1GAWA

Crystal structure analysis of the ferredoxin-nadp+ reductase from maize leaf
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
304
structure length
304
Chain Sequence
PATAKAKKESKKQEEGVVTNLYKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGKIPYREGQSIGVIADGVDKNGKPHKVRLYSIASSAIGDFGDSKTVSLCVKRLIYTNDAGEIVKGVCSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEKHDDYKFNGLGWLFLGVPTSSSLLYKEEFGKMKERAPENFRVDYAVSREQTNAAGERMYIQTRMAEYKEELWELLKKDNTYVYMCGLKGMEKGIDDIMVSLAEKDGIDWFDYKKQLKRGDQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the electron transfer complex between ferredoxin and ferredoxin-NADP(+) reductase.
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase/electron transport
molecule keywords FERREDOXIN-NADP+ REDUCTASE
total genus 95
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2000-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1gawA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1gawA02
1QFJA 1QGYA 4FK8A 2BSAA 1IJFA 3CMEB 3AVXA 2YWEA 1N8RD 2PLFA 3OZVA 3E20A 2EFGA 3CB4A 3I55B 1KK1A 4UAJA 3CCSB 2BN4A 1TUIA 1FNDA 4C0SA 1XB2A 4RD2A 4EH1A 5H5JA 3WNDA 1Q86D 4N3GA 2OTJB 4RD4A 1VQ6B 3WYAA 3G4SB 1KRHA 4F7DA 4M1KA 1BX1A 3CCMB 4TMXA 5TV2A 3U6KA 2QEXB 1FNCA 5JBQA 2BF4A 2RC6A 2ZITA 2NPFA 3CCLB 1OB5A 1JB9A 3QFRA 3CMAB 1QGAA 1TVCA 2XNCA 1DG1G 1BJKA 3AVWA 1VQ5B 1FDRA 4PC2A 2BVNA 4P6VF 3WXMA 3CW2A 1YJWB 5H59A 4HE6A 2BMWA 1QUFA 3W5VA 3CCEB 1QG0A 1W2BB 2EIXA 5GV8A 5KSWB 2OTLB 3I56B 1NDHA 4Q7JB 1IJEA 4MYTA 1Q81D 4M4SA 1TLLA 3QFTA 4LBYA 3CC7B 3VNUA 3VNVA 1KJZA 4ACAA 1W87A 3E1YE 3OJXA 1VQ4B 1M1KD 3W2IA 1CQXA 1G7RA 2B7CA 4PC7A 2HCJB 3MHPA 1VQMB 3LYUA 1SM4A 2D74A 3LVBA 3VO1A 1ZM4A 1H85A 3LRXA 3W2EA 4B47A 1YIJB 3FPKA 1KTVA 3W2HA 1D1NA 2X3UA 2GQFA 1EP1B 2QN6A 4RCYA 3ES9A 3VO2A 2BGJA 3QFSA 1EXMA 5DSZA 1Q7YD 1OGJA 2YWFA 3ZBTA 3J81k 1W34A 4FN5A 4YAUA 1TTTA 1B23P 3W2FA 2OK7A 4DQLA 1ZM2A 3OZUA 1QH0A 3CCRB 4Y9RA 4AC9A 1D2EA 4PGOA 1KK2A 1GO2A 1DDIA 2OK8A 4G1VA 1I7PA 3CCJB 4TN1A 1K9MD 3B78A 4ACBA 4RD6A 1K73D 1BX0A 3OJWA 1F60A 3QFCA 1B2RA 4YHBA 4HE5A 2C78A 1G7SA 2DERA 2DCUA 3CC2B 4WQMA 4LBVA 3JQRA 3WBJA 1EFUA 1CNFA 2CRVA 3AVTA 1K8AD 2RC5A 2VZLA 1VQKB 3OW2B 1EFTA 4ZV4A 4BPRA 4B4DA 3CXCB 1XE1A 2VNIA 4YAFA 1CNEA 5GV7A 2BGIA 1VQOB 4TMWA 2FX3A 1QX4A 1NJID 1VQ8B 1JNYA 4K1XA 1BQEA 1EWYA 1F20A 1N0VC 1W35A 4QFMA 2BV3A 4ZCLA 1YJ9B 4YAWA 1N0UA 2QTLA 1QVGB 4G5GA 2BPOA 1UMKA 1U2RA 2GPJA 1ZUNB 3CCUB 1E63A 2DY1A 1FRQA 1Q82D 5HXBA 4PC3A 3CC4B 3JQQA 1QFYA 4RCZA 4M2LA 1OB2A 4IW3B 2CNDA 4RJLA 4QHYA 3G71B 3CRZA 3WNBA 3WY9A 3AGPA 2J7KA 1R5NA 3LO8A 1ZM3A 2QMUA 4RD0A 1S0UA 4Y7CA 4NCNA 1GJRA 1R5BA 3W2GA 1IB0A 1GVHA 1R5OA 3VMFA 3FJOA 3QE2A 1FNBA 1KC8D 1YI2B 1WDTA 3ZZUA 2C77A 1AIPA 4MYUA 1DARA 1GAWA 3OZWA 1VQPB 4LBWA 3WBKA 2DETA 2HMAA 3U6BA 2VNKA 2YWGA 5TR9A 3B82A 2B5OA 4FWTA 3PENA 1EP2B 1E62A 1YITB 2XNJA 4ZCIA 4YALA 5THXA 3V76A 4TMVA 2BM0A 4U9UA 3AVYA 1OGIA 3ZC3A 2XEXA 4B48A 3ZBUA 1GAQA 1ELOA 1EP3B 2AHOA 5EMNA 3JQPA 1A8PA 4AF7A 4TMTA 2R6HA 3MCAA 5TY0A 1QGZA 1G7TA 1S72B 3SJZA 3A1FA 1QUEA 1EFCA 2BM1A 3B8HA 4Y9UA 3W5HA 1FNMA 2B7BA 4B43A 2HDNB 4DQKA 1YHQB 4ZCMA 2VYQA 1HA3A 1H42A 3P26A 3CCVB 4RD3A 1QFZA 2DEUA 4ZGQB 1DDGA 3QSYA 4B3XA 4PC6A 4LBZA 4M53A 2E1RA 4YAOA 4G1BA 4P3YA 1G7CA 1KD1D 1KK0A 3W5UA 3P27A 1JA0A 4H9GA 3ZZ0A 3AVUA 1VQ9B 4M0LA 1VQNB 3AGQA 1YJNB 4TMZA 1D8TA 3U2QA 4N3NA 1VQLB 2QDXA 5AN9A 3ZZTA 4AF6A 3MMPA 4C43A 4B44A 1QVFB 3CCQB 3WNCA 2PIAA 1JA1A 3CD6B 2VNHA 4ZGNB 1AMOA 4PC1A 4R71A 1GR1A 2QTZA 4LC0A 1E64A 4NBSA 4RD1A 1KK3A 3I1FA 1J9ZA 4J0QA 1ZM9A 1VQ7B 2QA4B 2VNJA 1JJ2B 2PMDA 1FRNA 3G6EB 1KQSB 1M90D 3AVVA 1SKQA 3CPWB 2YWHA 5FA6A
chains in the Genus database with same CATH superfamily
4X92A 5J2TB 1UXIA 2CHVA 3BSSA 3Q6MA 3FMOB 1EBUA 2PT6A 1O6ZA 5H70A 3I6IA 1ORRA 1VPWA 1R3DA 4L4ZA 1P8JA 4LEIA 1D0VA 3ICPA 4UUAA 3RUHA 3AVXA 1E94E 2I1QA 3LCMA 4XR9A 4DNPA 1JKIA 3H1FA 2JIRA 4EA7A 5C9ZA 1U63A 3D2BA 1VJGA 2PMWB 5DE3A 1QKKA 2QL7A 3HKDB 4X1IB 3OUTA 1KEEB 4B8WA 1KK1A 1Z47A 1USIA 3ZHYA 2ZUEA 1R5JA 2OD9A 3DBHA 1UADA 3ZW9A 1BTOA 4N41A 4CETA 4QXOA 5DNYB 3ONFA 3ZJTA 3LLMA 1KJWA 3FUWA 4FW9A 4PNHA 1VJ5A 2V7QA 3HPRA 5LMCA 3PYXA 4W5RA 4N6NA 3UTDA 3ZWPA 3RWMB 1LV8A 1VLJA 2VT6A 3HU5A 3RABA 4JUBA 4ARCA 1KMHB 2Y2VA 4QX6A 5I3ZA 3KSAC 3LHSA 4XWKA 5KO2A 2VNAA 1FX0B 2F1OA 1Q86D 2VRNA 2WJIA 2Z5GA 3CYFA 1ZJ6A 2X9NA 3Q72A 1LLFA 2Z6BD 2XWJI 5DS0A 3BXZA 3T1QA 4B3JA 1T5OA 4MKHA 3Q3CA 3TZLA 1DRJA 1RXCA 2BR3A 2KQUA 3KQWA 4NH4A 1M6EX 1RPNA 1ZMBA 3E3NA 4K3VA 3EXAA 2UUCB 3PCXA 1WZ2A 1KORA 2FUCA 2EFJA 2O05A 2QTAA 3NNSA 4Q6BA 1DOAA 4R51A 2AX3A 3LPAA 4BN5A 3CM0A 2LV8A 4MTCA 4QQKA 2VSQA 4A8TA 4M1KA 1BX1A 1L7NA 4YMTA 1Z37A 2FG7C 1AD2A 2GPWA 2NGRA 1TVMA 3DZIA 4GMGA 4HAWA 4MUFA 4N0QA 4CTJA 3DL2A 1DCTA 3GZTB 5K3OA 1L5KA 3FNIA 1B76A 3HO6A 3IAS6 4NG5A 7AT1A 5KWEA 3TTYA 4BMPB 2BE7A 4OUDB 2PX2A 4E4TA 1EGAA 5LOVF 2DT8A 2V4UA 4J9UE 2BM9A 2I8LA 2VWGA 3W5BA 1G41A 4CHTA 2VLBA 4Y6SA 1SB8A 2GJAA 1YIOA 4TLEA 2WJGA 1KNXA 3E9ZA 4UHEA 5IARA 3TRJA 4YT4A 1JHPA 2VQ6A 2HXGA 1AUOA 1MO2A 2A9QA 2XB6A 4HRXA 2AJBA 3A4IA 1NUAA 2REQA 3D6UA 2ZJ7A 1VYVA 5TMDA 4PU0A 5G1NA 1QCDA 8ADHA 1JHQA 1ZRMA 3QU7A 5C8YA 3U16A 1HYHA 4Y1RA 4XGNA 1H4TA 3NIDB 3O9ZA 4C3UA 5IYZF 4BZWA 2ZPAA 2OMKA 3BSFA 4JBGA 4RK6A 4IOMA 2WKWA 2XGSA 4OXRA 4QRIA 5EIBC 1I9CA 3CF6R 4FVTA 5D5HA 5FFNA 1RBMA 3KD3A 3L7BA 5JH7F 1U81A 4F0JA 3BXOA 1VXOA 1L7PA 3A06A 3WXBA 2G76A 3OE7D 2VJYA 3X43A 1V71A 3OAAA 1KFCB 3GCDA 3IR7A 4J4BA 4JKOA 1L1EA 4ZO6A 2J3IA 4BWFB 1MHPA 2GCOA 2ORVA 5CCEA 2JHFA 3ZXUB 3W8FA 2RIRA 3ENVA 3W2IA 1L5HB 3L02A 3ULKA 4EKIA 1Q57A 1Y8ZA 3VDQA 3H9BA 3O92A 3LNCA 4P34A 4JR0A 1EUYA 3CBQA 3LYUA 2Z8YA 1RAEA 4FC6A 1T0JB 3RNLA 4TXMA 4XQEA 3OEWA 1N1MA 1W5BA 4KE6A 3TPZA 4CKWA 4DLUA 1DADA 5A03A 1LBIA 3KYJB 4QLAA 3TW6A 4MV9A 2AJLI 3GEPA 4HFMA 3TX6A 1T91A 2PS9A 5A2QA 2Y76A 1LJLA 3C0KA 1GPYA 1QO0D 1MOPA 3HQ4O 4FCCA 4ZQFA 4KN8A 3KYCA 1H4SA 4QM7A 1COWA 2PKXA 3ZLTA 5KOHB 2F1IA 5JSHA 1F3OA 1XG5A 5BYAA 4OHCA 5GONB 4F86A 1ZG3A 2HWWA 3UA4A 1YCHA 2CCKA 2VT3A 4WASA 3OWOA 1QGDA 1T25A 3QPBA 5FUQA 3IBGA 1M7HA 3UXHA 3SZOA 1NXQA 1ONPA 1VOTA 2C0CA 3DA8A 2XOKA 4LYYA 3ZPXA 5DSZA 4TT3A 4RVDA 2IUFA 3IQXA 5IS2A 4WPGA 4HFNA 1G16A 5JLAA 1T3HA 1V6CA 3CEPB 1TEHA 2R4TA 3ELYA 3FI0A 4MHOA 4NYJQ 4WK0B 1ULSA 2QE6A 3AEXA 4TSFD 4RVNA 4GLBA 4EW1A 3HGTA 3P5SA 2A92A 3PUWA 4NR0A 3B9RA 1QGOA 1QH8A 4DQLA 4N01A 1RVDA 2XTAA 4HCJA 3OQOA 4R1UA 4Q7QA 4QAQA 5E2AA 5KREA 5LYJB 1S8NA 3OBIA 2YFKA 1IDOA 3NEPX 4CKEB 4NCAA 3Q0TA 3EVDA 3ZK7A 2GXQA 2XF2A 4ENUA 5T41A 2BRUC 1XMXA 4P9SA 3OLCX 3VU9B 4E1BA 1BVHA 3VR3D 4CKWB 3BCDA 2XMSA 3LQ2A 2C4KA 2Y1CA 2QUBA 4YO7A 1NVTA 5G40A 3SQOA 3ZDEA 3CMMA 4M8LA 1NQVA 1U0TA 3B78A 2UZ1A 4PZEA 5B58T 4AFNA 2HF7A 3CUUA 3BICA 4UMFA 2LTAA 4RF5A 1NAHA 4M0CA 5HZKA 4QV2A 2AXNA 1MB9A 1OBFO 2Z2JA 2CMFA 3ME5A 4UJ3A 2HMWA 2CC2A 2WKSA 3PT9A 5HFNA 5A04A 5D5PA 2C3YA 4UE3S 2DKNA 2GFHA 3DMYA 3L7CA 4ESVA 2X23A 2XTJA 2OYCA 3HUFA 1FTWA 3WBJA 4PLTA 5AXDA 3L6CA 3K5HA 1RWVA 1WCV1 3RF7A 3RIEA 4BWVA 4HAVA 5HQTA 4BGVA 3CONA 4CDMA 4ZMRA 3HP1A 1SVLA 1ZJJA 4IIGA 3IKMB 2O1WA 2VATA 3L43A 3G17A 3ROPA 3URMA 1L4UA 1ST2A 2O0KA 4C2AA 2Y1OA 4DC9A 1WUIS 3CO0S 2GB4A 2CLEB 1EDOA 1MJGA 1QHYA 3IPRA 3M4NA 3ODGA 3I09A 4C7XA 5KNCD 3IKTA 3LWNA 4QM6A 2FJUA 4QZVA 2POCA 2W98A 2XDQA 4AICA 4A6DA 2AR0A 3AF5A 4KN9S 1NZDA 3D0OA 1OPXA 2X3FA 5F1YA 3QE9Y 3PKIA 1SZPA 2BGIA 3BSWA 4AY4A 4BNLA 1FFXB 1N3LA 1ZMRA 1UKBA 3EZLA 3I3OA 4I1UA 2ZYVX 2DYIA 2QMYA 4R1TA 5SV2A 4TVSA 4RK4A 2XRYA 2J0SA 4GPEA 1TJ3A 1UFOA 4EOGA 3T5PA 1D09A 1U6IA 1OWMA 1EX7A 1RDFA 1SVMA 2AK2A 2QNRA 1SN7A 4LJSA 4MH0R 2IHVA 4UQPA 2PO5A 2ZWVA 3FMPB 2XMRA 3MRTA 3C7DB 2OWEA 3M4JA 1W0JA 4FEEA 1EQAA 2GEUA 4X00A 2C04A 4XDGA 4O2BA 2FSGA 1GPJA 3K6KA 1Z4MA 2YC2C 1T43A 2AOTA 4FDLA 1JV2B 4OQFA 2P9ZA 2GJ8A 3LCJA 5F9FA 2EL9A 5JW6A 1FUKA 1PE0A 1IN5A 1Z73A 2HPVA 3GP3A 1ULAA 3MTEA 3W2TA 3B1FA 2OPBA 1GPDG 2QL5A 4RV4A 1SVUA 3T0GA 4E12A 1XRQA 2XD4A 1OMOA 4XFJA 2OR3A 4WWHA 5JJLA 1JP7A 2ZRBA 4QXMA 1TXGA 1YQEA 5BVHA 2JK0A 2XEDA 4MJLA 2YINC 5FPSA 5JBIA 4ZO9A 4DY4A 1HE1C 2R84A 1CJSA 2XVXA 3GUCA 3WK8A 3GLHB 4FN4A 2YJ4A 1LLQA 3AI3A 1LC0A 3HEBA 2VZ9A 3OF3A 4RLFA 5DASA 4ZT6A 1TZCA 4XRRA 4AI6A 1WSRA 2I1LA 1Y9ZA 1W2HA 1PNTA 4MB2A 2XYGA 5ER9A 5BUQA 1N1DA 2QTHA 3WE7A 2A88A 1HFEL 3D8RA 1VPTA 2IJGX 2H1OA 4W9NC 1KHTA 4RD0A 2WZCA 3MQ4A 4D57A 4OY3A 3FRHA 1E6WA 4L3OA 4P4GA 4CQMD 4NCNA 1BJTA 1LPBB 3NUQA 4COKA 4EI9A 5E1DA 2ZS9A 1NBHA 2BGNA 1RHRA 3LA8A 2A0YA 3IMFA 3VOTA 2PZFA 4HNUA 3PA1A 2QU7A 1XPJA 2ZRNA 1D2GA 1P4RA 4UUBA 2QTVB 2ZRPA 3OMWA 4BCCA 4AD8A 1O1YA 1XF1A 2ZTNA 1PYGA 1Z5ZA 2G06A 2JCSA 4P5DA 4Q3EA 2PRYA 4RKEA 1UPXA 4NQZA 4XM1A 4G5QA 2HREA 3LXRA 3RLIA 5E8RA 4AW9A 2DJIA 3HKBB 3EBPA 3M89A 2IYQA 1U2ZA 1L2TA 3OKFA 4QPDA 4UE2A 5JSQA 3U7RA 3W5JA 1NRIA 3ZE9A 3RGWS 2WWHA 4GBGA 4Q1EA 3ONVA 3ZUPA 4D6PA 4Z54A 1A9YA 4XQ9A 6AT1A 4DNQA 1U5AA 2F8SA 1XGKA 3TG8A 4EB3A 4EG0A 2IT1A 4RGBA 1QHSA 4Q47A 1B6RA 1DKUA 3DHEA 1ZJ4A 1V5GA 4RDCA 1HFKA 1LW6E 1NHGA 1ZIXA 2FSVA 2P4EA 3G7NA 3ITNA 3A32A 4G81A 4R2HA 1U2GA 5I5GA 2FETA 2R1VA 3TYXA 4WZ6A 3D7NA 3UANA 1DBRA 2OBBA 4IDOA 4BP8A 2IKQA 3ZHOA 1ESZA 2VHVA 1DAGA 4WFIA 4P25A 5EQJB 4R2MA 1E58A 2ZRFA 3C1UA 4CT0A 1M2GA 1O2DA 1E5DA 3R5HA 1DQRA 1Y3CE 1BS9A 5EWMA 1P18A 5G0SA 4MVYA 1WV1A 1XMIA 2GI4A 4RIGA 4PABA 1LLCA 3LH5A 3K73O 1A1SA 3F6YA 1ZPDA 2UYYA 3NHAA 2FX5A 3AZOA 3QG1A 4IL5A 5CH3A 1A88A 1I6KA 1IUOA 3WLMA 2D3LA 3GEMA 1DINA 3O74A 1HOXA 4JK3A 3PEYA 3ZIAD 5KX5A 4OP3A 3IP6A 3UGKA 3MINA 3H6HA 3K05A 3ZW8A 1N0IA 2BMEA 1NXVA 1R4NB 5IT9A 3MNFA 1Y5RA 4UHDA 4B9EA 1HLFA 2IYUA 2NO4A 1KDTA 1UOOA 1A8PA 1PP4A 4MUKA 4M1OA 3MW8A 4RAOA 3VX3A 4HT3B 4R2IA 3IA7A 1WSVA 1W5TA 3FPFA 3Q0EA 4FHFA 5HK9A 3MCAA 5CRIA 2VHZA 2PSEA 3MUOA 5GTDA 3GA5A 4I9FA 4P0PB 1SXPA 3MJHA 2GYUA 4A8JA 1N1GA 2JGNA 3NB0A 3BIWA 5BWBA 1V3VA 2VJOA 2G9ZA 4BTLA 2TECE 1KAOA 2CNBA 4LWPA 3SKYA 3TTSA 4JZKA 1YF3A 4EPVA 1X7YB 3PVZA 1WF6A 1X7HA 2O8VA 2QGZA 3QLJA 1XFOA 5DXAA 1Z7EA 3RAJA 3LU1A 4KEAA 4LZWA 1UK8A 3ANLA 1DL5A 1SD2A 2DBZA 1M72A 3OIDA 4G3XA 1YHQB 4DSUA 2RDMA 3JQ8A 2IYWA 1VL1A 5CM2Z 4Z8YA 5GQSA 2B2CA 5TRDA 4PR3A 3DG9A 4ATNA 2HR1A 5D2CA 3TBHA 2PD3A 1J21A 1BCSA 5CHYA 1N8KA 1ZA1A 1IONA 1UH5A 5TE9A 1E6UA 5LP6B 3P26A 1V26A 1L5ZA 2BEWA 3B5JA 3CC8A 3D3KA 3N86A 4XR4A 1FVXA 1IXYA 2EX1A 5KYXB 1G5RA 4G8DA 2HN9A 3MUFA 4Q3OA 5ED4A 4N54A 1W59A 2Q1TA 1N5LA 4Q6WA 3P0JA 4XR6A 3HI4A 5B7QA 5JADA 2RGDA 4WVFA 4AMGA 2Z9DA 3P27A 1DHRA 4AVZA 2WFMA 2CB0A 3AVUA 2FAXA 2YVAA 2I91A 1CU1A 4K28A 4Y30A 1JHRA 3BYZA 4RZUA 1NVGA 2W9XA 3GI1A 4FSHA 5ALPA 5ULLA 4CLDA 4BAZA 3TLMA 2GEDA 2C1ZA 3ZJVA 4I1YA 1T2FA 1DMRA 1U11A 4G5XA 5BORA 2LDXA 1XOIA 3OKCA 4NBTA 1DX6A 2Z08A 1HUQA 1VYUA 3FD8A 2D1SA 2AE2A 4X5OA 5JZOA 3BE6A 1R2QA 4KIJA 5DEIA 3SXJA 1T2NA 2Q0HA 3ELWA 1SWVA 2HFJA 4DLWA 2GKGA 2Y4OA 3IP5A 3GGOA 3NFRA 4X9XA 4BNFA 4B44A 3KQYA 5TPZD 5BXQC 1YZVA 2O2XA 2ON6A 1XDZA 1BRMA 4BZQA 4RVCA 1J39A 1Y6ZA 1K0UA 3OE1A 4K05A 4OXQA 3GA7A 4UMEA 4BFLA 3RTCA 1WMEA 4DDVA 1NUUA 5MDHA 3PHLA 2RGYA 1BAPA 1XU7A 4XYEA 4TKZA 3K70D 1SCUB 3DOJA 2YJZA 4HS9A 4JYPA 2NO7A 1D5CA 3UMBA 2L42A 4ZGNB 3GFRA 2CBXA 4BNXA 5F4MA 1Z4NA 1RADA 2ECPA 2O2IA 1QH1A 2VQDA 3K0CA 3ABIA 1CDOA 2GBIA 2VXBA 3HEMA 4GI1A 4GIBA 4IGEA 1GZ5A 2X0IA 2R7NA 2F67A 3MVEA 4MQEB 4NBVA 3VNBA 2ZUSA 4HDMA 4BBPA 2RIPA 1SG9A 1CERA 5JCJA 1S01A 5IYZA 3HY3A 3W0LB 1NZJA 3EW7A 3OU6A 4LXTA 1EBBA 4Q3BA 1Y80A 4M0UA 1U9IA 3I9FA 2CWWA 3DW3X 1J00A 4OK3A 1EUCA 5BQOA 1BH2A 1Y1KE 3V8QA 1RC8A 4MV1A 3MK31 4ISCA 4BMSA 2FPIB 3ILHA 2WHYA 3OQVA 4MMZB 1ECGA 1KO8A 2QLFA 5ELLA 5KYKA 2D2XA 5FQOA 1Z6YA 4KBYA 1IMOA 5JIBA 2DECA 2O57A 4HQLA 2OILA 1YDGA 4IYRA 1QFJA 2QLTA 3RVKA 3Q7EA 2EF0A 3B9PA 5FI5A 3UOWA 5I9MA 2VJBA 1EGQA 3PUNA 3RVLA 2BMFA 1RBYA 2OB1A 5AHWA 3ZR4B 5C8YF 5DT9A 4F2DA 2BEVA 1M6YA 1C7FA 2NZYA 4J29A 5F9MA 5BW4A 2WM9B 4CKCB 2F55A 4FDMA 3BIFA 3DCYA 2GBLC 2YKGA 3E20A 4DA9A 3E3LA 1EZ4A 3FNRA 2I7XA 3C8HA 4EG5A 4FZJA 3ICEA 1GFIA 4ETIA 4WY8A 1D6SA 2QR2A 2ZUUA 1VG1A 3KYCB 1NVFA 3PYMA 4KCGA 3TZHA 1RZUA 3UVEA 2FP3A 3ISXA 3NM4A 1FXWA 4QJ3A 1TUIA 4HQOA 4N7RA 2I54A 3FUUA 1JE0A 4NZYA 4DUGD 1TZKA 2AE1A 4ZI3A 1AQNA 4JMQA 1EB9A 1P4GA 2EFEB 2RJOA 3Q15C 1MRSA 3FUCA 4IXMA 4LYDA 3BF8A 4RD2A 4M7OA 4X94A 5FH9A 2R2AA 1SEVA 2JGFA 2M98A 4Y2RA 2HW8A 4EDHA 2WUDA 3UMRA 2ZXEA 3ZIUA 3DC2A 1LTQA 1ORWA 2NSHA 4ZZ2A 4V0ME 2I5PO 3BD9A 4IDGA 7ADHA 1C9DB 1E6CA 4FP9A 3HO8A 3BKWA 3CEMA 2ZVQX 4IUBS 4L57A 2VWHA 1N34B 4N6GA 2KYRA 4FSDA 5E1BA 5K3EA 1XMJA 3PXXA 5IAAA 2IVFA 3AUUA 3O9VA 2JJ8A 1SGWA 4MYCA 1Y8CA 3RR2A 1IJBA 4QQRA 3OZCA 2CNWA 2Q7XA 1UXHA 2OUKA 1I8TA 1YC2A 2C42A 2WIFA 1RJWA 5KIAA 1ISPA 4JI6B 4KLRA 3TB4A 4D9JA 3P2EA 1TIBA 4LZOA 3GT7A 5JNWA 1SKAA 5E9AA 1K7CA 4Z1MD 4GBMA 2WQZA 3BL8A 3HU2A 2R3SA 3PGVA 4OH7A 4QT0A 1R0BA 4ERXA 2A94A 2XXAB 1GITA 3GX1A 3DOFA 2ZATA 4HUJA 3U9LA 3WWEA 4TROA 1ZNXA 3BQ9A 4O1IA 2NPFA 4HAIA 5ELMA 4W5JA 4JUDX 5HJ5A 5EXSA 2VQEB 1OB5A 4DRXB 1C30A 4GX0A 3FNHA 1Z29A 1QGAA 2XNCA 1IJKA 5F2EA 3I5UA 4RPCA 3COJA 5J58A 3EMKA 2VBUA 3WXMA 2OCKA 4K26A 1I2AA 2ADMA 1X1AA 3L4SO 4HE6A 5F3RA 1SB9A 4DK1A 3QXHA 1UKAA 1VBNA 5DTQA 5T5QA 2EQ5A 3ZGZA 1R0CA 3G2LA 4S24A 5JMTA 2QD4A 4PFSA 4CM7A 3KU1A 1F2UB 4C7KA 2HMSA 2RGRA 2VJMA 1B8NA 5GV8A 1ZNYA 2Q46A 3O6VA 4J4TA 3EBLA 2EDCA 4BDSA 3I56B 1YZYA 3JZMA 4HH1A 4RORA 2X0EA 4MVXA 3WBBA 3ZY4A 1JFTA 1CC1S 1FUEA 1UL1X 2ZTHA 5E38A 2H2WA 1RKQA 4L8YA 4BVFA 2JGIA 2R85A 4BGIA 1OLUB 2RHOA 2MSNA 3PUVA 4EX6A 3STVA 1KJZA 3L8DA 3L8EA 4H6XA 4TQAA 1SQSA 2I4NA 3NVMB 3OEHD 4WTOA 5FORA 4ZYXA 1NI3A 3OURA 5B55A 5EJ8A 3LUFA 4GNRA 1P7VA 3DEZA 2IPNA 1W4BA 1AK1A 1L7AA 1LV7A 4LHWA 4XE5A 5DN9A 4JA2A 4YB8A 5L4LA 3TQFA 3CSDA 3ABQB 2JA2A 3X1XA 3Q9UA 2NNLD 2CJWA 4N7JA 1YS6A 4S1NA 3FJYA 1RWBA 4Z51A 3KTAA 4BV9A 4EG4A 2WQ7A 3VM6A 3HB1A 3RI3A 2WIKA 2Y4NA 1BQ4A 5JV5A 5IC5A 4RMIA 3RV3A 2BGKA 4HQNA 2AG0A 2RB5A 1PX2A 5CGZA 4YH1A 5C5EA 2RI6A 4MWBA 1OYYA 3A9TA 2RGEA 4EVRA 4A73A 2KLBA 2QA5A 2HU8A 1K98A 1EFKA 3SN6A 1GPWB 2ISSD 4NICA 2WHEA 4JHXA 4GSYA 1Q2XA 4QC2A 5HJ2A 2PNFA 3FNEA 2F1KA 3GDWA 2QX8A 4PQYA 3HADA 1E4EB 2QAGA 2IS6A 1EDZA 1YUNA 1H6AA 3RB8A 1QIIA 5H9WA 5C53B 1NY6A 3RM3A 3SBEA 3T5CA 3FPBA 3ZWDA 1KZGB 4F93B 1ONSA 1CEYA 3WLKX 5LU8A 3T12A 1SCQA 3GRCA 2HLHA 4OMFG 1MAWA 2TMDA 3KLPX 3FTEA 2GS9A 1EHCA 5DJ5A 1Z18A 3Q39A 1LK0A 2BFCB 3WICA 1HBJA 2G1JA 5K0ZA 2YHBA 3R7AA 1XYYA 4GC9A 3RC9A 1NRWA 4ZODA 1J8DA 3V2GA 1J24A 1LPAB 1S9HA 1T36B 2E7ZA 3LYHA 2BFNA 3RC3A 5G41A 4BVHA 5B2EA 3L6BA 5E6SB 4C06A 1U5CA 3ENZA 3PNVA 2DQ4A 2V7WA 1CYDA 1Q7GA 3K7EA 3QH4A 5B1EA 2JD1A 2G25A 5FRDA 4ZEXA 4J49A 5CA1B 1YZ3A 4IJKA 1UT5A 4H0CA 2FX2A 1UKZA 2W6NA 3GUYA 4PS0A 5K2MA 1KAQA 4NYJR 4MR7A 3RVOA 1QHEA 2C20A 1NXSA 3DMTA 4FM9A 3QUCA 2C78A 1GNPA 1FRVA 1X80B 4H16A 4MDYA 4PZUA 2O59A 1G42A 4G4SP 3SYRA 4KACA 2OCIA 1N7GA 1VZ3A 1E3WA 3FVVA 1SUCA 4R41A 5BPHA 3O2NA 5A0TA 1K8AD 2EV9A 3A1WA 1BMFD 3A9CA 5ISMA 3HXMA 3NCHA 2OHGA 4RMHA 1DCFA 3BOSA 1H6CA 2CN1A 3DAHA 3GDOA 4ARUA 1RKUA 1BCRA 4LFBB 1UDWA 2WVAA 3H13A 3GF4A 5IW8A 1QLHA 1M54A 3ASZA 2D7DA 3H2HA 2UVQA 4R1MA 1GGJA 2R5WA 4MA5A 1XE1A 2WJZB 4G4IA 2QG4A 5KTOA 1REQA 2QOEA 5BRAA 2WKRA 1C14A 1V16B 2EYQA 2J9FA 2PX5A 3IDSA 2QM7A 3TEFA 4L02A 2XJ4A 4B33A 5D3QA 2FPUA 5EE1A 4DV4B 2X8LA 2IZ7A 1CUVA 4DDKA 1JSCA 4TLCA 2J3QA 4Z7OB 1NOIA 2I7DA 4D8UA 2O19A 2QMHA 1YQ9A 1UQUA 2CNLA 4ZRDA 5GPBA 2WBLC 3EH1A 4NVRA 1VQ1A 3ZDRA 1HMPA 5ENVA 3K6RA 2ZT6A 3GCGA 3K6SB 4O4IB 4W9NA 3C48A 2Y05A 4P5EA 4YUXA 1MT0A 1NLFA 1PQYA 4FEAA 4IIYA 5DCYA 1K92A 4EHNA 3E3AA 4W5TA 1QBGA 2I9PA 1A9QA 2WW8A 4X54A 2GD1O 4KW7A 2ZYSA 2J5KA 4UU1A 3V2UA 2IHZA 3IKJA 4H2DA 3TR6A 1U0LA 4EWLA 3SE0A 1MU0A 2KSQA 2EQBA 3N0XA 2PYIA 3H5WA 2R44A 3AZPA 4HPJB 4OQQA 3N07A 3QJGA 5K0BA 1C41A 1UMCA 1EXDA 5DPMA 3SBOA 4KQGA 1HWYA 4Z2YA 1BXKA 1PJLA 2YC4C 4HZUB 2PFSA 3ENWA 4CKXA 2A14A 1VHLA 5JXJA 3C3AA 1KR5A 4MMYB 3PUYA 4CCYB 1VKZA 2IXTA 3WZMA 2ZTSA 1KAEA 4EITA 3A2LA 3ICCA 1GIAA 2C5AA 1M2JA 3WNBA 1VLZA 2NN3C 3GB9A 3KZOA 4HQFA 4MP8A 4UREA 4WZBA 4EFKA 4HKTA 1JFLA 1VKOA 2REOA 1S7CA 3TNDA 5LC1A 3GLIE 4IDDA 4JQOA 2IEYA 1YZGA 2QZ4A 2FW8A 2XOKD 3W7AA 4OSPA 1OX5A 4Z1MA 4Y0VA 4PLYA 4KWHA 3OFNA 4JCCA 2PJDA 4KSBA 5JYCA 1T36A 1PJAA 4Z9BA 4RQAA 3LYLA 1C3JA 1SVOA 2W8BB 3O03A 1GJRA 5JDIA 4INJA 4ETWA 2GZ3A 2HO4A 1NN3A 1VDZA 1WKVA 3I53A 3IAM6 4M9SA 4WV3A 3HFGA 1GGEA 4RSGA 3EF1A 1DRWA 2OHIA 5FTJA 1JTEA 1N9GB 3CJTA 2IZOA 5H16A 1EG2A 1NY5A 3GDFA 2HT1A 2TRSB 4WZAB 3MWGA 2O4UX 4AJ9A 1N2XA 1IK6A 2E87A 3IL2A 2DPLA 3QVLA 3IELA 2B35A 1DIBA 4WZAE 5F98A 1LC3A 1Y7TA 4QU8A 2X7XA 3EISA 5DLYA 4F5ZA 1H1DA 2J3LA 3OTHA 5MGNA 1R6DA 1Z68A 1FMTA 3CLRC 3EQ2A 4UXJA 1QK4A 2NUPA 2V7PA 3LUAA 1Q91A 3PPWA 4KGZA 4KNVA 4UNNA 5CT4A 3BMXA 3OCWA 3A36A 5GMOA 4HNSA 1HEIA 1IOWA 1FQJA 3UJ6A 1TC2A 4BV8A 2DTEA 4KR6A 2BKEA 3KNZA 2WIDA 1J1UA 5IAKA 2PX4A 4GRIA 1B1AA 1N5OX 2AG1A 2H6EA 5F1PA 4EAAA 2V58A 2FW1A 3VDMA 5J2UF 3GP8A 1D1QA 2R97A 1HZZC 5AI9A 2B8WA 4B85A 1E1NA 4LJ5A 5I7WA 1GFWA 2O5RA 4RWEA 1UBRS 2F1MA 3DM5A 5LIPA 4JLVA 2ZIUB 3A58B 4FOSA 5J59A 1GA4A 5B3JA 4ZTZB 4EA8A 5D85A 4R8VA 1N25A 5DGTA 2QRPA 4XPIA 3WIDA 2VSFA 4A6PA 1JEDA 1JQJC 3M49A 5ITZA 4FJ0A 4Y67A 2I4OA 1Y8QB 1INLA 1BJRE 2WB4A 3CO5A 5C5DA 3G2JA 5ALQA 4DSAA 1OLUA 4EM6A 1F9EA 5FT9A 3IBFA 3AILA 3WK9A 1OGIA 4MRAA 4UVEA 2BL4A 4AN1A 5EE3A 4R7GA 1UEJA 2FPGA 5JC8A 1LDGA 2Q45A 1L5LA 1Z07A 3TI7A 2ATEA 4DV6B 4V2IA 2UAGA 2QJFA 2YRXA 4D7AA 2YIVX 2Q3BA 4RGVA 4TM8A 5JPCA 3FOCA 4E4RA 4WBXC 2VZ8A 3VZQA 3PJFA 1YMVA 4AF7A 3ZY3A 4D43A 3I83A 4FFPA 1VCNA 5JAMA 1I24A 2VXYA 3FAKA 1KDYA 1QK3A 2F1RA 4TQUS 1WORA 3FCAA 5EKXA 1DBIA 1Q7TA 5FFMA 3OJFA 5G4KA 4MGYR 3UHOA 1L4EA 1RQLA 4QAJA 2HHHB 1LDNA 1XBTA 1E20A 4I4TF 3W8NA 2ZYGA 1XQXA 1I7DA 2QGFA 1XF9A 2VLIA 4B1FA 2TS1A 1KYYA 4RDLA 3QF4A 4TTAA 4ZEOA 3W6NA 1U8XX 1ZESA 3ZCXA 2QJRA 3AUAA 2DFDA 1NM5C 5CTAA 1U1DA 2QLNA 4IXTA 2YN4A 5GM2A 4EB8A 4G23A 1K9VF 5MFPA 5IN4A 1YRYE 3OC6A 1UOEA 4AYXA 3RVQA 4DQKA 1YRAA 4G9BA 4FS3A 4OREX 2PWYA 1LNZA 1QIKA 1SUWA 1Y1LA 1YS1X 3ND8A 2QQEA 3BMQB 5FJJA 3KVOA 1ACMA 1L4HA 1J23A 1HE3A 2KM1A 5FHQA 4BCDA 3G49A 1L0BA 2J6BA 4O2RA 2EP5A 3GFBA 1W7AA 4G7WA 4ZT5A 2INGX 3B20A 2SNIE 4D4GA 5IXJA 3UMFA 4HFJA 4D4HA 4DA8A 3UPUA 3UT5B 2LNDA 2ZZKA 4CF3A 3B1XA 3O26A 4TZ0A 1G7CA 4AJIA 4X65B 1N06A 4JI0B 1GSHA 3U7QA 1PHRA 1QR6A 1Z8DA 3BH4A 2JVIA 1QOZA 5DGHA 1MH9A 4DM7A 5K0FA 1VQ9B 4B2IA 3GRPA 4GE0A 3NG1A 4IDCA 3LGXA 9GPBA 2OO5C 1N2HA 4M0LA 4G0MA 2JGLA 2XMPA 2GO1A 5IXYA 4HV4A 4Q3NA 4CIAA 2JFQA 2PX0A 1VQLB 2WZQA 4GP6A 3RO7A 4QYSA 1UUFA 1ITZA 1H2FA 1NTOA 1Q19A 3MMPA 3TLGB 5FIUA 2PVPA 3H18A 3TW8B 2M6LA 1Y0YA 1H2XA 2VK2A 5BOVA 5LQUA 3RC8A 3NH9A 4L9WA 1PSWA 1XZBA 2VJNA 2H2AA 3I12A 2Y0DA 4QYMA 4PV7A 4UVHA 1H3NA 1Q77A 3GFOA 4G8BA 2HA4A 2QGGA 3V46A 3G1TA 3EGIA 4OJKA 5DISB 1UK6A 4O4JB 1JA1A 2BEVB 3WOHA 1J07A 4G63A 1RJ9B 3HJUA 1U8ZA 5KVSA 3GV0A 3L0ZA 1P75A 1PW5A 2W2VA 1ICEA 2KS6A 3OJLA 1LK7A 4UNPA 2J7PA 3QIVA 4BX0A 3I8SA 4OV6B 4ZHQB 2FV8A 1ONOA 2GVNA 3AW8A 3A35A 4IEIA 2JJQA 4ZGGA 2YFHA 1UBSB 1XTZA 3LDFA 5CT5A 1TKCA 5BN5B 4A8HA 1LU9A 3GWZA 2ZAGA 4GPD1 4ABTA 3CS3A 1VL2A 4FILA 4L2IA 4QGGA 1NP3A 3IDZA 1E18A 1KK3A 2UYHA 2BHRA 1XK7A 4LMRA 2DFLA 2YFQA 3EOAI 1RLTA 3RU9A 2O8FA 2J31A 4KNWA 1SVWA 1M8GA 1T8YA 2Y0EA 1EVIA 3JW8A 4C0LA 3VUFA 3D02A 5FPHA 5P8WA 2XUZA 2WVGA 2JD0A 4ARZA 3KBBA 3O4HA 3HM2A 3S70A 2A9OA 4MYRA 3DL7A 4X7EA 1SHLA 1TCVA 3TFWA 5FV4A 2EZ4A 3V4ZA 4A2QA 3FTQA 2VTDA 4JQZA 1SC1A 4DW8A 5AW7A 3A6GA 3DMTC 5HE8A 3SQWA 1CEXA 3DOCA 1I14A 1CG6A 1C9KA 3I9MA 1YVPA 2GDJA 3KZNA 4BO6A 1N78A 1PUXA 4ZYTA 1I3KA 1DT5A 2ZJ4A 1YRHA 1XAIA 4H1UA 4IHJA 5D1NA 5C8VA 1KIFA 1Y6RA 2PSSA 1Z13A 1BROA 3ETGA 4M9QA 1E69A 2E4AA 3TK1A 1WXEA 1K7XB 4P58A 5JDCC 4D9KA 2ICAA 1PTKA 3BGOS 1B3BA 4RVUA 1GM5A 2HHAA 2GHIA 2O1XA 2VHWA 3UEOA 2BFMA 5TVKA 4I1PA 2GD6A 3LUHA 4GXNA 3QEBZ 3H1AA 1YA8A 2X2FA 2EJVA 2QTTA 2YL2A 4FMDB 3HKEB 2Q29A 4II3A 1KC3A 1C7QA 3IE2A 3HK2A 4DLTA 2TYSB 3PWKA 4CVNA 1WBDA 2OV1A 3WAKA 1X6VA 3CIOA 4NK4A 3MPUA 4L0DA 4RJIA 4EABA 3ZUGA 1MRNA 3ESRA 5K6TA 4PEVA 4RHEA 2BT4A 5BSHA 5KYTA 3T1HB 2ZBUA 2XW6A 4KREA 3GQBA 1RABA 4DG5A 2HWYA 2WRZA 2ZIFA 3I1JA 4L08A 2XKKA 3B1WA 2QV0A 4PPQA 2IIQA 3WMXA 3WNZA 2V55B 5FOXA 5HDBB 1L5GB 2HU2A 3R77A 3F4BA 3FKJA 4LSWA 5LBTA 4DBZA 3GEEA 1J2UA 4FPXA 1MN6A 5DWDA 4A10A 1M0SA 1YFLA 4FKZA 1P9OA 1ZVJA 3D3JA 1U3CA 1AMNA 3KAKA 3CH4B 4U7PB 3KQVA 2N1MA 1DEOA 1N6KA 2VXCA 3DC7A 3ZY2A 2BD0A 2FG5A 4MXDA 3GL9A 4KQCA 4OU5A 2IQIA 1NF9A 2OD2A 3K8OE 5E3JA 4G5SA 4DNOA 1BA3A 1P6UA 2ETXA 4HB3A 4JEUA 4WUTA 3TVDA 1HX7A 4DSTA 2IZ6A 4Q4JB 4O1HA 1C3EA 3UN1A 4D80A 2A1IA 3I2GA 1YB6A 3HS3A 1NVVQ 5KAPA 5CDSA 1CE8A 1BJKA 3AVWA 4W1QA 2ETVA 4K6KA 4PYMA 2PANA 3CUYA 4MUNA 4YJ3F 3ETJA 2F64A 4E5NA 4L85A 1P0FA 1XQ9A 2VF8A 2F48A 5IAEA 3V4PB 4EARA 5HQJA 1Y0RA 3GH1A 4IHJF 4O4IF 4Q00A 2IYOA 3TIGA 2NYRA 4MIKA 1E2BA 1KBQA 3B6ZA 3DMGA 4D46A 3HJCA 3FRJA 1KI1A 1UPTA 1V47A 3V9PA 1P73A 1U0HC 3HCBA 1CNMA 1TMKA 3IAFA 5FULA 5T6BA 4EG8A 3DSRA 2H2IA 3ZCTA 2HIAA 1G291 4YJKA 2E6UX 2HQBA 1K7YA 2ACKA 1G8FA 3AJDA 4QGHA 2EKZA 3O0DA 1ZH0A 3E7DA 3G8CA 4U2CA 3U7GA 3BJZA 3TLCA 5E8JA 1TD9A 4G5HA 5EQDA 3BRWA 4YAIA 1KJNA 3T6KA 3VTFA 5IDWA 2CWDA 2IEIA 2ZJ8A 1UD2A 3P9XA 1V11B 4UNRA 4BGDA 1E3XA 3OQIA 2OV4A 4NPCA 2O8BB 2JB9A 1GPMA 1MORA 5HMLA 1E0JA 1RZRA 2D06A 1U9ZA 3BAFA 4N39A 2GCNA 3BRWD 4Z1OA 1OXUA 2J0VA 2H18A 1Y9AA 2HCJB 5CEJA 3OZIA 1GTMA 3QVXA 2ZXHA 3IPLA 4ZJYA 2Y0BA 3AH8A 4E3ZA 1I2BA 3GRRA 4AKEA 4EDFA 4D79A 4AJEA 5JAOA 4WN9B 4L5AA 4YCSA 2OESA 3ZCQA 5FUMA 3NGMA 2YXDA 4D9NA 4E5VA 4YCJA 4D4LA 2XTNA 4P4TA 1Y5NA 1CSEE 4HGQA 4NAUA 4YAJA 2KLHA 2XECA 1ISJA 4FWBA 4KRXA 4L4YA 5GVRA 5KTPA 1HT2E 1JHZA 5C34B 4TWBA 3ZQ4A 2R8OA 2ZULA 3SGLA 2VBVA 1OFIA 1VKNA 4DT1A 2Q5LA 1TAUA 3NUZA 4FR5A 1RYEA 2EBFX 3FYSA 3EF3A 4M0DA 3I4CA 3KEWA 4QYXA 4O4LF 5BSXA 1LSJA 1PR5A 3TOCA 1NHWA 2OFXA 2W6ID 3KOOA 5EPOA 1L6IA 3KWLA 4JMLA 1XD9A 2VSXA 2ZJBA 5CDUA 1ZXLA 3AKYA 4D25A 1CF2O 4EFNA 3UY4A 5AIBA 4HDNB 1U1IA 3UH1A 3A11A 2PT9A 3U1TA 1T3SA 3GZNB 1OH8A 1PJTA 4Y18A 4DV3B 3M6VA 4M1YA 2W2PA 4OJYA 4XXHA 3OOYA 1YDFA 1QG4A 2GUGA 4GRAA 4RIIA 3UC5A 1QJCA 3EPPA 3OZTA 3L0OA 1FTQA 3CQ9A 3RSOA 2R0QC 4Q3AA 3RVDA 4MYHA 3ETNA 5TEWA 3MHTA 2PPVA 3N2GB 3STWA 4BQNA 1NJ1A 1G3IA 2CFOA 2ZT7A 4O6VA 4KH0A 2VPZA 3WWPA 3LQRA 2TMGA 3IH5A 4DEYA 4X06A 1UXGA 3RYHB 3ZCPA 4BEWA 2I66A 3KTAB 2OVBA 4Z4YA 4GNKA 4PLCA 5LDDC 3MJVA 4POAA 5AWFC 1QKJA 2D00A 4ZV9A 2DWUA 2CMHA 2X6TA 4MUYA 2P68A 3QWFA 4GH5A 4KQ6A 4R4JA 2X6QA 4NFHA 3OJWA 4OYYA 1XTRA 2HK9A 1YT5A 1FLVA 2WHXA 3DO6A 3IJ5A 3K1ZA 5AP9A 4I3HA 3L8YA 3V1UA 3U7IA 1ODTC 3MWYW 3DUFB 1P2SA 3MQ2A 4H7EA 4LBVA 4EYKA 1Z26A 4MK4A 2GAAA 4YO8A 2W2QA 1NYRA 2BGRA 4JC5A 1ZNZA 4JH0A 2GILA 2RGNC 1P4MA 3SICE 2ARKA 2VBTA 4EVQA 5HW0A 4RXTA 3GLFB 3O75A 1GYQA 3OPNA 4NJOA 4PYKA 4TRRA 2P6RA 1CX9B 3B6MA 4FYMA 1ZKDA 3EVBA 3PTAA 1UDRA 4RDIA 4Y2VA 2Q21A 4ZZ0A 1ZK2A 4MIYA 2NSDA 3EZYA 2VG8A 2WF5A 3WTCA 4EMTA 3DEHA 3HPQA 1AQLA 2R8EA 1K6IA 1ENOA 1YKFA 2DOKA 4C20A 5IUNC 5GV7A 3FTDA 1N2CA 4ZT4A 3PXCX 3FHLA 5IVIA 4EHBA 3U1BA 3VV2A 1XMOB 2PY6A 4R3UC 1E9RA 3COPA 1YRQA 2D13A 1FFXA 5AM2A 5KTSA 5LBIA 5CA0B 4OHWA 3MN1A 2C9OA 4FJ1A 4KUEA 4C4SA 1ZOOA 1FS4A 4FQ5A 2XOXA 3QHPA 4PHCA 4D81A 4MUXA 4PLVA 1VG8A 1U04A 4F12A 3D1LA 3NTVA 4MDHA 3V7UA 1E3JA 5KQSA 1I6LA 3IDAA 1OFGA 2IHTA 2J45A 3BWBA 4N7BA 4NAHA 4Q02A 3VPHA 4EELA 5KQGA 3JQ6A 4GMDA 4Z4SA 2P9QA 3TQQA 2C3UA 2AKYA 2KPOA 3PITA 4CV3A 1ANKA 1NMYA 3B52X 1HR0B 2K6GA 3HM9A 2BLLA 1B16A 1HSOA 1IQ0A 1J42A 1JQEA 1ULZA 3FZNA 4YV7A 3O8RA 1FLDA 4IIJB 2Q41A 4P12A 1Y7HA 3KQTA 4W8OA 1YU9A 3UJHA 1HRKA 2FZVA 4BNHA 5BQ5A 1JR3D 4O2AB 5JH7A 3BMOA 1JIVA 1Z0ZA 1Q6ZA 3PB3A 1RYFA 2Z5VA 1LKZA 3GLTA 3SEZA 5JMWA 1WS6A 4S0ZA 2UZ1B 4R2JA 3VR6A 1KU6A 1LX6A 1YH3A 2QW1A 4D8TA 2GBCA 121PA 4UHFA 1K8YB 3DEJA 4OK6A 1U98A 5IDQA 3WL4A 4GDMA 3CT4A 4IIVA 1YQWA 1QZTA 3PQ6A 3TG2A 3OD1A 4IRXA 2GPYA 1JG2A 1Y98A 3FCOA 3WAJA 3FHCB 5CT6A 1M8FA 4HDRA 4DY6A 1PKXA 1MJNA 1BYUA 4TKOB 2OBXA 1WMAA 2WU4A 3KT8A 1QH8B 3BD8A 3T53B 3KDAA 3K6JA 1F48A 3IX7A 1QP8A 4WY2A 3VZBA 1YRLA 1VLOA 4HPXB 4HN9A 1MFZA 4I4TA 3F49S 4DMGA 2PA3A 3FFWA 4CL0A 3LIIA 1N9KA 2WHPB 3RS9A 1YCGA 4C4ZA 1VIDA 1WXHA 5HEKA 5FTLA 2HUNA 2Y99A 2WHPA 3PEWA 3GGDA 4W8GA 5EIAA 4R01A 1RYNA 3RFVA 3R2JA 3CLUD 3NT5A 3ZNOA 4DJTA 1QF6A 1HQYE 2CFIA 3PGXA 3OUZA 4DJJA 4ER0A 1OFHA 5B6JA 2FZ4A 3NXKA 3NHWA 4EKYA 3AIKA 4XKVA 2G40A 1TK2A 2CDAA 3PWTA 4RH1A 3UWKA 4B83A 3W3AD 2HDHA 3FTFA 1TGVA 1C7EA 3GRUA 4MP3A 4KR0A 5H82A 2ECQA 1XTVA 4Y2XA 4B6GA 1O7JA 2NSLA 1S2GA 2CF6A 4ZU3A 2DWPA 3BXXA 4DIEA 2VNKA 2GSWA 5IKPA 3JD4A 2H85A 3H9NA 2JKVA 3ZVLA 1OXBB 1S7GA 13PKA 1O89A 3AR6A 2YWCA 2AFVA 3TQSA 4QLBA 3WFJA 3IURA 1YJ5A 4F9FA 3TDNA 1E62A 1TCUA 2VJCA 3ZEIA 5CFNA 3UFXB 2YY7A 2I6UA 3IDFA 2EIHA 3IESA 1KSHA 5K0LA 1E7WA 2HRCA 4I1VA 3GBPA 4HH4A 4EJSB 1JDBC 1G8PA 1Q3HA 3HN2A 3USZA 4YMVA 2PMFA 3A2KA 1BYIA 2EHDA 2QYOA 3A9VA 2F8MA 3F46A 1OT5A 4U9UA 1EGHA 3AVYA 1YZQA 3KK0A 2WOOA 5AJVB 1AY0A 4O02B 3ZC3A 3ZIDA 2PJRA 3AUXA 3JWGA 2W2KB 3ZBUA 1W4CA 2H1FA 2CFSA 3H1PA 1MC8A 3R3JA 1YR8A 4G4SO 4AUMA 4EZBA 4PG6A 4F5DA 1XVUA 1LCIA 4C6HA 1MAAA 1XEAA 2AK3A 1YJAA 3NBYC 5AVKA 2Q2OA 3E4DA 1U02A 1GKLA 4ENVA 2SHKA 2WSBA 3R41A 5H83A 5LU9A 4KWTA 3IOYA 2YXEA 4PWZA 5E7IA 1XTUA 3TS1A 3FWPA 2B7LA 1GYRA 3WYFA 1Z0KA 5FA5A 3VO9A 2OGSA 3OIGA 4I9UA 1ZBDA 3VC7A 3FOAA 4XD7A 2B5WA 4KG7A 5EERA 3TN7A 1GOTA 2JIDA 4ZT3A 2B1JA 4L9SA 4RQBA 5BR4A 1NYQA 1FDUA 3EQ6A 1XZMA 3SAJA 4F21A 1K3UB 2GN9A 4C3ZA 2PKRA 2B7BA 1T2CA 1IYZA 2AR9A 2HEGA 3F5DA 4WD3A 3SK0A 3TOZA 5JYBA 2B8NA 2WUVA 3OX1A 5DB4A 2C9BA 3K31A 3GMTA 1QVAA 1USKA 2JFBA 1V8BA 3GIDA 3MTAA 4AF8A 1P2GA 1XTJA 1BKSB 1JU4A 3NUGA 3JQ8B 4NYMQ 2BGMA 4A15A 4FFLA 3EXIB 4HAYA 4MRRA 5KNDD 3RUPA 1W5AA 3JQGA 3L8MA 4RVOA 1II9A 1DTWA 4DIOA 8OHMA 2QTRA 3S2EA 5EXDA 4YHHB 1PR6A 3EASA 3D8SA 4I7EA 4C5AA 3VPAA 1YB2A 2VZEA 1KD1D 2FZWA 2HV9A 2CSXA 1R0WA 2WNHA 3KEQA 3D6VA 1QCCA 4KZKA 4MRMA 3UC9A 1PJQA 3IEMA 3DDYA 1FX0A 2EBHX 3EIXA 5EP3A 2ZAOA 4TMKA 3PE4A 4U2EA 1SKUA 2ZIXB 2O8BA 3QEJA 3KELA 4XVQA 3B7PA 1JRLA 5D5QA 4D9FA 5KU7A 1EJ2A 4AS1A 1S3IA 4MPDA 3VAYA 3N2GA 1NVBA 2ZL6A 2F17A 3BWMA 3BMCB 4G4JA 4MKIA 3WKEA 3AT1A 4IP0A 4CHGA 2HU5A 2PBZA 1GZHB 3QFFA 2Q3FA 2IS4A 1T24A 2OLKA 2JKYA 3UICA 3ZH2A 4LSZA 4RTJA 5CLHA 3K70C 4FGLA 3CCQB 1YE5A 2W71A 1FTSA 3KYIB 3JYOA 3T3IA 1KBOA 3VPBA 4BV2A 4CDGA 3CKLA 4HDNA 4CFSA 2VYVA 3I0NA 1MVNA 3NM6B 2ZI9A 3ECCA 4RABA 5L6MB 3N2EA 4JQYA 1IY1A 4JXZA 1V39A 3EUEA 3IUQA 3NKVA 1FDTA 5DYWA 4GKAA 1NA5A 2I62A 4ID3A 3K5IA 4NONA 5JHHB 4LW8A 5KVVA 3N0VA 1C9EA 4MKZA 3V4VB 3G05A 1R6TA 5F21A 5HRCA 3QPDA 4Q3CA 1KJ8A 3G8BA 4RTOA 1N0WA 1CE8B 2Y1GA 3KB1A 4XAQA 4KIUA 2WZNA 2WJ3A 3PJRA 4I36A 3ICQB 4XOTA 3C4VA 3ZWAA 1TQHA 3T7KA 2H4WA 3ZWQA 2IOQA 3L77A 4B09A 2JNWA 3RIXA 4ZDIA 3AZQA 4NZPA 2NSJA 4XJVA 5HA5A 1T2VA 3ORSA 1FF9A 1BZYA 4ZVUA 3BS4A 3O8DA 1I1NA 3Q8KA 4OMCA 3KFLA 3O82A 4YN3A 5A7HA 4LXUA 3D3WB 1L8LA 4C03A 4EB6B 4EUHA 2PZBA 4EI8A 5EXTA 2VP4A 5EHIA 2DGDA 2NMVA 2BP7A 2MSKA 4B7AA 1PFYA 2E5FA 3RPEA 1DV2A 1SOMA 4TV8F 2RK4A 3OZXA 3PHIA 2GZSA 5KX5F 1T3ZA 1C8LA 4WOBA 3STUA 1QIEA 1U3WA 2ZB7A 3CEAA 5C80A 3REGA 4OIFA 4P1VA 1PGPA 3MZ0A 3P9PA 1JG7A 4GWLA 4HWGA 3N5KA 2ZWMA 4I9HA 4CMCA 4HGYA 1NLYA 4DQ0A 3HXOA 2PL3A 2XYQA 3J81A 3KFVA 3VZDA 3AHFA 3ZDQA 2C4WA 3LSYA 5TQ2B 5BYJA 1V1MB 2AI1A 2R25B 3AO0B 2FHSA 1SZJG 1K2WA 2WJJA 3L8CA 4JELA 4KE7A 3OA2A 1D6JA 1EE9A 2C2BA 3BMCA 1N6RA 4LQCA 1XB2A 3HE3A 3WQQA 1XXHB 1C3LA 4HATA 3SE7A 3A1PA 1ZM7A 1KFKB 2ZIXA 3F3SA 3EX7C 2O8NA 4YRJA 1GPBA 3ET4A 1QIJA 3ORHA 3WNDA 3QKSB 4TL6A 5I7EA 4RW0A 4C6RA 1PNVA 3HUTA 1I1HA 3PICA 4QBHA 2FVGA 4BOYA 2WLTA 4GL2A 3UB2A 2YOHA 4IH1A 4DGQA 4FMPA 2CK3D 2QAGC 1NUTA 5HTOA 3MXTA 1V3UA 2WTNA 3ACBA 4C87A 5IDXA 2RHGB 3GPIA 1NVXQ 2Z8XA 4KJXA 3L0CA 5AESA 2FJ0A 3TKLA 2PSFA 1U8EA 3RS2A 3VDNB 3CF2A 4PRZA 5J5AA 2P4SA 1PQWA 4FFRA 1KZHA 1ZD3A 4UEQA 3SZ3A 1SU4A 3WIBA 4X90A 4Q1CA 1P44A 5REQB 2X9LA 3GLSA 3FGOA 3DYBA 1HG0A 4YRGA 3VR5H 1S8AA 5NULA 5LYJF 4DKJA 2HMYB 1EIZA 2W5UA 2BF4A 4GT1A 4U6SA 4LF8B 3VC2A 4OHVA 1NPDA 2OHHA 3ZOZA 4RK1A 3QFRA 2WP0A 4NX2A 2GEJA 3ZLBA 4V0MA 3NORA 4X64B 1YB7A 1JJBA 1VQ5B 4MZXA 3QMVA 1W96A 3RJZA 1RI3A 1CWUA 2GCPA 3UJPA 2M6KA 1XP8A 3KSMA 2ZETA 2Y3IA 2IBSA 5DTMA 3L6EA 1GRCA 3D3EA 2J0UB 3T9AA 3VHRA 3TGLA 4FDUA 2W48A 4NCKA 1G3RA 4PINA 2Q28A 3FDXA 3DQQA 1ZITA 2B4RO 3E3MA 1WU8A 5FAKA 1BMDA 4A0SA 5JAUA 5JSZA 3RAPR 3VOAA 2XGJA 3GJ6A 5DO9A 4MA0A 2PO7A 1J1ZA 5AW5A 3B1KA 3S2FA 4FNOA 3H5OA 3G5UA 5EYPB 3NDBB 2BGUA 1TAQA 1XAHA 3DFKA 1PJZA 4PGHA 2ZROA 5CCBA 4WGGA 3WSWA 2ZM6B 3ICWA 4DCSA 1EI9A 4DIDA 4DDUA 2IGTA 4RL6A 3BJMA 4OHUA 3PGMA 1DB3A 4YXWD 1AXEA 1PVOA 1YKSA 2Y77A 4BNMA 2OP0A 5IH3A 4C5CA 1GCAA 1X0XA 3HV0A 3IALA 2XNHA 5EJ7A 2VCYA 5HFAA 5BR1A 1G8MA 3JR7A 2ZQ5A 1JG3A 1X1RA 5I45A 3GLUA 5AVWA 5AM3A 4I50A 1T1IA 3AYZB 1VCOA 1OI4A 4PO8A 4BATA 3UT5A 4F5YA 1EJ6A 3ROTA 3CG4A 5LXTF 2CNOA 2JCVA 3KPVA 5C3UA 4A5SA 3Q5GA 4KQEA 2NUTA 1W73A 4CMGA 4ASUA 3WLEA 4FMBB 1QRUA 1KYVA 5E9QA 1SQ5A 4Y2GA 2XBMA 2Q50A 3KT0A 1GPAA 3V1LA 4JC4A 5E0KB 3WHLA 3WMGA 4AXXA 4KMRA 2ZPUA 4TVBA 1L6RA 3MJTA 2B6HA 5K0EA 2HTFA 1AKNA 2CCJA 2I9KA 1ECLA 2NVOA 4B46A 2I4IA 2IOYA 2YZ7A 3OJEA 1SC3A 3GJZA 4DF3A 1LXCA 5A7FA 1ID1A 1OAOC 3VR4A 4V1CI 3OMXA 2B4KA 1S8OA 5C0OE 1PJBA 2XNDA 4LE0A 3ZBTA 2GK4A 2V5UA 3OZDA 4GEGA 4QUAA 4HX5A 4M88A 3LT5A 1K88A 3KKMA 1F0KA 4R7ZA 1V45E 2PLNA 4N3BA 5GONA 4DHWA 2VBSA 2JH3A 5AM0A 9LDBA 3N8NA 2QVXX 3RFFA 3U26A 2X1VA 1JBKA 3ZE1B 4IVPA 3DWGA 1DKOA 1XVLA 1E3SA 1EWRA 1DTSA 2NO5A 1RKBA 4P4UA 3MILA 3UJ9A 3PKZA 1KK2A 2OAEA 2GJRA 2RHHA 3PFBA 4AM8A 4DCPA 5LM3A 4OLHA 1VFPA 3D7RA 2OHOA 2WWYA 1XLUA 4BRUA 3VVLA 3B6EA 5CJ2A 2IU4A 4R8LA 2L18A 1LZLA 2X5KO 5J4KA 2B5VA 1PWEA 2UXCB 5BV7A 3FHTA 1FP6A 2Q5FA 2XB4A 3SG0A 2PZMA 2X6XA 2J67A 2UDPA 3CKYA 4CM9A 2C9CA 4ITRC 4OX9B 5CW2A 3D26A 5LLSA 521PA 3I04A 4KE8A 1CFJA 2Z83A 4CMIB 3K0FB 2H5LA 3NBXX 4EGJA 1JXOA 2IYXA 3A28A 4J0JA 4RHTA 3TL3A 1AM4D 3K9BA 2JI6A 3INGA 2I3ZA 4EG7A 3U1VA 1DMSA 2CVOA 4YAEA 1QM5A 5JARA 3GIRA 5EI5A 3IPXA 4U7JA 2ZSIA 4HQ0A 1KEVA 3BFVA 2IK8A 1BC5A 4INOA 2OCBA 2OE2A 4HSGA 4B79A 4IWYA 1K66A 1M2KA 3ORQA 3RK4A 2AFIA 5HUJA 1ESDA 2O0HA 4IMJB 3WGIA 4BPRA 4B45A 3NGXA 3G2KA 5JD3A 4BRZA 5JCPA 3IDOA 4WK2B 3NBQA 5DI9A 2YTZA 2BCJQ 2CDNA 5A1TA 3ZBPA 3B1ZA 3CWCA 1I5RA 3KC2A 3A9SA 3CTPA 3AQIA 4HGOA 3ZHBA 4PO1A 2H51A 3JZFA 2BI4A 3CF4A 4TMWA 2V6FA 4N0MA 1QE5A 5B1DA 1A9XA 3Q8MA 4GL4A 1XZJA 4QT4A 5B1YA 1W9HA 1C1DB 1UD4A 4Z3KA 1EWYA 1E1RA 2PGNA 1US8B 4AZ0A 5KSYA 3QXCA 4WK4B 5JSKA 4DLPA 4C4YA 5U9CA 2BMJA 2E37A 2J3KA 1JR6A 3AIIA 3RGGA 3KETA 1Q12A 1KMNA 2NVWA 3HA2A 2BPOA 1FRZA 1SA0B 1V6AA 2VL7A 5HKKA 3H2BA 4WI1A 4KPFC 4K6HA 2YJNA 1E1YA 1PTJC 3EZ7A 1N4DA 3KJEA 4RZSA 4MLDA 5IBRA 1ZLYA 1PT6A 4B6RA 5HCNA 4U7DA 4BVKA 1OWLA 2X1HA 3G6KA 2D5AA 4FE3A 5FI3A 3X0DA 2FN4A 3K09A 1CQIA 4JT2A 5TQVA 3EOBI 2K2WA 2Y1XA 3QITA 4ZDKA 4BWGA 5C7IO 1KZ7B 2LE0A 2ZSAA 4TS4A 3H87A 4WXPA 5TPZA 5LLDA 4GBJA 3KLBA 3OU2A 3E35A 5TQJA 3NIBA 4TTPA 1WP4A 2RHJA 2D8MA 1KARA 4RJLA 4JHLA 4UASA 1DI0A 1T8RA 1N77A 4IIXA 4AZWA 4FE7A 4DQVA 4PO3X 1TF2A 2PH3A 3IAS1 2ID7A 2J9ZB 2NPIA 3LUPA 1SZDA 1XU4A 3OKPA 4JBHA 4MWCA 4CG3A 3MJEA 2O8CA 4MWEA 5DKFA 2ZQYA 3JQAB 4DCCA 3PXAA 5C51B 3PV0A 1BDHA 3F7NA 1NE7A 2RHBA 4D9MA 2J5RA 2ILTA 2JIZA 4UZFA 4LY0A 5CX4A 3AHIA 3BULA 5IMBA 3I9KA 5ECWA 3LZCA 5EZ5A 1B73A 3AG5A 1GZSA 1HV8A 1KAHA 2O8DA 2CUNA 4B73A 3KAJA 4YP5A 1EUDB 4JVMA 5AUNB 5MF6A 1VA5A 2GPNA 2CFRA 2IXAA 2GLUA 2P9YA 4X95A 3WVNA 4RTRA 3Q9SA 1ES9A 2ACEA 3DTYA 3W5AA 2YICA 3DDHA 2PKQO 1XVAA 1AT1A 5B1IA 4K9QA 1C4KA 2XAAA 4MIOA 3F78A 1SRRA 1W8DA 4MKFA 5JAZA 3GCZA 1MV5A 3A4MA 3PLNA 4P26A 4GLJA 1O0BA 1MJHA 3AESB 5HXAA 2V6MA 3ESBA 4DT1B 2JGKA 1MW9X 3KSZO 4MPPA 4O4LA 2HRBA 1UJ4A 2VR1A 4LF4B 3UJ3X 1LZKA 1WQ1R 3RW9A 4RL4A 4EEKA 4NH0A 4XL9A 3WBKA 3M5CA 2O2SA 3NWPA 2PM8A 1GTL1 4FINA 1J70A 2YWGA 2B82A 1JEJA 3FCUB 5FOTA 4EPTA 4II7A 4H3VA 2FRDC 1NB0A 1L3CA 1OXSC 2VAVA 2I6XA 2WYVA 3OCYA 4LGYA 5IJ0B 3EXG2 4NPAA 5FPYA 1X80A 1IY8A 1DTEA 1Z34A 1NBMD 4KFRA 3IAUA 5DW0A 2IP2A 1P5RA 1TA0A 1NJFA 4JWTA 2DR3A 3OE5A 3ROEA 2WSIA 1Y8RB 4G67A 4EUFA 4PYQA 4TL9A 5FUBA 3KCQA 5KWVA 3SDBA 3AHDA 4C2TA 4HI0E 1P0PA 1E7SA 2V0GA 1M5TA 3R3XA 3CU5A 4J90A 3BB4A 2X7HA 4QBFA 1PSZA 2BM0A 4RZHA 4W5QA 1YBAA 2JFZA 4CL8A 5F1KA 1K5HA 4B6FA 2FWIA 4FR2A 1CUYA 1GAQA 4TRMA 5AW6A 1UXKA 5FJIA 1GUYA 4P3IA 3CLSD 1B26A 1DFGA 3KEMA 2WJ4A 2AHOA 4HXFB 1P5ZB 1W0KA 4V39A 1IG0A 4N6OA 1NI5A 2IQ5A 1Z83A 3CBGA 3K9LA 2YN0A 1XL0A 1BG6A 2J9XB 3G89A 1VE7A 5DF1A 1QPZA 2C61A 4UATA 3TM4A 4TXNA 4E2YA 4KPYA 1SOVA 4BB0A 1Z4PX 3EWIA 1SQFA 2FQWA 1Z2CA 1A7AA 3G7SA 3SYKA 1V16A 2A8YA 4QVAA 2ATIA 2C4MA 3BWXA 4KZPA 4QFCA 3P1JA 1ECJA 1A4RA 1Z22A 2D8AA 4S3MA 4FFSA 4X61A 4ZVSA 2RHMA 5LWHA 3D7LA 3PUJA 3VPXA 1WQ4A 3T95A 3ILVA 2R9VA 2O54A 1ULTA 1YIDA 1TYZA 3ZQKA 1UP4A 2HDNB 4TWAA 5IK2D 1ZR4A 1DBWA 2ZBQA 1IU9A 4ZCMA 3PQFA 2JL1A 3EFBA 4LYEA 4ZQBA 5ER6A 1E7QA 4JXKA 2AFIE 3AM5A 3OPVA 2YYAA 5DXJA 5IT0A 1ESCA 1YQQA 3RTEA 1S2NA 5P21A 4DL9A 1OH7A 2RAUA 5B3KA 1XK6A 3K0AB 2R5NA 1QFZA 2PKWA 3RROA 2ZRJA 4UCXA 3VYVA 3OTQA 3PXGA 1XXLA 3T3PB 4G1BA 2G5CA 2ZB3A 2WMNB 2XVAA 2EG5A 4S1WA 5TMPA 2V7XA 2X6RA 5J63A 1M3SA 2J4CA 2UKDA 4TV9F 3EEOA 4EHDA 4XOPA 4Q66C 4PNZA 2AOWA 1PJ5A 1YBMA 2HCTA 4JLAA 4YI5A 3PTZA 3AM4A 4QYIA 4JI7B 1IHPA 1O96A 1Q2UA 2FGKA 3L05A 4KQIA 4ML3A 3I5AA 2WMOB 2DUNA 2YNMC 1M5UA 4QBTA 5E9WA 2HSZA 3KV3O 3M8KA 4J2OA 4TMZA 3JQ7B 3ZXYA 1R66A 4TZTA 1VKHA 2FPLA 4JVOA 3TIFA 4DJEC 5AN9A 3IXMA 1M6HA 4YJ3A 1NJ5A 1Y63A 1HTWA 2QT1A 2WF7A 2Z4RA 4GM4A 2D59A 1SD1A 1AQIA 2Z5FA 1QZ3A 2HMTA 2A1UA 3D5EA 2RGCA 4Q48A 4B3IA 5CD9A 3G85A 4Z9XA 4LHSA 2PUFA 5G2OA 2XGMA 1OFVA 2OBRA 1VECA 2PWAA 3T4PA 3TJRA 5SYMA 2ZBFA 3VYUB 4YUWA 4LRXA 4LQ4A 1BXGB 2CUZA 2NT4A 3QBDA 1RI5A 1NNI1 2P9GA 1S1MA 2VEOA 3G2QA 3ASRA 4RIFA 3ZWBA 1VFNA 3EQZA 3DCNA 1G21E 3CT6A 1AKVA 2D7CA 2GQ0A 1F5SA 4IAOA 4XMYA 2C83A 4DMRA 4ZT7A 2QVLA 4IGFA 2H4JA 4PG7A 2R60A 3LFHA 1CQJB 2FKAA 2PD4A 3LF2A 1YDWA 3M0EA 2AFIB 4M7WA 4MINA 1L4KA 3IO3A 4UNIA 1XEXB 4BLPA 3ZPNA 1E1RD 2ZRQA 4RJKA 4Z8XA 3SJAA 5I47A 3EEQA 2OGUA 3C5HA 3PNLA 1G20E 5DMHA 3NHRA 3GARA 1P61B 4QTZA 4CU2A 1WB9A 1M34A 1SQ6A 4DMCA 3RYIA 1D8AA 3ET5A 3G8YA 4YBZA 3R7WB 5JPDA 4WLFA 1OJ7A 3HVJA 1GRVA 3IJEB 4ZVRA 5H4GA 1E3MA 1NJ2A 3LCVB 3QI2A 4G26A 1PZHA 2CJWB 1XTQA 2ZWAA 4NABA 3N2ZB 3AIMA 2C5EA 2YWHA 5L3ZA 1C3XA 1CUWA 3RK1A 4CM8B 3NIFB 2AIRA 1RTTA 2E48A 2HC9A 1MW8X 1G21A 3GUUA 3LLSA 4XA8A 1WOSA 1XZIA 1S2OA 3LXMA 4LI3X 4M87A 1W19A 4MCAA 5EN4A 4EBBA 4Q3DA 2XWQA 3DWEX 3N7TA 4H1HA 4K8OA 3GLIB 5IM4F 3EDOA 2ZZMA 1DO8A 1ZGZA 2PGLA 3R6TA 1U3UA 1W25A 1CUJA 2G28A 3DKVA 3OX3A 4HVLA 3CB4A 2IY9A 5AVYA 5SZKB 2O3TA 4P93A 4XRGA 5JRJA 2J6HA 3FZGA 5KCZA 4FJ2A 1FDVA 2FG6C 3UJ7A 2AJTA 2H54A 2OORA 3OLQA 1LTHR 4JBYA 4XYMA 2ZYWX 3B51X 4YASA 4KXYA 5CXUA 1C9MA 2O3UA 2V4DA 1JPVA 4Q9KA 4BXOB 1VGRA 2IPLA 2VP6A 3HI6A 1EXVA 1I4TD 3AERA 2ZYHA 5KEIA 3UV6A 1KMCA 4GGOA 3X2SA 1ZISA 1TK3A 2E49A 3VJLA 5JCZA 5MGBA 4NBNA 5J35A 2VJJA 3RWOA 1S1CA 2RB4A 5ICSA 1CZUA 3UF0A 1L4BA 1BOFA 4KQWA 4J3FA 3QEKA 4AKTA 5LD2B 2V4ZA 1NXTA 2Z6AA 3VR3A 4DM3A 4TYWA 3IS3A 4RD4A 1QZUA 2I8CA 4JB8A 5AK0A 1G21B 4TLDA 3ZI4A 4B2YA 1XKLA 4UUMA 4L1KA 2ECOA 3BXPA 1OA0A 3WYAA 1KA9H 1C0PA 1OWPA 4M55A 4ZOQI 2OC4A 1N7IA 3IDQA 4PGFA 2VJDA 4LJAA 5EUQB 3CTMA 3CCMB 2QRLA 1GP2A 3V7FA 5LA6A 2JARA 2ZJ3A 4PGMA 1JSZA 3RYIB 4IZHA 5BWLA 4BYMA 4AJOA 3E18A 1II0A 4BN0A 5H02A 2PEZA 5IVPA 4YRSA 1EM6A 3HA7A 3OFKA 2GZRA 3NC4A 1I8DA 3OQHA 2XKBA 1QWOA 1MQ9A 4GMKA 4P4NA 1XDBA 3PQ4A 4IR7A 4NOJA 3KXPA 3MB8A 4HDMB 2H4XA 3EVZA 4B7ZA 1FJGB 2R7KA 2I3DA 6PFKA 1T3GA 4PC2A 1F4PA 5CYFA 4ZOLA 4C6TA 5E7JA 4EKNB 1N75A 1UDAA 5H59A 3ZVNA 2OHVA 2R6GA 5H3LA 1O95D 4DJDC 1R6UA 2IOFK 5FNZA 2O5VA 4TLLB 5FQNA 5AQ1A 1EM8A 2IYEA 2GN0A 3EYWA 5BSUA 4BNGA 2Q5QA 4IIUA 2IE8A 3S28A 4BO4A 4ER3A 4ZIRB 1R7RA 1SY7A 4R1NA 4GZ6A 1WZUA 2WD9A 3D9QX 2Q07A 3P9ZA 3WRYC 2UYOA 1ZC3A 2C8JA 4F6CA 5LZ4A 3G2MA 5EVCA 1RIIA 1E9EA 1RE1A 2VS1A 3IP9A 4B6SA 5CA0F 3A10A 2JAUA 2GZDA 1Y3FE 2PXAA 1JIXA 3AI1A 3GN1A 2EZ9A 1A4IA 2C1XA 3PNPA 2E82A 3FOFC 4PXAA 2VA9A 4RSMA 2EERA 3L1IA 1XXHE 3RSSA 5BSVA 7MHTA 4RF3A 2YJTD 3EBOA 4EGAA 1VQ4B 4IIHA 2QVGA 1IMJA 1ZI6A 3CH6A 1VJRA 2DBYA 3M83A 5JZSA 2NAPA 1RQ2A 1Q16A 3AIOA 4HF7A 3L8HA 3L5OA 3U56A 2EATA 3ELBA 3MXOA 5FI1B 1Y0BA 5AOVA 2XIJA 4IUCS 4PIVA 1TUBA 4UQLA 1ZY2A 4FZVA 3H2SA 3P0HA 3EGDB 4Z0NA 4AP6A 3DV2A 3PNQA 4ZQIA 1UBEA 1GNQA 1XLVA 1WX1A 2K7FA 2GT1A 1I9GA 4WSOA 5KOIA 1U9JA 1JEQB 5AVUA 5LL6P 5BUZA 2E18A 2Y1DA 4RSRA 1O95A 2XITA 5K01A 2X4GA 3G9QA 4YCLA 4MJ7A 1IPEA 1KTVA 1ZEMA 3W1WA 5IYZB 2WNIA 3RY8A 2DJ5A 4ADSG 1X2EA 1WNTA 3LPCA 4LF6B 1E3ZA 1OI2A 1SR8A 4W5WA 3T3DA 1DELA 2CL7X 3SQLA 1AMUA 3UUGA 4PLZA 4A0HA 3AY0A 4E22A 4N1AA 3DEAA 1B0PA 3ZWYA 2BGJA 1Z4KA 1NQWA 1QV7A 2QG9A 4XLLA 3QFSA 3PJGA 1PK7A 2DU8A 2PV0A 4HTAA 4WZAA 1Q7YD 5I4CA 2X40A 4MCHA 2C7QA 4M1MA 4CUKA 2CVPA 2VKTA 5DBOA 1FUIA 1I2CA 2DTXA 3G88A 1EIWA 2WZDA 3RLFA 4L6CA 3O1LA 5TGTA 5JD6A 4S1PA 3QBJA 1O4WA 3INNA 4RANA 2X4LA 3RUDA 5LQAA 5A6SB 3ADBA 1EX6A 5JI3E 1ZM2A 3CCRB 4S1VA 4M22A 4E5PA 2A1UB 4IJQA 3L4JA 1E9FA 1R4NA 2C1EA 2E89A 2C88A 5AHRA 3RAFC 2OBYA 3GG9A 1Z62A 1DGQA 1U7PA 4LY9A 2C7PA 1BGWA 2MHCA 1PZEA 5ECGC 3CLVA 1PHPA 4OHOA 4TTSA 3KJXA 4DV1B 1TM2A 2PQ0A 3CZ9A 1K9MD 2GJKA 3PFKA 1PL7A 2H65A 2HQRA 4RQTA 1Y37A 2E2WA 4OPMA 1CQZA 2BKAA 2BKXA 2HF8A 3CJRA 1T1SA 3HTXA 3UOGA 1PI3A 2QUHA 3I32A 3C41J 3E84A 1BH6A 1SK9A 2G70A 1MBZA 2WMYA 3RVSA 1EFAA 3QX7A 5DRYA 1ID8A 1Y3IA 1QAOA 1NVAA 1P9NA 1H2ZA 2DERA 3NTLA 2BP7B 2VPIA 4IS2A 2MOKA 5IDYA 5T4FA 3P9IA 1P2DA 3MYRA 4OHZA 3JQRA 3AM3A 2D0OB 1BCSB 1RRKA 4DTCA 4EW3A 2OSVA 4MV3A 5ANRB 4RJJA 3TQHA 1HC7A 3LBAA 7ABPA 1XZGA 2J48A 4TRNA 3KX2A 4E3WA 4W4TA 3RIGA 4E4YA 4BMDA 2BJHA 2QPLA 3EA4A 3DFUA 3DBRB 3G1UA 4E2FA 2YZNA 3SBXA 4JSYA 5K8UA 1VSQA 4B4DA 5I4IA 1ADFA 1U7XA 4LECA 4DDHA 5I3CA 4LHYA 1YHYA 4TS1A 1W47A 4IGKA 4ZQHA 4YP6A 3EPRA 5JCOA 2BEUA 4W99A 1NYLA 4L0MA 1D3AA 1YR9A 4LXYA 4AQ7A 1CUIA 2PHZA 3KEFA 2IH2A 3E6AA 4OKIA 4Q9IA 1KYZA 3IFSA 1REQB 2IBTA 4TOIA 3PQCA 2V7TA 3OOSA 1LJ8A 3HDHA 2IFTA 1F20A 2GN2A 5EQFA 3U3DA 3T9EA 5HP4A 3VKGA 4XSVA 1LPMA 4ZCLA 3D6TB 1WRBA 2QTLA 1QVGB 2FZ5A 4URFA 2Q9UA 1ODFA 2I34A 4RHUA 2YJGA 3I37X 4I81A 4P3XA 4ENSA 2GPJA 4MJXA 3I9JA 3BORA 3P20A 5AQEA 1Q0ZA 5B58C 5IJXA 1SUPA 4J91A 3ADDA 2PRKA 3PGKA 4EMUA 2GTIA 2H5JA 2VVTA 1MEOA 4FU0A 3ROKA 3VKWA 4DA7A 2XKAA 2FMIA 3CXUA 2RH9B 3QI7A 5GINE 1RNLA 5HQ3B 2WTUA 1QFYA 1XO1A 1OBVA 2OZKA 2PRJA 3EF0A 5C46F 1HVXA 1JX6A 3NBMA 4GOLD 1HYQA 1N2SA 1ZQ9A 1NTRA 2XHEA 3PIIA 2W4QA 3CSUA 5D3ZA 4Q7KA 4DWOA 1Z0UA 4OI4A 5HFJA 5SZJA 3HNPA 3TOSA 4QEDA 4V0OA 5BXYA 1F2VA 1LQUA 1P2VA 4BKPA 2OZLB 2JHAA 1E5VA 2NVUA 2II6A 2ZWPA 1FVOA 3CXRA 4TVOA 5CVDA 4E15A 5IMSA 5TSDA 3E82A 1YL5A 1ZFNA 3Q3AA 4US1R 1PW7A 2XB8A 3H7AA 4OHPA 4CT5A 4F5WA 1G38A 1XA3A 1B42A 2HXSA 3JAWB 3KOXA 5CG2A 3AG6A 1FYWA 1M83A 2AC4A 3K1AB 2B4YA 2AGVA 1TEZA 1DKQA 1YI8A 4XUEA 3B1YA 4TV9A 3CRVA 2QRGA 4RFSB 4J0CA 1G64A 2ZUBA 1QSGA 3O3NB 1TZMA 3LX6A 1SXGA 4J1TA 2RK6A 3LECA 5I01A 2H3EA 3LBFA 1XCJA 1ZCBA 5A4FS 2VDPB 4RGYA 3DVAA 7REQA 3G0HA 4X66B 5JAPA 1XEWX 3Q2KA 2R65A 2A3RA 4R84A 3RUEA 5LMZA 1F2TA 2X0RA 2WJVA 2X76A 4BLOA 3MMSA 1UBJS 4OQPA 1I7SB 3SM3A 2VNSA 1EDBA 4LJKA 5K4HA 4KDCA 2GLXA 5AM1A 3TQRA 1E4EA 1E2LA 3KVNA 1Z0AA 2PVSA 1D5WA 3ZH9B 5BYKA 4BFXA 4G0WA 3PDJA 4DR4B 1GPUA 1HDRA 1PRYA 3L41A 4P7KA 2X8KA 1O97D 5C37A 2LIVA 5JVDF 1NLZA 1FVHA 2C5GA 1NX6A 2DWQA 5FPPA 1T13A 2XVYA 1BFDA 4YS6A 5CAEB 1WHTA 1IDN1 3STTA 4GXTA 1XMVA 3J7TA 1EUQA 4LY6A 1XKQA 2CXHA 2J30A 2PGOA 4FFBB 5FBQB 2IITA 2QRQA 5EIHA 1AGNA 1GZ3A 5FWNA 3CRW1 4Q1VA 4WUVA 3CEJA 4GWKA 1B15A 1F8XA 1I51A 3GVIA 4DSNA 3PEVA 2C54A 4AURA 5FWXB 4EAQA 1E2IA 3FZEA 1OLOA 3ONWA 2ZUFA 4QEZA 1T0HB 3IQFA 5HS6A 3ASSA 1AKYA 2WHQA 2C4UA 4MUIA 4C29A 4D9CA 5KTRA 1YRBA 2JPDA 2K7ZA 3KALA 5G0UA 1BWRA 3GAMA 4WXMA 4YALA 4BNUA 2NO6A 4PNPA 3IUNA 5FWYB 4ENWA 2B1IA 4MPJA 4YRDA 4AZ3B 2Z8ZA 1ZONA 2AHRA 2FF7A 3GA0A 4W7IA 4ANFA 1W36D 3PXEA 4DILA 2AG8A 1EDEA 4FHGA 4KAJA 5FNVB 3P2IA 1J0DA 4IIDA 4G1EB 4E5SA 3UGJA 4LZJA 1MIHA 3W04A 5DSXA 5EMNA 4PYNA 4FW8A 3VDRA 2DBVO 3I61A 2C5BA 3G0GA 4PAQA 4AKIA 1FU4A 5PNTA 3T3HA 3T5GA 3VZCA 1I5OA 2WWTA 1A9XB 2IIVA 2O3QA 3G0CA 2PG3A 4N65A 5BMVB 2ZJ0A 5BV8A 1ZL0A 2WMDA 5AVXA 5ICGA 3IVXA 4I8XA 2W6JD 4H3SA 1X19A 4K9DA 1PBNA 2VKQA 4P22A 2C4VA 3O95A 1I0ZA 2CMKA 3H5IA 3OOHA 4G85A 4BNTA 1CLEA 2CNWD 3AKCA 4E11A 5BR7A 3QXGA 5I9NA 3BK1A 4RTNA 2D1RA 1FNMA 4ER7A 3SYNA 3COSA 3W3AA 4ZMSA 3AP3A 4Q4AA 4BVJA 2FFBA 1VHQA 3L8ZA 2ZZNA 3CLTC 4YONB 2F1LA 2SCUB 3DWFA 3A8JA 3HZOA 1H8EA 4OGLA 1AGRA 2A1TS 4D26A 4C0QC 5I4KA 3LP8A 3QX3A 2A2ZA 1JF8A 5F35A 2H06A 4ZV7A 3QKIA 3ZYCA 2C97A 3CNOA 4LNHA 2HJRA 2PMCA 2DFKB 3CCVB 3OFJA 4XSGA 3AWIA 1WCIA 1TVEA 3TRHA 4FX5A 3U81A 2PYZA 3RHTA 3BXFA 4XPZA 5BW8A 4ZGQB 2NV2B 1DKPA 3HSYA 4P33A 1QHNA 3TUJC 4PC6A 2AYZA 3VNSA 4XYLA 1JPJA 3RE1A 2PZAA 1QCZA 3Q85A 4BC1A 1C7ZA 2E9SA 3VISA 3RSHA 4ESEA 2GVDC 3EPLA 1M10A 1T8SA 1WO8A 2JRLA 2Y9PB 2ZAIA 4QULA 3OLXA 1ZUIA 4I2NA 3GCWA 4D45A 2VDNB 2V8OA 4XDYA 4YRBA 5FTMA 3P4XA 4RPKA 1YJNB 4L07A 4ND2A 4F3RA 3OF2A 4LZLA 2WUFA 3Q7QA 2JLVA 4X0CA 1JDZA 3OF5A 2RE8A 1W5EA 3PRJA 1CJUC 4KJZA 3WRXA 1M2HA 1OSNA 2YX1A 4F3TA 1OHHD 1OILA 1AGXA 1E3QA 3C6ZA 1RHJA