1GAWA

Crystal structure analysis of the ferredoxin-nadp+ reductase from maize leaf
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
304
structure length
304
Chain Sequence
PATAKAKKESKKQEEGVVTNLYKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGKIPYREGQSIGVIADGVDKNGKPHKVRLYSIASSAIGDFGDSKTVSLCVKRLIYTNDAGEIVKGVCSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEKHDDYKFNGLGWLFLGVPTSSSLLYKEEFGKMKERAPENFRVDYAVSREQTNAAGERMYIQTRMAEYKEELWELLKKDNTYVYMCGLKGMEKGIDDIMVSLAEKDGIDWFDYKKQLKRGDQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP+ REDUCTASE
publication title Structure of the electron transfer complex between ferredoxin and ferredoxin-NADP(+) reductase.
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase/electron transport
total genus 95
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2000-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1gawA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1gawA02
2BGIA 4BPRA 1DDIA 1OGIA 2BM0A 1VQ8B 3ZC3A 1ZM2A 5AN9A 4ACAA 3CPWB 2XNJA 3LYUA 4TMTA 1B2RA 1KK2A 1Q82D 2AHOA 4ZV4A 1Q7YD 2B5OA 1NDHA 4J0QA 2QA4B 2HDNB 1FNCA 4M0LA 3ZZTA 1J9ZA 1VQ9B 4ZCMA 1N0VC 2QMUA 1A8PA 4RJLA 1ZUNB 1QH0A 2RC6A 2X3UA 1KD1D 3W2IA 2DERA 1YIJB 2C78A 4Q7JB 2YWHA 4ZCLA 2OTJB 2CRVA 5EMNA 3VO1A 1KK3A 1BX0A 1R5BA 2XNCA 3VO2A 1IJEA 3WYAA 1E62A 4M2LA 1JJ2B 2QN6A 1G7SA 1EFTA 3P27A 3W5HA 4PGOA 1BJKA 4B3XA 2J7KA 4TMXA 1XB2A 5TY0A 4ZGQB 1D1NA 2PMDA 3OW2B 3A1FA 1NJID 3JQPA 4QFMA 3CCLB 4MYTA 2BF4A 3ZBTA 1H85A 1TLLA 1FNMA 1AMOA 3CC7B 4EH1A 1VQPB 1QUEA 1KC8D 3AVXA 4YHBA 4RD2A 2PIAA 4PC6A 3FPKA 3B78A 4RCZA 2B7BA 2DY1A 5JBQA 5GV8A 3OJXA 2YWGA 3CCMB 3AVUA 5TV2A 1D2EA 1YJ9B 3CCRB 1F20A 1XE1A 4B47A 1N8RD 3VNVA 3ZBUA 2HMAA 4Y9UA 2BPOA 1ELOA 4N3NA 4UAJA 1ZM4A 1QVGB 3U6KA 1VQ5B 4RD6A 3CCQB 1IB0A 2RC5A 2OK8A 1DG1G 1EP1B 4P3YA 4ZGNB 3CC4B 3I1FA 3P26A 2VYQA 1OB2A 2FX3A 4NBSA 3CD6B 1JB9A 2BV3A 4U9UA 1F60A 1YJNB 3AGPA 4AF6A 1EFCA 1I7PA 1KTVA 2E1RA 1GJRA 4P6VF 2OTLB 1FDRA 1ZM9A 2C77A 4M53A 4B4DA 1W87A 3W5VA 3FJOA 1VQMB 1KK0A 4Y9RA 1QX4A 4PC3A 1EP2B 1OGJA 2BMWA 4ZCIA 1TTTA 1VQNB 2BN4A 1QUFA 1G7TA 3CW2A 1VQLB 1CNFA 3AGQA 1N0UA 4F7DA 4WQMA 4HE5A 1Q86D 3WNCA 1QG0A 3LVBA 3MCAA 4YAFA 1GR1A 1Q81D 4PC2A 3G4SB 4RD1A 1R5OA 2QTLA 4TN1A 3W2GA 1JA0A 4AC9A 4LBYA 3CXCB 2QEXB 2OK7A 1EP3B 1K73D 1U2RA 4HE6A 1TUIA 4YAUA 1FRNA 3WNDA 1VQ7B 3JQRA 3CCUB 4LBZA 1DARA 2BVNA 1EWYA 4C43A 3WXMA 1QFZA 1S0UA 1AIPA 1GO2A 3WNBA 5H59A 1M1KD 5FA6A 4TMVA 4N3GA 4LBWA 4FN5A 1QFYA 4M4SA 2VNKA 1HA3A 3WBKA 1OB5A 1QGAA 2YWFA 4FK8A 1YI2B 2VZLA 5TR9A 4AF7A 1JNYA 2DETA 3CRZA 3WBJA 2D74A 4B48A 1GAQA 1EFUA 4ACBA 3CMAB 1G7RA 3QFCA 1SM4A 1E63A 1FRQA 3VNUA 5DSZA 3LO8A 1M90D 3G6EB 2VNHA 1FNDA 4G5GA 4FWTA 3WY9A 3U2QA 3W2FA 1W35A 3OJWA 4R71A 3AVTA 4K1XA 1UMKA 3CCVB 4TMZA 1YJWB 1KK1A 3QFRA 5GV7A 3E1YE 1SKQA 4M1KA 1W2BB 1EXMA 3LRXA 4G1VA 3JQQA 1BQEA 2EFGA 3PENA 4PC7A 1CQXA 1FNBA 3QE2A 4YAWA 1BX1A 3W2HA 4LBVA 4B44A 1W34A 2VNIA 3E20A 2YWEA 4IW3B 1QGYA 2PLFA 3ZZ0A 4RD0A 3I56B 1YHQB 1DDGA 2VNJA 1GVHA 4H9GA 3W2EA 1TVCA 3QSYA 1VQ6B 4RCYA 4PC1A 2QDXA 1G7CA 2CNDA 5H5JA 1B23P 1K8AD 3V76A 4YAOA 3MHPA 3CCEB 1K9MD 4RD3A 3B82A 4Y7CA 2BSAA 3ZZUA 1KJZA 3OZWA 3OZUA 3W5UA 3OZVA 2DEUA 4G1BA 3AVYA 3U6BA 1VQOB 1WDTA 4C0SA 3QFTA 1ZM3A 4RD4A 4YALA 2EIXA 3B8HA 1H42A 3MMPA 4LC0A 1QFJA 2R6HA 1QGZA 2DCUA 3QFSA 3VMFA 2XEXA 4DQLA 3CC2B 2BM1A 4DQKA 3CMEB 4NCNA 1CNEA 1S72B 2B7CA 3AVVA 1E64A 1VQ4B 5KSWB 3CCJB 1YITB 2GPJA 1JA1A 4QHYA 3G71B 3AVWA 1KQSB 3CB4A 1KRHA 1QVFB 3CCSB 2GQFA 3J81k 3SJZA 4TMWA 2ZITA 4B43A 2BGJA 1GAWA 3ES9A 5HXBA 1VQKB 1D8TA 3I55B 1IJFA 5THXA 2HCJB 2NPFA 1R5NA 4MYUA 2QTZA
chains in the Genus database with same CATH superfamily
1N75A 1VJGA 3G3EA 4I8DA 1I1NA 3CLRC 3PFCA 1ZH4A 4HPJB 3VC3A 4EHBA 4Z2YA 3H13A 5AH0A 5E3JA 4DDMA 4JI0B 3G6WA 2R0QC 2B1JA 2GMWA 2P30A 4OL0A 1VHWA 1IZ8A 4NCHA 3CVXA 4HFMA 3NEYA 5JYDA 4U9HS 4II2A 4JB0A 5GY7A 3EH2A 3OA2A 4CKEB 4E5KA 3HK2A 1TZBA 4DMLA 3P5SA 1M34E 3H83A 1QK3A 5G1NA 5CH3A 1BZYA 1K89A 4UBOA 2E37A 1Z2PX 3CUSA 3DKVA 4ZV4A 2H9YA 2Z2JA 3BXXA 3V4ZA 2J5BA 3NJ8A 1KZ6A 1YH3A 2OC9A 2X58A 2X6XA 5J2UA 5I5GA 2B30A 1IN6A 1CUYA 1J0AA 4FQ8A 1CUVA 1G291 2QLFA 3JQAB 3QE3A 5KJEA 3VJKA 4BO9A 1CUUA 2GJ9A 5K0FA 3KHSA 1GL3A 1YQ9A 1VQ9B 2ALJA 2QYOA 2R6JA 4QQFA 1V2GA 5DM1A 1JEYB 4NYMR 2JIMA 1QGUA 4HDOB 4UC0A 2FUG6 4GHWA 4GOLD 1NXQA 1I8DA 2Y1OA 1HDRA 4MIYA 3UMRA 4ZK2A 4XJSA 1VA4A 1K3FA 3NVAA 3QBJA 1UIRA 2X77A 4EPTA 5BUSA 4OXXA 3FPGA 1UWCA 1N3BA 4AUMA 4V1CB 3Q88A 2VTVA 5IT5A 4EB3A 1KD1D 1AHHA 3RRMA 2AFHB 3SZMA 5DNDA 2Q5IA 2G7MC 3IHKA 2PPVA 5A9TA 3ONDA 1IB6A 2W2XA 4HAVA 3SYNA 4AK9A 1UOQA 1PV1A 2G8NA 3A26A 3GLHA 1B93A 4M1YA 2FPWA 4JL6A 3E15A 2IU6A 4EG5A 5ITWA 1TMOA 3IUSA 3B5EA 2OLEA 2XX3A 4RELA 1YIOA 5LZ8A 2OYNA 5KX5B 1RABA 3IQIX 1RE1A 4C7OA 1FVFA 4PG4A 1NPTO 3LSYA 3TW6A 3FDZA 1H0SA 4B74A 4O4LA 3T5PA 1NBIA 5T7BA 1IDN1 3TUIC 4H15A 3WAKA 1LTKA 3KQPA 4WACA 5KVAA 3HUEA 2FG7C 1P4MA 3HA2A 1A8QA 4UBMA 2M6LA 3IELA 4YMGA 5KOHB 4QV2A 3O9ZA 4IFTA 1SHZA 4IFEA 4C0BA 4JXXA 4G24A 1SC6A 1TAUA 4B6QA 2VOEA 1Z82A 4BN4A 1YA4A 1ZGAA 2WSMA 4N5IX 3REOA 1MPXA 4TRRA 3F5DA 4UHBA 2XB9A 1XCJA 2HLPA 1ST2A 2OHVA 4Q16A 1K4YA 5JS6A 4MKRA 3W5DA 1X70A 3AK4A 3EVGA 2CLOB 4PHTA 3V1LA 2WU3A 1L7MA 1BOFA 4FCWA 2B0JA 1GPBA 1GT6A 4ZXPA 3I73A 3RK4A 3SHFA 1VL0A 3P19A 4HXFB 2NUAB 2WDPA 3N87A 4MGEA 4Y0NA 5JDCA 3FLMA 3UUWA 3NDPA 4MW5A 1KA9H 2V0NA 3SCZA 5FO1A 1Y8ZA 2ILVA 4Y2JA 1CDOA 1YJQA 2CVOA 2RK6A 3O95A 4LQDA 1KR5A 4JJ8A 4XOTA 2YVLA 2ZKLA 1M0SA 3OQPA 4Q37A 3UJHA 5L95A 4XWAA 1UMCB 2P6RA 3HPQA 1RLJA 5PNTA 4D42A 4F4IA 1FNMA 3ROEA 5JH7A 3HJHA 1JIQA 2WIGA 4FNGA 5FPTA 3PA6A 4XJXA 3REFA 1XKXA 3EZNA 1ZBQA 4MITA 4QBHA 1HQDA 4Q1VA 4IF4A 4YB8A 3WK8A 2XWBF 3LGSA 4CKBA 3COWA 1A71A 2BZ0A 2F1LA 2AFHE 4JNCA 3IAEA 2JH8A 4HYYA 3O8CA 1U9YA 3BXFA 5DLPA 4EJ2A 3A8KA 1MR3F 1I3MA 1PHPA 4XX1A 4C0XA 2HTEA 2PUJA 2OV8A 3AVPA 2UYYA 3VO9A 2G1PA 3CZMA 4JR2A 4WKNA 1V47A 2ZROA 2OHHA 2ASEA 4ZIRB 1TQDA 5KWIA 4LYYA 4CQMB 5CGZA 3MJSA 5JHGB 5HQTA 1CFZA 4C7BA 2ZB7A 1TLTA 3VJMA 4D43A 5ALYA 3OZCA 1E2UA 3ZWDA 5T6MA 1REQB 3ADOA 4ID9A 3WQBA 2ZCJA 4L28A 4Z4YA 2YRWA 3DWEX 1N8RD 4AW9A 3KYJB 1K66A 3KAQA 3WMXA 2BFWA 5D3KA 2ZTLA 1QU2A 2J67A 4HRXA 1K7YA 1W5FA 3HWWA 4RTJA 3NFRA 2GJPA 2DQZA 1H2XA 4G0YA 4C7KA 3K71B 1T3GA 2HKIA 1BXRA 1UBKS 3EIFA 3PDCA 4FD3A 3MEQA 3U6KA 2YVKA 3R3XA 2CT8A 1NLYA 3M6XA 5K0JA 3TCKA 4F6RB 2CV0A 2ZOSA 4KXVA 4DADA 1VL5A 3STVA 3SKBA 4H4CA 1M10A 2O5RA 4MA0A 5DTQA 2CV2A 4CQNA 1CVRA 5HRAA 3B6IA 4YV1A 2WQ6A 3RTAA 3QA3E 4R0NA 4U2DA 4CMAA 3BT7A 1BA3A 5AXAA 3CD6B 3GVPA 2UVDA 2YNMC 3EVFA 4R7TA 4UVHA 3TB4A 3TG8A 1JBQA 2D5CA 4V0ME 4RPHA 3TBHA 2HSGA 4BV3A 1DI0A 4C5CA 4QD3A 5F3WB 4U3JA 1DEAA 3OPOA 1Q7BA 5L7YA 5JWOA 2FR0A 4XJTA 1G8SA 3K0SA 2EERA 4LN1A 1H8ED 3WA6A 4O4IB 1UWVA 4Q9HA 4K2HA 1VMEA 4E1BA 1QRAA 3RU2A 4MR8B 3WB0A 5MDHA 2BGGA 4JENA 3OTWA 5JD3A 5LQKA 1IBKB 3SHWA 1Z88A 4BO3A 3KZOA 3SIPA 3C6XA 4YECA 4D79A 3HL4A 4KXWA 3TW8B 1LDNA 3JWEA 1V0FA 2O7NA 2P1RA 5JAUA 4E1VA 4CRWB 1YA8A 4K9QA 1G8HA 2WAOA 3L82B 3RANA 2WD7A 4YJ3B 3ZI7A 5JCXA 1E6UA 1YNSA 3P52A 2IKQA 2ZUUA 4MYSA 1C3VA 1SXHA 1Q0LA 4J03A 4QHTA 4O1MA 4Z9XA 3VR3D 2AVNA 3LWNA 2W2LA 3IPYA 4D0SA 3NZEA 1BDBA 5B7PA 4BWVA 1V3UA 3CNHA 2KPOA 3PUWA 2OCPA 1O3YA 2ID7A 3V1MA 1KH3A 1N0UA 1M1YA 2AW3A 2RGUA 2XMCA 4E3ZA 1NJ6A 1N7HA 5BQ5A 1ISGA 3F4KA 4KFSA 4MVJI 4UVIA 4BZPA 1M2VB 3S7TA 4RDIA 4YAFA 5IT9A 1OF1A 4G5SA 1DAIA 4WFQA 1QKIA 4CM5A 1TM7E 3K0KA 3L04A 1V41E 3PNYA 4GZLA 3COZA 1LLCA 2ZAMA 1R4AA 2IQ5A 4M0PA 2JRLA 3LFTA 4PO3X 6GPBA 1GQFA 3TRDA 3VPGA 1T3SA 2XMRA 2E21A 3VZPA 5F3RA 4AC9A 4IHAA 2R6GA 2IV3A 3BICA 4N7BA 4FFPA 4BX9A 3AXTA 2Y1WA 5F9FA 1VG1A 5B53A 3HEMA 4KAXA 2I2BA 2P6UA 4GH5A 2XUDA 3B1JA 5JO0A 1Q2XA 3K0FB 1XZMA 3M2PA 1QF9A 4UOEA 1IK6A 4KAFA 1FYWA 3AKEA 1H9AA 1UBFA 3IVRA 4P8RA 5F35A 3PUZA 2Y9PB 2FZ5A 3B9PA 2HU7A 4L5IA 2EARA 3RSZA 5T57A 1J8YF 4AX8A 5J1SB 3KLOA 4WZ6A 4DRXA 4RJTA 1DE0A 4NYIR 3DFZA 2B83A 2JFOA 3LT0A 3PCRB 4WOJA 4DSAA 4CBVA 1PHRA 3GSIA 4C06A 4D80A 1N05A 2C7QA 1D1PA 1QFZA 2GEUA 3BILA 4GX0A 3SJAA 2DBYA 3TZEA 4M76B 1NMEA 4CDMA 3S81A 3D2CA 1KDYA 1MN6A 4IP0A 3A1CA 1BMTA 1QP0A 4M0MA 4Z9YA 3WL4A 1NG9A 2VAMA 1I4TD 3BD9A 2AEEA 3DVSX 1M6YA 1KO7A 3NBKA 1MABA 1Z22A 2FV8A 4Y1RB 3S99A 4WY2A 4N5DA 3F3KA 2AIRA 3D2LA 3DZJA 3KKQA 3MUEA 3SZRA 3WWEA 1N32B 3N53A 4MGIR 4MVJP 1T5HX 1I5RA 1HNNA 1U5BA 2BTQA 2GQ0A 2NTEA 4KACA 4MW2A 1SBZA 2XKKA 1HWYA 4CODB 5E7IA 1OXMA 3B2NA 2H17A 1RWXA 1S01A 3R4CA 2W2TA 4AJPA 1TJ5A 4KH1A 3G0CA 3VYUB 1BQ4A 1RWBA 3DXFA 4NV1A 5TR9A 1O03A 3R7LA 4R01A 3AHHA 4RTLA 3S0JA 2K5UA 5BYKA 1P4GA 1KOJA 3NWEA 1Z0ZA 2H1IA 5A9SB 5DWDA 1EFVB 4AAYA 4CEHB 1JWBB 2NIPA 3C5CA 2JBWA 2QPOA 4NYMQ 3RS8A 3ENKA 4Q0MA 1X9GA 5A3JA 2W0MA 2IS6A 1HH4A 2CLFB 4V3BA 3BH6A 4WMLA 2YDXA 2XQJA 1QO9A 3VR6H 3EDQA 2CKDA 1ZOLA 4PBTA 3R8XA 3GVLA 1D2HA 4N4AA 4G5GA 5A7HA 3VHXB 4RIEA 4GYYA 1X7WA 2VBVA 1TECE 2OV1A 2P9ZA 2XY4A 3W5IA 3WGGA 2G1AA 3GUCA 3FDJA 3HP1A 4K0KB 4I4IA 4P9SA 2BFDA 1YJAA 2IPOA 2OO5C 2Q21A 1WZEA 3C0KA 3HGQA 2XD9A 4H16A 5FR2A 5BWOA 5K6AA 1R4NA 3T35A 1ORRA 2D2FA 1KPHA 3O84A 5U1PA 3R75A 1U28C 2XBMA 3K2EA 4U7PB 5AOAA 4EO7A 1H4SA 1QHNA 5BURA 1I1HA 2SCUA 3L7OA 4H0FA 4EKNB 2EXXA 2GEKA 1NNSA 4UNRA 4JJEA 2XZDA 1XNHA 1CR1A 1YS1X 2PKXA 3OESA 3A3YA 1IEXA 3UWPA 3DMDA 4BO6A 1T34A 4XPIA 3TSZA 5BQFA 4C0KA 1RFLA 4UREA 1DKNA 3RYHB 5LC1A 5CB4B 4Y9DA 4P32A 3ADDA 1MFZA 1YE8A 2ZI5A 2ICAA 1T5IA 2ZYWX 3FAZA 3U3JA 3UGQA 3VPAA 1E96A 2ISSD 4RYLA 4ZO4A 5HBGA 5J4YA 4UFOA 4QUZA 1VKZA 2EFGA 4I9NA 4IDAA 3U0BA 1NF8A 3UUFA 3H9GA 3QLUC 1XLVA 3R5FA 1Z56C 3O2JA 4JQZA 5GIOE 3K1TA 3DDCA 3R09A 1AE1A 1JU3A 1GEEA 2A67A 4AG6A 4DGQA 1R0SA 3FGZA 4GVXA 4CKXA 4EYGA 4RMIA 1G38A 1E0DA 1NT2A 2VDJA 3TYXA 1M2WA 4MR9B 2KSQA 4FX5A 5H82A 3MJRA 4CKCA 3I45A 4IEFB 4NABA 4IVNA 1VBKA 4XGKA 3BWYA 1Q1BA 3RABA 4HF7A 2IODA 5B4TA 3GCXA 4AD8A 3HH8A 2G77B 3OWXA 2UV8A 3S55A 3X1KA 5DO9A 1T13A 2J3KA 3F6RA 1SURA 3A6ZA 3OE5A 2CXRA 3SBOA 1I24A 4XGNA 3OJFA 4KQCA 5L3QB 2B99A 2QX7A 2H0QA 5E4TA 1LFDB 2C0CA 3EDRA 3UV6A 3ZU2A 3O90A 4RABA 4HK4A 3T4XA 4ESEA 4J0KA 3T7TA 5DLDA 3NXSA 4KE9A 4MRVA 4V0LA 3MINA 3JQFA 3KOOA 4Q6WA 2XWSA 1GKLA 4L0CA 4YACA 1ZD8A 1ENOA 1WMSA 1Z5OA 5EJMA 3ZDXB 3UQYS 2YV3A 2XA9A 2W2OA 3H3FA 1KVQA 3TNJA 1Q95A 2DQSA 4C4AA 4ITUA 4HNTA 1WPCA 1L5KA 4LSGA 5E6UB 4GKKB 5DLYA 1SNYA 1BH2A 3D8NA 3W78A 2O0JA 2X8WA 4AZWA 3W5UA 3WK9A 4M87A 2VUIB 4FBGA 4O3FA 1HYHA 5IVIA 4YUYA 2YCBA 5WRFA 3ZCQA 5A4AA 1J97A 2A6PA 2DAPA 1E2LA 2DJ5A 4LI3X 1TYBE 1GVNB 2GX6A 3TIVA 1A4UA 2ZXFA 1P73A 4ATNA 2A9QA 4JBHA 2LBPA 2AN9A 3AM4A 3GVKA 3NORA 3W5JA 2KVOA 4O4JF 1K97A 1P18A 2YZGA 3QFSA 4MWDA 1HC7A 4WT7A 4TL6A 3FB1A 5FTNA 2FB9A 5SYAA 4P81A 4XA8A 3VPSA 3RR2A 3VR0A 1TC2A 3CC2B 1VL2A 3WRWA 4CMJA 1E0JA 4ZOAA 4LRYA 4GOKA 1H4QA 1CNEA 4MQ4A 1M8PA 4DA4A 3DOUA 1E64A 1NVDA 5KSWB 1JHVA 2ZTGA 4EFKA 5EIEA 3NYIA 5LR6A 2YY5A 2IE8A 3NRJA 4F8YA 3FSRA 3WRVA 4FS8A 5A4FS 5B6PA 5IRCD 4YRBA 4QBTA 3CB4A 5BVGA 5C4IA 2DRIA 4KQKA 1QPZA 1XZHA 5HTOA 1NF2A 3A9SA 2GQFA 3SJZA 1NVVR 5BWBA 1CW2B 4NVRA 8OHMA 1C1DA 1ZICA 1ZMOA 2A0FA 2AYZA 4FOOA 1Z16A 2P77A 2AMFA 3TLEA 2ETXA 3UJAA 1IQ0A 2D2VA 4JC8A 5LOVA 3LBHA 1OH6A 2J4DA 3D4OA 3OKPA 4ENPA 5I47A 2B3TA 2BFOA 3A14A 4IQ8A 1NQUA 3PQFA 1Q50A 4EG6A 4TSFD 3ONWA 5JNRA 3NS7A 1QAOA 1NB0A 1E2FA 2AUNA 1NZDA 3AF5A 2WTNA 3EMVA 3HS3A 4XR9A 5D8DA 4B8YA 3ZDCA 3RI3A 5CNJA 1R5NA 3R44A 1QYWA 3SXUA 4LOKA 3ZDQA 3LIPA 5GIPE 1NBWB 2PMCA 5FRDA 5FYDA 1QF6A 1AM4D 4PZAA 4ZVPA 3QJYA 3ST7A 1E7SA 1ORIA 4DYVA 3FNFA 1AHNA 1ETHA 2VP6A 1ZM2A 1D2AA 2C2YA 2G8LA 3OW7A 3EG9B 4LZOA 5JPDA 3U44B 2BFPA 2PGNA 4DYHA 5GVSA 2GZ3A 3B2QA 4DQ0A 5IH7A 3TAXA 2OAGA 2Y1XA 4PR3A 1JQ3A 2PZGA 5CM9C 4I5IA 1Q74A 1JYSA 3GDHA 3LC0A 5EUCA 4ARVA 4I99A 1OA0A 4BASA 2NO9A 4KPGA 2V7TA 3IDOA 3QOYA 4FMPA 3ZX4A 1B8NA 1A4IA 2Q4EA 2A0WA 1NR7A 1TEVA 3UWOA 5IXSA 3IP5A 3GEDA 5C1OA 1SCJA 4F4CA 3Q98A 5AUOB 3HCOA 2OLJA 4QBIA 1K28D 2AN1A 3ETGA 2YMPA 3MXTA 3EULA 4ZAYA 5BMVF 1GQSA 1E1RA 4KMRA 3U7JA 3E03A 2FPPB 2R25B 2AKYA 1P19A 2QSJA 1D09A 2PKRA 2F3QA 2PYZA 3GP8A 3EPJA 2X19A 4EB8A 1PR1A 2O2YA 2PXXA 3FNHA 5I9BA 6REQA 1Y7PA 3P9RA 4QRIA 3N8HA 2P79A 4G23A 4XM0A 2AMYA 1EEXB 5ALLA 3RFCA 4E30A 1VLHA 1E60A 2H7CA 4DV3B 2JAPA 5FDFA 1BE1A 2ZIGA 2XVYA 5FWYA 1S2GA 3ZLJA 1ZHHA 2OCXA 2PBZA 1A8HA 4N54A 4WVFA 2A9VA 4UAGA 3ZKWA 1QHYA 2ZRQA 5ARDA 4ZOCA 4ARIA 3F9RA 4RKEA 1KMHA 4UXIA 4UU0A 1TQ8A 4Q02A 3BZUA 3TXXA 3WNZA 3BIFA 1XV5A 4OYRA 1CEQA 4NYIQ 5FADA 2P67A 1Y7HA 1ONSA 2CCJA 3QY0A 5CVTA 1T3LA 4IIJF 1ZJ6A 1IHMA 3AP1A 4Q1CA 2YIMA 3DBLB 4H59A 3AR5A 3QX8A 4YJFB 3NDJA 3INTA 1ZOSA 1ZOPA 4B7AA 4RESA 4JB8A 521PA 1EFTA 5JQGA 4FDMA 4BEVA 5HG0A 2OCKA 1BS9A 3RUFA 1NJGA 5F64A 2Q1TA 4RLHA 1EFPB 3EOAI 2BSQA 1XHEA 4IV5A 1S1CA 3CV3A 1U1GA 2EL9A 1Y0RA 3KFXA 3C3KA 3MWJA 4QYWA 2VSOA 5F77A 2OYRA 2AI3A 3EH1A 4JEHA 2Q5EA 2ZJAA 2YJZA 1X6VA 4FGLA 4LSWA 5DISB 1P2BA 2OY0A 5FQNA 2FW9A 1VJRA 4B40A 3CB2A 3EZYA 2IW1A 3PQ2A 3C6QA 5KI6A 3WGJA 4RVGA 1D7OA 4BEJA 2Q0XA 1D7AA 4RK7A 1A9SA 4DXAA 1LWNA 1HK7A 4OPVA 3MWGA 2J41A 3KFLA 3Q7RA 2IXEA 2QIPA 1NBHA 1RD4A 4HWTA 4QDOA 4R9UC 5DGDA 1OBOA 5CLLA 2V6IA 5F21A 4RXMA 2ERYA 4GPEA 4R51A 3U9TA 3JVVA 4A0QA 2NQ8A 1JJAA 1M5TA 1WPGA 2GD2A 2Q0HA 2QSZA 3R6LA 4YC7A 2CMHA 3KKKA 1EFRD 1LI7A 2QN2A 3KL4A 3TLKA 4ND1A 1MIOA 3EGVA 4ZDIA 3ZEAA 1X8KA 4FS3A 1VZ3A 1DJQA 1EVEA 3MG9A 1U4OA 1YACA 3N6VA 1E79D 3OJXA 5EJIA 2YWGA 1TYEB 2ZWVA 1JR3D 5DHQA 1PGPA 2P6OA 3AESA 3IAHA 4G0PA 5EAIA 4LDZA 5FA5A 1PJ4A 3PNVA 3PQDA 1USIA 5EJ7A 3AVUA 1N6PA 1PZHA 4RPDA 3B1VA 4R81A 4L95C 3GBVA 1W4RA 1IY0A 4L27A 3F3MA 1J25A 1CHDA 1KYXA 3L3BA 1F20A 5HZAA 3ETNA 4FOSA 1MD9A 5F5XA 3U13A 4KQ6A 4RTQA 4JBYA 4U7FA 1ISHA 1CY7A 2YWJA 3OCJA 3DPIA 4BLTA 5CEEA 1NL3A 1LK5A 1G5TA 2DU8A 3SOZA 5E7QA 1FF9A 4AZ3B 1AMUA 1U8YA 3M6LA 2JLZA 4MW0A 2X86A 3ORYA 1JXQA 1R9JA 4FZ5A 5GINE 3L6BA 1KOLA 3NGXA 4GZMA 4B80A 2BKXA 4UTXA 1TTHA 1PYOA 4J2HA 4BMOB 1LTHR 1KH2A 1KZ4A 2REBA 2ZE6A 4WFIA 5DF1A 1I3CA 1L4YA 1XD2A 3BWDD 2PL3A 4B0PA 3N76A 2XTAA 2C00A 4ZICA 3OCCA 4MB0A 3ABRB 4F8JA 5D51S 3D6HA 3LOUA 3A9WA 3GLGA 2B36A 2V5AA 4PGAA 1IHUA 2CJPA 1QHHA 4ENVA 4RA6B 2GHQA 1OX4B 3ZH9B 2FKAA 2WVAA 3NPMA 3PWTA 4JYPA 3K92A 1BX3A 1HDGO 3M0EA 4TSRA 1VB5A 2G7ZA 2C9BA 1R0XA 2HZBA 4US2R 3KPYA 1W0CA 3JQ9A 4R1OA 3KXDA 4B46A 5T64A 2ZSIA 2KS6A 1SPBS 3OBBA 1JWAB 2I4LA 1ZM9A 3DL4A 4FI3C 1DXYA 1XEXB 3NFYA 2ODAA 1ZPDA 4HR7A 3I05A 1VQMB 1BXGB 1WJGA 1XC7A 1AGYA 4HSGA 3GLIA 1WETA 2AZXA 3B6ZA 2QAIA 1L4NA 5LLTA 2FZVA 1Y89A 3BOSA 3HQ4O 1JDZA 4EHLA 3ZVNA 1E2BA 1AX9A 2D3TA 4JLUA 3L1UA 1KWGA 2BMWA 4EUKA 5LMNB 1SZJG 4PRLA 2YFKA 3ODPA 3L1JA 1SJ9A 1E6WA 4OLBA 1P62B 2GUGA 1IVYA 4LXTA 2CF4A 1K3UB 3ETLA 5CUQA 5A5DA 5JJBA 4REOA 5K20A 2WNSA 2R86A 3GNTA 2HV8A 3OE7D 4A23A 1QUFA 2W2VA 4BFSA 1RBMA 4IZHA 2B35A 4MSUA 3TAUA 1MLDA 3C24A 3WGZA 3QEAZ 3AGQA 3CPXA 2C8LA 3CS3A 3T1QA 1RYDA 4K40A 1Q86D 4Q4AA 3FOFC 1BRTA 1E92A 4LF6B 2DCMA 3FTNA 3WSTA 4YXWA 1QQ6A 5JNWA 4V2IA 3FFBA 1M8KA 1WQ1R 4URYR 1ZGBA 3FZQA 4MUBA 5FPHA 4D4JA 2GCEA 3VKFA 3RAEC 1K8XB 2CXNA 4L5AA 4RK1A 4ZEOA 1TA0A 3VHLB 2QU8A 5JSUA 2AFIB 3T9CA 3T4PA 4FYJA 2PVSA 3W2GA 1R6VA 2IA5A 4LZNA 4MPDA 5ALTA 5A3SA 4AP9A 5BYAA 2XH8A 3G23A 2GN0A 3IKVA 4E14A 2JCGA 2A5YB 3FSEA 1NF9A 1D1TA 1E2HA 3CXCB 3I5YA 3A6LA 1XPRA 3WIUA 1I3KA 1CQIB 4RFSB 2GARA 3M5CA 1Z4NA 3U7QB 4BUZA 4CDNA 1E4EA 4TWIA 4ZHQF 5AVJA 3WBBA 1NVVQ 4Y8VA 2HJHA 4UM9D 4CF4A 3HY3A 3N9IA 4G0UA 1QFSA 4Q47A 5KQSA 3LKDA 3VSEA 2C0QA 2PEZA 4DMUB 5CD1A 4LYHA 1VXRA 3R3SA 4J0DA 1AQLA 1DSSG 4NXNB 3LPCA 3A3BA 1CE8A 3UA3A 4WLFA 2REOA 1ZI6A 4NULA 2RGYA 5CAEA 4TKUA 1DFIA 3SR4A 4YPVA 3PXEA 3RRNA 1W4AA 4M1TA 5H70A 2BEVA 1BGXT 2QZZA 3ZHBA 1Q12A 2ANCA 1IU9A 1CUWA 4M8IA 3TRHA 1Z4MA 1OTXA 4N7RA 1JH9A 2HFKA 1DO8A 1RAAA 1XL1A 4CLRB 3T1NA 2QD4A 2YJ4A 1I4OA 4OX9B 1GIAA 5DBGA 2OQRA 1W0KA 2H4WA 4JU8A 4OB7A 5JADA 5GZ3A 5JMOA 1KZ1A 1CERA 2C98A 2WVGA 2XECA 5AI4A 3ZNOA 4ARAA 1SGWA 2IIQA 1HG0A 1P81A 1UR5A 1UZLA 2JA2A 4FYKA 4XUEA 2R7LA 4JBWA 2J32A 4DMRA 4GXNA 3STYA 3PHIA 1FZQA 4MRNA 4KDEA 3OC6A 3JCZA 4JLDA 2Z98A 1RQRA 3ABOB 4UTOA 4U2BA 2JPDA 4CLOA 4WXMA 2Q8QA 1ECBA 2VQSA 3AILA 3EN0A 5LDGA 2ZYSA 4AYTA 1AB5A 4RQAA 2Z2ZA 3VDRA 4HADA 2J3LA 1O8CA 2AS0A 2AFIE 1E3ZA 5KDDA 2DHDA 1F0YA 4CLXA 2KJQA 3T3GA 4RTRA 1QFMA 3D7KA 2X0IA 2PLNA 3RK0A 3ZN2A 3PUXA 5D2CA 2BFFB 2GK7A 3WGLA 4YP5A 5BUZA 3ZWAA 3IUNA 2WK1A 1NUPA 2Q5JA 4QFBA 4Y1EA 2WICA 5EXTA 2PMEA 2PPLA 4M8LA 4LZLA 3DZ8A 2R48A 3IOEA 5DM4A 1Q7EA 1C1HA 2GBPA 4JOQA 4NCIA 4BE9A 5KINB 3P2MA 4GECA 2TMDA 4NZMA 4JUDX 2B4QA 3VJLA 3IMGA 1L1RA 3LJKA 3IA2A 1AKRA 2PKQO 3KKOA 4R2LA 1U0OC 3DDUA 5GOTA 3NIFB 2XMBA 4AG5A 4YJ2A 2FOXA 2ZRHA 1WDKA 1PKEA 2PZFA 1KOFA 3PD1A 5BT8A 1KZ7B 3FUTA 5JNUA 1FFAA 1KERA 2I2DA 5BOSB 3HBFA 1NIJA 4CCYB 5TE9A 1QVRA 5IDWA 3T3IA 3N0XA 1IHDA 3OBIA 2HLHA 4JQCA 4CHGA 3O4FA 5EJ9A 2VJMB 4KN9S 3KYIB 3Q7IA 4M1ZA 2F4VB 1BE8A 4G9BA 5GV7A 5TEWA 1X38A 2BGTA 4GC9A 3TVDA 1OX5A 3DE1X 5EZYF 2FEMA 4X06A 3DMHA 3JQAD 5KNCH 3JATA 1NJFA 3COJA 4CEIB 4PAGA 4KI7A 5G41A 3SG0A 5JARA 4G8JA 1I5EA 1UODA 4MXDA 3DLAA 4QFDA 4QOIA 4R6XA 4U8GA 1QF7A 4YI3A 2O2GA 1HQKA 4J16A 2JFNA 2V3VA 3QPBA 1NQ5A 5F4JA 1R0KA 4LBVA 1KFKB 1Z07A 1RIIA 1Y9ZA 1VL6A 3FGPA 3IULA 3QKIA 4FINA 3DFFA 4KMMA 1Z3IX 4PX5A 2FXIA 3JRNA 1E6KA 4PZZA 4XIYA 4DV7B 4C0LA 2C4UA 1XUOA 3JTMA 4ZOLF 2XUPA 4DUPA 4GT1A 8ABPA 1D2GA 4P34A 1H8EA 1WOOA 1ZDMA 1ZD4A 3D7NA 4LYGA 4EWLA 2WHQA 1EVKA 3I56B 3L8YA 1OE0A 3WK5A 1QCCA 1U4SA 3G5AA 4N1AA 3E7WA 1GVHA 3ZV3A 2Y68A 1TVCA 3GGOA 1FNNA 3DVLA 1P4JA 4OHBA 4CFZA 1PL0A 2L19A 4F9GA 2PGXA 5G3ZA 3X0DA 2Z3WA 2CVFA 3OURA 3IUJA 2BFAA 5KC9A 3QI2A 4MI1A 1G7CA 5B1IA 2CXTA 3ZTWA 1WQ3A 3ETHA 1XZAA 1RPNA 5EVCA 2H3EA 4BFUA 1XK7A 2VA9A 2QAGC 4JLVA 4ZPXA 3CCEB 1HEIA 5HQJA 3VR3A 4W9NA 2Z2YA 3U4IA 2NU8A 3T3NA 5TF0A 1RKUA 2WKRA 4MEJA 5G40A 4EJSC 1GZHB 2IY7A 4LQCA 3BJZA 2EWVA 4S1WA 1ONPA 3OQ6A 3GLFE 3ZDZB 2P3MA 1K27A 3UANA 1T1SA 2VHCA 2KLBA 4KR6A 4FD2A 3OSUA 3O8QA 1EE2A 1LGYA 3TJMA 4U63A 5BV2P 3SE0A 3ZS8A 1K1EA 5IDQA 3WOVA 4KR7A 1UQUA 2B1RA 2J9YB 3HWX1 2R00A 2XTJA 4MHSA 2V96A 4XI9A 2YR0A 3ICOA 4ZO8A 4DK1A 1UDBA 3HCPA 5E8JA 3W4JA 5I9SA 1EKXA 5EXPA 4Z7NB 1VQOB 1TCCA 2HCTA 4PZDA 4UM5A 5KWSA 3VTZA 3WYBA 3TEMA 3IB3A 4XLCA 2ZPTX 3OT1A 2IIPA 2YWRA 4MW4A 3PEEA 3DOJA 4DUZB 4DJ5X 1VI5A 4RLSA 3ZE0B 2Z8YM 2H59A 3NIGB 4DV6B 2DWOA 2VKQA 4GRIA 1XMXA 2DFNA 4YLEA 1IPFA 2I1LA 1R0WA 1Y9DA 2P0YA 3GP5A 3GMSA 1NPYA 2G9VA 3IYLW 3KXLA 5CVCA 3CEHA 3O8OB 4MWEA 3FHLA 2O2JA 2IXFA 5TS3A 1DKUA 2A57A 2HX1A 2BM1A 3NYWA 4Q03A 2C2KA 3VAYA 1JFLA 4ND4A 4W9MC 4BNXA 2OGTA 1NHWA 5AUQA 5D84A 3AR3A 3E35A 4DIBA 2XCRB 3VZQA 1PL7A 4G9EA 2HUPA 3G7UA 1LNSA 3CLRD 5BMVB 3D5QA 1G8KA 1RCTE 4M7RA 3S27A 1KYYA 2NV0A 2X3YA 3K8ZA 2IITA 2YMMA 1SHJA 3QVGB 1DMRA 4KG7A 3ZXXA 2ZT8A 1QVFB 3F5FA 4R1PA 4U2EA 4CQMD 1JIKA 2ZITA 1V1MA 3GI1A 3QU9A 4DIFA 4U7DA 4HRVA 1YLOA 1XTRA 3PB3A 2ZR8A 1E3MA 2W37A 1VPDA 2EW8A 3QBVA 5FL3A 3FMFA 4EQZA 3LY8A 4LE0A 2M6KA 2G72A 4HH4A 5K6TA 3CSSA 3SC3A 3TH5A 1A8SA 1SC1A 5HK9A 2HC9A 3KKZA 3Q2IA 5HW0A 4WA7A 2QT1A 3IBSA 2OWEA 3L8MA 1K6XA 2CJWA 3OEWA 1LFAA 1WR8A 4CM1A 2VJCA 4BPRA 1HLFA 3GPLA 1XKQA 2YHIA 3NC1C 3PGVA 2PUVA 2D0IA 3F49S 4FC6A 1SVSA 4Y2XA 4E3WA 1J00A 3FCUB 4TTTS 4GLLA 4UJ3A 3K70D 2A4KA 3D3NA 4NRDA 3M3DA 3S2EA 4IIJB 2BZSA 5DNEA 1V1RA 5TPWA 4GPTA 2X3FA 4XNFA 3RUCA 2ILTA 2OESA 3EQ7A 3EIHA 1JQEA 4GG1A 3WK6A 3G0OA 4LJ4A 5EKUA 3ROKA 4OOSA 5E8RA 5A04A 4E0BA 2DWCA 3I4CA 1Z4PX 2Z3VA 2F48A 5A06A 4DCNA 4IS3A 2YHAA 2A92A 4X1YA 2QA4B 3DE3X 1XXHA 3GZJA 4RUKA 2C88A 5ELLA 5FPPA 3TMAA 1FNCA 1O8BA 2GNPA 3ZCUA 4WCDA 5KU7A 3EDCA 3R3HA 5E4FA 4J4TA 3LY7A 4YT5A 1XLTC 2W2KB 2JGDA 2G4CA 1GFZA 1UZAA 3HTXA 1T8SA 4A16A 2B25A 1JXMA 2LZ0A 1SBHA 3JYHA 3NMUF 4NK5A 5CVUA 5FT9A 1E1MA 5TSDA 3SMQA 1KI9A 3V00A 1DT3A 2Q9UA 2MSLA 4WESB 5HIAA 2QAGB 2WSYB 1P0IA 5FHRA 5FUWA 1PQYA 4ZO6A 1UBCA 1VL1A 1JEEA 2N46A 2QA5A 2X3UA 3NB0A 1NTRA 2DKFA 4PGFA 4EJSB 1DZ3A 2HA0A 1Y1QA 4K2AA 1FLDA 2BGLA 1GFIA 3CP8A 1PIWA 1WPRA 2NNWB 3DL2A 3PFFA 5DNYB 2DQ4A 2VI5A 3HKBB 3PKIA 4GSYA 4DNPA 1ORHA 3CF0A 1ZL0A 3AJ8A 3RC7A 1B8VA 1GGMA 4NI5A 3FKQA 2E5LB 4JAVC 1V5FA 3BWXA 3RKSA 1OH5A 2CVZA 3GFRA 3Q85A 3C6MA 3D4IA 3QWIA 4NARA 3EAGA 3T3PB 3TTWA 4KR3A 5IYPA 5U4XA 4RV4A 2O5CA 4CIAA 1MHTA 2NTJA 3G8YA 1JQKA 1K68A 4RA9A 4CPDA 2JJ1D 3FFWA 3OPYI 5F4ZA 4CIVA 4XTRA 1II0A 4LYJA 4X3CA 1NUSA 1JMYA 3FMGA 4JLNA 4HXYA 4JY7A 4L2IA 4KGDA 4WJKB 5D3QA 1HSOA 1KJ9A 3D7LA 5B1YA 3Q9UA 1U3FA 3HGTA 1YGPA 3FLEA 1PFQA 2BFCA 4QJIA 4ZGQB 4F3TA 2D62A 4JS0A 2PA0A 2RE8A 4D3YA 1E20A 1XDSA 1KSJA 1J2EA 4QJ4A 4KO8A 1N3LA 4M0CA 2HQOA 5CEFA 2XXAA 2MSNA 3F96A 1QH8B 3E1GA 1IATA 3GRCA 4IX9A 4KKXB 2VJDA 2PSHA 3FZNA 5TT0A 5A4MS 5J4LA 3REQB 1IZ7A 4DCMA 2GYYA 5K8IA 4G4GA 1RWQA 1KY3A 1RQNA 2UVQA 1MAHA 3L84A 1I9GA 3D1VA 3ELDA 4PZ0A 4M0DA 4Z0NA 5EYPB 1U6KA 4WUTA 4ZDJA 3CZRA 2FGJA 5LM3A 4AMVA 2PD3A 2TMYA 5HFAA 3RBZA 3WMGA 1UDWA 5BR7A 1KQ3A 1BVUA 1L3BA 1MAAA 2B8NA 4FOLA 5G0WA 4FKZA 3FCXA 1CIJA 3RW9A 1QZ3A 3LUGA 1ZESA 1SC9A 2GXUA 4Q4DA 2QK4A 4PFQA 1NW5A 1SBIA 4IILA 2NQTA 4L02A 4NBVA 4OFWA 4ILKA 2VK1A 1L1QA 2UVPB 3F7TA 3HCDA 4I4NA 4QTTB 1SUEA 1OXXK 5JWRA 3AHIA 4EG1A 5C34B 1ZWKA 4N9QA 1S7CA 4DDVA 4ZI3A 5DV9A 3ZIAD 4EZIA 2BHSA 1N2CB 3ODGA 4OXNA 4MJ3A 2E48A 2B7BA 3P9IA 1R8YA 1Y4ZA 1KQGA 1XALA 3RWMB 2Z9DA 1M76A 2IHKA 3GMDA 3NOVA 3FNQA 5ADUS 4QT4A 2D5IA 1OI4A 2FSGA 3D3EA 3KTFA 4XTCS 1L4HA 1GPLA 5DI3B 3OCVA 1KAHA 3FRJA 1E1YA 3CCMB 2H5EA 2X23A 5AVQA 3CZ5A 3EE6A 3GG9A 2HO4A 4J7CA 2HK7A 5SY6A 1W2GA 3RT1A 1PG5A 1KDPA 1XVIA 5H68A 1GUBA 4ZKDA 1R74A 4XWKA 3ACCA 3GJ5A 3PGKA 1L5YA 1N0IA 2O3QA 3ANXA 2YNMD 5KTPA 4CI0B 1J33A 3PUHA 3LCCA 1Y6ZA 4OM8A 2BPOA 3O8LA 2BI7A 4QSMA 1W0JD 2B69A 4N47A 1U1DA 1ZHFA 3COSA 4LMAA 5A03A 5I3CA 5EWMB 5AIBA 4JXZA 1FTYA 1JVBA 1CY6A 2VJKA 5B3KA 5A0TA 4FKMA 5TLSA 3W3ZB 1J1ZA 2XA1A 4HN4B 4CTNA 2JD0A 3QY9A 1NLZA 2D2EA 3I8SA 3LUAA 1Q0QA 3NATA 5CLGA 1KZGB 5EN4A 1UZNA 3SF0A 5B3JC 4XLTA 3ZWKA 4HO1X 1ZISA 3LSTA 4X1IA 1A9OA 2V1XA 4ZOLB 1WULS 2VK8A 4UD6A 4P3YA 3R3UA 2Z58A 2NVUB 4GGOA 5LQUA 1Z0JA 4HQKA 2PRJA 3V4RA 3QPDA 4DKJA 1TA4A 1E9CA 5KSYA 1KDRA 5G1OA 2CFCA 4PGHA 2A84A 5ELMA 5GPBA 1YDFA 1A2OA 1E2KA 3N0VA 4NE2A 2VXBA 1A50B 3UB3A 8ADHA 3I8XA 2WF8A 3L7IA 3GUUA 4UXHA 3OZBA 4AF6A 1WZIA 1KC3A 2WJGA 1H3NA 4IDFA 3PUYA 3KHKA 4YJKA 2A0YA 4JI6B 2GK3A 2OA0A 3TX6A 1SCUA 4ROTA 5F1YA 5EHXA 5LUBA 2FA9A 1VMIA 1KTIA 1ZRMA 2WW8A 2OB2A 3BBPA 1UD3A 4MKXA 5DX8A 3BCDA 4B4DA 1F2TB 3ICWA 4ZHQB 1JAYA 2BJVA 4U2FA 1DAPA 2VDWB 4JJGA 4XDHA 5EWLA 3EWSA 1VPTA 1KI6B 2RGDA 3FZEA 4GZ6A 4QELA 3TJRA 1DWPA 3B1FA 3OIVA 1WBJB 1PR2A 3N2GA 1Z0UA 3QF4A 3OIYA 1E5XA 5AKLA 2B92A 2PWPA 2YJ5A 1RHQA 1FYVA 1RXUA 1RM0A 1RXYA 4IWNA 5EUQB 2OENG 2PQ2A 4E5PA 1P5FA 2R8XA 4RORA 3V8QA 1TEHA 1EXNA 1O08A 1NI3A 5CJJA 3SYLA 2A86A 4EYOA 1ONOA 4J6FA 3A35A 2L0XA 2EGGA 2VHTA 3B9RA 3K09A 1XQXA 4KQ1A 4MVJF 1V37A 1KXZA 4EJFA 2PX8A 1R4ZA 2IGTA 2H65A 4K9KA 3IAFA 3NCHA 3I9OA 4WZEA 4OLAA 1PR6A 1E5DA 1DTEA 4UOQA 1QE3A 2MCFA 3KQUA 4KKTA 2W11A 4JT2A 2RGNC 3LL4A 4Z4FA 3DL7A 1P7WA 1ACMA 3DOEA 2CHFA 2HPZA 1XWFA 2AJ8A 1LLFA 3Q5DA 1PJAA 1O4WA 1OWMA 1C0EA 1L3IA 4MRMA 5ALFA 4ZRDA 3A8IA 3ZD7A 2IXDA 1N5IA 3ETCA 4CL3A 2OOKA 5F76A 5IC4A 4WXEA 2YQZA 3UJDA 4LDAA 4BTVA 1IQRA 5A1TA 4YMVA 4MV9A 3WLEA 4G56A 1RPZA 2HRDA 1SXIA 3Q3EA 9ATCA 2FPOA 3GT3A 2YWDA 2WV9A 3OJOA 3HAGA 2G25A 4HQNA 5HMLA 1ZI9A 3JY6A 4LYDA 1JDBC 1L9KA 4LJ7A 5DBOA 5EQJB 2GDJA 2IBSA 3TNYA 2OPBA 3EGOA 2G83A 4GF5A 3HYTA 3RVQA 5AJXA 3R8FA 2CUKA 1F6BA 4HSEA 1GFSA 1DWUA 1DX6A 1WSBA 4KQ2A 5DP1A 3ZVLA 2RAVA 1RM4A 3GJSA 1PK8A 2EEPA 4C6HA 1VQ7B 3JQRA 4FZJA 4PPNA 3UMBA 1VMDA 3BXPA 3H18A 1U3WA 3WDLA 1B2LA 3M6MD 1SIOA 5B4UA 4YCNA 3TO5A 2FPIB 4L6AA 3UT6A 1SFRA 4PG6A 4UKDA 3V8VA 1ORDA 3KTAB 3ZDEA 4F8EA 2VAXA 2EZ9A 3HJNA 4QNMA 4F9TA 1BMFD 3U09A 2EZ4A 1GQRA 3QU4A 2G0NA 4P26A 1U2ZA 1BD3A 5BSVA 1YXMA 3GEGA 3UBMA 4YR7A 3DF7A 4DBLC 3Q9SA 1Z15A 3EZGA 1NXVA 1U6JA 2A35A 2ZRLA 4HNRA 3ZCXA 2UYCA 5BN5B 1V4BA 4O1HA 3A10A 2IUEA 3RODA 4QUIA 2BP7B 3L6RA 5C8YF 2RJ3A 2FOLA 4AXBA 3IDAA 3VC2A 1T2DA 4JBGA 1Y3CE 3AM1A 3I6QA 1WMBA 3MUNA 1CUXA 3DZHA 1GZ7A 3HB4X 4I7EA 1LY1A 4C1BA 4FGKA 3DMRA 5SZKB 4AULA 1ZIYA 1LBIA 3CRZA 2Z6VA 4KLRA 4QNRA 4UHCA 1GYPA 1KE2A 3RROA 1GWNA 2DHRA 2PS3A 3RRBA 3SC6A 1QVWA 3Q0EA 2WTAA 4G2TA 4QUJA 3VNQA 4OGWA 3CMAB 5BPFA 3E5RA 1I2BA 3QFCA 2CD7A 1SM4A 1C30A 2CXSA 4Q39A 1PR9A 4PRYA 4KZPA 5JVDF 1VE3A 5FB3A 3TQSA 3JQBC 3C7CB 1FZTA 2B3DA 3LX8A 1JR3A 2JFGA 1H22A 1PE0A 1II8A 4I5DA 1PK9A 4LEIA 2VNHA 1OBVA 2BKUA 2YJTD 3DF9A 5ALPA 2HA4A 4YMSA 4O2BF 4INOA 1PAUA 2IRWA 3MQFA 4HTAA 3SXJA 3G2MA 3OECA 3WYEA 4M6WA 2WWRA 2ZYAA 1HOXA 2XOKD 3HR8A 4V0NA 4Y9SA 3C85A 1ZK4A 3C3WA 1SIWA 3WMEA 2M98A 1Z8DA 3AF1A 2XBLA 4OJNA 2IHUA 3LRTA 5K3SA 1SHUX 3EIQA 1XRNA 1T36A 3GC6A 3O8DA 4FFWA 4K3UA 3AHFA 1YKFA 3HU5A 5LCXA 4B7UA 3GNSA 3SZOA 1XDZA 2G1KA 4QU5A 4OLFA 1L5WA 3QEMB 4MINA 3MTQA 2J9XB 1O77A 5FAKA 1F7VA 5D5PA 3BL5A 3BMOA 5GONF 1YRQA 2ODTX 3D0RA 3L41A 4EA6A 4F46A 3VC1A 4QDJA 1TF2A 2VJBA 4F6CA 4YY3B 1VZ2A 5AD1A 2MSCB 5GZ6A 5ED0A 2FEWB 4FILA 4UFNA 4ER6A 2E6UX 3A6GA 4D4KA 1EXMA 1U9IA 3U3DA 3QVTA 4OUDB 5LP6A 2NZXA 4LJSA 4Q5IA 2DKOA 3WLPA 2PLRA 2BFBB 4F1JA 4O8ZA 3PENA 2O57A 2I65A 1XBTA 2XMZA 1OAKA 3H3JA 5K51A 3QE2A 1NOJA 5BSXA 2XRFA 1QAMA 1MDBA 4I55A 2JLYA 2PUWA 5AVTA 5D87A 2CBZA 4KODA 2FPUA 2FHPA 2XOXA 3LZDA 3MOGA 5IPFA 1TE2A 2AUTA 5I7AA 5BV1A 1YF3A 1H69A 2PUHA 3RSFA 4HB3A 2ZU6A 1CJUC 4R8VA 3L1IA 2V8OA 4A26A 4TQAA 1L8OA 1FA9A 2HBQA 4NU0A 5IM5A 2X5NA 3TGLA 3HSYA 4W5OA 2LKCA 3H94A 1JHOA 2RHCA 4EUNA 1JDBB 1IC6A 1YL7A 2OO3A 4WL0A 2Y2UA 1Z34A 4BLVA 4MGHA 1YU6A 2UZ4A 3KWLA 3PC4A 5HE8A 4AZTA 3PBKA 3ZKAA 3UMGA 1DG9A 4HQ6A 5IXYA 4JI2B 5BSFA 1X1QA 1YAHA 3PHCA 2ZBGA 1PTJC 5B37A 1GU0A 1EINA 4JP8A 3RBAA 3GDWA 3CZCA 5GM1A 3WLAA 2D9RA 3CWQA 1I13A 3GJ7A 2ODNA 3SJUA 3V6MA 2HQ1A 4YAOA 2RH8A 1Z5PA 3H7IA 1WCIB 2HSDA 3IOYA 1XMPA 1E69A 1T43A 3ZE9A 2IHZA 3K8YA 2A5GA 1LK0A 3G1UA 3WLIA 5B58C 2LTAA 3IUYA 3G6KA 4LHWA 4B5LA 1BKYA 2BD0A 2C5SA 2HSEA 3D8HA 3EMDA 1AUXA 1YL5A 3LO5A 3CZPA 2WNIA 3E9CA 3U40A 2F62A 2DGDA 3H6KA 2VSXA 3VYRB 1F3OA 2GF0A 1WF6A 2DM6A 3GN2A 3A05A 3NYRA 4E6PA 1H6BA 3T3HA 4C7XA 2VEOA 1WXEA 2HRCA 3ZWBA 4Z1MD 1FPMA 1M1NA 4K6CA 2ZFUA 5DB4A 4ZQIA 3GT4A 2OBSA 2IXAA 3OZUA 3QSGA 1SOUA 3CT4A 1NN3A 5IJXA 2YW9A 3EQ8A 3OZVA 4QOHA 2DEUA 3HUTA 4FFNA 2XYHA 2JRCA 3D43A 4NMLA 5M5BA 1II9A 5K3DA 2FZGA 1JIUA 1ZK0A 4FTWA 1IQPA 3O21A 4OB6A 5B2EA 5AVXA 2E4YA 3BEOA 3ORFA 3GPIA 3MWDB 3B9QA 1PZNA 1TT7A 2XCOA 1B1AA 3NHWA 2JIPA 2R6HA 4M1OA 1WXHA 4TZ0A 2AI1A 2EHJA 1RC1A 2W2NA 4NENA 1FUUA 3QVSA 1EHCA 4P7KA 5A05A 4M9ZA 2JEZA 4URHA 3HBAA 3D8RA 5HJ7A 4HEQA 4BUCA 1G3QA 1J21A 2DWUA 1C9KA 2RB5A 3AIOA 2ZAGA 5D86A 1OBHA 3OHSX 3EGIA 1SEVA 5F4MA 1W96A 5FJIA 4ZZ3A 2OYCA 2ZM6B 1M34A 3MOSA 5BSGA 2R8ZA 2L18A 1OFUX 3DMNA 2ZL7A 4G0ZA 4N65A 2YXBA 2BEKA 4D8WA 2UUBB 1MVOA 1TFUA 1HYGA 2EG9A 2CFTA 2P69A 3HV2A 2OD7A 4TL8A 3MTEA 4M99A 1NWCA 1X42A 5GJVC 1T4CA 3KUUA 4OLJA 3GLVA 1OB0A 4OK3A 2DYKA 2HCJB 4AJ1A 4BRSA 7GPBA 1FRVA 1SCNE 3SAJA 2D5BA 1YZTA 4M1SA 3ND5A 2Y1FA 3NHSA 4OBBA 5CVJA 1SKAA 2YQ5A 2ZYHA 1D04A 2YASA 1G8PA 3O3MB 4DT1A 4C21A 2WFLB 1IFXA 1QIFA 2P6NA 1GCUA 3LIIA 4MGKR 4ZJPA 1Z5UA 2X5JO 1OLSB 3NEJA 4LZJA 3N8NA 1C0IA 2F3UA 1YVRA 4MQEA 3S2GA 4CM7A 2C3PA 3ZC3A 3H05A 3HADA 4CIBA 5FH9A 2PWAA 2WTMA 3VVMA 2W9XA 1B1CA 5G1PA 1ZG3A 3L8GA 1KDZA 5EESA 3VNSA 1TQ4A 5F4OA 1K08A 2ZIXA 5H9WA 4JYZA 3H11B 4HVLA 2EP7A 1R6AA 2EEZA 1TK2A 2NV2B 2YOGA 3OUUA 3FW1A 3UFBA 4ZYXA 4ZAFA 3G2LA 3KJXA 3FPFA 5J23A 2FPLA 5LBUA 2P9EA 5FOUA 4N76A 4ADSG 1AUOA 5LL6P 2JI4A 2ZS9A 4PLFA 2ADOA 4QLOA 1P0FA 3IV6A 4UARA 1HEYA 4R7ZA 2BKAA 4MKZA 4RIIA 2K2QB 1PDOA 4HOYA 1LRJA 1WXIA 5H9VA 4J7AA 4RDHA 2WF6A 3VKGA 1OHHA 5IWCA 3ASTA 4A2PA 1GZ4A 1J9ZA 2SECE 3PUNA 3ZZNA 1T2UA 4QYMA 1GGEA 2LCFA 4PNPA 4UHHA 5DTJA 4HDRA 1AKWA 5FI1B 4RZSA 3FG9A 4CTJA 5C5IA 4JT8A 5ALEA 3GFVA 4RFLA 1VOTA 2ZI7A 3JWGA 3K20A 3K9LA 4REQA 4X1KB 5EVJA 5EUBA 4JL5A 3PLRA 1NXSA 4NECA 4F1KA 3JD2A 1HSZA 4A8TA 5GZ1A 2EVWX 2ETVA 2QTBA 3CR7A 3VOBA 1FJXA 2DWPA 3MN1A 4NKRA 2GCOB 1SRQA 4R2MA 5J5CA 2X1LA 2HBZA 3AIMA 4JVOA 2C3UA 2O3UA 3JQAA 4XFKA 3TLMA 5I4KA 4EF4A 5BSTA 3Q6IA 4M1WA 1U7PA 1RHUA 4MPRA 1P2VA 3KDPA 3V48A 4FSDA 4BKPA 3NU1A 3CG4A 1C0KA 1XL0A 2CLCX 1KH1A 3T7AA 2ZXIA 2ZE8A 1EX1A 4D8UA 2VCHA 2J1LA 3LS2A 1KVSA 3ZU4A 5L9AA 1NC1A 4PHFA 5MGNA 2ACWA 4KVFA 2VYVD 3D8SA 4BQOA 4BVBA 2P4SA 1J5PA 4YP0A 4FHEA 3IB6A 2HJSA 4V1CA 2BF7A 1WU8A 2FH5B 1DWOA 3HVIA 5K8JB 4JJAA 1Y1KE 2Z3ZA 5E9WA 1TT5A 5DT9A 1I9CA 1YDHA 5G2OA 3WB2A 4B33A 3R1IA 2OCDA 1LA2A 4I3FA 4EOGA 4RTNA 2J5QA 4TMXA 3IUBA 3EODA 3KE9A 5LVAA 3R5HA 1Y6GA 3OTQA 3TR0A 1SZPA 3GQBA 3CSDA 3I6YA 4BC0A 2Z9CA 3DUFB 4TRJA 1QNLA 3JQPA 2ZCUA 3FHCB 5CVVA 4H2DA 3M9LA 3MCWA 3NHZA 4WI1A 2GM5A 2NZJA 1DAKA 3GUYA 4GS5A 4OHFA 1CRWG 1B3BA 1KZLA 2HSZA 4L4SA 4NOJA 2AXNA 3JU3A 4OB8A 5F33A 3MXOA 3U0VA 3W6ZA 4BMYA 2Q99A 4C29A 2HW8A 1MJ5A 3TGPA 4B3TB 3OZDA 1U8TA 1KPGA 1YZHA 2XHEA 3NHJA 4OI2A 3AFIA 1T9AA 1DHTA 4EUFA 3G2PA 3KYDA 4RLZA 1VQPB 5KQLA 2JKYA 1KFCB 3O8NA 4NH4A 3IV7A 6PFKA 2NV6A 3A4VA 4EVSA 4P4SB 5LJLA 3OPXA 1EWQA 1JE1A 3F3SA 3RVMA 5AI5A 2NUAA 3AI7A 2ERXA 4YTEA 3S29A 5BNTA 1HLGA 1UMBA 3L7LA 3TRKA 1K4MA 1ZXBA 1XOIA 3H5LA 2M6SA 3BSFA 1GRVA 2YFQA 4KRYA 1EG2A 2TMGA 3L40A 4E5UA 1RHMA 4XDYA 2IHVA 1ZKDA 4TTPA 1RKXA 1Y9AA 2R8BA 3CTMA 5AMXA 3W77A 2UYOA 5NLLA 1PS9A 2HNAA 4AX4A 4UUAA 3SX4A 3KOYA 1U3UA 1BGWA 4GOXA 3UAGA 3ZIDA 5IJWA 2G17A 3ZX5A 4Q3KA 3WWCA 4TWJA 3HR4A 4X7CA 1Q1NA 1NZFA 3NDRA 5BRNA 4GBED 3CVVA 2PX4A 4F21A 1NUHA 2ZYIA 3H1TA 3N7UA 3BRWD 4O2AA 1ADYA 3PQ6A 5FOQA 4XGQA 4Y9UA 4KI0A 3L8HA 4J3JA 4BECA 3VVCA 4Y2TA 2GD1O 2VSYA 1BCSB 1E98A 3QTLA 4DBVO 5F2EA 1HT2E 5KNBD 4HZUA 4D5EA 1O94C 4DN6A 4GEGA 2QRKA 1RJDA 2AOVA 1PJ5A 4E03A 5AHXA 1IB0A 3KLNA 1DG1G 2J6IA 4ECAA 2P90A 2NO1A 4YRRA 1FDVA 2BR4A 4HV4A 5MN4A 3K1JA 3QLVC 2TMKA 5A8AA 2HRRA 2YXPX 1NAIA 3H16A 2X6WA 2DR2A 3EXAA 3RSSA 3ZIUA 4QDXA 2DFKB 4D0LB 1OB2A 2LPMA 8MHTA 4R68A 1IM5A 3ADPA 2GN8A 1A9RA 1N9KA 1RXSA 2I7TA 2V6GA 3ACBA 4L0QA 5FPKA 5ITSA 1LSUA 4R8LA 1M33A 3F7OA 1P80A 3N58A 2WJAA 3BG5A 1H3FA 1GA1A 2JCVA 5FLYA 3R7WB 5LKAA 4US0R 2A59A 1W47A 2DFDA 3VR4H 3KYBA 3ZHTA 3LQRA 2PT6A 4YX9A 5DH9A 3D6AA 2CSXA 3Q11A 3CU5A 1RNLA 4JSTA 1BN7A 2GFQA 4OLHA 4LZPA 4RDCA 1FDRA 3FTDA 1S2MA 2WZNA 1C81A 4M53A 3BE4A 2NO0A 1QIIA 3EW7A 4W5WA 3T3EA 3GBSA 3P9KA 5ENZA 2J0UB 1NKSA 4QOEA 2VSNA 3B6EA 4H7JA 1MB4A 1YTLA 1SCBA 2X0KA 1J2UA 2ZDHA 3QBTA 4X7DA 1ZMRA 2LKDA 4FLEA 4XE5A 2WWXA 2N47A 2J5RA 2X2FA 2ZWAA 3KQWA 3OUTA 4KUGA 4W82A 5EE1A 5EMLA 4B4KA 2IS2A 3V32A 1VECA 4YGXB 5A4KA 3ZOZA 3ZWNA 2FI1A 4UDNA 6ABPA 1JILA 4BLSA 1U7DA 3LQFA 2C4VA 3LLCA 4LYEA 4D0NA 3PVCA 2HRQA 3PF8A 3UIEA 3IO3A 3E7FA 1XHFA 4IVRA 1FP1D 4UPVA 1JPVA 1ISSA 4XIIA 5H83A 3Q1KA 1WZ2A 3FGNA 4RL4A 1P4AA 3N28A 3BIOA 2BN4A 3WRXC 3CW2A 4QEDA 1HV8A 1YR6A 3H2KA 2HLNA 1VE6A 2Q9CA 2HHAA 3CEPB 4RFVA 3WKBA 1T5LA 3NVDA 2QUZA 3V4FA 3N59A 4S3MA 1X15A 1ITZA 3AZOA 3CEMA 2IBMA 1QG0A 3FYDA 4JSYA 4DNRB 2Q5CA 1VDZA 5SZHB 3WP1B 4B81A 2ZYTX 3CMMA 1XAIA 2C8KA 3E5NA 5C8YB 3DYVA 2FVXA 3O4JA 1A9PA 3TOSA 2OGUA 3G2JA 4FE3A 2REXB 3IH5A 3WLJA 4AU1A 3PNLA 3BORA 3F78A 4G07A 5CX1A 5EFOA 1RXIA 3TTYA 4RD1A 3GFGA 3VO8A 1ST3A 3ZE1B 3TPZA 4GX1A 4TKOB 2WMOB 3KSUA 4TS4A 2GVNA 2Q1YA 3A9RA 1GKKA 3IOCA 3URMA 3R7NA 1Z7GA 1FYFA 3TECE 4C7OB 3SBEA 3NBUA 1MPTA 1D2CA 1PSWA 4XKWA 3IQDB 1E61A 5F7ZA 3NBAA 5K8TA 3GRKA 3U56A 5TS2A 4E2XA 5JVDB 4IDHA 4RS4A 2FJUA 5B2FA 4NBWA 3KTOA 2XODA 3C7KA 3GFBA 2VT7A 3AEUB 4QGSA 3VZBA 4PYQA 2H2WA 2IYRA 3K0CC 3RSCA 3TLCA 3K1AB 3DMYA 4G4JA 3W6UA 1O57A 2GOYA 4C2BA 4O2BB 4JJ6A 4QODA 2I3GA 5BQOA 1WWKA 2W42A 1I4LD 3I1YA 3TR5A 1WZCA 3L0ZA 3OCZA 4PFJA 3UK1A 2B8WA 1UKVY 4A91A 2OAQ1 1UANA 3ZXYA 4I1UA 2VH2A 1UAYA 2JLRA 3NALA 4PXYA 5BVHB 4DV4B 1OC4A 1ZVQA 3TZCA 3EBPA 3B3AA 5DGCA 2WIAA 4F11A 5AW4A 1JLLA 3ANLA 3IVCA 4KX5A 2PSEA 3NTUA 4GFDA 2IP2A 3P2IA 3DKRA 5GONB 1GCOA 1QFXA 5IU6A 4PYIA 2OCYC 5CDTA 3DJYA 3G0GA 2B6NA 4NZNA 2QRQA 3CGGA 5BQ3A 1PTKA 3U7FB 3K3PA 4ENSA 2E5FA 1SO8A 4N3CA 4PQFA 3RJTA 2JFBA 1IOVA 3KUKA 4OXQA 3AV0B 3ITEA 3MMNA 3Q7TA 3RAPR 3TQRA 4BIMA 3OU2A 4M9QA 4KQIA 4HX2A 1PLJA 1RXCA 1XEFA 2CWWA 3A32A 3MJFA 2Z83A 4FHGA 1HR0B 2FSIA 1SY7A 3I5UA 3PKZA 4I2VA 1UZMA 2FSHA 3IAS6 1R8QA 5B2ZA 3V2HA 3ESCA 2XIJA 3PUKA 3ZBQA 2VFAA 3P2OA 1H6AA 3NH9A 1Q0PA 3JU4A 2GA8A 3IPLA 3V46A 4EPVA 1H8HA 5ABPA 3K73O 3K30A 2VG8A 4GPD1 3CINA 5AR1A 1ODSA 1XGKA 4QUHA 4ACBA 1G7RA 4Z3KA 1OV4A 1PX2A 2R60A 3TPFA 3UT5A 3GAFA 3HP4A 4Q48A 3UN1A 4ALNA 3PYXA 3VR6D 3WQQA 1E3QA 3RD5A 1ILWA 2BDTA 3ICQB 2CD9A 2BMEA 3UMSA 5EINA 4P53A 3KAJA 2V6JA 2WD9A 2ZU0C 1Y8RA 4UBJA 4H3VA 3GZTB 4RZIA 3H5IA 4Z86A 4ZYVA 5ICCA 3VH4A 1QV7A 2WA2A 3IKLA 4CG3A 1L5HA 1RKQA 2FMIA 2P5UA 4BN5A 1GZUA 3OOCA 3ER6A 4LJYA 5HPYB 2DT8A 4BEBA 2DFVA 2GBCA 3TOXA 4CM4B 3SQXA 4Q3OA 1F4VA 2RH4A 3ORSA 4HWRA 3DLTA 3GRUA 4RADA 2GXAA 5A0VA 4H1UA 3KJEA 5EKSA 1EESA 3L6UA 5IASA 3KD3A 1W0JA 1YZNA 3VPCA 3PITA 1VCMA 4IDOA 3DTTA 1GZDA 5GADl 3PTLA 3Q38A 3WYGA 3IQGX 1ZP6A 5EMKA 1VG9B 5SICE 2E5WA 3USCS 4GR4A 1GGJA 4Z4TA 1Z74A 3E48A 2M2IA 3P5BA 1KK1A 1JG7A 3GRZA 4KO3S 2Z43A 4ALJA 4MRSA 2CHGA 2PFKA 2UKDA 3FUUA 1QNFA 2BISA 1ESDA 1PEDA 5JXJA 3DCYA 4IHJF 4BNNA 5IVDA 5BXQC 3T1HB 3ROPA 1W2BB 4FYWA 2VT3A 4AJ2A 4BV9A 1Z6GA 3CO5A 2ZI4A 4M3NA 4UOZA 2WSSD 2WZQA 3GHHA 1OFHA 5A3QA 2QPTA 2C5AA 4UNSA 4FMDF 2G9NA 4WDRA 3F46A 4ER5A 5H4HA 2ESRA 3ZWWA 3PUVA 2I62A 5ESDA 1Y9JA 3H2JA 4NPHA 1DT5A 1JECA 4RDLA 2RAFA 4IXNA 3IAS1 5A62A 3DT6A 4S05A 1U1FA 2FW0A 4L7QA 4BEWA 2HD4A 2QLMA 3DXXA 4UPEA 2GVZC 5BXYA 2ZRIA 1N08A 1UOEA 2O2SA 2NUPA 2B61A 4IVQA 4ZHSA 4N49A 4HP8A 3UJCA 4GXTA 1PJSA 4DR4B 1PJ3A 1E8NA 3RRJA 3WDMA 3TNDA 5DLEA 4Y30A 1AQNA 2O1SA 2PJDA 4TLBA 3SQDA 1KP3A 3IRVA 3ZHUA 1I4EB 2Q49A 5KPDA 1ZN2A 2CB0A 3PE3A 4KMOA 3WB1A 5REQA 4J29A 4KPFC 2C57A 2IC5A 4N0QA 4Q4HB 3W5CA 3DTNA 1RYFA 1K8AD 1OIWA 2FR8A 4KBGA 1WEKA 4IS2A 3N1UA 1SVLA 4DHWA 5KYUB 4DDTA 2YZMA 1UQRA 1HZJA 4O4JA 4U39A 1CZKA 4NCJA 5KOJB 1TK3A 2FUEA 4DLPA 3VBCA 3C5HA 3B52X 3R3WA 3W7AA 2ZR0A 1EK0A 5ES3A 2QRVA 3WTBA 4EGCB 4NQRA 3HI6A 4XPZA 1IHPA 4FYVA 4NCAA 1QQ7A 5KYGA 3OF3A 4ZVNA 1L5SA 4XONA 3HKDB 1YC5A 4BTEA 5IM4F 1GZ5A 2G4LA 1ESZA 1XVUA 3RCBA 4TXNA 3TD9A 1ZSNA 5J4KA 4QBFA 1WG8A 3PDUA 3NETA 3HB1A 1VE5A 3GJ3A 4WNIA 1FYEA 5AKHA 5EJ5A 4C6TB 1C0PA 1VGRA 3PQEA 2R47A 4P22A 3Q7PA 4WN9A 1KEUA 1ML4A 1MH9A 1TZJA 2P4UA 4OA5A 4OQMA 2Q5LA 1AGRA 1DAEA 1K5DA 1Z08A 1EAYA 5G53C 2ZRJA 3KHUA 4TSKA 1FS6A 2RHGB 2VK4A 5G0SA 3D3WB 5KU1A 1KEEB 4LCBA 4NONA 1ZYUA 1QTQA 1S2IA 1YUNA 1P1CA 3VFDA 2KWIA 2X4DA 2JJQA 1Q20A 3CZAA 4PSAA 4KHPB 1X0VA 4R0VA 1IAVA 3HRHA 3I64A 1KYIA 4E94A 4MQ6A 4DCGA 1WTHD 1ZH2A 3I9V6 5BYBA 5HOEA 2QT0A 3PJRA 4I4TF 3LHSA 3M3HA 2WT8A 4OAQA 2B7CA 5AW9A 2Q29A 5J47A 3HKCA 1WA5A 8AT1A 2BDEA 2Q3EA 4QIHA 1GUAA 3WGHA 2GPJA 3BY1A 2BM9A 2I8LA 1KZHA 1YRHA 2I0FA 3EFOA 1L5MA 4HTFA 5IBPA 4YV7A 1MO3A 1OUMA 3DAGA 5HXBA 3A3NA 2VBSA 2AEMA 2O7SA 3HO8A 3RM3A 1WCWA 3FFAA 1IJFA 1B16A 2I7CA 4JA0A 3CWCA 3VDQA 3NTXA 3IIEA 4DM3A 2DWQA 3DDZX 2WKPA 1P39A 1WEHA 1E2QA 1P9LA 2A4MA 4W5NA 3GRAA 4P7GA 3V55A 4ZVSA 5ULLA 3SJBA 1ECJA 5E4YA 3RS9A 4ZI7B 2ZYVX 1SD2A 1TYDE 2JIBA 1CQWA 1UK7A 4GKVA 4LY9A 4JEUA 2GO7A 2OO5A 3DFKA 2QLLA 1XNRB 2ZE7A 3QUBA 1MRNA 3FNGA 5EUMA 1NX9A 1U1IA 1U28A 2YXLA 3HNPA 3J7AC 3A8TA 4DV0B 1KJQA 1R0BA 1QCDA 1U8CB 5DSTA 2DF8A 1Q14A 1F4PA 4HFNA 2C96A 3SQOA 5B7QA 1Q7GA 5L7TA 3EXHC 2VH5R 3WKAA 5KMGB 5ILOA 3D9QX 4I1OA 4I4CA 3I76A 3D26A 1X74A 2WIJA 2JFFA 4F2HA 4M37A 2GR9A 1S8FA 3KDSE 3ZQUA 4YIHA 1KI2A 5EQFA 2R97A 4DLWA 4G0OA 3C1AA 4U1RA 4HD8A 1QBKC 4QPZA 5J59A 3W05A 2HIMA 2BUAA 3KIPA 3VU0A 5C32A 1RKBA 3BTUA 1JN0A 4D8XA 2P75A 4NYJR 1ZI8A 1H5QA 5SY4A 5LU9A 4NX2A 3RQSA 4YRIA 1Q5PA 1QCZA 3GW8A 3U44A 4IRUB 1JQ5A 1RLOA 3DZKA 3FIUA 4L9SA 5EEGA 3U49A 3EY4A 1GZ3A 1NR1A 3PV0A 1KJWA 3STHA 2A5LA 3FYSA 3ZDRA 1QGOA 2VJIA 1ODKA 2OM2A 2BMDA 1I10A 2CYCA 1D03A 1DO0A 5TARA 1PQWA 2XSZA 3BFKA 5AKJA 2A33A 3FOCA 1P9NA 3D4PA 5LLDA 3COVA 1BIFA 3OZGA 4W6QA 2ZI6A 5JTTA 4B6SA 3DEFA 3TTSA 3UH1A 3LH5A 1TC1A 2BTEA 1DJMA 2C54A 1OI3A 3EJWA 3RRZA 4LGVA 1Y1LA 3LQEA 3KD2A 4DTCA 5IJZA 4BNKA 4NNOA 1CR6A 2PTHA 5JCZA 5JS1A 2VN8A 3BA1A 1P2DA 2C82A 2FPPA 1CDDA 2JGFA 2JB9A 3G5TA 4L08A 5DGTA 1GGNA 3K94A 3UUEA 1WY7A 3I6IA 5IMSA 2XE8A 1PI3A 4LJ5A 3BH4A 4TT3D 3ZV5A 2YZKA 2WWIA 4P93A 1E62A 2JFWA 2GH1A 2OHXA 5ENDA 4BP8A 1DZIA 3G89A 4ETMA 3E9ZA 4G81A 1NXPA 1H2RS 4B6EA 1G7SA 4PCLA 3GO4A 3T9FA 4KIGA 1TU0A 4JLSA 4XARA 4AFNA 3WZLA 3S3TA 2G40A 1W85B 4FONA 4HXEB 4Y6SA 2FWBA 3AF0A 5E3IA 3O82A 4MV1A 1S9HA 2YYYA 5H0IA 4LHYA 2J7KA 3IR6A 5JXWA 2A1TS 5SZJA 4D9KA 2Z57A 3KT0A 1W581 4BJ1A 1PL8A 1WV1A 2WILA 4EKDA 2NOAA 1OAOA 1S2DA 3KJGA 4QFMA 1BU5A 1UFVA 2RHLA 3RC1A 2GAIA 4KQXA 5JI3E 2ZZKA 2XW6A 5DN6A 1CC1S 2IOQA 4QQRA 3FOWA 2ORVA 3AJDA 1O96B 4TX1A 1DADA 3RQIA 3LA8A 4YJFA 3DR3A 5DMHA 1ZN9A 4KXNA 3GGJA 1TLLA 1N2BA 3GMIA 5DHUA 4BMDA 4XWOA 1CJSA 3ELBA 4QECA 1D8AA 4S1TA 3DFUA 1M54A 3GBPA 1E6MA 1U65A 1QUEA 2IYOA 2ZAIA 2XNKA 4KZKA 3CEAA 3K16A 4ZCQA 4GM0A 4AS2A 4AUNA 1Y0YA 4WWVA 1XQWA 5I7FA 5LQMA 1Y7IA 5ALWA 4DAEA 4NAHA 3W7VA 2H07A 3JR3A 3M9XA 4D4MA 4N12A 1TCUA 3Q2KA 1RLTA 2Q3MA 2HSJA 4WKGA 1SPXA 4EYQA 4DYDA 3Q0TA 4MMYB 3SHTA 2LIPA 2ZP1A 1JYEA 1RYNA 3C5VA 4WRRA 3THOA 4G01B 3LY5A 2RKOA 5HX7A 3ZS9A 1WUJS 1EM8A 4QVAA 2ZWIA 3CEJA 1HTBA 5H80A 5KSPA 1RHJA 3M81A 3KR0A 1AD2A 4RZ2A 2I6TA 3HBLA 1ND5A 4KCGA 2V74B 3PHJA 4N0DA 4QL3A 2VXCA 5D7BA 4ZJYA 1RMTA 1UBLS 2QNRA 1S4QA 4G5HA 3TW0A 3QFFA 4RKQA 4Y2RA 3EXHB 3PQ7A 2OOSA 2Z5FA 1QO7A 1WOYA 1QWSA 3LHFA 5BNWA 3ONUA 1YJ9B 2PKWA 1FP6A 3H9CA 4QWMA 2J4FA 5BWCA 1OV6A 1PJLA 3FI9A 5CK4A 4D9GA 2XVMA 2V3WA 4IFIA 4TVBA 1PSDA 1U31A 4F9EA 3QG5A 3U3XA 5BW4A 3EGCA 4XSGA 1GTSA 1FTWA 1XRRA 1H2ZA 1XTIA 2FWNA 3RS0A 3MS2A 3ZWYA 4RPCA 4XSVA 3EW9A 4W4TA 1YZUA 4OMDA 4A8PA 4LWZA 2ZJ4A 1VPLA 4I6JA 4OXIA 3OM8A 5ETJA 4D0RA 1CS4C 2XLBA 3O9VA 3QI7A 1S89A 5LZ5A 3L5OA 3V1YA 4BVFA 4F3KA 1NTOA 4BIIA 3UMMA 2CFIA 4LX0A 9MHTA 1E1DA 2QTMA 2I34A 3CKLA 1Z36A 2GN9A 2VLBA 5ERGB 1V11A 2R66A 2A3NA 2QBYB 1QC5A 1SN7A 5BN4B 2C8JA 2YDYA 3AEKB 3W4IA 3N2YA 5KAPA 4KQEA 4R9NA 4UM7A 3ZUPA 3MC1A 5FOWA 3UGKA 1JB9A 2X13A 3NGMA 1SKMA 2WWGA 3AJEA 5EA2A 2REQB 3IXLA 1U2SA 4G1UC 1O5IA 3H4IA 5LIPA 1Q0ZA 3RUEA 2BYTA 4OIMA 3GOQA 1J2RA 4UDXX 3LQYA 1QLWA 2FWJA 2PXAA 5IF3A 4M36A 1STOA 1ZGHA 5AOBA 3E81A 2WV7A 1G60A 1L5LA 5F7XA 3E3NA 4ND8A 1GAXA 4Q7MB 1X80A 2VK2A 3PNSA 3O03A 2V9ZA 2AD1A 2GSWA 4C01A 4E22A 1R7RA 1JSRA 4PS0A 2XYGA 4O4HF 5CEJA 2H52A 4WHMA 1SK8A 3STWA 1VYVA 2EF0A 2WIDA 3MJHA 4J1TA 1Y8QB 3DHVA 4PYRA 2WWVD 4JYAB 4RA6A 3IQEA 1OX4A 4X7PA 3RARA 4D4LA 2D06A 4RLQA 4V0QA 1T6YA 1MG0A 1U2GA 1GYRA 2OD2A 3C3AA 3MWEA 1EVYA 5E3HA 3IJEB 1P2TA 4YRCA 3OPNA 4BRUA 2PX0A 3K32A 3TKAA 2AJDA 2B5VA 1E9VA 4BFCA 4ESVA 2XYVA 3UPDA 2W2MA 2NPOA 8ATCA 4UHDA 1VSBA 4TYNA 1CNFA 1BGVA 1HRDA 5JXHA 2F3PA 2NU9A 4NOLA 4CTOA 3KSMA 2Q9BA 4OPMA 5K3FB 1N9ZA 1RHRA 2CMKA 3FLAA 1AUQA 1WDLA 2ECOA 2C7OA 5T3UA 1PX0A 1K7FB 1SZCA 4DV1B 1BHQ1 3U81A 1JHZA 1R4MB 4BFXA 1E4OA 4DQVA 3B20A 3DEJA 4LXQA 1ZRNA 2I7XA 4GO1A 5LYJA 4XLEA 1DIBA 2NUTA 5HEKA 2GEFA 2VRCD 3WIVA 1E18A 2DVMA 3IERA 3GA0A 3AR7A 4L3VA 4OJYA 1YUBA 4JH0A 1QOPB 3CSUA 2H06A 3GFOA 2GEJA 2IZZA 3PD0A 1XE3A 1CP2A 1UD2A 1LV8A 2MT9A 2IIBA 3NKVA 1N5RA 2K7ZA 1MAUA 4Y2GA 2FZKA 1HM5A 4I1VA 4BDTA 5FOXA 4ZPJA 1TUIA 4YAUA 1UUFA 1E58A 3B6JA 4OJMX 2VTBB 1UEXC 2X8JA 1P1KA 3G7NA 1PG2A 1N2IA 5LB2A 3EXG1 1LTQA 5I9TA 4LBZA 3ETEA 1U2DC 1JI3A 1TB4A 2C99A 3ASYA 3DAFA 4TUYA 1V8DA 3QE9Y 1PFUA 3L4SO 4FSXA 2WU4A 4YPFA 2PMWB 2PIDA 3DSRA 3H9QA 4HDKA 4HWKA 4KH0A 1SD1A 4PX9A 4U6SA 1M6HA 2FAXA 3KC2A 3H2GA 5I8ZA 1NN1A 2EKZA 1E6CA 1BHSA 1G3UA 1ZSVA 2FFHA 3KPWA 4L8JA 2C2BA 3OPVA 4BPBA 1LS1A 1KQOA 4JOCA 2JZNA 3RREA 1A9YA 4E5DA 1XTKA 1TM3E 3AQIA 1MENA 1XMVA 1J8QA 4KL8S 2FCRA 4IHJB 3SEZA 2VHZA 3C1OA 3TDMA 2LCIA 2QR3A 1TKRA 1BWPA 2R85A 3IE0A 1OR8A 5CYOA 4EELA 1LI5A 2IUFA 1ZRSA 4FMDB 5AM4A 2NZ8A 2BFEA 5LXTA 2FQWA 2VHYA 3TZQA 4NPCA 5KJ6A 1L8XA 1T1IA 4KLNA 4NYJQ 1T2AA 1XYVA 1FQKA 3NBQA 1MMFB 4PO1A 4B32A 4EHDA 4B48A 5JR3A 3RFFA 3ZE2B 1NM5C 1DBIA 4LK2A 1ES9A 4NFLA 3SD7A 2WPNA 4KV9A 4AZ0B 3VNUA 5KC8A 3LO8A 3F98A 1UH5A 2GZHA 1LVHA 3DW3X 5F78A 1P3DA 3T7IA 4HXGA 4AJKA 2NP6A 1N6LA 1Y6QA 5IJ9B 4WH0A 2UAGA 3KPVA 2NYAA 4AS3A 4QE3A 1FNDA 1NA5A 3G9QA 4L4RA 1OILA 5I5EA 4FBMA 4G8CA 1YT5A 9ABPA 1M74A 2JGLA 4RKRA 4X9XA 1YULA 4LRUA 1E7MA 1TXGA 2CLDX 2BONA 2IPXA 2NZYA 2WJ6A 1R15A 3BRCA 3PC2A 2WLTA 1D2MA 1GNLA 4QREA 4ZXFA 2AXPA 3AHDA 5AM3A 2H63A 4B4UA 3OJWA 2HBYA 5BV7A 3C5EA 3L79A 4YRPA 4KC0A 4C22A 3BC1A 3ITDA 4LQLA 3EUWA 2P2SA 4KW7A 1C3OB 3G2KA 4U7WA 2H6EA 2I3AA 4GUDA 2F1OA 4BJ5A 1CUFA 2DBRA 3RYFB 4B3JA 2E4ZA 3DEHA 4DIMA 1QYXA 1Q6YA 3S40A 2O0HA 4PV7A 5L3QA 2CHEA 3U3OA 1PT7A 1SKQA 3EC7A 2I6FA 4IDCA 3SEFA 5IEBA 2CYAA 2IDZA 4HDMA 3LRXA 1I0LA 1Y81A 2I3ZA 4GGPA 2BH2A 3BFJA 2BMJA 2VXYA 1YBHA 5D3MB 3UK7A 1F38A 2W8BB 3GLFA 4RY8A 2CCKA 4YRJA 1CJVC 3W2HA 1MXHA 1XCGB 5KWEA 3AIKA 3KDAA 3ECSA 4KHZA 1FUEA 2IPAB 4U7TB 4K8OA 1L5OA 5TPZD 2RDMA 1YVUA 4C3ZA 4OX9Y 4IW3B 1GPYA 2VJMA 2IV2X 5CFOA 2GK6A 3BDVA 2AF4C 5EPUA 4ZV9A 3MWKA 3FCOA 2IWHA 2NGRA 4P25A 4EFDA 4P1VA 4GRAA 3PTAA 3BMCB 3JVUA 3Q3AA 4U9IS 5DOVA 3H3XA 2X9NA