEA 3JYOA 4LFCB 3LYUA 1TQDA 1M1UA 5ITWA 1G20B 1DEOA 4OMFG 3G9QA 5GOTA 3H5LA 1UC8A 2QSZA 3KJGA 5LA6B 5GP1A 4UHDA 1DV1A 4ASUA 2WDPA 3QLTA 1R4AA 2IHKA 3AF5A 3DMTC 4TSKA 4KKXB 3AUTA 1EWYA 2Q7XA 5DLQC 1NMZA 1AQIA 2F62A 4FXOA 2FZGA 3G2KA 1XPOA 3CX6A 4K1XA 4EVIA 1W6UA 5IT9A 4WOJA 3KZMA 1EGHA 4BYMA 2GEKA 4W9RA 2PYDA 2YWCA 4N01A 1UK9A 1Y8QA 3DNMA 4IZIA 1IMJA 1G21B 1TCAA 1NR1A 2B5WA 3AL2A 3FWNA 3R23A 1L9KA 2QJTA 4XVHA 4CMJA 1NG9A 5E1OA 5TARA 1OASA 4HY3A 4P32A 3LYLA 1M2HA 2D7CA 2C2YA 5GADl 3K0BA 1IULA 1JKJB 1TM2A 3MWDB 3PUXA 1Z34A 4M0DA 4OYRA 3WWPA 4B47A 3TXAA 5C5EA 1Z4LA 2N1BA 3H9EO 1T1SA 3HRIA 3SM9A 3N2KB 5ARCA 3G17A 3UFXB 1EH5A 1BX0A 4H7KA 1DBSA 1H3EA 3KZNA 1DQZA 1Z7YA 4R5MA 4MAAA 4J3NA 4CMCA 1QYVA 3SJUA 3CKYA 2B25A 4E1VA 5EJ5A 1TKRA 3WAKA 1UOOA 1NQVA 2VCYA 2R1UA 5DZSA 1HM5A 3TLXA 4MWZA 2UVQA 1M8FA 2X3FA 1Q50A 2HRZA 1F2UB 1T5OA 4H7EA 3H99A 1E9VA 2I78A 2Y1GA 3O2QB 1A1VA 1R4NA 2BCGY 3NI2A 1LJUA 4PLYA 4YUVA 4K1LA 4NZNA 3WWEA 2P3SA 1KJZA 5A9TA 3C8UA 3DE3X 2VRNA 5IULC 2JDIA 1ZJ5A 3CF2A 3O1LA 3VYRB 4ZZ0A 3NP9A 4JAVC 4BEVA 2VF5X 1NW6A 4BGUA 2QD1A 2QHXA 5K0TA 4WLEA 4K5QA 4OL9A 5DX0A 3QHQA 1K5PA 1VMEA 5FOXA 5I7FA 4B3GA 3RSZA 2NVOA 2PSFA 3ZU5A 2V7WA 4PPGA 1UZAA 1YAHA 2ZR8A 4L9SA 4C43A 3DHYA 4CL3A 4CMHA 3QFRA 1MAAA 3LP6A 4MMXB 3TDMA 4AMUA 4B6SA 3GLUA 4HBZA 3ZGVA 2IPMA 1V9SA 5C5IA 2RIRA 2B7BA 4ZO4A 5A71A 1NP7A 2SKDA 3ZOKA 5AJHA 3WHIA 1VHLA 2IOFA 1GZ4A 3LX8A 2PV7A 4NPCA 4O4LB 3HJUA 4RC9A 3RAPR 2I1QA 4L2IA 3DEIA 4XEUA 4AYXA 1UODA 1YCDA 5ECGC 5AQ1A 4G6ZA 3ONNA 4EPVA 2ZUUA 3MCVA 4BVKA 2F1OA 2XUIA 1NBOA 2CF5A 2D4AA 2PA0A 3IDQA 2VO1A 4HDNB 3IIJA 1JIQA 2FSHA 5EWJA 4KMOA 5AVVA 3ZJ5A 5DT2A 5C1IA 2CJXA 5L3ZA 1PS8A 2XQKA 4NMHA 3WP1B 1E3SA 1O6CA 1B16A 3VR4A 4RSGA 2AWOA 2PQ0A 5JZBA 3FYDA 1QGYA 4YLGA 5DFAA 4C7KA 1R6XA 1GGVA 3BIOA 3DLBA 4N3AA 3JALA 1SA0A 2CMHA 2MINB 3UJPA 4N0QA 4WZAB 3QW2A 3SM3A 2ZXFA 4IJKA 1XTJA 4Z49A 4YMLA 1SU8A 4E03A 3M82A 4KFRA 3ZW8A 1XN4A 1X1TA 1BW9A 3I52A 1U8UA 3KR2A 4EO7A 4GMDA 3THYB 2IUUA 2G9UA 2ISSD 5FTWA 4JT4A 5HEKA 2COKA 3PK0A 3C3XA 3PPYA 2IEDA 3NMUF 3IAXA 2W6JA 3ETGA 4C3OB 2QY9A 1A7AA 2NTEA 2PMBA 3BJEA 2I91A 1K5GA 1LPNA 1WXQA 3N28A 4OLAA 3MTQA 3HV2A 4LHEA 2YMPA 1JP7A 3EEYA 3R5XA 2QD4A 1QIHA 4DE5A 1TRHA 3OPQA 5I7VA 5THKA 5ALSA 3BGVA 2E3JA 3N86A 1ESMA 4DMUB 1MOQA 1QV6A 1XEFA 3N3BC 3Q3CA 4OBBA 4IMRA 1ENYA 5TQJA 1WZEA 2G72A 1VGQA 3HYNA 4C0XA 1L4NA 4MRNA 1M6VB 3PXEA 1W4RA 2YW2A 2BEVB 5H16A 5D3ZA 2J5QA 1GTMA 3FLEA 1HURA 4KO2S 4KRXA 1NJGA 1VSTA 1XE3A 1ZM2A 2PEZA 4M8SA 5AM5A 4E1BA 3ZTTA 5TS2A 1FXSA 4LCEA 4DM7A 2B92A 1Z63A 4LRUA 1QMGA 2OV3A 3THWA 4OXQA 1BEEA 4H31A 2GAIA 2IBTA 4NV1A 4FOTA 2HLPA 2G1PA 2L17A 3RAJA 4Q1CA 1T9ZA 2XKJE 4Q7KA 4U6NA 4EATA 3UJ8A 4NQRA 1X8KA 2PFGA 4QLOA 5HBRA 3W34A 1RIIA 2ZXUA 2O8DA 5DYNA 1V6AA 5KSPA 3F49S 3MUFA 1K3UB 2VJOA 2LPMA 3H1PA 4MI3A 4I1YA 2Y93A 4G5QA 3FWZA 4MZDA 4I4NA 3P32A 2Q6LA 1OIWA 3CZQA 3FAKA 2ARKA 2HR1A 3GNTA 4CT0A 3U7QA 3ON5A 2C2MA 2XYRA 1A2QA 1AT1A 5A4AA 1Z4QA 1C5KA 4Y6LA 2ZYRA 3BIWA 3LBHA 3P26A 3PCRB 3LQ1A 4DA6A 4N3NA 4OGWA 3MEQA 4BB9A 5CITA 2PIDA 4P80A 1P75A 2HSGA 2JZOA 3RAGA 5HM8A 4A5SA 1E5DA 3OC0A 1P2FA 1Y4DE 2RGWA 3P9QA 3MCWA 4YMVA 1I24A 5D01A 2AF3C 5I8PA 3FFWA 3GNSA 4JELA 2C0CA 4EYOA 1PR3A 4TYNA 1SU7A 4B3IA 3ICOA 1IHPA 2PX8A 1K6MA 3IOEA 1EUDB 1JLKA 4ENRA 1G38A 2R60A 3VM6A 3D3WA 1DIGA 2V4MA 4U7GA 2OXCA 4S1OA 4JZYA 3NHKA 4U8GA 1JLHA 2AOUB 3HB4X 3X1XA 5H1YA 3OT1B 1N25A 2YXPX 5ILOA 1GGHA 1Q0RA 2Y99A 3HY3A 3MM4A 4ND1A 3AMVA 1XV5A 3OU6A 4RH3A 1WKBA 2QJRA 2WJHA 2X8JB 1O58A 1FZTA 4ZD6A 4HCJA 3A1TA 2TECE 3EFEA 3SJ7A 3Q6NA 2GUGA 4BFCA 3EVFA 3NOOA 3E23A 3OCZA 5DNUA 2MDTA 1D04A 2PZMA 3F74A 3NAGA 1L5QA 4DQDA 2ZTHA 5AJVB 4IS2A 1U2GC 2J31A 3L7BA 1N7IA 2R6HA 3UMMA 1AZTA 3D2LA 4XUGB 3DE2X 4QODA 1JDPA 4TKLA 5REQA 1R6UA 3HGMA 2O8EB 2PD4A 2CB0A 3AR4A 4RK5A 5EHQA 2HKIA 5COQA 1XC7A 5A3SA 4AP6A 1FX1A 1CEXA 1QC5B 3H1GA 3OFSA 4B4DA 3PRHA 3QITA 2AD1A 4I55F 3A4IA 4C6SA 2UU9B 1SUAA 3GZ4A 3WJAA 1OE0A 2PLNA 3QQPA 4QJBA 2J41A 3SIRA 2I80A 2O0LA 3GJ0A 1VFPA 2Z1NA 2H9AA 3D0RA 3RYFA 3ZKWB 2XCUA 2R7MA 2O1WA 3BMOB 4OSOA 4X94A 4CM9A 2LR0A 4KTTE 3KZOA 1L5GB 3M4YA 2YICA 3AF6A 3H5IA 3UNXA 1EBFA 3Q0TA 3QNUA 3MJ4A 3FR8A 4RH1A 1KS2A 1OT5A 4KN6A 5F7ZA 3RS7A 3AI7A 4I8IA 5LQUA 4R2WA 1U6IA 4Q9NA 4TZKA 4A0FA 2R2AA 2WWXA 3H2BA 1CHNA 2CC2A 3NATA 1MAUA 4RVNA 4XUEA 3PQDA 2XB9A 1NQXA 3CBGA 5EZYF 2IV3A 1G8KA 1FXUA 1SZCA 5EZ6B 1WXDA 5BQ5A 2HDWA 4TRNA 5TVKA 3TCNA 3UXMA 2YIDA 3DMYA 3N8NA 3NHYA 2WIAA 2ZUCA 3T4PA 2YCBA 3WK9A 2AMFA 1WR8A 2CFRA 1PWXA 3HBJA 3ZDYB 1ID1A 4HZGA 1X87A 1ZMBA 2Z83A 5EMNA 5C32A 1ZJYA 1HLGA 2VJKA 4KAFA 1RYMA 5JBNA 1O96B 4G23A 3G8CA 3HNRA 1V35A 4XDZA 3ED5A 3OFVA 1DTEA 1ONPA 2YMLA 2WJGA 3EXG1 3FMPB 3OFJA 4XB1A 5AJUA 4ZREA 3V5NA 1W85B 2VDUE 3KKLA 1M75A 3OJXA 4GBMA 4XZ3A 3RLFA 3VYTB 3JQAD 1PGNA 4I08A 2J7KA 2FG6C 2GFQA 2QENA 4J0JA 4RXTA 5JTTA 3OIGA 2B20A 4OMCA 2C7GA 1M1ZA 3KSZO 2E6UX 4YASA 4FIZA 1UH5A 3CSSA 3L0DA 2P9QA 3CLVA 3ORFA 2B4KA 2VUSA 2ZM6B 4M9UA 3LOQA 3BRWD 2CL6X 2VLBA 2WPNA 3CPEA 3VPHA 1SKAA 4I9NA 4MS3A 1WOYA 5EJEA 1ELOA 2B1JA 2C2GA 2OL4A 4BP3A 5CR9A 5K0GA 3G5UA 3NHMA 3HR7A 2I9PA 3BQNB 3MJEA 4JEHA 2BBSA 4ROTA 5FTNA 1OIXA 4S2UA 4YFVA 1TZ2A 3QHAA 4EGQA 3V2UA 1XQ9A 5KSOA 3LG2A 3ZEIA 1YV9A 1JR2A 3LQ2A 4DJDC 2UUBB 4IEIA 1Z4KA 1MRZA 3JARB 1HDRA 2GA8A 1QG4A 3SNKA 4IRMA 1CZHA 1NNUA 2WB2A 4OK6A 4NC9A 4DDUA 1NUPA 1ZN2A 3T7DA 3LBYA 4BNTA 3E9MA 4M53A 4ZV4A 4PZLA 1EJ6A 721PA 3B1FA 4MP6A 1V16A 4E22A 4TWZA 3RKRA 1TF2A 3H97A 2W0MA 4MOWA 1V8ZA 2NZ2A 2F1HA 4ZOBA 3EX7C 2YWEA 3R4VA 2QLBA 3DSRA 1CJSA 1ZWLA 4Q9KA 5DMHA 1D1SA 5JMWA 4GEGA 4R2HA 4PV7A 1F2TB 2I33A 3QEKA 5CT9A 3J80A 1OFVA 1PK8A 3A10A 1DLJA 3DW1X 5FOTA 3UWPA 3V6LA 1KTIA 1MVOA 4FS8A 5F3WB 3DZJA 3ASVA 1OOEA 3C7AA 2QLJA 1LX6A 1JR6A 3KT0A 1EP2B 2CXHA 3I45A 1G21E 4Y7DA 2QBYA 4E21A 4CUJA 2PIAA 1V8FA 2GVNA 3T1YB 4I5FA 1XZMA 4WUTA 3ZY6A 1I4EB 3HZRA 3WV4A 3A8TA 1E2BA 4RVFA 4ZHSA 3AVXA 3HMQA 1BE6A 4JGIA 5CDHA 5LWQA 2P8JA 3LK6A 2FN3A 3UMBA 1EK5A 1LDYA 3EQ9A 4FT4A 5IC5A 1E3WB 4C0SA 1A8IA 4QPPA 3HXTA 5AUQA 3T3HA 4KQKA 5KYTA 3HM9A 1UMBB 4YDHB 1DIBA 4PNHA 1FJ2A 4J7UA 5ALTA 4ND2A 5LCXA 5LM3A 9GPBA 3A6KA 2PSSA 3V8MA 2QM8A 3ZGYA 1RRGA 2IPLA 5DRTA 1LC3A 1QFZA 5C2JB 4N82A 2AE1A 2WHQA 4URZR 4Q4AB 1WXHA 4YLEA 5AK3A 6NULA 2XT9A 1ATZA 4B2LA 1KRHA 5LZ8A 3KLBA 4MUKA 3GX1A 4M88A 4KQ1A 5DLEA 1DKPA 1LSOA 1T1JA 4Z4EA 1CT9A 4INPA 2JGMA 2OM2A 3S2ZA 1SKBA 3EXAA 5K0LA 4LDQA 4MUXA 3VDXA 5L7TA 2DE0X 3BULA 1TTTA 1WHSA 4TQGA 5TSDA 4CMBA 3SZUA 2G6BA 1QK4A 3K09A 1I7NA 1ST3A 4OK5A 3TCXB 3BN3A 3NRCA 5JWOA 5H3HA 1R8YA 2XE4A 1H0HA 4DDHA 3IUQA 4IZHA 1B3BA 2AHRA 4U9IS 4H9GA 1KAHA 2A9KA 3KJIA 4Q4DA 1P7YA 1R6DA 5BP7A 5KOHB 1HTTA 5EESA 2BFCB 2RC6A 1QS0A 2W2QA 1D6MA 2IYLD 2PUWA 4HLUC 4X1YA 3N2EA 4XQGA 2EFCB 5BPHA 4DM4A 1MDFA 1PX2A 4IL5A 4TM8A 5H3LA 5J4YA 4KIUA 4X7PA 1V4VA 1D5WA 5BSUA 3VZRA 2J46A 1QE0A 1OI4A 1JLMA 3NM4A 1WDKA 4P4LA 4O25A 3K1AB 3DOIA 2E4YA 1CQIA 3OQJA 2V3CC 1GPBA 2HWUA 2RAUA 3H1AA 3NGMA 5L40A 3E53A 5K2MA 4H3SA 4Q18A 5KTKA 2HN9A 3IP6A 2WIKA 3TRHA 3TNJA 3B38A 3LF2A 3QUAA 2BHLA 1R6AA 2JGLA 3K2BA 3WQHA 1KYYA 1J5XA 3BIJA 1A5TA 3LPMA 1KPIA 4E30A 2G9VA 2IEZA 2VQ3A 2W58A 4PIPA 3UAOA 2J0VA 3DBRB 2VUTA 3SYKA 2C92A 3CRW1 1IEXA 3CIOA 5LBUA 2GJSA 2Q5QA 1WUTA 2VPZA 1RQ2A 2V7EA 3KQTA 2FPGB 1ADFA 2DKNA 1BIFA 1UJMA 2GN8A 3COZA 4BZPA 3U6KA 3H16A 1IY1A 3E82A 2QTZA 1FMFA 1ODKA 3CPJB 2A9PA 3I5AA 4L5BA 3I9LA 4FMCB 4LBVA 4WK0B 2ID8A 2II6A 4CF3A 3ENZA 2HQOA 2PD3A 3IR5A 4RGBA 2LCFA 1PNRA 4B7CA 4FWIB 1H2AS 1XMOB 4O59O 4AG5A 3S70A 3FOZA 1V7PC 1HT3A 3EXG2 3GLTA 4P93A 5DP2A 5LDHA 4PPYA 1Z18A 3KJXA 1VRVA 3AFOA 1VKZA 4X1YB 3UMJA 4MI9A 3NJRA 4IIGA 1I6MA 5DEOA 4CKBB 5JATA 2I22A 1IHYA 1KTVA 1BS1A 4XWYA 4LXUA 5B1DA 4KYIB 2XHZA 4C0HA 3OJLA 5BY2A 5LKRA 5IDVA 4MARA 2VJNA 3NWBA 4F3RA 4PC6A 1HE4A 4X0EA 2ZUDA 5ALFA 2F3UA 4QSHA 1TQHA 1X39A 2ZJ8A 4GICA 1HG1A 3BXXA 1FLVA 3R9XA 5KX5F 1HH4A 2F1KA 3KT3A 3P9SA 4XIJA 4ZT6A 1YMUA 3IJRA 4NFSA 3PEFA 3KKQA 2ADOA 1C3OA 2X9LA 3UT0A 4EW3A 1LGYA 2WYOA 2UZ0A 4CW7A 1FQJA 2KSQA 2XZDA 4PZ0A 2YXLA 3MXTA 3GLHA 4A6EA 3C3MA 4OX9B 4HQKA 1DO0A 5ALIA 2DG2A 4BMPB 3RV4A 2F4VB 3EG9A 2HV9A 3DHVA 5HKKD 4N39A 1E1KA 1UZMA 2AEMA 1YKSA 2VBCA 3BTVA 3D6JA 3EBPA 4M1KA 5EXTA 4M54A 1UIMA 3DD1A 4LE0A 1IEVA 5H70A 5HKLA 5CDGA 4KWHA 2XQJA 1G8MA 1QYDA 2QVZX 4PO8A 2P9CA 3AR8A 3F6BX 1T9BA 3EIUA 4CDMA 3S29A 1KOLA 1NSYA 2HHJA 3MSXA 3RASA 2VK4A 5IVIA 5IF9A 3AEYA 2P27A 4V39A 1U4SA 3QVVA 1Y42X 5GM2A 4CKBA 1JEAA 1I8TA 1FJGB 4B9AA 3I6IA 4V2IA 1K2WA 5K0SA 4XX0A 1RJ9A 4V0QA 2YVKA 2NO1A 2JAHA 1LLQA 2IEIA 3GPBA 3P7MA 2EERA 5KHLB 2IZ6A 4G9GA 1ZP6A 3FDZA 4QU5A 2BCEA 2ZB3A 1A95A 4LXQA 2PUBA 3HYRA 4FKBA 2D2IA 1JIKA 2HO4A 3FCEA 4GI3A 4Z1MD 3L7OA 3N2IA 1HO3A 4AMYA 1QFSA 3GVXA 1IE3A 2Z6VA 3BFPA 3LY8A 4LPKA 2X41A 3SR3A 2X5JO 1ZJJA 1GN9A 2FG7C 3BGSA 4XWAA 2APJA 2D2XA 4W8OA 3DVRX 5EZSA 4RETA 3U3OA 2IYEA 3WLAA 4DUPA 2E18A 4BIIA 5CLJA 2D2FA 1CUCA 1XA3A 3GXBA 4LFBB 2XYVA 2ZEJA 3Q41A 5M29A 1N75A 2V54A 3B89A 4OHRA 3EFOB 5A4DA 3OT4A 4MGKR 1ZJ4A 2V45A 1NU8A 1BSVA 3DOUA 2IYUA 2GYUA 3FZNA 1LFAA 2IDJA 4PLHA 3ZWPA 3EGOA 3RRZA 1PZEA 4Y2JA 2HL6A 5DTQA 4D4JA 2VR1A 1GGFA 2I65A 1DWQA 3KLMX 2DKFA 1DIRA 4B4VA 4DMLA 4XDYA 5IDQA 3EAGA 4PXAA 1AXGA 1HQCA 5E8RA 4GPZA 1LBHA 2PJUA 1UMDA 3ACCA 5CTJA 5IC6A 5JNRA 4QBFA 4DZZA 2QZJA 2YNMD 5FBQB 1G59A 2P2ZA 3VA7A 4QARA 3ZWQA 2QRJA 3OM1A 4U2CA 2A67A 3H86A 1KSHA 2QZ9A 3LPDA 3PUKA 4FEEA 2HWKA 3OIFA 3PQ4A 3VU8A 4PZCA 4RVSA 1NVMB 2NSHA 2Q0XA 3DZGA 2HT6A 4BEWA 1E0JA 3ZTYA 2EF1A 4X45A 5DN9A 2KB0A 2X4LA 3FBWA 3RBAA 1EVYA 2VZ9A 4NOJA 2EGHA 3PXDA 4O8ZA 1M6WA 3DF9A 1ZESA 1RM5A 3A4NA 3HVJA 3OEWA 3QFCA 2BTQA 2CGEA 2KS6A 5JXWA 4KXLA 1US8A 4EPTA 2ZWAA 4QOEA 1QH9A 1CKEA 5EINA 2Z57A 5BT8A 1TCCA 3UMYA 3HVIA 4BN4A 1J8YF 1R0YA 1TK2A 3T6KA 3MERA 4EG5A 1V3QE 5B58C 2PKWA 4MVYA 4CCWA 1YS1X 5HS6A 4ZT7A 3RFTA 2W2MA 4C4OA 1Z6AA 4KQEA 4RULA 2PFKA 4D3XA 1OYOA 1Y37A 4MUGA 3ZV4A 3C7DB 4HFJA 1JKIA 4G5XA 4EY5A 1K6EA 2QXYA 2EP5A 3ZLUA 1MB9A 4FIDA 2FDXA 4PPNA 1WMBA 2UYCA 1OZGA 1ISPA 3WL3A 3K6KA 3ICPA 2ZJYA 3GIDA 3IIIA 4D43A 1OLUB 1L3IA 1NBWB 3PXBA 4HJXA 4O4JA 4P5EA 5GV8A 4GC9A 2V5UA 5BWBA 1V11B 1ZCJA 1I7LA 1WCV1 2ZUTA 1S7GA 1GTG1 1Z17A 4J9VA 5JQGB 1T5LA 1AXRA 1JF8A 1V1RB 4K26A 5DO9A 1POXA 3HSKA 3LHDA 5C31A 3ROKA 1SCDA 4E3ZA 5BR7A 4IJVA 4AO7A 3GFQA 1GPLA 2QQFA 2JFFA 2XUAA 4L95C 3BEOA 2J08A 1DUSA 4IQ8A 2B4YA 4NG5A 4OK3A 3ZX4A 5I4KA 2XF8A 1DUVG 1KBZA 1T9KA 3IAS6 5KAPA 2WG0A 2YIMA 2X77A 4JKIA 5DGDA 3I9OA 2QPAA 3URMA 1E2IA 1SVOA 4RNCA 3TKLA 2OSBA 4RX1A 4E2YA 1E8DA 3I09A 4IUBS 1CUVA 4ZVOA 1GNLA 1KE1A 2BEKA 4OBEA 4D9HA 3GO4A 4LNHA 1E9FA 4L76A 2J3LA 4RTPA 1QG2A 3R6DA 4GP7A 3F9RA 3H2SA 3EULA 4GOOD 4KLAA 4RZ2A 4Z4GA 2NTNA 2IYRA 3MWYW 2FTKE 2VPPA 3KD2A 3WZMA 3QLUC 3VSAA 3E9DA 3NWEA 3OIYA 4FR0A 3TF5A 1BCSA 2Z6QA 2YHIA 4E32A 4EEZA 1U3FA 2XRMA 1H23A 5GOZA 3ZUGA 4BFXA 4BCDA 3JWGA 3ZCUA 5DNYB 4IKEA 3R0VA 2O2HA 2X8JA 4W8GA 5CA1F 4ETNA 1QQ5A 1LF5A 1D2CA 1GU7A 1ISIA 3GFTA 1Z6XA 4MVJE 4OQQA 4C7VA 1JDUA 2DHRA 3DFKA 3HEAA 2EZUA 1RVDA 3GUYA 1I1NA 3NYRA 5DBFA 1CE8B 3FBGA 2YW9A 4CIAA 2OPHA 2NW6A 3B9RA 1XJCA 3HU2A 2CEAA 1MD9A 2AX3A 4FZRA 1FU4A 3B12A 3ER6A 2HCJB 3UJ9A 2PTGA 1M2EA 5EEHA 1C4XA 4LY3A 4UE3S 3NNNA 1RYBA 1VA4A 3CUWA 3K35A 3SXPA 2FW8A 1ZD5A 1U65A 1EFCA 1GUDA 3LXMA 2J0EA 4RANA 4ZQFA 5TF4A 1AXEA 2AT1A 4AJ2A 2C5BA 3I53A 3B6IA 1CR1A 4FE7A 1SC9A 4RZQA 2BRUA 1QFXA 3N2NA 3I1JA 1IJFA 5G40A 5A9SB 4YMSA 4AMZA 2EF0A 3MIIA 1UAGA 4YJ3B 5KBYA 1UMKA 2I2BA 3NUGA 4FYXA 1IBRA 3GYBA 3P0FA 3KV3O 4ES6A 4EHLA 2PGIA 3B7PA 1KEKA 5K6RA 4JEIA 1RWMA 3QUCA 2CDAA 1P45A 4IDBA 4JQCA 1E59A 1ZCBA 1B76A 4TTIA 1V8BA 4QGHA 1WWKA 2GKOA 1E5TA 1ONNA 2QNRA 3FCXA 4DNXA 1UXGA 2QKYA 4XWOA 2ZT7A 2ONJA 5EN4A 4EF4A 3GRZA 1JEDA 4AUKA 4PZYA 1SNYA 3L4KA 5J43A 4MYUA 4W1PA 3EARA 1X9GA 4KV7A 4BLWA 3OCUA 4ALNA 1M2WA 1FFSA 4NCHA 3YASA 3L7NA 3MJDA 3K70B 2P0AA 1EGQA 1DKLA 2BRUC 2X23A 3BE8A 3PNOA 1N8SA 2PXAA 3FA2A 3LT2A 4W5HA 4Y18A 1DIHA 3PXCX 1H66A 1YE3A 2YOGA 3HLYA 1ZGHA 4OQEA 3L6DA 4QDTA 2EFHB 4RPGA 3CR7A 1ECFA 5DSTA 1H2ZA 3D6MA 2IXDA 4K9MA 2F43B 3FJYA 4LUCA 4B5LA 2A4MA 1ADCA 4NR0A 3EZFA 1GG9A 2WE7A 1G8AA 1I9CA 5L4NA 1ZAYA 1OAOA 1XF9A 2BI7A 1XZGA 2DYKA 3DL2A 4IX1A 4BX0A 1WLYA 2A0WA 4K86A 1ZQ1A 1MV8A 2QAGA 1Q0PA 5DCUA 4B44A 5IT5A 5U9CA 1R0RE 1G18A 1OHHD 2WT9A 3OPVA 3SX0A 3NONA 1EE2A 2EWWA 5KREA 5JADA 4PBRA 1P8JA 1X1CA 1QZZA 2XWBF 1FSZA 3JD2A 2AQIA 5G41A 1AS3A 4ABTA 1MO6A 3JVIA 3LNTA 1WKCA 3VO2A 2LP4Y 4DY4A 1XPUA 4GL2A 3QTLA 5MHTA 1RXSA 1E1RD 4QQKA 1MC1A 2ZPAA 3JQ9A 3ZJYA 5CVVA 2C82A 3GBSA 3BWMA 1PYOA 1G41A 1X1AA 4GR5A 2YMQA 4YRGA 4J0GA 5AMXA 4A0GA 1QYWA 4YRLA 2V7BA 1EJ0A 3PENA 1HUQA 1OAOC 3PTZA 4UHBA 4AXXA 5IU6A 2XEXA 3Q7IA 1Q0SA 3CYFA 4MLZA 2QAGC 4BNDB 4BNXA 2GD2A 2GF0A 2OZKA 3SX2A 2M1XA 4MICA 4N76A 1CNMA 1QONA 1OR8A 1YR1A 4PZZA 3X1KA 2YJ5A 4FDLA 1OBVA 3HA5A 3N0RA 1TGYA 2VPQA 1ZH6A 3G88A 2NYAA 5FI1B 4MZXA 1TM1E 5FV4A 5LR6A 1UBEA 3V4ZA 1WP9A 1XQVA 2VYVA 4KE9A 2C4HA 3DL4A 5D6NA 3WZ2A 1M2KA 1CRQA 1TT5A 2I2FA 1U7PA 3CUYA 4GXRA 1N4AA 4ZO8A 3WQQA 4H18A 3LDHA 5ERGB 2XRYA 4Z2YA 3AKDA 4FFPA 5KPDA 2ZB4A 1XTUA 2F59A 3E22A 2WJYA 2G25A 1H85A 3R0JA 4ERNA 4WZZA 1LC0A 1RRKA 1XBTA 5JHGB 1OXMA 3OE4A 1H2BA 4KBFA 2FV8A 3OZFA 1SG9A 1YT5A 1N6OA 2Z5FA 4FXPA 3B8HA 10MHA 3N7AA 5ELLA 2P30A 2VRBA 4H4DA 3NRBA 4GUAA 4JL5A 4CZ2A 1XYGA 1KY2A 2FXIA 2H85A 3G7SA 1DC6A 3QUSA 1T13A 1VA5A 2OE2A 1R7RA 2VI5A 2VPXA 3KYJB 5KZMB 2ZZMA 2ORWA 1ZLYA 4N7MA 1E7QA 2HJWA 1GZ7A 2AJBA 2RAPA 2WV7A 3A3NA 1XLUA 3H42B 3OIVA 4A36A 3UKJA 1QZTA 1EWKA 2W2XA