1GB1A

A novel, highly stable fold of the immunoglobulin binding domain of streptococcal protein g
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
b'MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN G
publication title A novel, highly stable fold of the immunoglobulin binding domain of streptococcal protein G.
pubmed rcsb
source organism Streptomyces griseus
molecule tags Immunoglobulin binding protein
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1991-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1gb1A00
2K0PA 1Q10A 1HZ5A 4MACA 1EM7A 1MHHE 2ON8A 1K50A 2N7JA 1JMLA 4KGRA 2KN4A 2ZW0A 1K52A 2JWUA 1MVKA 2IGGA 4GLSC 1ZXHA 2IGHA 1YMHE 2GI9A 2JU6X 5BMIA 3FILB 2I2YA 1P7EA 1IGCA 2KQ4X 3MP9A 1C9FA 1PGXA 2GB1A 1FD6A 4HJGE 2JXTA 1F2RI 2LHDA 2EELA 3GB1A 1IBXB 1PGAA 1FCCC 1P7FA 2J52A 2KACA 3V3XA 1KH0A 1YNTE 2KDMA 1GB1A 4IOIE 2LUMA 1HZ6A 4KGSA 1HEZE 5HFYA 2KWDA 2J53A 1XCTL 2ONQA 1XF5L 1MI0A 5HG2A 2PLPA 2I38A 4D2KA 3UI3A 1MPEA 1D4BA 1K51A 1K53A 4HKZE 2N9LA 2LGIA 5JXVA 1QKZA 1GB4A 1UWXA 5HHDG 2PTLA 3FILA 1F2RC 1FCLA 4KGTA 1PGBA 2QSDA 4WH4A 2N9KA 2QMTA 2IGDA 5BMGA 5HI1A 4OZBA 2NMQA 2PW9A 4IKGA 4OZAA 1IBXA 2JSVX 1MHXA 2ZW1A 2OEDA 2RPVA 5BMHA 1IGDA 2LHEA 1XCQL 2JZPA 2RMMA 4OZCA
chains in the Genus database with same CATH superfamily
4K3BA 3IAM1 4DDID 1OQQA 2WDVB 4WJNA 3L16A 4NZLB 1MG8A 4EKUA 2PE6B 2R2OA 4TQ1A 3Q8AA 1YQBA 1XLQA 2BT6A 2BS2B 4W9KA 2C9WB 1EF1A 1E7PB 1JRUA 4P1BC 3RMKC 1VCBA 1H4RA 2INDC 2KX0A 3MP9A 3HK0A 3DQVA 1TZOA 3A4RA 4ZRPA 4WWPA 3VH3B 4KSKC 1D6EC 2XEWA 2DAFA 4RF0A 3S2AA 1FNWA 4M8MA 3ZQ4A 4EFOA 1V97A 2AQ2B 2Z0EB 2BQQA 4FXCA 2N0SB 2L83A 3LXFA 1TKEA 1OGWA 2AYOB 4C80A 1WYWB 1XCTL 3JYUA 4KZCA 2WYQA 2Y3AA 3L08A 1T0SC 3ZUNA 3ONSA 1WF9A 4YWGG 3N3KB 1HXYD 2JX5A 2KFKA 2WDRB 2DNFA 4FHKA 4WQMA 2WXHA 1FCLA 4OVZA 1Y8RC 1N61A 1N6ZA 3M63B 3DBHI 5CX3A 1I35A 4TSSA 2NMQA 1VRAB 4ZRKA 2K3UA 2AWTA 3EFCA 2V1YA 2OEDA 2KTRB 1D3ZA 1HE8A 3ZDTA 1CMXB 1JALA 1IPGA 4PK1A 3T8MA 2D5GA 1Q10A 3N30A 4N58A 1E10A 2QDFA 2OJWA 4XWWA 1XT9B 2GMIC 2KMCA 4JE3B 5D2MB 1DOYA 1GC7A 4CQNA 2J0MA 2EMTA 4GU2A 1K52A 2KDIA 1UWMA 3T9LA 1B9RA 4JIOU 4F8CB 2SAKA 5D3IB 3VR9B 3SFEB 5E6OA 1C9FA 1KJTA 4HEA1 4C7ZA 1WJ6A 2JWZA 2WXQA 2E6XA 4PYZA 2KQSA 1ENFA 2K9XA 2DBYA 1SE3A 2YVCA 3B9JA 3M3JA 3TEXA 1N60A 2FBWB 4HWIB 1Z2MA 3OWEB 3BWUD 5CHFA 4TKNA 3V6EB 2L00B 2C60A 4AJYB 1L6VA 3RUIB 2CKHB 5EE9A 1ZDVA 3AEBB 3PLUA 5JZEB 2M19A 3Q3NC 1WGYA 3RD2A 3N1YC 3MHSD 3R66C 2LGSA 3WA0A 1K51A 2MLBA 2LGIA 5JXVA 3RPFC 4LCDE 1GB4A 1MJDA 3ECIA 1V5OA 2D3BA 1XD3B 4BOSC 1WGGA 3QIJA 4KGTA 2CU1A 1QT9A 2I1JA 3MC8A 1D5ZC 5BYRA 2K22A 1VDVA 2MBBB 3H6NA 3M62B 2M17A 1WZ3A 1K8RB 3TBLD 1IYFA 2TSSA 5BMHA 4IDIA 2HDEA 4K7SA 3KYDD 3L4PA 3NS8A 4KVGB 2IYDB 2IO3B 1P0RA 4UDUC 4DHJD 3MHZA 2WU2B 2J42A 5DPSA 5GMVA 2DX5B 1V49A 2L8JA 2PE9A 4WWNA 4KGRA 2N9PC 5EE3A 1SGHA 3I63C 4YSYB 2KAJA 4USAA 3DVGY 2JU6X 2BB5A 3FC4A 2DYBA 1I7HA 1WXMA 3AMZA 3PRPB 2WDQB 4DK5A 1LM8B 3HVZA 3H1UA 3BYYB 3NG0A 2LGXA 2A4ZA 1EF5A 1IBXB 3DHGC 3H7SA 3SFDB 2D07B 3AEAB 2AQ3B 1JRPA 2QC8A 2GBNA 2LUMA 4ICVA 3ZNID 4MELA 4AQ7A 3PRZA 4M0WB 5G55A 3B08A 3MJ5A 3PLVA 2C5LC 4RGTA 1OEYJ 5LLIA 1MG4A 4YTPB 3OLMD 3ZJTA 1MPEA 2KO3A 5IN7A 1DGJA 2M8SA 2FE8A 1B1ZA 4GIVA 4GSWA 4BVUC 2QSDA 2DLBA 3GP7A 2KOXA 1IUEA 2NBVB 3CMMB 1WJNA 1PFDA 2BBCA 1V1PB 2JSVX 2ZW1A 3URYA 3SEBA 3NRZA 4HDOA 1XCQL 2ZPYA 1VLBA 5EE0A 2ACZB 3L54A 3UQBA 4MACA 4P7IA 3BVZA 5BO4B 2ASQA 2KN4A 4WIPA 2DYMA 4S17A 2IPKD 1J19A 1V5TA 4FN2A 2L32A 3A9KA 4C56C 1RWSA 3EECA 3AE1B 2KT7A 2E3TA 4BBNC 3WAPA 1FD6A 3H7PA 4O1NA 1F2RI 3ALBA 1SJED 1OFFA 5AZFA 2OOBB 3ZGZA 4M8NA 3R8BA 3PVLA 1SJHD 2M56B 4ANXA 1YX5B 1YJIA 2KLGA 4GOCA 4KSLC 1C4AA 2LASA 2HJ1A 5AUIA 1TY2A 4IM3A 2AEHA 2FAZA 3TEYA 2M0XA 1PYWD 4D2KA 1TYGB 5D94A 3BK1A 1FMAD 2BS4B 4FLHA 4L2YA 2QEJC 3BVMA 4Q2JA 3ABVB 1C76A 4QAYA 2KHWB 2WXIA 3P4RB 1OQRA 2GRIA 4LNOA 3RNGC 4A8XC 4MJSB 2N1VA 3Q3OC 4MDKE 4EZJA 2REXA 1AWDA 1SE4A 1V6EA 1MHXA 3QWZB 3W1YA 1VZ8A 1H8CA 5BYQA 3P2BA 2WXMA 3C0RB 1RFKA 1J7CA 4NJ6A 1TY0A 1GAQB 2H89B 2IO0B 4E71A 4REZA 3VUWA 1NBFC 1YQ3B 4GDKA 4LJOB 3C8YA 1MVKA 3RNCC 1SE9A 3Q14C 1XEEA 1MFWA 2LRWA 3BY4B 3CF6E 1E8YA 5BYSA 2B3AA 2N1WA 4XGAB 1N63A 2PJHA 1Q5WB 1WXQA 3CWIA 4CO7A 4IM2A 4MGYE 5H92C 1J8CA 2WP9B 4RH6A 3A1QA 2X8XX 4DBGA 4ZYNA 1D5XC 4AS1A 2NS5A 4WJQA 2J53A 1RFAA 2J0JA 2L0FA 3PREA 1UH6A 3T3NA 4RM8A 5HG2A 2WX1A 1T3QA 1DOXA 5LNK1 2O6VB 2FCMA 5LXHA 3NHEB 2JRHA 1OTRB 2R61A 4ZRQA 2K39A 1SF0A 5C2TB 4P6VF 2LVOA 3EC8A 4W9DA 5L83A 1TS2A 2QMTA 1FEHA 2IGDA 4EEWA 1FIQA 3PZ7A 4HCPB 3TL5A 3OG5A 1VJKA 1GPXA 2BGFA 1E0ZA 1ZP0B 2DHZA 4OZCA 2NVUI 2ZZPB 2BW2A 1TKYA 2CS4A 1EUVB 3AE8B 4A6QA 1E5WA 4ARCA 1KFYB 2PVOD 4IM0A 2NPTB 2WGSA 1WIAA 1QZEA 1WZ0A 1E9MA 2K6DB 3HRDD 1Q1OA 1WRDB 3AU5A 3NVVA 3R2TA 3W5VB 1E8ZA 1WX7A 5G5HA 3MJWA 3Q3MC 3V62A 2LHDA 4W9FA 4CHKA 2JY6A 3Q69A 3PGEA 4XE0A 1KM7A 3N32A 4DXFA 4LNNA 5H8YE 5FKAC 4MM3A 3Q8CA 2KDMA 3HM3A 1HZ6A 1L5PA 4AJWA 3DDCB 1L0VB 4OVVA 2VZKD 3NS1A 3PZDA 4WWOA 4GB9A 3IXSA 4JPSA 2WXRA 2Q5WD 1D4BA 4HJKA 3SR6A 2N9LA 3N20C 3VDZA 4A3PA 2LMCA 3FILA 3HM6X 4JLCA 4OHJA 4WH4A 1TS4A 1E7UA 2KJHB 5GXGB 3PT2B 3AE5B 3A9JA 4LK0M 4RMAA 4OVUA 4KDIC 1WX9A 4WQOB 1SEBD 4LNFA 3IG3A 3IVFA 2MBHA 1BMLC 5E6JA 2CHZA 4RF1A 1EWYC 2LUEA 2LZ6A 2WLBA 1HZ5A 2YLMA 3KQ4A 1EM7A 3D32A 3QC8B 2PKOA 5IAAC 4ZOHC 2DWQA 1J7BA 2KDEB 1NI2A 1WXAA 2WS3B 3E56A 1XXGA 4HPLB 1YN3A 4MH8A 1WE6A 4HKQA 3PHWB 1WX8A 3JW0X 5AUKA 2IGGA 4NJCA 2RPQA 1YMHE 2K8BA 1ZGUB 3AE2B 2KWUB 2Z8LA 1IP9A 1WGKA 3V60A 1PGXA 2WQYB 1UNSA 1TTNA 1EU4A 1WSPA 2XN9C 3VH4B 2LXCA 2CHXA 2FIFA 4KZ0A 4EZLA 4XX5A 3H8HA 2LVQA 1YNTE 1L6UA 5HFYA 2O2VA 4URKA 2BYVE 1JWUD 1L0XB 1UBIA 3WAMA 2A5UA 2Y5PA 3LYYA 4KIKA 3CIRB 4ICUA 3PSEB 2I38A 2EKEC 3GZNB 3A1QB 3UI3A 3RFZB 2FUG1 3NY5A 3PRMB 2L52A 2RGFA 4FJYA 4I6NB 3Q2AC 2V9HA 5C3JB 4NAWB 3U7DA 5C23A 4NNJB 4HROA 3ZRFA 4HCNB 3V61A 2FNJB 1DOIA 1TIFA 2N9KA 1WY8A 4ZHPA 2V4IB 5TSSA 5HI1A 4OW0A 2H88B 1E7VA 3RULA 4IW0A 1RLFA 2XK5A 3DVGX 3BIID 2D11A 3ZJUA 1WR6E 1IGDA 5KHOA 3WCQA 4AWJA 1FRDA 3U4EG 4YT0B 4A20A 1YD8U 4FJZA 4ASWC 3U2SC 1TZ1A 1YIWA 1HTQA 2CU3A 3BK2A 3TIXA 4GGQA 3GE3C 4JGHB 3C19A 4A9AA 2JWUA 3L17A 3ZDMC 1ZXHA 2IO1B 4N59A 1P3QU 5HKHA 2B76B 2CHWA 2G4SA 4H2AA 2L3ZA 4M00A 4GDLB 2V0GA 1R4MB 4K7WA 4HJGE 3Q8FA 4ZHOA 2JXTA 3K9OB 2LXAA 3JSVB 3OAWA 2EELA 2MJDA 3MC9A 3NVZA 1YOVB 4HRSA 1FM0D 3L0WB 2C7NB 2IBIB 1A70A 3VQIA 2AL6A 1WGRA 1SBBB 3HHMA 1GB1A 4WWMA 4YTMB 2LJIA 2DZIA 3RI7C 3KUZA 5G2NA 1LO5D 4P16A 2MRPA 1WI0A 2KWVB 4ANUA 2KC1A 4E74A 2WXLA 1GUAB 3QJZA 2K5PA 3ML8A 3X23A 4MM3B 3TEWA 1ZPSA 2KMMA 1XQQA 5DPRA 2D3GA 4KV2A 4LLGM 4XDDA 4GMVA 4MSQB 1FFVA 1JWSD 2K25A 2KVZA 4B0EA 2QHOA 1A5RA 2ZNVB 2DZMA 1JWAD 1M4VA 5CHVC 1SB3C 2BVCA 2LGYA 3KWVA 4BAXA 4R3DA 3NZSA 4IC7B 1FXIA 2DYOA 3VRAB 1ZKHA 3E9SA 2K8HA 5AEKB 2WWZA 1QOAA 4BKSA 1CK1A 1JWMD 2YEPB 3GOEA 3AE7B 3B0AA 4XWTA 1ZE3D 2L1AA 3NVWA 4MT5A 1GOZA 3VR8B 3I5JC 1UELA 2KFKB 3GZNI 2GI9A 3AECB 3O13A 5CTRC 4JX1C 3LDZE 4LTUA 1ZXIA 4AOFA 5D7GA 2L76A 3P4QB 2M0AA 4NAMA 2HE7A 1C77A 2BWFA 2K6QA 1ISNA 2KJRA 3AH7A 1F1HA 3RZFA 5LXIB 1AARA 4BKTA 2PIAA 3R7QA 4TQ0A 2J52A 3J9CA 3MC0B 5C1ZA 2MJ3A 5FR3A 1HEZE 4DHJB 3U7ZA 4MEMA 2JPHA 3EFUA 3PZ8A 5DCNA 4XYCA 1C4CA 4FBJB 3JVZX 4N9F4 1SIFA 2N4FA 4ZYSA 2KJ6A 1L2NA 2FUHB 2MSED 2RSUA 2CR5A 2LJ5A 2JQRB 3VUYA 2O2VB 5E6PA 5AZHA 3RYTA 4HXDA 2M4NA 2RDGA 3NVYA 5BMGA 1R4MI 4W9LA 1FNVA 4JQWC 4F1SA 4K3CA 4OZAA 4B9KA 4RNAA 3SD5A 2JZPA 4FHJA 4LNKA 4NPNA 4G0NB 4A55A 4PYUA 1FXAA 5TR5A 4YL8A 1VZ7A 4RFBA 2L0TA 1XO3A 3AXCA 4W9EA 3I3TB 4RGOS 1ACCA 2JT4B 1C78A 5IO9A 3TSSA 1L4DB 4ITKA 4BKSD 3CSFA 3KUDB 5E6NA 4NY0A 2BF8B 3VAWA 2KC2A 2V3NA 3RN9C 4M02A 1VZ6A 1SIJA 1T0QC 1WJUA 5I4DA 3ZYYX 4KKJA 3EGRA 4US8A 2EKIA 1OQYA 2MH7A 3BYTB 2MCNB 1PGAA 2MBOA 2GBMA 3W2DA 2KACA 2LI5A 2KFJA 5D6JB 2KTRA 3RNFC 2GBRA 1WXSA 2FCQA 1GJZA 3QARA 3QCAA 2SEBD 3VTVA 3IHPC 4ZRIA 2INPE 2ONQA 2HTHA 1UGMA 4ZDVA 2GLSA 4TMAB 3NUHB 2NCNA 1FRRA 3RNEC 1YQ4B 2D10A 1WH3A 2WXGA 4RGNA 4KKIA 1YX6B 5G5GA 4W9HA 3ZLZA 2FCNA 3SHQA 1C1YB 1V80A 4YSZB 1F2RC 1PGBA 1KLUD 4JL9A 2UYZB 3R2IA 2WHIA 4L1BA 5EE1A 3AU4A 2ZEQA 3DVNV 4NQKE 4IWPA 4MH0E 4XZ4A 2NTSA 2PW9A 5EDSA 3DHHC 5IA7A 4IKGA 1WGHA 2MHJA 2KK8A 2LVPA 2Y5BB 2RDBC 3I57A 2X38A 3B2GA 3OJ4B 4LNIA 1FO4A 3AV8A 2QCZA 3ZIMA 1C3TA 2BB6A 3KLSX 2INCC 4E3CA 1RM6C 2IY1B 2JF5A 4L23A 3T3OA 3OJ3A 3V6CB 2WXFA 5L95C 4IUMB 4I6PA 4GLSC 4XDCA 3DBRB 4M01A 4LDTD 3TEZA 1RYJA 2I2YA 2GB1A 2MJEA 1L7YA 2YEPF 3WAOA 1F77A 3KWLA 4B0MA 5IKCM 3HIZA 3ZTDA 4RGMA 1R7SA 2CJOA 1UGJA 1NEKB 3GE8C 1I4GA 3VXWA 2VRRB 2WNMA 3DOWA 1C79A 4C4VA 2J0KA 4EE2A 1E8XA 1JCKB 1DYQA 2DAJA 2KXJA 2BYTA 5MPOA 2ZNVC 2AL3A 3APFA 3ENEA 3TJPA 1I4PA 3ZNHB 4W9JA 2GOWA 4FJVB 2ZVOA 2WX0A 3A9KB 4TUUA 3VRBB 4HPMB 3K9PB 1QKZA 1V8CA 4C7YA 1QLBB 1T6BX 2KYWA 3B1LX 3H7PB 2K8CA 4WAFA 5AZGA 2XBBC 5JHBA 1LXDA 1SXTA 2LRUA 3U8ZA 1YJ1A 3PV1A 2NBUA 2KWCA 2JZZA 3QK0A 1IBXA 1WWTA 4US9A 2JYTA 3EUB2 2RPVA 3Q8EA 4II2B 2CJNA 3AB5A 3B2FA 3Q3JA 1NYQA 1J0GA 5J18A 1N5XA 2V3SA 2ON8A 4M0WA 4RM9A 1QILA 4MGKE 1JMLA 2QILA 4EOYA 4K7UA 1L4ZB 3HVDA 4TV3A 2N9EB 2MW5A 1PUTA 1S3SG 3VUXA 2IGHA 5DPTA 3QHTA 5BMIA 1P7EA 3ETRA 1L0YB 1VR9A 1UBQA 1QF6A 3SDLC 1NVID 3W5UB 2KD0A 2JYEA 1KOTA 2Y5CA 1AW7A 3TMPB 1HTOA 2BYFA 2HD5B 3Q8BA 1CQVA 3PTFC 1P7FA 4PT5A 2BPSA 1NENB 1V1PA 2GBJA 4LDTB 1KF6B 3KYCD 1GC6A 1YN4A 1ZOYB 4S0RA 4DXAB 2UU7A 2UWQA 2N7EA 4BZAA 4FADA 2OJRA 2LFIA 1WYGA 1T0YA 3N9YC 1KLGD 1HA5A 4W9GA 3AM9A 2K1FA 1V2YA 2NR2A 2MWSB 3W1SC 4GDKB 1UF0A 4K81A 2D2QA 1K53A 4HKZE 1R4NI 2VH2A 2KVRA 1I4QA 1WM2A 3DBRI 3DVNU 3GS2A 3ZTCA 3RNAC 1EWCA 3FAHA 3A4SC 2PVGC 3EA6A 4NQLB 1LFDA 1U4AA 2C7MB 4J6IA 3RT3B 3AEFB 4C00A 3AULA 2ICIA 2OHFA 1CZPA 1E8WA 2I1KA 4HK2A 4DQOC 1WM3A 5JHAA 1JW9D 1TJEA 2VZKB 1WRIA 4PS7A 4P1CC 1LQBA 1PDXA 2KQ7A 1YN5A 4F7ZA 3NJTA 1ZDXA 2MEKA 3W1SA 1ZW7A 4J3OD 1ZUD2 3L10B 3AI5A 4WURA 4KDLB 1JWBD 3DHIC 2EMSA 4JWUC 3QA8A 1TT5B 4MJSA 1NYRA 3BVGA 4WJOA 4YTNB 4BKGA 4DXGA 1P98A 1V86A 3R3MA 2ZCCA 2PMVA 3ZRCA 4FA6A 3NZ3A 3IBEA 1M94A 3AEDB 2W54A 1F52A 2KTFA 3VTWA 3IFWB 2LD9A 3HUIA 3KUCB 4YXDB 1TS5A 2L05A 3AE9B 4MGIE 1GG3A 1UWXA 4C4VB 4PS3A 1FPYA 2INNE 3AE6B 2N9XA 4NJ7A 3DBLB 3P1MA 2KDFB 2Z59B 2PEAA 1BT0A 5J2RA 2DZKA 1RRBA 3RNBC 1NDDA 1GNUA 3N1XC 5J17A 5D3DA 2KNBA 1SE2A 3ZJVA 3V05A 2WXNA 1Z5SB 4EUTA 2K0PA 5KHQA 2AX5A 1KLVA 1P1AA 1WE7A 1K50A 4I6LB 3BZDB 1VD2A 2N7JA 2WXOA 2LGDA 1XLNA 3LB8C 1TKGA 2J7QB 2MP2A 4B95A 2BKFA 1WMHA 2JRIB 2O6VA 3FKYA 2W55A 4AUQC 2QIEB 2MBEA 3FILB 1IGCA 3VHTC 3EHVA 1OEYA 4EZKA 3KVFB 1Y56A 2IZVB 3A9JB 1UZXB 2G45B 2IDYA 3GB1A 4HPPA 4G11A 1QQRA 3ZNGC 3H9DA 1BXTA 5FK9C 1TBEA 1J7AA 2MQJA 4BBNF 4G3XB 1LGRA 3UF8A 2ZPNA 4KGSA 3U30A 2V4LA 4ANWA 2R2QA 3BINA 4N6EB 3QQ8B 3P42A 3ML9A 2MA9B 1I4HA 2IY0B 1ESFA 2WU5B 4BFRA 1G6JA 1UUPA 2DZJA 3O65B 2D3AA 2NPTA 3TUOA 3ZNZB 3IT6B 4FULA 4ARIA 3QAQA 5HHDG 2PTLA 1T0RC 2ZJDA 3ZXVA 1I4RA 4GN1A 2AQ1B 4MSMB 4DHZB 1TS3A 1E6EB 4WAAA 2KX3A 3MTNB 1ET9A 2ZVNA 1D5MC 3AE4B 3VFKA 2G3QB 1WXVA 2LHEA 4A3OA 2GBKA 1WJ4A 2RMMA 2V3PA 5T8IA 3Q6BA 4HVBA 1X1MA 3DCGA 1XLOA 2G9HD 2W9NA 4DHZE 2C7HA 3I9V1 4KIKB 2IJ0A 3ZW3A 4IWQA 4PS8A 2BTEA 4ACFA 2ZW0A 1XLPA 1WGDA 2O6VD 3MFGA 1F0ZA 3QX1A 2RD0A 3CSTA 3DPDA 2KLCA 2KQ4X 3W9CB 2W82A 2Z0DB 3N1ZC 2BKRB 1E90A 3Q3FA 1P9DU 1C4PA 3DWGC 3DBLI 3KW5B 2XK5B 1ET6A 4MGZE 2JVCA 1FCCC 5DPWA 1SSNA 4JWSC 1KH0A 2JXXA 3UIPB 2N7DA 1CJEA 2W3SA 3APDA 2HJ8A 4W9IA 4IG7B 3L13A 3DWMA 4BOZB 1QOBA 2KMAA 3UQAA 3R7RA 1TGZB 1EU3A 1I42A 1MI0A 2J4XA 2PLPA 2FIDA 4XC2A 2JUOA 2ZCBA 3A33B 3SU8X 1FFUA 1JQ4A 1HQRD 1PQSA 2LEKA 1KRHA 2LWPA 2WXKA 3VTUA 3PHXB 2M1MA 1RAXA 3RCZA 2IO2B 2KN5A 2G1EA 5FR6A 1YJJA 2QJLA 4OZBA 4HLEA 1Q0WB 4KX6B 3ZXRA 2WXJA 1AN8A 3AN1A 1JROA 2NTTA 4YSXB 2L7RA 3PPAA 2HTME 4X57B 3NOBA 5IOIA 3X0WA 1N5WA 4ANVA 1MHHE 4DDGD 1WR1A 4A90A 3WALA 2JZ3B 3VVWB 3KH0A 4RCOA 4ZRJA 3M95A 2DENB 3AEEB 2MX2A 3IT4B 5JH5C 1STEA 1QOGA 4NAWA 3DBHB 3AEGB 1ROEA 1AYFA 1FXTB 3ZO5B 3RZWC 3PS6A 2XNAC 1UD7A 4CYEA 1EO6A 3U52E 2MP2B 1WFYA 4WJPA 1V9JA 2KANA 1WMHB 2VH1A 3WIMA 1F9JA 4G50A 1R4NB 4AP4C 2WXPA 3V3XA 4IOIE 3PO0A 2KWDA 3TCAA 3WANA 2KKCA 1FNUA 4B6WA 3UIOB 3ZVVA 2RR9A 1N62A 1XF5L 4LJPB 1T5XD 1V81A 3LJ3A 4GXBA 4HDQA 1KTKA 3UGBB 1NI3A 2FCSA 2PPHA 2BWES 5CHWA 1QOFA 3IAS1 3UINB 2W3RA 5IP4D 4K1RB 2BS3B 3ZKJC 1S1QB 4GDLA 4IWOA 3DBSA 3P63A 2MBQA 1I4XA 1BUIC 3APCA 2KZRA 3JSVA 3P4SB 1V1OA 4W9CA 4DWFA 2NBWB 2BYEA 2RDHA 3NZUA 3AE3B 3P4PB 2KDBA 4II3B 2D3CA 2G4DB 2WDTB
chains in the Genus database with same CATH topology
4DQOC 3IAM1 5BYQA 1OQQA 2WXMA 1JW9D 2WDVB 1RFKA 1FXIA 1J7CA 1TJEA 1TY0A 4NZLB 1GAQB 2VZKB 1WRIA 2H89B 2DYOA 3VRAB 3E9SA 1PDXA 4TQ1A 1QOAA 1YN5A 3Q8AA 1CK1A 4REZA 1JWMD 2YEPB 1XLQA 3AE7B 4XWTA 2BT6A 2BS2B 1ZE3D 1YQ3B 1ZDXA 2L1AA 2MEKA 3W1SA 3NVWA 4MT5A 1GOZA 3C8YA 1MVKA 4J3OD 3VR8B 1XEEA 2GI9A 1E7PB 3AECB 3O13A 4JX1C 5BYSA 1ZUD2 4LTUA 3MP9A 1ZXIA 5D7GA 4WURA 1N63A 1TZOA 3P4QB 4ZRPA 1JWBD 2M0AA 4NAMA 4JWUC 1WXQA 1C77A 1D6EC 3CWIA 1NYRA 3AH7A 3BVGA 4YTNB 5H92C 2PIAA 4RF0A 4TQ0A 4DXGA 2WP9B 1FNWA 2J52A 4RH6A 3ZQ4A 3J9CA 1V97A 3MC0B 1D5XC 2AQ2B 2MJ3A 2PMVA 4FXCA 1HEZE 2N0SB 5FR3A 4AS1A 2L83A 3U7ZA 3LXFA 2J53A 1TKEA 3PZ8A 3NZ3A 1C4CA 4C80A 1XCTL 3AEDB 2W54A 2Y3AA 3T3NA 4ZYSA 5HG2A 3HUIA 1T3QA 1DOXA 5LNK1 4R3DA 4YXDB 2JQRB 4YWGG 1TS5A 1HXYD 3AE9B 2JX5A 2WDRB 1UWXA 2R61A 4ZRQA 4WQMA 2WXHA 1FCLA 4OVZA 2INNE 1SF0A 5C2TB 4P6VF 3AE6B 2RDGA 1TS2A 3NVYA 2QMTA 1N61A 1FEHA 2IGDA 3P1MA 1FIQA 3PZ7A 5BMGA 4TSSA 2NMQA 1FNVA 1VRAB 2K3UA 1VJKA 1GPXA 4OZAA 4RNAA 5D3DA 2OEDA 1E0ZA 1ZP0B 2JZPA 4A55A 1SE2A 3ZJVA 1JALA 4OZCA 2WXNA 3V05A 1FXAA 1VZ7A 2K0PA 2D5GA 4RFBA 1Q10A 1XO3A 4N58A 1E10A 2BW2A 2AX5A 1TKYA 4RGOS 4XWWA 1ACCA 1C78A 1K50A 4JE3B 1DOYA 3AE8B 3TSSA 1L4DB 4A6QA 4CQNA 3BZDB 4ITKA 2N7JA 2WXOA 1XLNA 3LB8C 1TKGA 4ARCA 1K52A 1KFYB 2PVOD 1UWMA 2V3NA 2W55A 1B9RA 2SAKA 2QIEB 5D3IB 1VZ6A 1E9MA 3FILB 3VR9B 3HRDD 3SFEB 1SIJA 1IGCA 1C9FA 4HEA1 4C7ZA 3NVVA 3R2TA 3W5VB 5I4DA 3ZYYX 2WXQA 4KKJA 3EGRA 1Y56A 4US8A 2E6XA 5G5HA 2EKIA 1ENFA 2LHDA 2K9XA 2MH7A 2IDYA 3BYTB 3GB1A 2DBYA 1SE3A 3B9JA 3Q69A 3TEXA 1N60A 4XE0A 1QQRA 1PGAA 2FBWB 4DXFA 1BXTA 5H8YE 5FK9C 3OWEB 5FKAC 3W2DA 1J7AA 3BWUD 2KACA 3Q8CA 2KDMA 1HZ6A 4KGSA 1L5PA 1L0VB 4N6EB 3P42A 1L6VA 2VZKD 2SEBD 5EE9A 1ZDVA 3AEBB 1I4HA 2INPE 2ONQA 1ESFA 3NS1A 2WU5B 2M19A 1UUPA 4TMAB 3NUHB 3IXSA 4JPSA 1FRRA 2WXRA 2Q5WD 1YQ4B 1D4BA 1K51A 2WXGA 4RGNA 3SR6A 2N9LA 4KKIA 2LGIA 5JXVA 3RPFC 5G5GA 1GB4A 3TUOA 3IT6B 4ARIA 4YSZB 2LMCA 5HHDG 2PTLA 3FILA 1F2RC 4KGTA 4OHJA 1PGBA 1I4RA 1KLUD 4WH4A 1QT9A 1TS4A 3R2IA 4L1BA 1D5ZC 2AQ1B 5EE1A 5BYRA 5GXGB 3AE5B 1TS3A 2NTSA 2K22A 1E6EB 1VDVA 4LK0M 2PW9A 4IKGA 1ET9A 1D5MC 3AE4B 1SEBD 3I57A 2X38A 3B2GA 2TSSA 5BMHA 2LHEA 4IDIA 2HDEA 2RMMA 2V3PA 1BMLC 5E6JA 3L4PA 4RF1A 5T8IA 1FO4A 3AV8A 2BB6A 1EWYC 4UDUC 3KLSX 2WLBA 1HZ5A 3KQ4A 2WU2B 3MHZA 1EM7A 2J42A 2PKOA 1XLOA 2G9HD 4ZOHC 1RM6C 3I9V1 2DWQA 2IJ0A 4L23A 1J7BA 3T3OA 4KGRA 2WS3B 3E56A 1XXGA 2BTEA 5EE3A 1YN3A 2ZW0A 4MH8A 2WXFA 4HKQA 1XLPA 3MFGA 5AUKA 2IGGA 4GLSC 1F0ZA 4XDCA 4YSYB 2KAJA 4NJCA 4USAA 1YMHE 2JU6X 3TEZA 3AE2B 2BB5A 1RYJA 3FC4A 2I2YA 2Z8LA 1I7HA 3AMZA 2KQ4X 1WGKA 3W9CB 2W82A 2WDQB 1PGXA 2WQYB 2GB1A 1UNSA 2MJEA 3HVZA 1EU4A 1WSPA 2XN9C 2YEPF 1F77A 3KWLA 3BYYB 4B0MA 4RGMA 1C4PA 1R7SA 3DWGC 2CJOA 1IBXB 1ET6A 1UGJA 1FCCC 3SFDB 1NEKB 1SSNA 1I4GA 3H8HA 4JWSC 1KH0A 3AEAB 1YNTE 2WNMA 2AQ3B 1JRPA 1CJEA 1L6UA 2LUMA 2W3SA 5HFYA 4AQ7A 1C79A 1JWUD 1L0XB 4EE2A 3DWMA 3MJ5A 1QOBA 4RGTA 1JCKB 1DYQA 1EU3A 2Y5PA 3LYYA 2BYTA 1MI0A 2J4XA 5MPOA 4YTPB 3CIRB 1I4PA 2PLPA 2I38A 3ZJTA 3UI3A 1MPEA 3RFZB 1FFUA 3VRBB 1HQRD 2FUG1 1JQ4A 2LEKA 2L52A 1KRHA 1QKZA 1V8CA 4C7YA 2WXKA 1DGJA 2FE8A 1QLBB 1T6BX 1B1ZA 4NAWB 5C3JB 2QSDA 2DLBA 4HROA 4WAFA 3GP7A 1DOIA 2N9KA 1IUEA 1SXTA 2G1EA 4ZHPA 1YJJA 2V4IB 5TSSA 2QJLA 5HI1A 4OZBA 4OW0A 2H88B 4KX6B 2BBCA 1PFDA 1V1PB 1IBXA 2JSVX 1WWTA 4US9A 2WXJA 2JYTA 2ZW1A 1AN8A 2RPVA 3BIID 3EUB2 3SEBA 3NRZA 3AN1A 3URYA 1IGDA 3WCQA 3Q8EA 1XCQL 1JROA 1VLBA 2CJNA 2ACZB 2NTTA 5EE0A 4YSXB 3AB5A 3B2FA 2HTME 1FRDA 1NYQA 3U4EG 4YT0B 4MACA 3BVZA 1N5XA 1N5WA 1MHHE 2ON8A 3U2SC 4M0WA 2CU3A 3BK2A 4A90A 1QILA 1JMLA 2QILA 2KN4A 1L4ZB 4WIPA 3HVDA 2DYMA 4A9AA 2JWUA 1PUTA 4RCOA 2IPKD 1ZXHA 2IGHA 2L32A 3AEEB 4N59A 4C56C 5BMIA 1RWSA 3IT4B 3AE1B 1P7EA 2B76B 3ETRA 1L0YB 1VR9A 1STEA 2E3TA 4H2AA 1QOGA 1QF6A 4GDLB 2OHFA 1FD6A 1NVID 3AEGB 2V0GA 4HJGE 1ROEA 1AYFA 3Q8FA 2JYEA 4O1NA 3W5UB 4ZHOA 2JXTA 2Y5CA 1AW7A 1F2RI 2XNAC 2EELA 1SJED 2MJDA 3U52E 3NVZA 3Q8BA 1OFFA 1CQVA 1FM0D 4HRSA 3ZJUA 3ZGZA 1A70A 3VQIA 1P7FA 4PT5A 3R8BA 1SJHD 1NENB 1V1PA 2WXPA 3V3XA 1KF6B 2M56B 1YN4A 1SBBB 1ZOYB 4IOIE 4WWMA 1GB1A 4YTMB 2LJIA 1YJIA 3PO0A 2KWDA 2LFIA 1FNUA 1LO5D 4P16A 1WYGA 3N9YC 1C4AA 1KLGD 1HA5A 5AUIA 1N62A 1TY2A 1XF5L 2WXLA 3AM9A 3TEYA 2K5PA 1PYWD 4GDKB 1TYGB 4D2KA 1T5XD 3BK1A 1FMAD 4MM3B 2BS4B 3TEWA 1ZPSA 4L2YA 2QEJC 1K53A 4HKZE 2KMMA 1KTKA 1NI3A 3BVMA 4Q2JA 3ABVB 1C76A 1QOFA 1I4QA 3IAS1 2W3RA 3GS2A 4LLGM 2WXIA 1EWCA 3FAHA 3P4RB 4XDDA 1OQRA 2BS3B 1FFVA 2GRIA 1JWSD 3P63A 4A8XC 1I4XA 2PVGC 3EA6A 1BUIC 4B0EA 3P4SB 1V1OA 1AWDA 1SE4A 1MHXA 1JWAD 1M4VA 1SB3C 2RDHA 3KWVA 3AE3B 3P4PB 3AEFB 2ICIA 1CZPA 1VZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K0P A;  1Q10 A;  1HZ5 A;  4MAC A;  1EM7 A;  1MHH E;  2ON8 A;  1K50 A;  2N7J A;  1JML A;  4KGR A;  2KN4 A;  2ZW0 A;  1K52 A;  2JWU A;  1MVK A;  2IGG A;  4GLS C;  1ZXH A;  2IGH A;  1YMH E;  2GI9 A;  2JU6 X;  5BMI A;  3FIL B;  2I2Y A;  1P7E A;  1IGC A;  2KQ4 X;  3MP9 A;  1C9F A;  1PGX A;  2GB1 A;  1FD6 A;  4HJG E;  2JXT A;  1F2R I;  2LHD A;  2EEL A;  3GB1 A;  1IBX B;  1PGA A;  1FCC C;  1P7F A;  2J52 A;  2KAC A;  3V3X A;  1KH0 A;  1YNT E;  2KDM A;  1GB1 A;  4IOI E;  2LUM A;  1HZ6 A;  4KGS A;  1HEZ E;  5HFY A;  2KWD A;  2J53 A;  1XCT L;  2ONQ A;  1XF5 L;  1MI0 A;  5HG2 A;  2PLP A;  2I38 A;  4D2K A;  3UI3 A;  1MPE A;  1D4B A;  1K51 A;  1K53 A;  4HKZ E;  2N9L A;  2LGI A;  5JXV A;  1QKZ A;  1GB4 A;  1UWX A;  5HHD G;  2PTL A;  3FIL A;  1F2R C;  1FCL A;  4KGT A;  1PGB A;  2QSD A;  4WH4 A;  2N9K A;  2QMT A;  2IGD A;  5BMG A;  5HI1 A;  4OZB A;  2NMQ A;  2PW9 A;  4IKG A;  4OZA A;  1IBX A;  2JSV X;  1MHX A;  2ZW1 A;  2OED A;  2RPV A;  5BMH A;  1IGD A;  2LHE A;  1XCQ L;  2JZP A;  2RMM A;  4OZC A; 
#chains in the Genus database with same CATH topology
 4K3B A;  3IAM 1;  4DDI D;  1OQQ A;  2WDV B;  4WJN A;  3L16 A;  4NZL B;  1MG8 A;  4EKU A;  2PE6 B;  2R2O A;  4TQ1 A;  3Q8A A;  1YQB A;  1XLQ A;  2BT6 A;  2BS2 B;  4W9K A;  2C9W B;  1EF1 A;  1E7P B;  1JRU A;  4P1B C;  3RMK C;  1VCB A;  1H4R A;  2IND C;  2KX0 A;  3MP9 A;  3HK0 A;  3DQV A;  1TZO A;  3A4R A;  4ZRP A;  4WWP A;  3VH3 B;  4KSK C;  1D6E C;  2XEW A;  2DAF A;  4RF0 A;  3S2A A;  1FNW A;  4M8M A;  3ZQ4 A;  4EFO A;  1V97 A;  2AQ2 B;  2Z0E B;  2BQQ A;  4FXC A;  2N0S B;  2L83 A;  3LXF A;  1TKE A;  1OGW A;  2AYO B;  4C80 A;  1WYW B;  1XCT L;  3JYU A;  4KZC A;  2WYQ A;  2Y3A A;  3L08 A;  1T0S C;  3ZUN A;  3ONS A;  1WF9 A;  4YWG G;  3N3K B;  1HXY D;  2JX5 A;  2KFK A;  2WDR B;  2DNF A;  4FHK A;  4WQM A;  2WXH A;  1FCL A;  4OVZ A;  1Y8R C;  1N61 A;  1N6Z A;  3M63 B;  3DBH I;  5CX3 A;  1I35 A;  4TSS A;  2NMQ A;  1VRA B;  4ZRK A;  2K3U A;  2AWT A;  3EFC A;  2V1Y A;  2OED A;  2KTR B;  1D3Z A;  1HE8 A;  3ZDT A;  1CMX B;  1JAL A;  1IPG A;  4PK1 A;  3T8M A;  2D5G A;  1Q10 A;  3N30 A;  4N58 A;  1E10 A;  2QDF A;  2OJW A;  4XWW A;  1XT9 B;  2GMI C;  2KMC A;  4JE3 B;  5D2M B;  1DOY A;  1GC7 A;  4CQN A;  2J0M A;  2EMT A;  4GU2 A;  1K52 A;  2KDI A;  1UWM A;  3T9L A;  1B9R A;  4JIO U;  4F8C B;  2SAK A;  5D3I B;  3VR9 B;  3SFE B;  5E6O A;  1C9F A;  1KJT A;  4HEA 1;  4C7Z A;  1WJ6 A;  2JWZ A;  2WXQ A;  2E6X A;  4PYZ A;  2KQS A;  1ENF A;  2K9X A;  2DBY A;  1SE3 A;  2YVC A;  3B9J A;  3M3J A;  3TEX A;  1N60 A;  2FBW B;  4HWI B;  1Z2M A;  3OWE B;  3BWU D;  5CHF A;  4TKN A;  3V6E B;  2L00 B;  2C60 A;  4AJY B;  1L6V A;  3RUI B;  2CKH B;  5EE9 A;  1ZDV A;  3AEB B;  3PLU A;  5JZE B;  2M19 A;  3Q3N C;  1WGY A;  3RD2 A;  3N1Y C;  3MHS D;  3R66 C;  2LGS A;  3WA0 A;  1K51 A;  2MLB A;  2LGI A;  5JXV A;  3RPF C;  4LCD E;  1GB4 A;  1MJD A;  3ECI A;  1V5O A;  2D3B A;  1XD3 B;  4BOS C;  1WGG A;  3QIJ A;  4KGT A;  2CU1 A;  1QT9 A;  2I1J A;  3MC8 A;  1D5Z C;  5BYR A;  2K22 A;  1VDV A;  2MBB B;  3H6N A;  3M62 B;  2M17 A;  1WZ3 A;  1K8R B;  3TBL D;  1IYF A;  2TSS A;  5BMH A;  4IDI A;  2HDE A;  4K7S A;  3KYD D;  3L4P A;  3NS8 A;  4KVG B;  2IYD B;  2IO3 B;  1P0R A;  4UDU C;  4DHJ D;  3MHZ A;  2WU2 B;  2J42 A;  5DPS A;  5GMV A;  2DX5 B;  1V49 A;  2L8J A;  2PE9 A;  4WWN A;  4KGR A;  2N9P C;  5EE3 A;  1SGH A;  3I63 C;  4YSY B;  2KAJ A;  4USA A;  3DVG Y;  2JU6 X;  2BB5 A;  3FC4 A;  2DYB A;  1I7H A;  1WXM A;  3AMZ A;  3PRP B;  2WDQ B;  4DK5 A;  1LM8 B;  3HVZ A;  3H1U A;  3BYY B;  3NG0 A;  2LGX A;  2A4Z A;  1EF5 A;  1IBX B;  3DHG C;  3H7S A;  3SFD B;  2D07 B;  3AEA B;  2AQ3 B;  1JRP A;  2QC8 A;  2GBN A;  2LUM A;  4ICV A;  3ZNI D;  4MEL A;  4AQ7 A;  3PRZ A;  4M0W B;  5G55 A;  3B08 A;  3MJ5 A;  3PLV A;  2C5L C;  4RGT A;  1OEY J;  5LLI A;  1MG4 A;  4YTP B;  3OLM D;  3ZJT A;  1MPE A;  2KO3 A;  5IN7 A;  1DGJ A;  2M8S A;  2FE8 A;  1B1Z A;  4GIV A;  4GSW A;  4BVU C;  2QSD A;  2DLB A;  3GP7 A;  2KOX A;  1IUE A;  2NBV B;  3CMM B;  1WJN A;  1PFD A;  2BBC A;  1V1P B;  2JSV X;  2ZW1 A;  3URY A;  3SEB A;  3NRZ A;  4HDO A;  1XCQ L;  2ZPY A;  1VLB A;  5EE0 A;  2ACZ B;  3L54 A;  3UQB A;  4MAC A;  4P7I A;  3BVZ A;  5BO4 B;  2ASQ A;  2KN4 A;  4WIP A;  2DYM A;  4S17 A;  2IPK D;  1J19 A;  1V5T A;  4FN2 A;  2L32 A;  3A9K A;  4C56 C;  1RWS A;  3EEC A;  3AE1 B;  2KT7 A;  2E3T A;  4BBN C;  3WAP A;  1FD6 A;  3H7P A;  4O1N A;  1F2R I;  3ALB A;  1SJE D;  1OFF A;  5AZF A;  2OOB B;  3ZGZ A;  4M8N A;  3R8B A;  3PVL A;  1SJH D;  2M56 B;  4ANX A;  1YX5 B;  1YJI A;  2KLG A;  4GOC A;  4KSL C;  1C4A A;  2LAS A;  2HJ1 A;  5AUI A;  1TY2 A;  4IM3 A;  2AEH A;  2FAZ A;  3TEY A;  2M0X A;  1PYW D;  4D2K A;  1TYG B;  5D94 A;  3BK1 A;  1FMA D;  2BS4 B;  4FLH A;  4L2Y A;  2QEJ C;  3BVM A;  4Q2J A;  3ABV B;  1C76 A;  4QAY A;  2KHW B;  2WXI A;  3P4R B;  1OQR A;  2GRI A;  4LNO A;  3RNG C;  4A8X C;  4MJS B;  2N1V A;  3Q3O C;  4MDK E;  4EZJ A;  2REX A;  1AWD A;  1SE4 A;  1V6E A;  1MHX A;  3QWZ B;  3W1Y A;  1VZ8 A;  1H8C A;  5BYQ A;  3P2B A;  2WXM A;  3C0R B;  1RFK A;  1J7C A;  4NJ6 A;  1TY0 A;  1GAQ B;  2H89 B;  2IO0 B;  4E71 A;  4REZ A;  3VUW A;  1NBF C;  1YQ3 B;  4GDK A;  4LJO B;  3C8Y A;  1MVK A;  3RNC C;  1SE9 A;  3Q14 C;  1XEE A;  1MFW A;  2LRW A;  3BY4 B;  3CF6 E;  1E8Y A;  5BYS A;  2B3A A;  2N1W A;  4XGA B;  1N63 A;  2PJH A;  1Q5W B;  1WXQ A;  3CWI A;  4CO7 A;  4IM2 A;  4MGY E;  5H92 C;  1J8C A;  2WP9 B;  4RH6 A;  3A1Q A;  2X8X X;  4DBG A;  4ZYN A;  1D5X C;  4AS1 A;  2NS5 A;  4WJQ A;  2J53 A;  1RFA A;  2J0J A;  2L0F A;  3PRE A;  1UH6 A;  3T3N A;  4RM8 A;  5HG2 A;  2WX1 A;  1T3Q A;  1DOX A;  5LNK 1;  2O6V B;  2FCM A;  5LXH A;  3NHE B;  2JRH A;  1OTR B;  2R61 A;  4ZRQ A;  2K39 A;  1SF0 A;  5C2T B;  4P6V F;  2LVO A;  3EC8 A;  4W9D A;  5L83 A;  1TS2 A;  2QMT A;  1FEH A;  2IGD A;  4EEW A;  1FIQ A;  3PZ7 A;  4HCP B;  3TL5 A;  3OG5 A;  1VJK A;  1GPX A;  2BGF A;  1E0Z A;  1ZP0 B;  2DHZ A;  4OZC A;  2NVU I;  2ZZP B;  2BW2 A;  1TKY A;  2CS4 A;  1EUV B;  3AE8 B;  4A6Q A;  1E5W A;  4ARC A;  1KFY B;  2PVO D;  4IM0 A;  2NPT B;  2WGS A;  1WIA A;  1QZE A;  1WZ0 A;  1E9M A;  2K6D B;  3HRD D;  1Q1O A;  1WRD B;  3AU5 A;  3NVV A;  3R2T A;  3W5V B;  1E8Z A;  1WX7 A;  5G5H A;  3MJW A;  3Q3M C;  3V62 A;  2LHD A;  4W9F A;  4CHK A;  2JY6 A;  3Q69 A;  3PGE A;  4XE0 A;  1KM7 A;  3N32 A;  4DXF A;  4LNN A;  5H8Y E;  5FKA C;  4MM3 A;  3Q8C A;  2KDM A;  3HM3 A;  1HZ6 A;  1L5P A;  4AJW A;  3DDC B;  1L0V B;  4OVV A;  2VZK D;  3NS1 A;  3PZD A;  4WWO A;  4GB9 A;  3IXS A;  4JPS A;  2WXR A;  2Q5W D;  1D4B A;  4HJK A;  3SR6 A;  2N9L A;  3N20 C;  3VDZ A;  4A3P A;  2LMC A;  3FIL A;  3HM6 X;  4JLC A;  4OHJ A;  4WH4 A;  1TS4 A;  1E7U A;  2KJH B;  5GXG B;  3PT2 B;  3AE5 B;  3A9J A;  4LK0 M;  4RMA A;  4OVU A;  4KDI C;  1WX9 A;  4WQO B;  1SEB D;  4LNF A;  3IG3 A;  3IVF A;  2MBH A;  1BML C;  5E6J A;  2CHZ A;  4RF1 A;  1EWY C;  2LUE A;  2LZ6 A;  2WLB A;  1HZ5 A;  2YLM A;  3KQ4 A;  1EM7 A;  3D32 A;  3QC8 B;  2PKO A;  5IAA C;  4ZOH C;  2DWQ A;  1J7B A;  2KDE B;  1NI2 A;  1WXA A;  2WS3 B;  3E56 A;  1XXG A;  4HPL B;  1YN3 A;  4MH8 A;  1WE6 A;  4HKQ A;  3PHW B;  1WX8 A;  3JW0 X;  5AUK A;  2IGG A;  4NJC A;  2RPQ A;  1YMH E;  2K8B A;  1ZGU B;  3AE2 B;  2KWU B;  2Z8L A;  1IP9 A;  1WGK A;  3V60 A;  1PGX A;  2WQY B;  1UNS A;  1TTN A;  1EU4 A;  1WSP A;  2XN9 C;  3VH4 B;  2LXC A;  2CHX A;  2FIF A;  4KZ0 A;  4EZL A;  4XX5 A;  3H8H A;  2LVQ A;  1YNT E;  1L6U A;  5HFY A;  2O2V A;  4URK A;  2BYV E;  1JWU D;  1L0X B;  1UBI A;  3WAM A;  2A5U A;  2Y5P A;  3LYY A;  4KIK A;  3CIR B;  4ICU A;  3PSE B;  2I38 A;  2EKE C;  3GZN B;  3A1Q B;  3UI3 A;  3RFZ B;  2FUG 1;  3NY5 A;  3PRM B;  2L52 A;  2RGF A;  4FJY A;  4I6N B;  3Q2A C;  2V9H A;  5C3J B;  4NAW B;  3U7D A;  5C23 A;  4NNJ B;  4HRO A;  3ZRF A;  4HCN B;  3V61 A;  2FNJ B;  1DOI A;  1TIF A;  2N9K A;  1WY8 A;  4ZHP A;  2V4I B;  5TSS A;  5HI1 A;  4OW0 A;  2H88 B;  1E7V A;  3RUL A;  4IW0 A;  1RLF A;  2XK5 A;  3DVG X;  3BII D;  2D11 A;  3ZJU A;  1WR6 E;  1IGD A;  5KHO A;  3WCQ A;  4AWJ A;  1FRD A;  3U4E G;  4YT0 B;  4A20 A;  1YD8 U;  4FJZ A;  4ASW C;  3U2S C;  1TZ1 A;  1YIW A;  1HTQ A;  2CU3 A;  3BK2 A;  3TIX A;  4GGQ A;  3GE3 C;  4JGH B;  3C19 A;  4A9A A;  2JWU A;  3L17 A;  3ZDM C;  1ZXH A;  2IO1 B;  4N59 A;  1P3Q U;  5HKH A;  2B76 B;  2CHW A;  2G4S A;  4H2A A;  2L3Z A;  4M00 A;  4GDL B;  2V0G A;  1R4M B;  4K7W A;  4HJG E;  3Q8F A;  4ZHO A;  2JXT A;  3K9O B;  2LXA A;  3JSV B;  3OAW A;  2EEL A;  2MJD A;  3MC9 A;  3NVZ A;  1YOV B;  4HRS A;  1FM0 D;  3L0W B;  2C7N B;  2IBI B;  1A70 A;  3VQI A;  2AL6 A;  1WGR A;  1SBB B;  3HHM A;  1GB1 A;  4WWM A;  4YTM B;  2LJI A;  2DZI A;  3RI7 C;  3KUZ A;  5G2N A;  1LO5 D;  4P16 A;  2MRP A;  1WI0 A;  2KWV B;  4ANU A;  2KC1 A;  4E74 A;  2WXL A;  1GUA B;  3QJZ A;  2K5P A;  3ML8 A;  3X23 A;  4MM3 B;  3TEW A;  1ZPS A;  2KMM A;  1XQQ A;  5DPR A;  2D3G A;  4KV2 A;  4LLG M;  4XDD A;  4GMV A;  4MSQ B;  1FFV A;  1JWS D;  2K25 A;  2KVZ A;  4B0E A;  2QHO A;  1A5R A;  2ZNV B;  2DZM A;  1JWA D;  1M4V A;  5CHV C;  1SB3 C;  2BVC A;  2LGY A;  3KWV A;  4BAX A;  4R3D A;  3NZS A;  4IC7 B;  1FXI A;  2DYO A;  3VRA B;  1ZKH A;  3E9S A;  2K8H A;  5AEK B;  2WWZ A;  1QOA A;  4BKS A;  1CK1 A;  1JWM D;  2YEP B;  3GOE A;  3AE7 B;  3B0A A;  4XWT A;  1ZE3 D;  2L1A A;  3NVW A;  4MT5 A;  1GOZ A;  3VR8 B;  3I5J C;  1UEL A;  2KFK B;  3GZN I;  2GI9 A;  3AEC B;  3O13 A;  5CTR C;  4JX1 C;  3LDZ E;  4LTU A;  1ZXI A;  4AOF A;  5D7G A;  2L76 A;  3P4Q B;  2M0A A;  4NAM A;  2HE7 A;  1C77 A;  2BWF A;  2K6Q A;  1ISN A;  2KJR A;  3AH7 A;  1F1H A;  3RZF A;  5LXI B;  1AAR A;  4BKT A;  2PIA A;  3R7Q A;  4TQ0 A;  2J52 A;  3J9C A;  3MC0 B;  5C1Z A;  2MJ3 A;  5FR3 A;  1HEZ E;  4DHJ B;  3U7Z A;  4MEM A;  2JPH A;  3EFU A;  3PZ8 A;  5DCN A;  4XYC A;  1C4C A;  4FBJ B;  3JVZ X;  4N9F 4;  1SIF A;  2N4F A;  4ZYS A;  2KJ6 A;  1L2N A;  2FUH B;  2MSE D;  2RSU A;  2CR5 A;  2LJ5 A;  2JQR B;  3VUY A;  2O2V B;  5E6P A;  5AZH A;  3RYT A;  4HXD A;  2M4N A;  2RDG A;  3NVY A;  5BMG A;  1R4M I;  4W9L A;  1FNV A;  4JQW C;  4F1S A;  4K3C A;  4OZA A;  4B9K A;  4RNA A;  3SD5 A;  2JZP A;  4FHJ A;  4LNK A;  4NPN A;  4G0N B;  4A55 A;  4PYU A;  1FXA A;  5TR5 A;  4YL8 A;  1VZ7 A;  4RFB A;  2L0T A;  1XO3 A;  3AXC A;  4W9E A;  3I3T B;  4RGO S;  1ACC A;  2JT4 B;  1C78 A;  5IO9 A;  3TSS A;  1L4D B;  4ITK A;  4BKS D;  3CSF A;  3KUD B;  5E6N A;  4NY0 A;  2BF8 B;  3VAW A;  2KC2 A;  2V3N A;  3RN9 C;  4M02 A;  1VZ6 A;  1SIJ A;  1T0Q C;  1WJU A;  5I4D A;  3ZYY X;  4KKJ A;  3EGR A;  4US8 A;  2EKI A;  1OQY A;  2MH7 A;  3BYT B;  2MCN B;  1PGA A;  2MBO A;  2GBM A;  3W2D A;  2KAC A;  2LI5 A;  2KFJ A;  5D6J B;  2KTR A;  3RNF C;  2GBR A;  1WXS A;  2FCQ A;  1GJZ A;  3QAR A;  3QCA A;  2SEB D;  3VTV A;  3IHP C;  4ZRI A;  2INP E;  2ONQ A;  2HTH A;  1UGM A;  4ZDV A;  2GLS A;  4TMA B;  3NUH B;  2NCN A;  1FRR A;  3RNE C;  1YQ4 B;  2D10 A;  1WH3 A;  2WXG A;  4RGN A;  4KKI A;  1YX6 B;  5G5G A;  4W9H A;  3ZLZ A;  2FCN A;  3SHQ A;  1C1Y B;  1V80 A;  4YSZ B;  1F2R C;  1PGB A;  1KLU D;  4JL9 A;  2UYZ B;  3R2I A;  2WHI A;  4L1B A;  5EE1 A;  3AU4 A;  2ZEQ A;  3DVN V;  4NQK E;  4IWP A;  4MH0 E;  4XZ4 A;  2NTS A;  2PW9 A;  5EDS A;  3DHH C;  5IA7 A;  4IKG A;  1WGH A;  2MHJ A;  2KK8 A;  2LVP A;  2Y5B B;  2RDB C;  3I57 A;  2X38 A;  3B2G A;  3OJ4 B;  4LNI A;  1FO4 A;  3AV8 A;  2QCZ A;  3ZIM A;  1C3T A;  2BB6 A;  3KLS X;  2INC C;  4E3C A;  1RM6 C;  2IY1 B;  2JF5 A;  4L23 A;  3T3O A;  3OJ3 A;  3V6C B;  2WXF A;  5L95 C;  4IUM B;  4I6P A;  4GLS C;  4XDC A;  3DBR B;  4M01 A;  4LDT D;  3TEZ A;  1RYJ A;  2I2Y A;  2GB1 A;  2MJE A;  1L7Y A;  2YEP F;  3WAO A;  1F77 A;  3KWL A;  4B0M A;  5IKC M;  3HIZ A;  3ZTD A;  4RGM A;  1R7S A;  2CJO A;  1UGJ A;  1NEK B;  3GE8 C;  1I4G A;  3VXW A;  2VRR B;  2WNM A;  3DOW A;  1C79 A;  4C4V A;  2J0K A;  4EE2 A;  1E8X A;  1JCK B;  1DYQ A;  2DAJ A;  2KXJ A;  2BYT A;  5MPO A;  2ZNV C;  2AL3 A;  3APF A;  3ENE A;  3TJP A;  1I4P A;  3ZNH B;  4W9J A;  2GOW A;  4FJV B;  2ZVO A;  2WX0 A;  3A9K B;  4TUU A;  3VRB B;  4HPM B;  3K9P B;  1QKZ A;  1V8C A;  4C7Y A;  1QLB B;  1T6B X;  2KYW A;  3B1L X;  3H7P B;  2K8C A;  4WAF A;  5AZG A;  2XBB C;  5JHB A;  1LXD A;  1SXT A;  2LRU A;  3U8Z A;  1YJ1 A;  3PV1 A;  2NBU A;  2KWC A;  2JZZ A;  3QK0 A;  1IBX A;  1WWT A;  4US9 A;  2JYT A;  3EUB 2;  2RPV A;  3Q8E A;  4II2 B;  2CJN A;  3AB5 A;  3B2F A;  3Q3J A;  1NYQ A;  1J0G A;  5J18 A;  1N5X A;  2V3S A;  2ON8 A;  4M0W A;  4RM9 A;  1QIL A;  4MGK E;  1JML A;  2QIL A;  4EOY A;  4K7U A;  1L4Z B;  3HVD A;  4TV3 A;  2N9E B;  2MW5 A;  1PUT A;  1S3S G;  3VUX A;  2IGH A;  5DPT A;  3QHT A;  5BMI A;  1P7E A;  3ETR A;  1L0Y B;  1VR9 A;  1UBQ A;  1QF6 A;  3SDL C;  1NVI D;  3W5U B;  2KD0 A;  2JYE A;  1KOT A;  2Y5C A;  1AW7 A;  3TMP B;  1HTO A;  2BYF A;  2HD5 B;  3Q8B A;  1CQV A;  3PTF C;  1P7F A;  4PT5 A;  2BPS A;  1NEN B;  1V1P A;  2GBJ A;  4LDT B;  1KF6 B;  3KYC D;  1GC6 A;  1YN4 A;  1ZOY B;  4S0R A;  4DXA B;  2UU7 A;  2UWQ A;  2N7E A;  4BZA A;  4FAD A;  2OJR A;  2LFI A;  1WYG A;  1T0Y A;  3N9Y C;  1KLG D;  1HA5 A;  4W9G A;  3AM9 A;  2K1F A;  1V2Y A;  2NR2 A;  2MWS B;  3W1S C;  4GDK B;  1UF0 A;  4K81 A;  2D2Q A;  1K53 A;  4HKZ E;  1R4N I;  2VH2 A;  2KVR A;  1I4Q A;  1WM2 A;  3DBR I;  3DVN U;  3GS2 A;  3ZTC A;  3RNA C;  1EWC A;  3FAH A;  3A4S C;  2PVG C;  3EA6 A;  4NQL B;  1LFD A;  1U4A A;  2C7M B;  4J6I A;  3RT3 B;  3AEF B;  4C00 A;  3AUL A;  2ICI A;  2OHF A;  1CZP A;  1E8W A;  2I1K A;  4HK2 A;  4DQO C;  1WM3 A;  5JHA A;  1JW9 D;  1TJE A;  2VZK B;  1WRI A;  4PS7 A;  4P1C C;  1LQB A;  1PDX A;  2KQ7 A;  1YN5 A;  4F7Z A;  3NJT A;  1ZDX A;  2MEK A;  3W1S A;  1ZW7 A;  4J3O D;  1ZUD 2;  3L10 B;  3AI5 A;  4WUR A;  4KDL B;  1JWB D;  3DHI C;  2EMS A;  4JWU C;  3QA8 A;  1TT5 B;  4MJS A;  1NYR A;  3BVG A;  4WJO A;  4YTN B;  4BKG A;  4DXG A;  1P98 A;  1V86 A;  3R3M A;  2ZCC A;  2PMV A;  3ZRC A;  4FA6 A;  3NZ3 A;  3IBE A;  1M94 A;  3AED B;  2W54 A;  1F52 A;  2KTF A;  3VTW A;  3IFW B;  2LD9 A;  3HUI A;  3KUC B;  4YXD B;  1TS5 A;  2L05 A;  3AE9 B;  4MGI E;  1GG3 A;  1UWX A;  4C4V B;  4PS3 A;  1FPY A;  2INN E;  3AE6 B;  2N9X A;  4NJ7 A;  3DBL B;  3P1M A;  2KDF B;  2Z59 B;  2PEA A;  1BT0 A;  5J2R A;  2DZK A;  1RRB A;  3RNB C;  1NDD A;  1GNU A;  3N1X C;  5J17 A;  5D3D A;  2KNB A;  1SE2 A;  3ZJV A;  3V05 A;  2WXN A;  1Z5S B;  4EUT A;  2K0P A;  5KHQ A;  2AX5 A;  1KLV A;  1P1A A;  1WE7 A;  1K50 A;  4I6L B;  3BZD B;  1VD2 A;  2N7J A;  2WXO A;  2LGD A;  1XLN A;  3LB8 C;  1TKG A;  2J7Q B;  2MP2 A;  4B95 A;  2BKF A;  1WMH A;  2JRI B;  2O6V A;  3FKY A;  2W55 A;  4AUQ C;  2QIE B;  2MBE A;  3FIL B;  1IGC A;  3VHT C;  3EHV A;  1OEY A;  4EZK A;  3KVF B;  1Y56 A;  2IZV B;  3A9J B;  1UZX B;  2G45 B;  2IDY A;  3GB1 A;  4HPP A;  4G11 A;  1QQR A;  3ZNG C;  3H9D A;  1BXT A;  5FK9 C;  1TBE A;  1J7A A;  2MQJ A;  4BBN F;  4G3X B;  1LGR A;  3UF8 A;  2ZPN A;  4KGS A;  3U30 A;  2V4L A;  4ANW A;  2R2Q A;  3BIN A;  4N6E B;  3QQ8 B;  3P42 A;  3ML9 A;  2MA9 B;  1I4H A;  2IY0 B;  1ESF A;  2WU5 B;  4BFR A;  1G6J A;  1UUP A;  2DZJ A;  3O65 B;  2D3A A;  2NPT A;  3TUO A;  3ZNZ B;  3IT6 B;  4FUL A;  4ARI A;  3QAQ A;  5HHD G;  2PTL A;  1T0R C;  2ZJD A;  3ZXV A;  1I4R A;  4GN1 A;  2AQ1 B;  4MSM B;  4DHZ B;  1TS3 A;  1E6E B;  4WAA A;  2KX3 A;  3MTN B;  1ET9 A;  2ZVN A;  1D5M C;  3AE4 B;  3VFK A;  2G3Q B;  1WXV A;  2LHE A;  4A3O A;  2GBK A;  1WJ4 A;  2RMM A;  2V3P A;  5T8I A;  3Q6B A;  4HVB A;  1X1M A;  3DCG A;  1XLO A;  2G9H D;  2W9N A;  4DHZ E;  2C7H A;  3I9V 1;  4KIK B;  2IJ0 A;  3ZW3 A;  4IWQ A;  4PS8 A;  2BTE A;  4ACF A;  2ZW0 A;  1XLP A;  1WGD A;  2O6V D;  3MFG A;  1F0Z A;  3QX1 A;  2RD0 A;  3CST A;  3DPD A;  2KLC A;  2KQ4 X;  3W9C B;  2W82 A;  2Z0D B;  3N1Z C;  2BKR B;  1E90 A;  3Q3F A;  1P9D U;  1C4P A;  3DWG C;  3DBL I;  3KW5 B;  2XK5 B;  1ET6 A;  4MGZ E;  2JVC A;  1FCC C;  5DPW A;  1SSN A;  4JWS C;  1KH0 A;  2JXX A;  3UIP B;  2N7D A;  1CJE A;  2W3S A;  3APD A;  2HJ8 A;  4W9I A;  4IG7 B;  3L13 A;  3DWM A;  4BOZ B;  1QOB A;  2KMA A;  3UQA A;  3R7R A;  1TGZ B;  1EU3 A;  1I42 A;  1MI0 A;  2J4X A;  2PLP A;  2FID A;  4XC2 A;  2JUO A;  2ZCB A;  3A33 B;  3SU8 X;  1FFU A;  1JQ4 A;  1HQR D;  1PQS A;  2LEK A;  1KRH A;  2LWP A;  2WXK A;  3VTU A;  3PHX B;  2M1M A;  1RAX A;  3RCZ A;  2IO2 B;  2KN5 A;  2G1E A;  5FR6 A;  1YJJ A;  2QJL A;  4OZB A;  4HLE A;  1Q0W B;  4KX6 B;  3ZXR A;  2WXJ A;  1AN8 A;  3AN1 A;  1JRO A;  2NTT A;  4YSX B;  2L7R A;  3PPA A;  2HTM E;  4X57 B;  3NOB A;  5IOI A;  3X0W A;  1N5W A;  4ANV A;  1MHH E;  4DDG D;  1WR1 A;  4A90 A;  3WAL A;  2JZ3 B;  3VVW B;  3KH0 A;  4RCO A;  4ZRJ A;  3M95 A;  2DEN B;  3AEE B;  2MX2 A;  3IT4 B;  5JH5 C;  1STE A;  1QOG A;  4NAW A;  3DBH B;  3AEG B;  1ROE A;  1AYF A;  1FXT B;  3ZO5 B;  3RZW C;  3PS6 A;  2XNA C;  1UD7 A;  4CYE A;  1EO6 A;  3U52 E;  2MP2 B;  1WFY A;  4WJP A;  1V9J A;  2KAN A;  1WMH B;  2VH1 A;  3WIM A;  1F9J A;  4G50 A;  1R4N B;  4AP4 C;  2WXP A;  3V3X A;  4IOI E;  3PO0 A;  2KWD A;  3TCA A;  3WAN A;  2KKC A;  1FNU A;  4B6W A;  3UIO B;  3ZVV A;  2RR9 A;  1N62 A;  1XF5 L;  4LJP B;  1T5X D;  1V81 A;  3LJ3 A;  4GXB A;  4HDQ A;  1KTK A;  3UGB B;  1NI3 A;  2FCS A;  2PPH A;  2BWE S;  5CHW A;  1QOF A;  3IAS 1;  3UIN B;  2W3R A;  5IP4 D;  4K1R B;  2BS3 B;  3ZKJ C;  1S1Q B;  4GDL A;  4IWO A;  3DBS A;  3P63 A;  2MBQ A;  1I4X A;  1BUI C;  3APC A;  2KZR A;  3JSV A;  3P4S B;  1V1O A;  4W9C A;  4DWF A;  2NBW B;  2BYE A;  2RDH A;  3NZU A;  3AE3 B;  3P4P B;  2KDB A;  4II3 B;  2D3C A;  2G4D B;  2WDT B; 
#chains in the Genus database with same CATH homology
 4DQO C;  3IAM 1;  5BYQ A;  1OQQ A;  2WXM A;  1JW9 D;  2WDV B;  1RFK A;  1FXI A;  1J7C A;  1TJE A;  1TY0 A;  4NZL B;  1GAQ B;  2VZK B;  1WRI A;  2H89 B;  2DYO A;  3VRA B;  3E9S A;  1PDX A;  4TQ1 A;  1QOA A;  1YN5 A;  3Q8A A;  1CK1 A;  4REZ A;  1JWM D;  2YEP B;  1XLQ A;  3AE7 B;  4XWT A;  2BT6 A;  2BS2 B;  1ZE3 D;  1YQ3 B;  1ZDX A;  2L1A A;  2MEK A;  3W1S A;  3NVW A;  4MT5 A;  1GOZ A;  3C8Y A;  1MVK A;  4J3O D;  3VR8 B;  1XEE A;  2GI9 A;  1E7P B;  3AEC B;  3O13 A;  4JX1 C;  5BYS A;  1ZUD 2;  4LTU A;  3MP9 A;  1ZXI A;  5D7G A;  4WUR A;  1N63 A;  1TZO A;  3P4Q B;  4ZRP A;  1JWB D;  2M0A A;  4NAM A;  4JWU C;  1WXQ A;  1C77 A;  1D6E C;  3CWI A;  1NYR A;  3AH7 A;  3BVG A;  4YTN B;  5H92 C;  2PIA A;  4RF0 A;  4TQ0 A;  4DXG A;  2WP9 B;  1FNW A;  2J52 A;  4RH6 A;  3ZQ4 A;  3J9C A;  1V97 A;  3MC0 B;  1D5X C;  2AQ2 B;  2MJ3 A;  2PMV A;  4FXC A;  1HEZ E;  2N0S B;  5FR3 A;  4AS1 A;  2L83 A;  3U7Z A;  3LXF A;  2J53 A;  1TKE A;  3PZ8 A;  3NZ3 A;  1C4C A;  4C80 A;  1XCT L;  3AED B;  2W54 A;  2Y3A A;  3T3N A;  4ZYS A;  5HG2 A;  3HUI A;  1T3Q A;  1DOX A;  5LNK 1;  4R3D A;  4YXD B;  2JQR B;  4YWG G;  1TS5 A;  1HXY D;  3AE9 B;  2JX5 A;  2WDR B;  1UWX A;  2R61 A;  4ZRQ A;  4WQM A;  2WXH A;  1FCL A;  4OVZ A;  2INN E;  1SF0 A;  5C2T B;  4P6V F;  3AE6 B;  2RDG A;  1TS2 A;  3NVY A;  2QMT A;  1N61 A;  1FEH A;  2IGD A;  3P1M A;  1FIQ A;  3PZ7 A;  5BMG A;  4TSS A;  2NMQ A;  1FNV A;  1VRA B;  2K3U A;  1VJK A;  1GPX A;  4OZA A;  4RNA A;  5D3D A;  2OED A;  1E0Z A;  1ZP0 B;  2JZP A;  4A55 A;  1SE2 A;  3ZJV A;  1JAL A;  4OZC A;  2WXN A;  3V05 A;  1FXA A;  1VZ7 A;  2K0P A;  2D5G A;  4RFB A;  1Q10 A;  1XO3 A;  4N58 A;  1E10 A;  2BW2 A;  2AX5 A;  1TKY A;  4RGO S;  4XWW A;  1ACC A;  1C78 A;  1K50 A;  4JE3 B;  1DOY A;  3AE8 B;  3TSS A;  1L4D B;  4A6Q A;  4CQN A;  3BZD B;  4ITK A;  2N7J A;  2WXO A;  1XLN A;  3LB8 C;  1TKG A;  4ARC A;  1K52 A;  1KFY B;  2PVO D;  1UWM A;  2V3N A;  2W55 A;  1B9R A;  2SAK A;  2QIE B;  5D3I B;  1VZ6 A;  1E9M A;  3FIL B;  3VR9 B;  3HRD D;  3SFE B;  1SIJ A;  1IGC A;  1C9F A;  4HEA 1;  4C7Z A;  3NVV A;  3R2T A;  3W5V B;  5I4D A;  3ZYY X;  2WXQ A;  4KKJ A;  3EGR A;  1Y56 A;  4US8 A;  2E6X A;  5G5H A;  2EKI A;  1ENF A;  2LHD A;  2K9X A;  2MH7 A;  2IDY A;  3BYT B;  3GB1 A;  2DBY A;  1SE3 A;  3B9J A;  3Q69 A;  3TEX A;  1N60 A;  4XE0 A;  1QQR A;  1PGA A;  2FBW B;  4DXF A;  1BXT A;  5H8Y E;  5FK9 C;  3OWE B;  5FKA C;  3W2D A;  1J7A A;  3BWU D;  2KAC A;  3Q8C A;  2KDM A;  1HZ6 A;  4KGS A;  1L5P A;  1L0V B;  4N6E B;  3P42 A;  1L6V A;  2VZK D;  2SEB D;  5EE9 A;  1ZDV A;  3AEB B;  1I4H A;  2INP E;  2ONQ A;  1ESF A;  3NS1 A;  2WU5 B;  2M19 A;  1UUP A;  4TMA B;  3NUH B;  3IXS A;  4JPS A;  1FRR A;  2WXR A;  2Q5W D;  1YQ4 B;  1D4B A;  1K51 A;  2WXG A;  4RGN A;  3SR6 A;  2N9L A;  4KKI A;  2LGI A;  5JXV A;  3RPF C;  5G5G A;  1GB4 A;  3TUO A;  3IT6 B;  4ARI A;  4YSZ B;  2LMC A;  5HHD G;  2PTL A;  3FIL A;  1F2R C;  4KGT A;  4OHJ A;  1PGB A;  1I4R A;  1KLU D;  4WH4 A;  1QT9 A;  1TS4 A;  3R2I A;  4L1B A;  1D5Z C;  2AQ1 B;  5EE1 A;  5BYR A;  5GXG B;  3AE5 B;  1TS3 A;  2NTS A;  2K22 A;  1E6E B;  1VDV A;  4LK0 M;  2PW9 A;  4IKG A;  1ET9 A;  1D5M C;  3AE4 B;  1SEB D;  3I57 A;  2X38 A;  3B2G A;  2TSS A;  5BMH A;  2LHE A;  4IDI A;  2HDE A;  2RMM A;  2V3P A;  1BML C;  5E6J A;  3L4P A;  4RF1 A;  5T8I A;  1FO4 A;  3AV8 A;  2BB6 A;  1EWY C;  4UDU C;  3KLS X;  2WLB A;  1HZ5 A;  3KQ4 A;  2WU2 B;  3MHZ A;  1EM7 A;  2J42 A;  2PKO A;  1XLO A;  2G9H D;  4ZOH C;  1RM6 C;  3I9V 1;  2DWQ A;  2IJ0 A;  4L23 A;  1J7B A;  3T3O A;  4KGR A;  2WS3 B;  3E56 A;  1XXG A;  2BTE A;  5EE3 A;  1YN3 A;  2ZW0 A;  4MH8 A;  2WXF A;  4HKQ A;  1XLP A;  3MFG A;  5AUK A;  2IGG A;  4GLS C;  1F0Z A;  4XDC A;  4YSY B;  2KAJ A;  4NJC A;  4USA A;  1YMH E;  2JU6 X;  3TEZ A;  3AE2 B;  2BB5 A;  1RYJ A;  3FC4 A;  2I2Y A;  2Z8L A;  1I7H A;  3AMZ A;  2KQ4 X;  1WGK A;  3W9C B;  2W82 A;  2WDQ B;  1PGX A;  2WQY B;  2GB1 A;  1UNS A;  2MJE A;  3HVZ A;  1EU4 A;  1WSP A;  2XN9 C;  2YEP F;  1F77 A;  3KWL A;  3BYY B;  4B0M A;  4RGM A;  1C4P A;  1R7S A;  3DWG C;  2CJO A;  1IBX B;  1ET6 A;  1UGJ A;  1FCC C;  3SFD B;  1NEK B;  1SSN A;  1I4G A;  3H8H A;  4JWS C;  1KH0 A;  3AEA B;  1YNT E;  2WNM A;  2AQ3 B;  1JRP A;  1CJE A;  1L6U A;  2LUM A;  2W3S A;  5HFY A;  4AQ7 A;  1C79 A;  1JWU D;  1L0X B;  4EE2 A;  3DWM A;  3MJ5 A;  1QOB A;  4RGT A;  1JCK B;  1DYQ A;  1EU3 A;  2Y5P A;  3LYY A;  2BYT A;  1MI0 A;  2J4X A;  5MPO A;  4YTP B;  3CIR B;  1I4P A;  2PLP A;  2I38 A;  3ZJT A;  3UI3 A;  1MPE A;  3RFZ B;  1FFU A;  3VRB B;  1HQR D;  2FUG 1;  1JQ4 A;  2LEK A;  2L52 A;  1KRH A;  1QKZ A;  1V8C A;  4C7Y A;  2WXK A;  1DGJ A;  2FE8 A;  1QLB B;  1T6B X;  1B1Z A;  4NAW B;  5C3J B;  2QSD A;  2DLB A;  4HRO A;  4WAF A;  3GP7 A;  1DOI A;  2N9K A;  1IUE A;  1SXT A;  2G1E A;  4ZHP A;  1YJJ A;  2V4I B;  5TSS A;  2QJL A;  5HI1 A;  4OZB A;  4OW0 A;  2H88 B;  4KX6 B;  2BBC A;  1PFD A;  1V1P B;  1IBX A;  2JSV X;  1WWT A;  4US9 A;  2WXJ A;  2JYT A;  2ZW1 A;  1AN8 A;  2RPV A;  3BII D;  3EUB 2;  3SEB A;  3NRZ A;  3AN1 A;  3URY A;  1IGD A;  3WCQ A;  3Q8E A;  1XCQ L;  1JRO A;  1VLB A;  2CJN A;  2ACZ B;  2NTT A;  5EE0 A;  4YSX B;  3AB5 A;  3B2F A;  2HTM E;  1FRD A;  1NYQ A;  3U4E G;  4YT0 B;  4MAC A;  3BVZ A;  1N5X A;  1N5W A;  1MHH E;  2ON8 A;  3U2S C;  4M0W A;  2CU3 A;  3BK2 A;  4A90 A;  1QIL A;  1JML A;  2QIL A;  2KN4 A;  1L4Z B;  4WIP A;  3HVD A;  2DYM A;  4A9A A;  2JWU A;  1PUT A;  4RCO A;  2IPK D;  1ZXH A;  2IGH A;  2L32 A;  3AEE B;  4N59 A;  4C56 C;  5BMI A;  1RWS A;  3IT4 B;  3AE1 B;  1P7E A;  2B76 B;  3ETR A;  1L0Y B;  1VR9 A;  1STE A;  2E3T A;  4H2A A;  1QOG A;  1QF6 A;  4GDL B;  2OHF A;  1FD6 A;  1NVI D;  3AEG B;  2V0G A;  4HJG E;  1ROE A;  1AYF A;  3Q8F A;  2JYE A;  4O1N A;  3W5U B;  4ZHO A;  2JXT A;  2Y5C A;  1AW7 A;  1F2R I;  2XNA C;  2EEL A;  1SJE D;  2MJD A;  3U52 E;  3NVZ A;  3Q8B A;  1OFF A;  1CQV A;  1FM0 D;  4HRS A;  3ZJU A;  3ZGZ A;  1A70 A;  3VQI A;  1P7F A;  4PT5 A;  3R8B A;  1SJH D;  1NEN B;  1V1P A;  2WXP A;  3V3X A;  1KF6 B;  2M56 B;  1YN4 A;  1SBB B;  1ZOY B;  4IOI E;  4WWM A;  1GB1 A;  4YTM B;  2LJI A;  1YJI A;  3PO0 A;  2KWD A;  2LFI A;  1FNU A;  1LO5 D;  4P16 A;  1WYG A;  3N9Y C;  1C4A A;  1KLG D;  1HA5 A;  5AUI A;  1N62 A;  1TY2 A;  1XF5 L;  2WXL A;  3AM9 A;  3TEY A;  2K5P A;  1PYW D;  4GDK B;  1TYG B;  4D2K A;  1T5X D;  3BK1 A;  1FMA D;  4MM3 B;  2BS4 B;  3TEW A;  1ZPS A;  4L2Y A;  2QEJ C;  1K53 A;  4HKZ E;  2KMM A;  1KTK A;  1NI3 A;  3BVM A;  4Q2J A;  3ABV B;  1C76 A;  1QOF A;  1I4Q A;  3IAS 1;  2W3R A;  3GS2 A;  4LLG M;  2WXI A;  1EWC A;  3FAH A;  3P4R B;  4XDD A;  1OQR A;  2BS3 B;  1FFV A;  2GRI A;  1JWS D;  3P63 A;  4A8X C;  1I4X A;  2PVG C;  3EA6 A;  1BUI C;  4B0E A;  3P4S B;  1V1O A;  1AWD A;  1SE4 A;  1MHX A;  1JWA D;  1M4V A;  1SB3 C;  2RDH A;  3KWV A;  3AE3 B;  3P4P B;  3AEF B;  2ICI A;  1CZP A;  1VZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...