1GBAA

Alpha-lytic protease with met 190 replaced by ala and gly 216 replaced by ala
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGANVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase (serine proteinase)
total genus 50
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbaA01
5AVDA 3M5LA 4WMFA 5ABWA 2CXVA 1C5WB 1GCDA 3SO3A 1QFKH 3BTQE 2BDCA 1GGDB 4A6LA 1YPEH 1F0TA 1V2MT 1YPHC 4I8JA 1INCA 1SSXA 2GT7A 2GCHG 1KXCA 1P12E 1GHZA 3SV7A 3GCNA 1ID5H 1RXPA 1O30A 4X2YA 3SV9A 1O3KA 2OBQA 5I25A 1Y5BT 3LH3A 3ZZ8A 3CP7A 3E90B 1G3BA 3HK3B 2ANMH 2BY5X 3P8GA 1GMDF 2B7DH 1LVMA 2J95A 3B8JA 1OOKB 2F9NA 2FOGA 3RMMH 1KXFA 4ZAEA 1XVOA 5ESBA 3ENSB 5BPEA 2VIOA 4Y0ZE 2GVFA 3MTYA 3VB5A 1OWDA 1ZHRA 1W11U 1AO5A 1UCYH 4HGCA 4BAOB 4UD9H 4D8NA 1CA0C 1FIZA 1C2EA 1F92A 1RTLA 1A61H 1M9UA 4DVAU 1DXPA 2TGDA 3LGIA 3OTJE 1KLJH 1TGSZ 2GD4B 5DGJA 1J14A 1ARCA 1WCZA 2BDAA 2I6SA 4I31A 1TNHA 2ZFTA 1P0SH 5C1XA 1MTSA 3K6ZA 2FLBH 2WYJA 3SOSA 3BTTE 2QAAA 1Z8JB 1C1VH 5JBCS 3Q3KA 1UJ1A 1EPTA 1UCYE 1P10A 1AGJA 4X8VH 2VU8E 1ETRH 3SU4A 1KXDA 1Q2WA 2GZ7A 3ODFA 1D3PB 5AF9H 1LQDB 5FHTA 1CT2E 2O8WA 3NPSA 3SBKA 2Y6TA 2SNWA 1IQHA 5EQQA 1N6YA 1VZQH 1GHVH 5LPFA 3ESTA 3ZVDA 2XRCA 1AE5A 1PPCE 1RRKA 1EKBB 3RXLA 1W2KH 1EOLA 1OWEA 4NA8A 2OBOA 1YGCH 2ZHQH 4X8SH 4FU9A 1DITH 5JBBS 1FN6A 2J92A 4WMDA 5H4IB 5C1UA 4K8BA 5LH8A 1ELCA 3RMNH 2C8XB 1C5MD 1D3TB 1TAWA 1LVBA 2JETC 1O2JA 3VB3A 4CBNA 3CS7A 5HM2A 2XWAA 4Q2KA 1SGIB 1BTHH 1GL0E 4AG2A 2J2UA 5FPSA 4WXIA 1O2HA 1ZTJA 4FUGA 1EZXC 1ARBA 1DOJA 3AW1A 4NG9H 1YYY1 1MZDA 4CRGA 1C1SA 1BMLA 3QWCH 1DUEA 2Q6DA 2A5AA 4U2WA 3D65E 3KHVA 1GVZA 1O34A 1W7XH 1QR3E 1P03A 1S85A 1VCWA 2Z9KA 4BAKB 1IQLA 1PYTD 3RXGA 1GI8B 1O33A 5C5NA 4GLYA 4MDSA 3SNAA 1HRTH 2AEIH 5T6DA 4TWWA 1SR5C 2AIPA 3Q3YA 3UWIA 1ZTKA 3S9CA 1T4UH 4ZUHA 1FMGA 2ILNA 2B9LA 3UFAA 3DFJA 5FCKA 2BLVA 2EI6A 1BRCE 1QB6A 1TGBA 5HXFA 2EA3A 3PMJA 2ZU3A 4HI3A 2SNVA 5K7RA 1OWKA 1SFIA 4Y7AA 2FS9A 1KTSB 2C3SA 1QL8A 1L1NA 4X6MA 1A2CH 4JK6A 2XYAA 1FUJA 1RTFB 1WUNH 3FAOA 3VEQB 4B2BA 1FV9A 4ZXYH 4B2CA 3ATIA 4Y8XA 1VCPA 2BD5A 1ELTA 1XM1A 1P06A 1AQ7A 1CU1A 3PTNA 1FY5A 1XVMA 1S84A 4X1SU 1IHTH 3ZV9A 3EGKH 3VPKA 2FYQA 1XXDA 1QL7A 2H2ZA 1NTPA 2BM2A 5GDSH 1DWDH 1SQOA 4CRBA 1Y8TA 4NA9H 2FODA 2Z9LA 4NIXA 1SHHB 4D9RA 1O2SA 2HPQH 2AS9A 2XBVA 2I6QA 2OC7A 3GDUA 4UFDH 3M5MA 4ABEA 4B73A 3A8AA 2IPHA 3SQHE 2OP9A 2FLRH 3TGJE 1GJBB 3FZDA 1H8IH 2BY6X 1C4V2 5HM9A 2ANKH 3RUOA 2ZHWH 4OS2A 1T8OA 3A80A 4XBDA 3EAJA 1GBKA 2ZFPH 3M7UA 3E3TA 1SMFE 2P59A 3A88A 2GCTC 3QGJA 1LQEA 5JBAS 1FY3A 4A5TS 1L4ZA 5EPYA 4AFUA 5LPEA 1H1BA 1MD7A 1XUHA 2F91A 2Y80A 2QY0B 3ZZBA 1O5AB 4X6NA 3PO1C 3KF2A 1GPZA 1H4WA 3S7HB 3EA8A 1N6XA 1GDNA 3SNDA 3GCHB 2CMYA 3HGNA 2XCFA 1V2NT 1CHOF 5TCAA 3U1IB 2Y5FA 3BTEE 1C2LA 4D7FA 3UREA 1O35A 1BITA 1O2NA 4INLA 1TGCA 4Q7XA 2WPJS 3M5NA 5DP3A 3RDZA 3SORA 1ZZZA 1MKXK 1H9IE 1QB9A 1TONA 1EUFA 1ZTLA 1ZYOA 4SGAE 2WYGA 2QXGA 1OSSA 6CHAB 1O3FA 3PLKA 3TGKE 1GVLA 5A09A 4YT6H 1O3IA 1HAVA 1G3CA 3S9BA 5C20A 1MQ6A 1DFPA 2KAIA 1D9IA 1TOMH 2P3UB 3UR9A 3MH6A 1XMNB 2O8LA 1BMAA 4MVNA 4BTIB 4MNYA 1NROH 3URCA 1ZJDA 2FYRA 2GV7A 1G36A 2A0QB 3BTME 1P11E 4E05H 5F6MA 2BVRH 1IQKA 4JZEH 2A4GA 2SGFE 2ZDKA 1PYTC 4I8LA 1GHBF 1Z8IB 1SQAA 1HYLA 3MNCA 1BZXE 1O0DH 1F2SE 1MQ5A 1UK2A 1MKXH 3HKJB 1AIXH 2FZZA 2QN5T 4NSYA 3A81A 1LHFH 1GI3A 5IYTA 5E2OA 2ANYA 1SQTA 2K1QA 1V2TT 2AGEX 1NU7B 6GCHG 3SHAH 3MO3A 4GHQA 4XOJA 4YZUA 2ODQA 5L6NH 4H6TA 3GY7A 1DS2E 1BHXF 1GHXH 1XUIA 1RGQA 1A0LA 2H5DA 2G8TA 1ESAA 1RIWC 1QHRB 1G37A 1AMHA 2NU4E 2ZPSA 1J15A 5SGAE 1Y3UA 1DICA 1HV7A 1CT0E 1WTGH 3ZZ5A 1AFQC 1O2WA 1BTPA 4JK5A 3RU4T 1G32B 2A32A 2OC1A 5GCHG 2FO9A 5E8EH 2VGCB 3NKKA 2ASUB 5HMAA 3LGWA 4INKA 1J17T 3R3GB 1TNGA 1O3NA 1CHOG 3NZIA 3SN8A 1HJAB 4OS1A 1Z6EA 2BZAA 3E1XB 1ZRBA 1OWHA 1TQ7B 1TBQH 4AZ2B 1RD3B 3ZZ7A 1PQAA 1SLUB 1ZOMA 2ZU1A 2C8YB 4DJZB 3E91A 4XE4A 1EASA 3ITIA 2Y7ZA 4B74A 2FS8A 1QA7A 2WPKS 2WPLS 1OP2A 5FPTA 1GJ4H 1UTKA 3A7ZA 1HCGA 1GBFA 1TFXA 1O2QA 4ZHMU 2V6NA 3M3SA 1KDQA 2ZHEH 1MTUA 1H9LB 4E7RG 1SHYA 3P8OA 1HLTH 4VGCC 4A1XA 3GY4A 3UQVA 2QXHA 1NZQH 3FZZA 5FPYA 1FY4A 1ANDA 1HAXB 1NT1A 1UTOA 1GBLA 2XBXA 2QF0A 2BQ6B 3A8DA 1SLVB 4IMQA 3GYMA 1HB0B 3UNRA 3JZ2B 1CGHA 3UNSA 4WY3A 1TPAE 4X6OA 1GI0A 2F9UA 1A5IA 2VVVA 1D4PB 1GHBG 4FUDA 2AIQA 1LPGB 1TRNA 1EPTB 2VVCA 3GCTF 2BZ6H 2PSYA 2RDLA 1O5DH 1UTQA 1HAHH 2UWOA 4X1PU 2IJOB 2ZU5A 2DE9A 1NRPH 4NCYA 4RN6A 5A8YA 3A7XA 1FY8E 4CREA 3RXUA 4ISNA 1K21H 1OPHB 1QRXA 5EODA 2V3OH 1A1RA 5FXLA 1GI7B 1F5KU 1LCYA 4AYYB 1C5OH 1C5UA 1LPZB 5ETXA 2A4QA 1BCUH 1C5QA 3PMAB 3LIWA 3HGPA 1C2KA 2D2DA 1MCTA 3PLPA 4A7IB 1DWEH 1EATA 2FTLE 1ESTA 3M61U 4FXGH 3ZZ6A 3R0FA 1KY9A 1TMBH 5FX5A 1QIXB 2ZTYA 1EZUC 4Y8YA 1TQ0B 2GX4A 2WV5A 3FP6E 1SGEE 1TIOA 4CR9A 3ZVGA 1UTPA 2FOFA 1F0RA 3DD2H 3EQ0H 1W14U 4IS5A 1GHYH 2FI4E 2OC8A 2QC2A 4OS6A 4NIWA 1CBWC 2BX4A 2ZTZA 1TRMA 4JYTA 1UTJA 2BOKA 3T29A 5EXMA 5CMXH 3TJUA 3A7WA 1LMWB 3VB4A 1VJAU 2FOMB 1BB0B 4WJG2 3GY2A 4B71A 4Q7ZA 1CA0B 1ZHPA 4AFSA 3P17H 1GG6C 2OC0A 1AKSB 3B23B 1B0FA 1C5NH 4YO9A 4NFEA 1UTMA 2AMDA 3NK8A 4WF8A 1EPTC 1C5ZB 4R0IA 3RC4A 5DPAA 2AGIX 4WVPE 3TNTA 1FN8A 1BRUP 3RU4E 2WPHS 1ZHMA 2FDAA 4IC6A 1JIRA 1GMCG 3S9AA 1QCPA 4DW2U 1SGPE 1VR1H 1HAOH 1J16A 5L2ZH 1UCYK 1O2GH 1BMNH 1V2VT 3EE0B 2IN2A 3VXFH 2O8MA 4AX9H 3MO6A 1C1QA 2VWLA 1C2JA 5T6GA 4KP0A 3C27B 2FI5E 1AY6H 3U69H 1VGCC 4YT7H 1TNIA 2Z7FE 3FANA 2EI8A 1DLEA 5L30H 1O3MA 1YCPM 5JYIA 2H5CA 4MLFB 3S0NA 4AB9A 1YCPH 2R0KA 2PWXA 1HAYB 3TK5A 2BD3A 1ZSJA 3K6YA 3RXCA 1C1PA 4D76A 1IQGA 3STIA 1V2KT 3H7OA 3MNBA 4CH2B 3BIVH 4CRFA 3TK9A 2Z9GA 1MMJN 1SGRE 2ZF0H 3LGUA 3A89A 4Z6AH 5FBIA 5DP5A 2Q1JA 1GDQA 1L4DA 2CV3A 2A7CA 4CRAA 4DG4A 3P8FA 4JZDH 1THPB 1O2VA 1V2PT 2BQWB 2JETB 3SZNA 2VINA 3RM0H 1ZGIA 2UUKB 1N1LA 1GCTC 5FAHA 2ZEBA 1BTZA 3Q77A 4GCHF 1TPSA 1GI5A 2G51A 5HGGA 2A2QH 1EB1H 2FI3E 2QCYA 2W26A 2XC5A 1E34B 5EPNA 2Y81A 1T32A 1Y3XA 1D3QB 3BTWE 2VIVA 1Z71A 1AB9C 3PB1E 2AGGX 4I8HA 3M37A 1AHTH 2R9PA 1MBMA 5A2MH 2ZFFH 4NIVA 3TLOA 3ATLA 2BXUH 1TABE 3RC5A 3ZYEA 2BDIA 1LDTT 1V2UT 3RXJA 3ZV8A 1F0UA 1YC0A 1Y59T 4O9VA 4B1TA 2AMQA 4BAMB 3SU2A 3GICB 1GL1A 2V0BA 1DY9A 3BG4C 5DP4A 1P01A 1HXEH 1GBMA 2ZGJA 1MBQA 2J34A 1GWAA 1C2MA 4D7GA 1ELVA 1GBBA 2XC0A 4BAHB 2BXTH 3LGVA 2WUBA 4AG1A 3M7QA 2BQ7B 1L1JA 4BTTB 3I29A 2F83A 3QK1A 1NFWA 5A0AE 4CHAC 1AVGH 1CQQA 3MU8A 2R0LA 2BY7X 3PLBA 1V2LT 3QZQA 1W0YH 3LGYA 3EDXB 1IQFA 2GZ9A 3BSQA 4U01A 1C5VA 2O8UA 1TNKA 2ZDAH 3T28A 3JZ1B 2O8TA 1FDPA 1DPOA 1TNJA 3HK6B 1AVWA 3MHWU 3PV4A 1AFEH 1KLIH 1GBAA 3VFEA 4LZ4B 2HNTF 2Z94A 3KQCA 1A3BH 3TNSA 5GWZA 2BDYA 3A7YA 1MTWA 3TITA 3BTDE 1SG8B 3I78A 1P57B 1D3DB 3SU6A 4Y10E 4HZHA 1GMDG 4JCNA 1V2RT 1IHSH 1C1WH 1AZ8A 3MU1A 1BHXB 2Z6BD 3BTHE 4H42U 2D26C 1U6QA 4J1YA 4MPXA 1B5GH 1O5EH 2R2MB 1TX6A 2ZDNA 1C4Y2 2GDDA 3TJOA 1ESBA 3A82A 4JZ1A 3SU3A 4Y0YE 2G4UA 1JOUB 3PTBA 3LDXH 1K1MA 4ABDA 1SGYE 1FNIA 1SOTA 4WWYA 5A8XA 3P92A 2GCTB 2QXIA 1O3HA 3SUDA 1FY1A 3GY3A 4IMZA 4KGAA 1KXAA 2PKAB 3H5CB 3FP8E 3PO1B 2H1UA 2JH6D 2XC4A 1T8MA 1GJDB 3KQDA 3SI4H 1MD8A 1P2IA 4MTBA 2A4RA 1Z8RA 8ESTE 2OTVA 1TWXB 2GV6A 2XBWA 3U8TH 1GI4A 1EP5A 1AN1E 1V2ST 4FUCA 2G00A 1P3EA 1Z8GA 1V2JT 3TU7H 2VWOA 1QRWA 1HAZB 1L2EA 3RXKA 1BA8B 5EU8A 1P9SA 4X1NU 1HIAA 4TPIZ 1WU1A 1O3OA 1EOJA 4K3JA 4X1RU 3GY6A 1ZR0A 4XDEA 4UFEH 4NSVA 1MTVA 1TMUH 3GYLB 1K1OA 1TOCB 1P2OA 4KTCA 3RC6A 4TWYA 2B8OH 2BMGB 1SBWA 4A1TA 1G30B 1SLWB 5JB9S 8GCHF 2H9EH 1P2QA 1S83A 3RXPA 1WV7H 4MQAA 1T4VH 2BDGA 5J4QA 1KDQB 1ZPBA 3KIDU 3KQEA 3SJIA 1EJAA 4NZQA 3H7TA 3PWBA 1ACBE 2VH6A 3Q3XA 4I32A 2FWWA 4AB8A 2BY8X 4DY7B 3SHCH 2B0FA 2Y5GA 1C2HA 3F9EA 1A5HA 1XUGA 2NU2E 1NRRH 2BLWA 1LO6A 4YLQH 4X8UH 4CH8B 2P95A 1MAYA 2THFB 1P05A 1P2JA 4CRDA 2W7UA 2TBSA 3EA9A 4O3TA 4X0WU 4ABFA 1P2KA 3BTKE 1GJ7B 3NUMA 2WV4A 1PQ7A 5B6OA 1GBTA 3HKIB 2ZP0H 5GPIB 2A45B 1GI9B 1GJ8B 1OXGA 3KEEA 1ELEE 1EP6A 1RIWB 1C1RA 1F5LA 1E36B 1QL9A 3RMOH 1GBEA 1AFQB 1OYTH 3ZVEA 1CO7E 2R2WU 4D9QA 2GTBA 1SGFA 2QF3A 3AW0A 1IQMA 4X2VA 9LPRA 4KELA 4ZHAA 3GCOA 1DXWA 1T8NA 4XFQA 1L0ZA 1FXYA 1C5SA 1V6DA 1GBJA 2W5EA 3NCLA 3RXHA 1DT2A 1PPGE 1BTXA 1SGCA 3MU0A 4ABIA 4AGKA 2P3TB 2Q6FA 2BY9X 4FUBA 4ISIH 2CN0H 4YTAA 1MKWK 2PGBB 2HALA 1FQ3A 1DWBH 5E2PA 1GI2A 4GSOA 1GBDA 2BDHA 1E35B 3ZVCA 3LONA 2PGQB 1NRSH 1O2ZA 1MAXA 4Q7YA 1O3PB 2A1DB 2ESTE 1RJXB 2J38A 3Q00A 4IN2A 2BD9A 5A0CA 4RSPA 1K28D 4ZXXH 1BRBE 3MWIU 4WXVA 1KXEA 1PQ8A 1CHGA 1ELAA 1P04A 1OS8A 4MNVA 1FI8A 4VGCB 1O2PA 5LPRA 3RXFA 5F8TA 3F9GA 2XNIA 3URDA 3P8NA 2VVUA 3UUZA 1JWTA 3GY5A 4YM9A 3DT0H 4ZKOU 4FUIA 2CJIA 5E0JA 3MH4A 1OX1A 1QJ6B 1W7GH 3A8CA 1GBCA 1E0FD 1Q31A 1MKWH 3T26A 5DP9A 2W7SA 4NFFA 3C1KA 5CHAC 1BJUA 1HAIH 3S69A 1LHCH 1T31A 2W3IA 3FFGA 3SGAE 3GDVA 1CE5A 3DUXH 3MMGA 1WSSH 4KTUA 2P16A 2ZGCA 5JBTA 1FIWA 1NRNH 3MFJA 1X7AC 4M7GA 3SJ8A 2VIDA 1AUTC 1BBRH 1XKBC 3BEUA 1D6RA 2XW9A 4FUFA 1P02A 5C67A 5EQRA 4UONA 1ZJKA 2D1JA 1F5RA 1BJVA 1K1PA 1NN6A 2ZFSA 4NIYA 2TRMA 1JBUH 1PPEE 2ZNKH 5DK1A 2FTMA 4UEHH 4LZ1H 2J4IA 2ZG0H 1AUJA 3KL6A 4LOYH 3QLPH 1WBGB 2FX4A 4OS4A 1KTTB 5JDUB 1O3JA 1QBNA 2HNTE 1LKBA 1CSOE 1BBRE 3QUMP 1FJSA 4AORA 4TY7A 4NA7A 1ORFA 1C1UH 1CBWB 1J8AA 1EX3A 1GDUA 2ZDLA 4ISOA 4OS5A 2HRVA 2NU1E 4KKDA 1O36A 1N8OC 5FBEA 3RLYH 3MNSA 1GMHF 2GDEH 2HWLB 1UK3A 3LOXA 1C2FA 2XTTB 1YPGH 4NZLA 2Y7XA 4JYUH 1HPGA 1GG6B 1O2XA 4B2AA 2A4OA 2C93B 3A7VA 1YPHE 1ETTH 2XCNA 3QN7A 1ANEA 2P93A 5DKMA 3UNQA 4J2YB 1DM4B 1GHAF 1WTHD 2GMTC 2BLOA 1LHDH 1BIOA 3RXQA 3SV2H 3O8DA 4ZKRU 2Z9IA 3TK6A 4GPGA 1MTNC 9ESTA 4ABBA 1W0ZU 2NWNA 1THRH 4IN1A 5E0HA 3AVZA 4TY6A 2VIWA 2ZCKP 3KN2A 4B75A 5JPMH 3BG8A 1GJAB 1HGTH 2BD2A 1K1JA 1S5SA 4X2XA 4JMYA 5K0HA 7GCHF 1O2IA 5EOKA 1O2MA 5FX6A 4ZH8A 1DDJA 2QGRA 3RXDA 2ALPA 1GVKB 4IGDA 1ELFA 1V2QT 3MU5A 4Y11E 1LHEH 3KNXA 1VGCB 1WAYB 4LK4A 4DGJA 2YNBA 1TPOA 5AHGH 7ESTE 3RP2A 4H6SB 5C2ZA 3A85A 3RU4D 1CA8B 1QBVH 1XX9A 2BVXH 1TPPA 2ZTXA 1LVYA 1SL3A 1G9IE 2IOTA 4GUXA 2G52A 1HUTH 2NU3E 1XKAC 4UE7H 4UFGH 2JH5D 1G3DA 3RXRA 1DY8A 4K8YA 1CGIE 1O3CA 2OQUA 1OYQA 2PKSC 2GZ8A 2W3KA 4I7YH 4Y76A 3IITA 3ZZ9A 4QT8C 1C5YB 1TRYA 1Y3WA 2B5TB 3F6UH 3ODDA 5A8ZA 3SW2B 4BNRA 1YCPK 4U30A 3ZZAA 1MZAA 2VH0A 4ISLA 1F0SA 1GCTB 4ISHH 3RXVA 3DFLA 3OU0A 1FLEE 4IBLH 4X6PA 3E16B 1P09A 2CHAC 4K60A 3LC5A 3TJNA 2DUCA 2HOBA 1FAXA 2ZZUH 1GJ6A 3CENA 4FVBA 5DP8A 4YOIA 5DJ7A 3SU5A 3VXEH 1AB9B 2ZC9H 4SGBE 3ZVFA 1VITH 2HNTC 1ZPZA 1OWJA 2P8OB 4DIIH 2QA9E 5T3HA 1DSTA 4XBBA 2OXSA 5TJXA 2PUQH 1CVWH 1XUFA 3PMBB 4NWLA 4K69A 2UUJB 1BTUA 1C1MA 1GMHG 1LKAA 2GKVE 4ZKNU 1ZMLA 1EZSC 3ATKA 1QRZA 1LHGH 1ZSKA 3ATWA 3VGCC 2G55A 3ZVAA 2Y82A 3BG4B 4XBCA 3PMHB 1YLCA 3D23A 2PHBA 4HFPB 1A0HB 2WPMS 1TGNA 1P2MA 1K9OE 4OGXA 2YOLA 1UO6A 1KSNA 3GCTG 1QBOA 1GHAG 1YPLH 1UVPA 3IG6B 3E0NB 2Y5HA 1NY22 3K9XB 3V12A 4CHAB 1EQ9A 4ESTE 3O8RA 1PPZA 1P9UA 5IDKA 4BXWA 1WYKA 1A46H 2UUYA 4ZMAH 1GBIA 1HNEE 1NFYA 1O2KA 3AASA 3LU9B 3E6PH 4X2WA 1NFXA 5GIBA 4Y71A 1HIAB 4Z0KA 1BTYA 2ANWA 4AN7A 1S0QA 7GCHG 1TALA 2F3CE 3E0PB 3BV9B 1AE8H 1AWHB 1SGNE 3BTFE 5F8ZA 1QGFA 1E38B 3A86A 3SU0A 3LPRA 1EJNA 2WINI 1NS3A 2EI7A 3MI4A 1YM0A 2SGDE 2Z3EA 1UHBA 2G81E 1ELDE 3DA9B 4LXBH 2A31A 4UDWH 1C2DA 3BF6H 4WH6A 2ZQ1A 4XSKU 1SOZA 1O3DA 2RA3A 1IAUA 2STBE 4FVDA 1JIMA 4YESB 1O2YA 1P8VC 2TGAA 2P8OC 1HDTH 2PTCE 2A7JA 2DE8A 1AVXA 2NU0E 1WOFA 2ZPRA 1JRSA 3TH4H 2XWBI 2AMPA 3AAVA 3U9AH 3ELAH 2ZWLH 1PFXC 1UVOA 1GI6A 1ANCA 1EJMA 3MO9A 5DG6A 1EB2A 1ZMJA 3RXOA 1O2RA 2ZU2A 2SGAA 3UPEA 6ESTA 6LPRA 3T62A 5A0BA 4HTCH 1BOQA 4FU8A 1GGDC 4ABJA 3ZZ3A 1UVUH 2C90B 1EAXA 4K1TA 2OUAA 3E8LA 3RXIA 1UMAH 2FP7B 3F1SB 3RM2H 2EC9H 1GJ5H 3Q76A 5FCRA 4Y6DA 4ABGA 1GJ9B 1EZQA 1O2LA 2HGTH 1QQUA 1VCQA 1QQ4A 2SFAA 3UIRA 1O3LA 1SFQB 3OSYA 2ZKSA 1YPJH 4WMEA 2H6MA 1CT4E 2JH0D 2V35A 1S6HA 4Q80A 1PQ5A 3P6ZB 4FUJA 3L33A 2VIQA 2C8ZB 2JKHA 2PFEA 1TX8A 1FPHH 1HBTH 1TE0A 3HPTB 3W95A 2CGAA 4O3UA 1GBHA 2ZDVH 2VWNA 1OKXA 2STAE 2J9NA 2C8WB 2ODYB 3RXBA 2BVSH 3U8RH 1HAPH 1HAVB 1Y5AT 4CR5A 2KAIB 2FOBA 2RA0A 2VIPA 1Q3XA 3LJOA 1SI5H 1DWCH 1S6FA 2ZQ2A 4O97A 3LT3A 3UY9A 5T6FA 2PSXA 3OX7U 1O3BA 3IWMA 3A84A 1NO9H 2WUCA 3L3TA 3P95A 1C5LH 4OGYA 3SU1A 1O3EA 1SGQE 3F68H 1K2I1 3SQEE 3KQBA 2UUFB 1C5XB 4PROA 1AKSA 1EAUA 2HPPH 1KLTA 2FX6A 4RKOB 2AYWA 1QNJA 1Z7KA 3LJJA 3OY6U 1O39A 1W3CA 2ZCLP 4AYVB 5LGOA 5DO4H 1SPJA 4Y8ZA 4GCHG 4GAWA 3W94A 3SUGA 4E7NA 2AERH 1J9CH 4BXSA 1O5GH 3RXAA 1IQJA 4FU7A 2LNCA 3SNEA 2F9OA 1OP0A 4H4FA 2FESH 1ELGA 2G4TA 3P70B 3ZYDA 1SVPA 1FZZA 3UOPA 1MCVA 1PJPA 3G01A 3EA7A 3V3MA 1NM6A 2VWMA 1ELBA 1DVAH 1YBWA 3BIUH 3TH2H 1H9HE 1QURH 1DSUA 3UOUA 5TCCA 5ESTE 4DOQA 3PROA 4NWKA 2F9BH 3BTGE 4I8GA 1TBZH 2VB0A 4YLUA 1VJ9U 8KME2 1ABIH 3L6PA 3T25A 3WY8A 1OWIA 1UVTH 2ZDMA 1C5TA 2BD8A 2ZIQH 3SJOA 2WPIS 1Z6JH 1TGTA 3TIUA 2P94A 1G2MA 2FPZA 3SUFA 3TJVA 4THNH 5E0GA 1GI1A 1NU9A 4FUHA 2BD7A 4YOGA 3V13A 3VB6A 1BTWA 2CF9H 3A87A 1BQYA 1RFNA 3LGTA 2OCVB 2CF8H 1LPKB 2R3UA 3PWCA 4BAQB 3O8BA 4MPUA 3OYPA 2ZI2H 4AOQA 2PLXA 1SGTA 6GCHF 1LVOA 5EQSA 1YF4A 3QGNB 1BUIA 1MH0A 1O37A 5JB8S 1KIGH 3T2NA 4F4OC 3SJKA 2ZU4A 3VB7A 1NFUA 1C5PA 4DURA 4DT7B 2VNTA 2OQ5A 4INHA 4CBOA 1IOEA 1W12U 1C9TA 2YNAA 3I77A 5G4BA 3TH3H 2QIQA 2ZGBH 4K1EA 3RXTA 1A4WH 2ZECA 3CS0A 3RXSA 1ZMNA 4ABHA 5GCHF 1S82A 2BLQA 2PR3A 3MOCA 5DP7A 1KXBA 1ZGVA 4B76A 2BHGA 2VJ1A 2ZHDA 4ZROA 1VITF 3QZRA 1SC8U 4K1SA 5F8XA 1IQNA 3SGQE 1ZPCA 3D49H 2ZGXH 2BX3A 2QV1A 4AFZA 5L2YH 4X1QU 2GP9B 3OY5U 1P3CA 3SGBE 2ZPQA 3QO6A 4DIHH 1O3AA 1AI8H 1TA2A 2LPRA 5CHAB 4K5ZA 3STJA 1QA0A 1TYNA 1T8LA 1O5FH 5I46H 1EAWA 2OLGA 1HAGE 4MNXA 1V2OT 3NXPA 2FOAA 1UTLM 3TGIE 1O3GA 2ZGHA 1DE7H 1O38A 2O9QA 2D8WA 3D62A 1UTNA 1EXFA 1YP9A 5J4SA 1QJ1B 2TGTA 3UTUH 3QDZB 3SNCA 3U98H 2SGEE 1HFDA 1HJ8A 3GDSA 4ZHLU 4Y79A 4O03A 2BOHB 3FP7E 1NC6A 1BMMH 3MU4A 1K1IA 1K22H 1ETSH 2XBYA 2M5TA 3GOVB 5EW2H 4R8TB 2F9PA 2FOHA 1BDAA 1C5RA 1TBRH 1PPFE 1BBRK 1P2NA 1JMOH 2ZFQH 2FIRH 1A5GH 1NPMA 2ZFRH 2Z3CA 1V2WT 4YOJA 3GY8A 2OD3B 1A3EH 1T7CA 1AD8H 4TPYA 1FAKH 4MNWA 8GCHG 1NESE 3V0XA 1E37B 4MG3A 3GCHC 1N8OB 5GJ4B 1YLDA 3AAUA 2A7HA 3B9FH 1O2TA 1Y5UT 4DCDA 1O2OA 4KTSA 2PKAA 1BRAA 3ZZCA 4RKJB 1Y3YA 1RS0A 1UK4A 5EXLA 5AFZH 2EEKA 2FOEA 5EGMA 3N7OA 2BB4A 3MYWA 2HVXA 2F9VA 1XXFA 1W10U 5PTPA 1W13U 2GMTB 3SV6A 1ZSLA 2QYIA 3NWUA 2BDBA 6CHAC 2BD4A 1MTNB 2BTCE 3M5OA 2A5KA 1B7XB 4WH8A 1ABJH 1TA6A 3U1JB 3EYDA 3A7TA 2A5IA 2FEQH 1JXPA 4IW4E 3PYHA 2A2XH 1XUJA 4K2YA 3U8OH 1TLDA 4JZIA 2FXRA 3K65B 2V3HH 1W8BH 1VITG 1S81A 1ZLRA 4ZKSU 1YPMH 3BEIB 3MH5A 3PM3A 3RXMA 1PPHE 3MH7A 3RLWH 1O32A 1PPBH 5C1YA 1C1OA 3SJ9A 4IC5A 1RTKA 1DANH 1TX7A 4X8TH 1Z1JA 3K2UA 3LC3A 2J94A 4GVUA 1XUKA 5F03A 4E06H 1OP8A 1H8DH 1YPKH 3M36A 3T27A 4A92A 4ASHA 1DUAA 1ZRKA 4MPVA 1D6WA 1WQSA 3S7KB 2PKSB 3SV8A 1O5CB 2FMJA 5AFYH 1GMCF 1UHBB 2C4FH 4A1VA 5HYOA 1C2IA 1S0RA 4BOHA 3QTVH 2ODPA 3UR6A 2G5VA 3TVJB 3ZZ4A 7KMEH 2AFQB 2PW8H 4GHTA 4BANB 2PTNA 3T5FH 1SB1H 1HJ9A 1LTOA 2XXLA 1K1LA 5EW1H 1ANBA 3UWJH 3SI3H 1FONA 1GJCB 2OINA 3M3TA 1WQVH 3LKWA 2RCEA 1NRQH 3GISB 2GCHF 1SGFG 4UFFH 2CHAB 1B0EA 3BN9A 2UWPA 1A7SA 1AZZA 4JYVH 1HXFH 4U32A 8LPRA 1O5BB 1IQEA 4OS7A 1BT7A 1F7ZA 7LPRA 2P3FH 2VGCC 4NGAH 3ZZDA 5EXNA 2ZCHP 2ZHFH 2FM2A 3UQOA 4AGJA 2BYAX 3SNBA 3M35A 5C3NA 1Y3VA 2QXJA 3M3VA 1G3EA 3ATMA 2FOCA 1HJAC 3KCGH 1TMTH 1GHWH 3VGCB 1SLXB 1IQIA 1C1TA 3KGPA 2GGVB 1DLKB 2ZO3H 1UVSH 3RMLH 3DHKH 1QB1A 2TPIZ 3HATH 1SGDE 1L1GA 3V7TA 2SGPE 1JRTA 2ZA5A 1K1NA 3MNXA 5DP6A 5EG4A 2Q6GA 4MPWA 1QTFA 4AFQA 1DX5M 3TPIZ 3BEFB 2UWLA 2ALVA 3QTOH 5CE1A 1O31A 1TB6H 1O2UA 2HLCA 1KYNA 1V3XA 2ULLA 3O8CA 2R3YA 3LH1A 3QX5H 1FPCH 2Z3DA 1AWFH 2H9HA 2PV9B 3ZVBA 1MUEB 3A83A 1EAIA 3F9HA 4BTUB 1G2LA 4FUEA 2TGPZ 4Y7BA 3A8BA 4F49A 1YKTA 2PUXB 1CGJE 2G5NA 5BRRE 3F9FA 1C9PA 4I33A 2Z9JA 1THSH 3SUEA 1C4U2 5C5OA 1AU8A 1MU8B 1Z1IA 3RXEA 4CRCA 2GT8A 5GXPA 2H9TH 1C2GA 1C1NA 1TNLA 4TYDA 3M7TA 4I8KA 2TIOA 3FVFB 1QJ7B 2AH4X 1A0JA 2RG3A 4JZFH 2SGQE 4ABAA 1QY6A 1MU6B
chains in the Genus database with same CATH superfamily
5AVDA 3M5LA 4WMFA 5ABWA 2CXVA 1C5WB 1GCDA 3SO3A 1QFKH 3BTQE 2BDCA 1GGDB 4A6LA 1YPEH 1F0TA 1V2MT 1YPHC 4I8JA 1INCA 1SSXA 2GT7A 2GCHG 1KXCA 1P12E 1GHZA 2QE7D 3SV7A 3GCNA 1ID5H 1RXPA 1O30A 4X2YA 3SV9A 1O3KA 2OBQA 5I25A 1Y5BT 3LH3A 3ZZ8A 4FOUC 3CP7A 3E90B 1G3BA 3HK3B 2ANMH 2BY5X 3P8GA 3OTPA 1GMDF 2B7DH 3KYGA 1LVMA 2J95A 3B8JA 1OOKB 2F9NA 2FOGA 3RMMH 1KXFA 4ZAEA 1XVOA 2YMSC 3ENSB 5ESBA 2VIOA 5BPEA 4Y0ZE 2GVFA 3MTYA 3VB5A 1OWDA 1ZHRA 1W11U 1E1RD 1AO5A 1UCYH 4HGCA 2M2AA 4BAOB 4UD9H 4D8NA 1CA0C 1FIZA 1C2EA 1F92A 1RTLA 1A61H 1M9UA 4DVAU 1DXPA 4F55A 2TGDA 3LGIA 3OTJE 1KLJH 1TGSZ 2GD4B 5DGJA 1J14A 4P02A 1ARCA 1WCZA 2BDAA 2I6SA 4I31A 1TNHA 2ZFTA 1P0SH 5C1XA 1MTSA 3K6ZA 2FLBH 2WYJA 3SOSA 3BTTE 2QAAA 1Z8JB 1C1VH 5JBCS 3Q3KA 1UJ1A 1EPTA 1UCYE 1P10A 1AGJA 4X8VH 1WXRA 2VU8E 1ETRH 3SU4A 1KXDA 1Q2WA 2GZ7A 3ODFA 1D3PB 5AF9H 1LQDB 5FHTA 1CT2E 2O8WA 3NPSA 3SBKA 2Y6TA 2SNWA 1IQHA 5EQQA 1N6YA 1FX0B 1VZQH 1GHVH 5LPFA 2J98A 3ESTA 3ZVDA 2XRCA 1AE5A 1PPCE 1RRKA 1EKBB 3RXLA 1W2KH 1EOLA 1OWEA 4NA8A 2OBOA 1YGCH 2ZHQH 4X8SH 4FU9A 1DITH 5JBBS 1FN6A 2J92A 4WMDA 5H4IB 5C1UA 4K8BA 5LH8A 1ELCA 3RMNH 2C8XB 1C5MD 1D3TB 1TAWA 1LVBA 1NBMD 2JETC 4RI0A 1O2JA 3VB3A 4CBNA 4RT1A 3CS7A 5HM2A 2XWAA 4Q2KA 1SGIB 1BTHH 1GL0E 4AG2A 2J2UA 5FPSA 4WXIA 1O2HA 1ZTJA 4FUGA 1EZXC 1ARBA 1DOJA 3AW1A 4NG9H 1YYY1 1MZDA 4CRGA 1C1SA 1BMLA 3QWCH 1DUEA 2Q6DA 2A5AA 3VG8A 4U2WA 3D65E 3KHVA 1GVZA 1O34A 1W7XH 1QR3E 1P03A 1S85A 1VCWA 2Z9KA 4BAKB 1IQLA 1PYTD 3RXGA 1GI8B 1O33A 5C5NA 4GLYA 4MDSA 3SNAA 1HRTH 2AEIH 5T6DA 4TWWA 1SR5C 2AIPA 3Q3YA 5GNDA 1ZTKA 3UWIA 3S9CA 1T4UH 3WWBA 4ZUHA 1FMGA 2ILNA 2B9LA 3UFAA 3DFJA 5FCKA 2BLVA 2EI6A 1BRCE 1QB6A 1TGBA 5HXFA 2EA3A 3PMJA 2ZU3A 1K0HA 4HI3A 3AK5A 2SNVA 5K7RA 2HLDD 1OWKA 1SFIA 4Y7AA 2FS9A 4F48B 1KTSB 2C3SA 1QL8A 1L1NA 4X6MA 1A2CH 4JK6A 2XYAA 1FUJA 1RTFB 1WUNH 3FAOA 2LELA 3VEQB 4B2BA 1FV9A 4ZXYH 4B2CA 3ATIA 4Y8XA 1VCPA 2BD5A 1ELTA 1XM1A 1P06A 1AQ7A 3ZIAD 1CU1A 3PTNA 1FY5A 1XVMA 1S84A 4X1SU 1IHTH 3ZV9A 3EGKH 3VPKA 2FYQA 1XXDA 1QL7A 2H2ZA 1NTPA 2BM2A 5GDSH 1DWDH 1SQOA 4CRBA 1Y8TA 4NA9H 2FODA 2Z9LA 4NIXA 1SHHB 4I86A 4D9RA 1O2SA 2HPQH 2AS9A 2XBVA 2I6QA 2OC7A 3GDUA 4UFDH 3OEED 3FOAA 3M5MA 4ABEA 2WPDD 4B73A 3A8AA 2IPHA 3SQHE 2OP9A 2FLRH 3TGJE 1GJBB 3FZDA 1H8IH 2BY6X 1C4V2 2JDID 2ANKH 5HM9A 3RUOA 2ZHWH 4OS2A 1T8OA 3A80A 4XBDA 3EAJA 5KGOA 1GBKA 2ZFPH 3M7UA 3E3TA 1SMFE 2P59A 3A88A 2GCTC 3QGJA 1LQEA 5JBAS 1FY3A 4A5TS 1L4ZA 5EPYA 4AFUA 5LPEA 1H1BA 1MD7A 1XUHA 2F91A 2Y80A 2QY0B 3ZZBA 1O5AB 4X6NA 3PO1C 3KF2A 1GPZA 1H4WA 3S7HB 3EA8A 1N6XA 1GDNA 3SNDA 3GCHB 2CMYA 3HGNA 2XCFA 1V2NT 1CHOF 5TCAA 3U1IB 2Y5FA 3BTEE 1C2LA 4D7FA 5C94A 3UREA 1O35A 1BITA 1O2NA 2K8IA 4INLA 1TGCA 4Q7XA 2WPJS 3M5NA 5DP3A 3RDZA 3SORA 1ZZZA 2JJ2D 1MKXK 1H9IE 1QB9A 1TONA 1EUFA 1ZTLA 1ZYOA 4SGAE 2WYGA 2QXGA 1OSSA 6CHAB 1O3FA 3PLKA 3TGKE 1GVLA 5A09A 4YT6H 1O3IA 1HAVA 1G3CA 3S9BA 5C20A 1MQ6A 1DFPA 2KAIA 1D9IA 3CNRA 1TOMH 2P3UB 3UR9A 4Q63A 3MH6A 1XMNB 2O8LA 1BMAA 4MVNA 3UB0A 4BTIB 4MNYA 1NROH 3URCA 1ZJDA 2FYRA 2GV7A 5EIYA 1G36A 2A0QB 3BTME 1P11E 4E05H 5F6MA 2BVRH 1IQKA 4JZEH 2A4GA 2SGFE 2ZDKA 1PYTC 3OE7D 4I8LA 2RFKC 1GHBF 1Z8IB 1SQAA 3FKSD 1HYLA 3MNCA 1BZXE 1O0DH 1F2SE 1MQ5A 1UK2A 1MKXH 3HKJB 1AIXH 2FZZA 2QN5T 4NSYA 3A81A 1LHFH 4B6EA 1GI3A 5IYTA 5E2OA 2ANYA 1SQTA 2K1QA 1V2TT 2AGEX 1NU7B 6GCHG 3SHAH 3MO3A 4GHQA 4XOJA 4YZUA 2ODQA 5L6NH 4H6TA 3GY7A 1DS2E 5KECA 1BHXF 1GHXH 1XUIA 1RGQA 1A0LA 2H5DA 2G8TA 1ESAA 1RIWC 1QHRB 1G37A 1AMHA 2NU4E 2ZPSA 1J15A 5SGAE 1Y3UA 1DICA 1HV7A 1CT0E 1WTGH 3ZZ5A 1AFQC 1O2WA 1BTPA 4JK5A 3RU4T 1G32B 2A32A 2OC1A 5GCHG 2FO9A 5E8EH 2VGCB 3NKKA 2ASUB 5HMAA 3LGWA 4INKA 1J17T 3R3GB 1TNGA 1O3NA 1CHOG 3NZIA 3SN8A 3EE7A 1HJAB 4OS1A 1Z6EA 2BZAA 3E1XB 1ZRBA 1OWHA 1TQ7B 1TBQH 4AZ2B 1RD3B 3ZZ7A 1PQAA 1SLUB 2J5UA 1ZOMA 5FL7D 2ZU1A 4ZCNA 3MQKC 2C8YB 4DJZB 3E91A 4XE4A 1EASA 3ITIA 2Y7ZA 4B74A 2FS8A 1QA7A 2WPKS 2WPLS 1OP2A 5FPTA 1GJ4H 1UTKA 3A7ZA 1HCGA 1GBFA 1TFXA 1O2QA 4ZHMU 2V6NA 3M3SA 1KDQA 2ZHEH 1MTUA 1H9LB 4E7RG 1SHYA 3P8OA 1HLTH 4VGCC 4A1XA 3GY4A 3UQVA 2QXHA 1NZQH 3FZZA 5FPYA 1FY4A 5F53A 1ANDA 1HAXB 1NT1A 1UTOA 1GBLA 2XBXA 2QF0A 2BQ6B 3A8DA 1SLVB 4IMQA 3GYMA 1HB0B 3UNRA 3JZ2B 1CGHA 3UNSA 1KMHB 4WY3A 1TPAE 4X6OA 1GI0A 2F9UA 1A5IA 2VVVA 1D4PB 1GHBG 4FUDA 2AIQA 1LPGB 1TRNA 1EPTB 2VVCA 3GCTF 4FETA 2BZ6H 2PSYA 2RDLA 1O5DH 1UTQA 1HAHH 2UWOA 4X1PU 2IJOB 2ZU5A 2DE9A 1NRPH 4NCYA 4RN6A 5A8YA 3A7XA 1FY8E 4CREA 3RXUA 4ISNA 1K21H 1OPHB 1QRXA 5EODA 2V3OH 1A1RA 5FXLA 1GI7B 1F5KU 1LCYA 4AYYB 1C5OH 1C5UA 1LPZB 5ETXA 2A4QA 1BCUH 1C5QA 3PMAB 3LIWA 2HVYB 3HGPA 4M9FA 1C2KA 2D2DA 1MCTA 3PLPA 4A7IB 1DWEH 1EATA 2FTLE 1ESTA 3M61U 4FXGH 3ZZ6A 3R0FA 1KY9A 1TMBH 5FX5A 1QIXB 2ZTYA 1EZUC 4Y8YA 1TQ0B 2GX4A 2WV5A 3FP6E 1SGEE 1TIOA 4CR9A 4XD7D 3ZVGA 1UTPA 2FOFA 1F0RA 3DD2H 3EQ0H 1W14U 4IS5A 1GHYH 2FI4E 2OC8A 2QC2A 4OS6A 4NIWA 1CBWC 2YMSB 2BX4A 2ZTZA 1TRMA 4JYTA 1UTJA 2BOKA 3T29A 5EXMA 5CMXH 3TJUA 3A7WA 1LMWB 3VB4A 1VJAU 2FOMB 1BB0B 4WJG2 3GY2A 4B71A 3WW7A 4Q7ZA 1CA0B 1ZHPA 4AFSA 3P17H 1GG6C 5C17A 2OC0A 1AKSB 3B23B 2KFWA 1B0FA 1C5NH 4YO9A 4NFEA 1UTMA 2AMDA 3NK8A 4WF8A 1EPTC 1C5ZB 4R0IA 3RC4A 5DPAA 2AGIX 4WVPE 3TNTA 1FN8A 1BRUP 3RU4E 2WPHS 1ZHMA 2FDAA 4IC6A 1JIRA 1GMCG 3S9AA 1QCPA 4DW2U 1SGPE 1VR1H 1HAOH 1J16A 5L2ZH 1UCYK 1O2GH 1BMNH 4TSFD 1V2VT 3EE0B 2IN2A 3VXFH 4ACAA 2O8MA 4AX9H 3MO6A 1C1QA 2VWLA 1C2JA 5T6GA 4KP0A 3C27B 2FI5E 1AY6H 3U69H 1VGCC 4YT7H 1TNIA 2Z7FE 3FANA 2EI8A 1DLEA 5L30H 1O3MA 1YCPM 5JYIA 2H5CA 4MLFB 3S0NA 4AB9A 1YCPH 2R0KA 2PWXA 1HAYB 3TK5A 2BD3A 1ZSJA 3K6YA 3RXCA 1C1PA 4D76A 1IQGA 3STIA 1V2KT 3H7OA 3MNBA 4CH2B 3BIVH 2XNDD 4CRFA 3TK9A 2Z9GA 1MMJN 1SGRE 2ZF0H 3LGUA 3A89A 4Z6AH 5FBIA 1YY3A 5C0UA 5DP5A 2Q1JA 1GDQA 1L4DA 2CV3A 2A7CA 4CRAA 4DG4A 3P8FA 4JZDH 1THPB 1O2VA 1V2PT 2BQWB 2JETB 3SZNA 2VINA 3RM0H 1ZGIA 2UUKB 1E1QD 1N1LA 1GCTC 5FAHA 2ZEBA 1BTZA 3Q77A 4GCHF 1TPSA 1GI5A 2G51A 5HGGA 2A2QH 1EB1H 2FI3E 2QCYA 2W26A 2XC5A 1E34B 5EPNA 2Y81A 1T32A 1Y3XA 4P00A 1D3QB 3BTWE 2F43B 2VIVA 1Z71A 1AB9C 3PB1E 2AGGX 2L74A 4I8HA 3M37A 1AHTH 2R9PA 1MBMA 5A2MH 2ZFFH 4NIVA 3TLOA 3ATLA 2BXUH 1TABE 3RC5A 3ZYEA 2BDIA 1LDTT 1V2UT 3RXJA 3ZV8A 1F0UA 1YC0A 1Y59T 2JIZD 4O9VA 2AMQA 4B1TA 4BAMB 3SU2A 3GICB 1GL1A 2V0BA 1DY9A 3BG4C 5DP4A 1P01A 1HXEH 1GBMA 2ZGJA 1MBQA 2J34A 1GWAA 1C2MA 4D7GA 1ELVA 1GBBA 2XC0A 4BAHB 2BXTH 3LGVA 2WUBA 4AG1A 3M7QA 2BQ7B 1L1JA 4BTTB 3I29A 2F83A 3QK1A 1NFWA 5A0AE 4CHAC 1AVGH 1CQQA 3MU8A 2R0LA 5CHBA 2BY7X 3PLBA 1V2LT 3QZQA 1W0YH 3LGYA 3EDXB 1IQFA 2GZ9A 3BSQA 4U01A 1C5VA 2O8UA 1TNKA 2ZDAH 3T28A 3JZ1B 2O8TA 1FDPA 1DPOA 1TNJA 3HK6B 1AVWA 3MHWU 3PV4A 1AFEH 1KLIH 1GBAA 3VFEA 4LZ4B 2HNTF 2Z94A 3KQCA 2KCYA 1A3BH 3TNSA 5GWZA 2BDYA 3A7YA 3SZEA 4YXWD 1MTWA 3TITA 3BTDE 1SG8B 3I78A 1P57B 1D3DB 3SU6A 2J97A 4Y10E 4HZHA 1GMDG 4JCNA 1V2RT 1IHSH 1C1WH 1AZ8A 2K0QA 1OHHD 3MU1A 1BHXB 2Z6BD 3BTHE 4H42U 2D26C 1U6QA 4J1YA 4MPXA 1B5GH 1O5EH 2R2MB 1TX6A 2ZDNA 1C4Y2 2GDDA 3TJOA 1ESBA 3DSOA 1W0JD 3A82A 4JZ1A 3SU3A 4Y0YE 2G4UA 1JOUB 3PTBA 3LDXH 1K1MA 1H8ED 4ABDA 1SGYE 1FNIA 1SOTA 4WWYA 5A8XA 3P92A 2GCTB 2QXIA 1O3HA 3SUDA 1FY1A 3GY3A 4IMZA 4KGAA 1KXAA 2PKAB 4RT0A 2KX4A 3H5CB 3FP8E 3PO1B 2H1UA 2JH6D 2XC4A 1T8MA 1GJDB 3KQDA 3SI4H 1MD8A 1P2IA 4MTBA 2A4RA 1Z8RA 8ESTE 2OTVA 1S6LA 1TWXB 2GV6A 2XBWA 3U8TH 1GI4A 1EP5A 1AN1E 1V2ST 4FUCA 2G00A 1P3EA 1Z8GA 1V2JT 3TU7H 2VWOA 1QRWA 1HAZB 1L2EA 3RXKA 1BA8B 5EU8A 1P9SA 4X1NU 1HIAA 4TPIZ 1WU1A 1O3OA 1E79D 1EOJA 3N99A 4K3JA 4X1RU 3GY6A 1ZR0A 4XDEA 4UFEH 4NSVA 5HIZA 1MTVA 1TMUH 3GYLB 1K1OA 1TOCB 1P2OA 4KTCA 3RC6A 4TWYA 2B8OH 2BMGB 1SBWA 4A1TA 1G30B 3F2FA 1SLWB 5JB9S 8GCHF 2H9EH 1P2QA 1S83A 3RXPA 1WV7H 4MQAA 1T4VH 2BDGA 5J4QA 1KDQB 1ZPBA 3KIDU 3KQEA 3SJIA 1EJAA 4NZQA 3H7TA 3PWBA 1ACBE 2VH6A 3Q3XA 4I32A 2FWWA 4AB8A 2BY8X 4DY7B 3SHCH 2B0FA 2Y5GA 1C2HA 3F9EA 1A5HA 1XUGA 2NU2E 1NRRH 2BLWA 1LO6A 4YLQH 4X8UH 4CH8B 2P95A 1MAYA 2THFB 1P05A 1P2JA 4CRDA 2W7UA 2TBSA 3EA9A 4O3TA 4X0WU 4ABFA 1P2KA 3BTKE 1GJ7B 2AHME 3NUMA 2WV4A 1PQ7A 5B6OA 1GBTA 3HKIB 2ZP0H 5GPIB 2A45B 1GI9B 1GJ8B 1OXGA 3KEEA 1ELEE 1EP6A 1RIWB 1C1RA 1F5LA 1E36B 1QL9A 3RMOH 1GBEA 1AFQB 1OYTH 3ZVEA 1CO7E 2R2WU 4D9QA 2GTBA 1SGFA 2QF3A 3F2HA 3AW0A 1IQMA 4X2VA 9LPRA 4KELA 4ZHAA 3GCOA 1UW7A 1DXWA 1T8NA 4XFQA 1L0ZA 3PV2A 1FXYA 1C5SA 1V6DA 1GBJA 2W5EA 5HIYA 3NCLA 3RXHA 1DT2A 1PPGE 1BTXA 1SGCA 4HG6A 3MU0A 1MABB 4ABIA 4AGKA 2P3TB 2Q6FA 2BY9X 4FUBA 4ISIH 2CN0H 4YTAA 1MKWK 2PGBB 2HALA 1FQ3A 1DWBH 5E2PA 1GI2A 4GSOA 1GBDA 2BDHA 1E35B 3ZVCA 3LONA 2PGQB 1NRSH 1O2ZA 1MAXA 4Q7YA 1O3PB 2A1DB 2KCAA 2ESTE 1RJXB 2J38A 3Q00A 4IN2A 2BD9A 5A0CA 4RSPA 1K28D 4ZXXH 1BRBE 3MWIU 4WXVA 1KXEA 1PQ8A 1CHGA 1ELAA 1P04A 1OS8A 4MNVA 1EFRD 1FI8A 4VGCB 1O2PA 5LPRA 3RXFA 5F8TA 3F9GA 2XNIA 3URDA 3P8NA 2VVUA 3UUZA 1JWTA 3GY5A 4YM9A 3DT0H 4ZKOU 2IJD1 4FUIA 2CJIA 5E0JA 3MH4A 1OX1A 1QJ6B 1W7GH 3A8CA 1GBCA 1E0FD 1Q31A 1MKWH 3T26A 5DP9A 2W7SA 4NFFA 3C1KA 3U28C 5CHAC 1BJUA 1HAIH 3S69A 1LHCH 1T31A 2W3IA 3FFGA 3SGAE 3GDVA 1CE5A 3DUXH 3MMGA 1WSSH 4KTUA 2P16A 2ZGCA 5JBTA 1FIWA 1NRNH 3MFJA 1X7AC 4M7GA 3SJ8A 2VIDA 1AUTC 1BBRH 1XKBC 3BEUA 1D6RA 2XW9A 4FUFA 1P02A 5C67A 5EJ1A 5EQRA 4UONA 1ZJKA 2D1JA 3OFND 1QZ8A 1F5RA 1BJVA 1K1PA 1NN6A 2ZFSA 4NIYA 2TRMA 1JBUH 1PPEE 2KCOA 2ZNKH 2FTMA 5DK1A 4UEHH 4LZ1H 2J4IA 2ZG0H 1AUJA 3KL6A 4LOYH 3QLPH 1WBGB 2FX4A 4OS4A 1KTTB 5JDUB 1O3JA 1QBNA 2HNTE 1LKBA 1CSOE 2WHXA 1BBRE 3QUMP 1FJSA 2KR7A 4AORA 4TY7A 4NA7A 1ORFA 1C1UH 1CBWB 3DCLA 3OAAD 1J8AA 1EX3A 1GDUA 2JJ1D 3N7DA 2ZDLA 4ISOA 4OS5A 2HRVA 2NU1E 4KKDA 1O36A 1N8OC 5FBEA 3RLYH 3MNSA 1GMHF 2GDEH 2HWLB 1UK3A 3LOXA 1C2FA 2XTTB 1YPGH 4NZLA 2Y7XA 4JYUH 1HPGA 1GG6B 1O2XA 4B2AA 2A4OA 2C93B 3A7VA 4DT4A 1YPHE 1ETTH 2XCNA 3QN7A 1ANEA 2P93A 5DKMA 3UNQA 4J2YB 1DM4B 1GHAF 1WTHD 2GMTC 2BLOA 1LHDH 1BIOA 3RXQA 3SV2H 3O8DA 4ZKRU 2Z9IA 3TK6A 4GPGA 5DSFA 1MTNC 9ESTA 4ABBA 1W0ZU 2NWNA 1THRH 4IN1A 5E0HA 3AVZA 4TY6A 2VIWA 2ZCKP 3KN2A 4B75A 5JPMH 3BG8A 2J98B 1GJAB 1HGTH 2BD2A 1K1JA 1S5SA 4X2XA 4JMYA 5K0HA 7GCHF 1O2IA 5EOKA 1O2MA 5FX6A 4ZH8A 1BMFD 1DDJA 2KCPA 2QGRA 3RXDA 2ALPA 1GVKB 4IGDA 1ELFA 1V2QT 3MU5A 4Y11E 1LHEH 3KNXA 1VGCB 1WAYB 4LK4A 4DGJA 2YNBA 1TPOA 5AHGH 7ESTE 3RP2A 2V3MA 5C0TA 4H6SB 5C2ZA 3A85A 3RU4D 1CA8B 1QBVH 1XX9A 2BVXH 1TPPA 3W1EA 3N7EA 2ZTXA 1LVYA 1SL3A 1G9IE 2IOTA 4GUXA 2G52A 1HUTH 2NU3E 1XKAC 4UE7H 4UFGH 2JH5D 1G3DA 3RXRA 1DY8A 4K8YA 1CGIE 1O3CA 2OQUA 1OYQA 2PKSC 2GZ8A 2W3KA 4I7YH 4Y76A 3NRLA 3IITA 3ZZ9A 4QT8C 1C5YB 1TRYA 1Y3WA 2W6JD 2B5TB 3F6UH 3ODDA 5A8ZA 3SW2B 4BNRA 1YCPK 4U30A 3ZZAA 3FN8A 1MZAA 2VH0A 4ISLA 1F0SA 1GCTB 4ISHH 3RXVA 3DFLA 3OU0A 1FLEE 4IBLH 4X6PA 3E16B 1P09A 2CHAC 4K60A 3LC5A 3TJNA 2DUCA 2HOBA 1FAXA 2ZZUH 1GJ6A 3CENA 4FVBA 5DP8A 4YOIA 5DJ7A 3SU5A 3VXEH 1AB9B 2ZC9H 4SGBE 3ZVFA 1VITH 2HNTC 1ZPZA 1OWJA 2P8OB 4DIIH 2QA9E 5T3HA 1DSTA 3PRBA 2OXSA 4XBBA 4OM9A 5TJXA 2PUQH 2QF5A 1CVWH 1XUFA 3PMBB 4NWLA 4K69A 2UUJB 1BTUA 1C1MA 1GMHG 1LKAA 2GKVE 4ZKNU 1ZMLA 1EZSC 3ATKA 5EJLA 1QRZA 1LHGH 1ZSKA 3ATWA 3VGCC 2G55A 3ZVAA 2Y82A 3BG4B 4XBCA 3PMHB 1YLCA 3D23A 2PHBA 4HFPB 1A0HB 2WPMS 1TGNA 1P2MA 1K9OE 4OGXA 2YOLA 1UO6A 1KSNA 3GCTG 1QBOA 1GHAG 1YPLH 1UVPA 3IG6B 3E0NB 2Y5HA 1NY22 3F0PA 3K9XB 3V12A 4CHAB 1EQ9A 4ESTE 3O8RA 1PPZA 1P9UA 5IDKA 4BXWA 1WYKA 1A46H 2UUYA 4ZMAH 1GBIA 1HNEE 1NFYA 1O2KA 3AASA 3LU9B 3E6PH 4X2WA 1NFXA 5GIBA 4Y71A 1HIAB 4Z0KA 1BTYA 2ANWA 4AN7A 1S0QA 7GCHG 1TALA 2F3CE 3E0PB 3BV9B 1AE8H 1AWHB 1SGNE 3BTFE 5F8ZA 1QGFA 1E38B 3A86A 3SU0A 3LPRA 1EJNA 2WINI 1NS3A 2EI7A 1SQRA 3MI4A 1YM0A 2SGDE 2Z3EA 3GS9A 1UHBA 2G81E 1ELDE 3DA9B 4LXBH 2A31A 4UDWH 1C2DA 3BF6H 4WH6A 2ZQ1A 4XSKU 1SOZA 1O3DA 2RA3A 1IAUA 2STBE 4FVDA 1JIMA 4YESB 1O2YA 1P8VC 2TGAA 2P8OC 1HDTH 2PTCE 2A7JA 2DE8A 1AVXA 2NU0E 1WOFA 2ZPRA 1JRSA 3TH4H 2XWBI 2AMPA 3AAVA 3U9AH 3OEHD 3ELAH 2ZWLH 1PFXC 1UVOA 1GI6A 1ANCA 1EJMA 3DSPA 3MO9A 5DG6A 1EB2A 1ZMJA 3RXOA 1O2RA 2ZU2A 2SGAA 3UPEA 6ESTA 6LPRA 3T62A 5A0BA 4HTCH 1BOQA 4FU8A 1GGDC 2CK3D 4ABJA 3ZZ3A 1UVUH 2C90B 1EAXA 4K1TA 2OUAA 3E8LA 3RXIA 1UMAH 2FP7B 3F1SB 3RM2H 2EC9H 1GJ5H 3Q76A 5FCRA 4Y6DA 4ABGA 1GJ9B 1EZQA 1O2LA 2HGTH 1QQUA 1VCQA 1QQ4A 2SFAA 3UIRA 1O3LA 1SFQB 3OSYA 2ZKSA 1YPJH 4WMEA 2H6MA 1CT4E 2JH0D 2V35A 1S6HA 4Q80A 1PQ5A 3P6ZB 4FUJA 3L33A 2VIQA 2C8ZB 2JKHA 2PFEA 1TX8A 1FPHH 1HBTH 1TE0A 3HPTB 3W95A 2CGAA 4O3UA 1GBHA 2ZDVH 2VWNA 1OKXA 2STAE 2J9NA 2C8WB 2ODYB 3RXBA 2EY4C 2BVSH 5KEDA 3U8RH 1HAPH 1HAVB 1Y5AT 4CR5A 2KAIB 1W0KD 2FOBA 2RA0A 2VIPA 1Q3XA 3LJOA 1SI5H 1DWCH 1S6FA 2KM0A 2ZQ2A 4O97A 3LT3A 3UY9A 5T6FA 2PSXA 3OX7U 1O3BA 3IWMA 3A84A 1NO9H 2WUCA 3L3TA 3P95A 1C5LH 4OGYA 3SU1A 1O3EA 1SGQE 3F68H 1K2I1 3SQEE 3KQBA 2UUFB 1C5XB 4PROA 1AKSA 1EAUA 2LP6A 2HPPH 1KLTA 2FX6A 4RKOB 2AYWA 1QNJA 1Z7KA 3LJJA 3OY6U 1O39A 1W3CA 2ZCLP 4AYVB 5LGOA 5DO4H 1SPJA 4Y8ZA 4GCHG 4GAWA 3W94A 3SUGA 4E7NA 1NBME 2AERH 1J9CH 4BXSA 1O5GH 3RXAA 1IQJA 4FU7A 2LNCA 3SNEA 2F9OA 1OP0A 3PV5A 4H4FA 5T1VA 2FESH 3H09A 1ELGA 2G4TA 3P70B 3ZYDA 1SVPA 3SYJA 3DSGA 1FZZA 3UOPA 1MCVA 1PJPA 3G01A 3EA7A 3V3MA 1NM6A 2VWMA 1ELBA 1DVAH 1YBWA 3BIUH 3TH2H 1H9HE 1QURH 1DSUA 3UOUA 5TCCA 5ESTE 4DOQA 3PROA 4NWKA 2F9BH 1COWD 3BTGE 4I8GA 1TBZH 2VB0A 4YLUA 1VJ9U 8KME2 1ABIH 2V7QD 3L6PA 3T25A 3WY8A 1OWIA 1UVTH 2ZDMA 1C5TA 2BD8A 2ZIQH 3F0OA 3SJOA 2WPIS 1Z6JH 1TGTA 1WDIA 3TIUA 2P94A 1G2MA 2FPZA 3SUFA 3PRDA 4THNH 5E0GA 1GI1A 3TJVA 1NU9A 4FUHA 2BD7A 4YOGA 3V13A 3VB6A 1BTWA 2CF9H 3A87A 1BQYA 1RFNA 3LGTA 2OCVB 2CF8H 1LPKB 2R3UA 3PWCA 4BAQB 3O8BA 4MPUA 3OYPA 2ZI2H 4AOQA 2PLXA 1SGTA 6GCHF 1LVOA 5EQSA 1YF4A 2EQNA 3QGNB 1BUIA 1MH0A 1O37A 5JB8S 1KIGH 4Q4LA 3T2NA 4F4OC 3SJKA 2ZU4A 3VB7A 1NFUA 1C5PA 4DURA 4DT7B 2RDEA 2OQ5A 2VNTA 4INHA 4CBOA 1IOEA 1W12U 1C9TA 2YNAA 3I77A 5G4BA 3TH3H 2QIQA 2ZGBH 4K1EA 5IK2D 3RXTA 1A4WH 2ZECA 3CS0A 3RXSA 1ZMNA 4ABHA 5GCHF 1S82A 2BLQA 2PR3A 3MOCA 5DP7A 2OK5A 1KXBA 1ZGVA 4B76A 2BHGA 2VJ1A 2ZHDA 4ZROA 1VITF 3QZRA 1SC8U 4K1SA 5F8XA 1IQNA 3SGQE 1ZPCA 3D49H 2ZGXH 2BX3A 2QV1A 4AFZA 5L2YH 4TT3D 4X1QU 2GP9B 3OY5U 1P3CA 3SGBE 2ZPQA 3QO6A 4DIHH 1O3AA 1AI8H 1TA2A 2LPRA 5CHAB 2IPQX 4K5ZA 3STJA 1QA0A 1TYNA 1T8LA 1O5FH 5I46H 1EAWA 2OLGA 1HAGE 4MNXA 1V2OT 3NXPA 2FOAA 1UTLM 3TGIE 1O3GA 5EJZA 2WV9A 2ZGHA 1DE7H 1O38A 2O9QA 2D8WA 3D62A 2WSSD 1UTNA 1EXFA 1YP9A 5J4SA 1QJ1B 2TGTA 3UTUH 4AC9A 3QDZB 3SNCA 3U98H 2SGEE 1HFDA 1HJ8A 3GDSA 4ZHLU 4Y79A 4O03A 2BOHB 2VBCA 3FP7E 1NC6A 1BMMH 3MU4A 1K1IA 1K22H 1ETSH 1H8HD 2M5TA 2XBYA 3GOVB 5EW2H 4R8TB 4Z1MD 2F9PA 2FOHA 1BDAA 1C5RA 1TBRH 1PPFE 1BBRK 1P2NA 3WWFA 2QF4A 1JMOH 2ZFQH 2FIRH 1A5GH 1NPMA 2ZFRH 2Z3CA 1V2WT 4YOJA 3GY8A 2OD3B 1A3EH 1T7CA 1AD8H 4TPYA 1FAKH 4MNWA 8GCHG 1NESE 3V0XA 1E37B 4MG3A 3GCHC 1N8OB 5GJ4B 1YLDA 3AAUA 2A7HA 3B9FH 1O2TA 2GJGA 1Y5UT 3KYFA 4DCDA 1O2OA 4KTSA 2PKAA 1YLNA 1BRAA 3ZZCA 4RKJB 1Y3YA 1RS0A 1UK4A 5EXLA 5AFZH 2EEKA 2FOEA 5EGMA 3N7OA 2BB4A 3MYWA 2W6ID 2HVXA 2F9VA 1XXFA 1W10U 5PTPA 1W13U 2GMTB 3SV6A 1ZSLA 2QYIA 3NWUA 2BDBA 6CHAC 2BD4A 1MTNB 2BTCE 3M5OA 2A5KA 5B6LA 1B7XB 4WH8A 1ABJH 1TA6A 3U1JB 3EYDA 3A7TA 2A5IA 2FEQH 1JXPA 4IW4E 3PYHA 2A2XH 1XUJA 4K2YA 3U8OH 1TLDA 4JZIA 2FXRA 3K65B 4ASUD 2V3HH 1W8BH 1VITG 1S81A 1ZLRA 4ZKSU 1YPMH 3BEIB 3MH5A 3PM3A 3RXMA 1PPHE 3MH7A 3RLWH 1O32A 1PPBH 5C1YA 1C1OA 3SJ9A 4IC5A 1RTKA 1DANH 1TX7A 4X8TH 1Z1JA 3K2UA 3LC3A 2J94A 4GVUA 1XUKA 5F03A 4E06H 1OP8A 1H8DH 1YPKH 3M36A 3T27A 4A92A 4ASHA 1DUAA 1ZRKA 4MPVA 1D6WA 1WQSA 3S7KB 2YMSD 2PKSB 3SV8A 1O5CB 2FMJA 5AFYH 1GMCF 1UHBB 2C4FH 4A1VA 5HYOA 2KZ4A 1C2IA 5CDFE 1S0RA 4BOHA 3QTVH 2ODPA 3UR6A 2WZQA 2G5VA 3TVJB 2PP6A 3ZZ4A 2F4LA 7KMEH 2AFQB 2PW8H 4GHTA 4BANB 2PTNA 3T5FH 1SB1H 1HJ9A 1LTOA 2XXLA 1K1LA 5EW1H 1ANBA 3UWJH 3SI3H 1FONA 1GJCB 2OINA 3M3TA 1WQVH 3LKWA 2RCEA 2XOKD 1NRQH 4B6FA 3GISB 2GCHF 3UAIC 1SGFG 4UFFH 2CHAB 5HKKD 1B0EA 3BN9A 2UWPA 1A7SA 1AZZA 4JYVH 1HXFH 4U32A 8LPRA 1O5BB 1IQEA 4OS7A 1BT7A 1F7ZA 7LPRA 2P3FH 2VGCC 4NGAH 3ZZDA 5EXNA 2ZCHP 2ZHFH 2FM2A 3UQOA 4AGJA 2BYAX 3FO8D 3KQ5A 3M35A 3SNBA 5C3NA 1Y3VA 2QXJA 3M3VA 1G3EA 3ATMA 2FOCA 1HJAC 3KCGH 1TMTH 1GHWH 3VGCB 1SLXB 5DN6D 1IQIA 1C1TA 1SKYE 3KGPA 2L6OA 2GGVB 1DLKB 1YWUA 2ZO3H 1UVSH 3RMLH 3DHKH 1QB1A 2TPIZ 3HATH 1SGDE 1L1GA 3V7TA 2SGPE 1JRTA 2ZA5A 1K1NA 3MNXA 5DP6A 5EG4A 2Q6GA 4MPWA 1QTFA 4AFQA 1DX5M 3TPIZ 1VKYA 3BEFB 2UWLA 2ALVA 3F2GA 3QTOH 5CE1A 1O31A 1TB6H 1O2UA 2HLCA 1KYNA 1V3XA 2ULLA 3O8CA 2R3YA 3LH1A 3F3BA 3QX5H 1FPCH 2Z3DA 1AWFH 2H9HA 2PV9B 3ZVBA 1MUEB 3A83A 1EAIA 3F9HA 4BTUB 1G2LA 4FUEA 2TGPZ 4Y7BA 3A8BA 4F49A 1YKTA 2PUXB 1CGJE 2G5NA 5BRRE 3F9FA 1C9PA 4I33A 2Z9JA 1THSH 3SUEA 1C4U2 5C5OA 1AU8A 1MU8B 1Z1IA 3RXEA 4CRCA 2GT8A 4XRNA 5GXPA 2H9TH 1C2GA 4ACBA 1C1NA 1TNLA 4TYDA 3M7TA 4I8KA 2TIOA 3FVFB 1QJ7B 2AH4X 1A0JA 2RG3A 4JZFH 2SGQE 4ABAA 1QY6A 1MU6B
chains in the Genus database with same CATH topology
5AVDA 3M5LA 4WMFA 5ABWA 2CXVA 1C5WB 1GCDA 3SO3A 1QFKH 3BTQE 2BDCA 1GGDB 4A6LA 1YPEH 1F0TA 1V2MT 1YPHC 4I8JA 1INCA 1SSXA 2GT7A 2GCHG 1KXCA 1P12E 1GHZA 3SV7A 3GCNA 1ID5H 1RXPA 1O30A 4X2YA 3SV9A 1O3KA 2OBQA 5I25A 1Y5BT 3LH3A 3ZZ8A 3CP7A 3E90B 1G3BA 3HK3B 2ANMH 2BY5X 3P8GA 1GMDF 2B7DH 1LVMA 2J95A 3B8JA 1OOKB 2F9NA 2FOGA 3RMMH 1KXFA 4ZAEA 1XVOA 5ESBA 3ENSB 5BPEA 2VIOA 4Y0ZE 2GVFA 3MTYA 3VB5A 1OWDA 1ZHRA 1W11U 1AO5A 1UCYH 4HGCA 4BAOB 4UD9H 4D8NA 1CA0C 1FIZA 1C2EA 1F92A 1RTLA 1A61H 1M9UA 4DVAU 1DXPA 2TGDA 3LGIA 3OTJE 1KLJH 1TGSZ 2GD4B 5DGJA 1J14A 1ARCA 1WCZA 2BDAA 2I6SA 4I31A 1TNHA 2ZFTA 1P0SH 5C1XA 1MTSA 3K6ZA 2FLBH 2WYJA 3SOSA 3BTTE 2QAAA 1Z8JB 1C1VH 5JBCS 3Q3KA 1UJ1A 1EPTA 1UCYE 1P10A 1AGJA 4X8VH 2VU8E 1ETRH 3SU4A 1KXDA 1Q2WA 2GZ7A 3ODFA 1D3PB 5AF9H 1LQDB 5FHTA 1CT2E 2O8WA 3NPSA 3SBKA 2Y6TA 2SNWA 1IQHA 5EQQA 1N6YA 1VZQH 1GHVH 5LPFA 3ESTA 3ZVDA 2XRCA 1AE5A 1PPCE 1RRKA 1EKBB 3RXLA 1W2KH 1EOLA 1OWEA 4NA8A 2OBOA 1YGCH 2ZHQH 4X8SH 4FU9A 1DITH 5JBBS 1FN6A 2J92A 4WMDA 5H4IB 5C1UA 4K8BA 5LH8A 1ELCA 3RMNH 2C8XB 1C5MD 1D3TB 1TAWA 1LVBA 2JETC 1O2JA 3VB3A 4CBNA 3CS7A 5HM2A 2XWAA 4Q2KA 1SGIB 1BTHH 1GL0E 4AG2A 2J2UA 5FPSA 4WXIA 1O2HA 1ZTJA 4FUGA 1EZXC 1ARBA 1DOJA 3AW1A 4NG9H 1YYY1 1MZDA 4CRGA 1C1SA 1BMLA 3QWCH 1DUEA 2Q6DA 2A5AA 4U2WA 3D65E 3KHVA 1GVZA 1O34A 1W7XH 1QR3E 1P03A 1S85A 1VCWA 2Z9KA 4BAKB 1IQLA 1PYTD 3RXGA 1GI8B 1O33A 5C5NA 4GLYA 4MDSA 3SNAA 1HRTH 2AEIH 5T6DA 4TWWA 1SR5C 2AIPA 3Q3YA 3UWIA 1ZTKA 3S9CA 1T4UH 4ZUHA 1FMGA 2ILNA 2B9LA 3UFAA 3DFJA 5FCKA 2BLVA 2EI6A 1BRCE 1QB6A 1TGBA 5HXFA 2EA3A 3PMJA 2ZU3A 4HI3A 2SNVA 5K7RA 1OWKA 1SFIA 4Y7AA 2FS9A 1KTSB 2C3SA 1QL8A 1L1NA 4X6MA 1A2CH 4JK6A 2XYAA 1FUJA 1RTFB 1WUNH 3FAOA 3VEQB 4B2BA 1FV9A 4ZXYH 4B2CA 3ATIA 4Y8XA 1VCPA 2BD5A 1ELTA 1XM1A 1P06A 1AQ7A 1CU1A 3PTNA 1FY5A 1XVMA 1S84A 4X1SU 1IHTH 3ZV9A 3EGKH 3VPKA 2FYQA 1XXDA 1QL7A 2H2ZA 1NTPA 2BM2A 5GDSH 1DWDH 1SQOA 4CRBA 1Y8TA 4NA9H 2FODA 2Z9LA 4NIXA 1SHHB 4D9RA 1O2SA 2HPQH 2AS9A 2XBVA 2I6QA 2OC7A 3GDUA 4UFDH 3M5MA 4ABEA 4B73A 3A8AA 2IPHA 3SQHE 2OP9A 2FLRH 3TGJE 1GJBB 3FZDA 1H8IH 2BY6X 1C4V2 5HM9A 2ANKH 3RUOA 2ZHWH 4OS2A 1T8OA 3A80A 4XBDA 3EAJA 1GBKA 2ZFPH 3M7UA 3E3TA 1SMFE 2P59A 3A88A 2GCTC 3QGJA 1LQEA 5JBAS 1FY3A 4A5TS 1L4ZA 5EPYA 4AFUA 5LPEA 1H1BA 1MD7A 1XUHA 2F91A 2Y80A 2QY0B 3ZZBA 1O5AB 4X6NA 3PO1C 3KF2A 1GPZA 1H4WA 3S7HB 3EA8A 1N6XA 1GDNA 3SNDA 3GCHB 2CMYA 3HGNA 2XCFA 1V2NT 1CHOF 5TCAA 3U1IB 2Y5FA 3BTEE 1C2LA 4D7FA 3UREA 1O35A 1BITA 1O2NA 4INLA 1TGCA 4Q7XA 2WPJS 3M5NA 5DP3A 3RDZA 3SORA 1ZZZA 1MKXK 1H9IE 1QB9A 1TONA 1EUFA 1ZTLA 1ZYOA 4SGAE 2WYGA 2QXGA 1OSSA 6CHAB 1O3FA 3PLKA 3TGKE 1GVLA 5A09A 4YT6H 1O3IA 1HAVA 1G3CA 3S9BA 5C20A 1MQ6A 1DFPA 2KAIA 1D9IA 1TOMH 2P3UB 3UR9A 3MH6A 1XMNB 2O8LA 1BMAA 4MVNA 4BTIB 4MNYA 1NROH 3URCA 1ZJDA 2FYRA 2GV7A 1G36A 2A0QB 3BTME 1P11E 4E05H 5F6MA 2BVRH 1IQKA 4JZEH 2A4GA 2SGFE 2ZDKA 1PYTC 4I8LA 1GHBF 1Z8IB 1SQAA 1HYLA 3MNCA 1BZXE 1O0DH 1F2SE 1MQ5A 1UK2A 1MKXH 3HKJB 1AIXH 2FZZA 2QN5T 4NSYA 3A81A 1LHFH 1GI3A 5IYTA 5E2OA 2ANYA 1SQTA 2K1QA 1V2TT 2AGEX 1NU7B 6GCHG 3SHAH 3MO3A 4GHQA 4XOJA 4YZUA 2ODQA 5L6NH 4H6TA 3GY7A 1DS2E 1BHXF 1GHXH 1XUIA 1RGQA 1A0LA 2H5DA 2G8TA 1ESAA 1RIWC 1QHRB 1G37A 1AMHA 2NU4E 2ZPSA 1J15A 5SGAE 1Y3UA 1DICA 1HV7A 1CT0E 1WTGH 3ZZ5A 1AFQC 1O2WA 1BTPA 4JK5A 3RU4T 1G32B 2A32A 2OC1A 5GCHG 2FO9A 5E8EH 2VGCB 3NKKA 2ASUB 5HMAA 3LGWA 4INKA 1J17T 3R3GB 1TNGA 1O3NA 1CHOG 3NZIA 3SN8A 1HJAB 4OS1A 1Z6EA 2BZAA 3E1XB 1ZRBA 1OWHA 1TQ7B 1TBQH 4AZ2B 1RD3B 3ZZ7A 1PQAA 1SLUB 1ZOMA 2ZU1A 2C8YB 4DJZB 3E91A 4XE4A 1EASA 3ITIA 2Y7ZA 4B74A 2FS8A 1QA7A 2WPKS 2WPLS 1OP2A 5FPTA 1GJ4H 1UTKA 3A7ZA 1HCGA 1GBFA 1TFXA 1O2QA 4ZHMU 2V6NA 3M3SA 1KDQA 2ZHEH 1MTUA 1H9LB 4E7RG 1SHYA 3P8OA 1HLTH 4VGCC 4A1XA 3GY4A 3UQVA 2QXHA 1NZQH 3FZZA 5FPYA 1FY4A 1ANDA 1HAXB 1NT1A 1UTOA 1GBLA 2XBXA 2QF0A 2BQ6B 3A8DA 1SLVB 4IMQA 3GYMA 1HB0B 3UNRA 3JZ2B 1CGHA 3UNSA 4WY3A 1TPAE 4X6OA 1GI0A 2F9UA 1A5IA 2VVVA 1D4PB 1GHBG 4FUDA 2AIQA 1LPGB 1TRNA 1EPTB 2VVCA 3GCTF 2BZ6H 2PSYA 2RDLA 1O5DH 1UTQA 1HAHH 2UWOA 4X1PU 2IJOB 2ZU5A 2DE9A 1NRPH 4NCYA 4RN6A 5A8YA 3A7XA 1FY8E 4CREA 3RXUA 4ISNA 1K21H 1OPHB 1QRXA 5EODA 2V3OH 1A1RA 5FXLA 1GI7B 1F5KU 1LCYA 4AYYB 1C5OH 1C5UA 1LPZB 5ETXA 2A4QA 1BCUH 1C5QA 3PMAB 3LIWA 3HGPA 1C2KA 2D2DA 1MCTA 3PLPA 4A7IB 1DWEH 1EATA 2FTLE 1ESTA 3M61U 4FXGH 3ZZ6A 3R0FA 1KY9A 1TMBH 5FX5A 1QIXB 2ZTYA 1EZUC 4Y8YA 1TQ0B 2GX4A 2WV5A 3FP6E 1SGEE 1TIOA 4CR9A 3ZVGA 1UTPA 2FOFA 1F0RA 3DD2H 3EQ0H 1W14U 4IS5A 1GHYH 2FI4E 2OC8A 2QC2A 4OS6A 4NIWA 1CBWC 2BX4A 2ZTZA 1TRMA 4JYTA 1UTJA 2BOKA 3T29A 5EXMA 5CMXH 3TJUA 3A7WA 1LMWB 3VB4A 1VJAU 2FOMB 1BB0B 4WJG2 3GY2A 4B71A 4Q7ZA 1CA0B 1ZHPA 4AFSA 3P17H 1GG6C 2OC0A 1AKSB 3B23B 1B0FA 1C5NH 4YO9A 4NFEA 1UTMA 2AMDA 3NK8A 4WF8A 1EPTC 1C5ZB 4R0IA 3RC4A 5DPAA 2AGIX 4WVPE 3TNTA 1FN8A 1BRUP 3RU4E 2WPHS 1ZHMA 2FDAA 4IC6A 1JIRA 1GMCG 3S9AA 1QCPA 4DW2U 1SGPE 1VR1H 1HAOH 1J16A 5L2ZH 1UCYK 1O2GH 1BMNH 1V2VT 3EE0B 2IN2A 3VXFH 2O8MA 4AX9H 3MO6A 1C1QA 2VWLA 1C2JA 5T6GA 4KP0A 3C27B 2FI5E 1AY6H 3U69H 1VGCC 4YT7H 1TNIA 2Z7FE 3FANA 2EI8A 1DLEA 5L30H 1O3MA 1YCPM 5JYIA 2H5CA 4MLFB 3S0NA 4AB9A 1YCPH 2R0KA 2PWXA 1HAYB 3TK5A 2BD3A 1ZSJA 3K6YA 3RXCA 1C1PA 4D76A 1IQGA 3STIA 1V2KT 3H7OA 3MNBA 4CH2B 3BIVH 4CRFA 3TK9A 2Z9GA 1MMJN 1SGRE 2ZF0H 3LGUA 3A89A 4Z6AH 5FBIA 5DP5A 2Q1JA 1GDQA 1L4DA 2CV3A 2A7CA 4CRAA 4DG4A 3P8FA 4JZDH 1THPB 1O2VA 1V2PT 2BQWB 2JETB 3SZNA 2VINA 3RM0H 1ZGIA 2UUKB 1N1LA 1GCTC 5FAHA 2ZEBA 1BTZA 3Q77A 4GCHF 1TPSA 1GI5A 2G51A 5HGGA 2A2QH 1EB1H 2FI3E 2QCYA 2W26A 2XC5A 1E34B 5EPNA 2Y81A 1T32A 1Y3XA 1D3QB 3BTWE 2VIVA 1Z71A 1AB9C 3PB1E 2AGGX 4I8HA 3M37A 1AHTH 2R9PA 1MBMA 5A2MH 2ZFFH 4NIVA 3TLOA 3ATLA 2BXUH 1TABE 3RC5A 3ZYEA 2BDIA 1LDTT 1V2UT 3RXJA 3ZV8A 1F0UA 1YC0A 1Y59T 4O9VA 4B1TA 2AMQA 4BAMB 3SU2A 3GICB 1GL1A 2V0BA 1DY9A 3BG4C 5DP4A 1P01A 1HXEH 1GBMA 2ZGJA 1MBQA 2J34A 1GWAA 1C2MA 4D7GA 1ELVA 1GBBA 2XC0A 4BAHB 2BXTH 3LGVA 2WUBA 4AG1A 3M7QA 2BQ7B 1L1JA 4BTTB 3I29A 2F83A 3QK1A 1NFWA 5A0AE 4CHAC 1AVGH 1CQQA 3MU8A 2R0LA 2BY7X 3PLBA 1V2LT 3QZQA 1W0YH 3LGYA 3EDXB 1IQFA 2GZ9A 3BSQA 4U01A 1C5VA 2O8UA 1TNKA 2ZDAH 3T28A 3JZ1B 2O8TA 1FDPA 1DPOA 1TNJA 3HK6B 1AVWA 3MHWU 3PV4A 1AFEH 1KLIH 1GBAA 3VFEA 4LZ4B 2HNTF 2Z94A 3KQCA 1A3BH 3TNSA 5GWZA 2BDYA 3A7YA 1MTWA 3TITA 3BTDE 1SG8B 3I78A 1P57B 1D3DB 3SU6A 4Y10E 4HZHA 1GMDG 4JCNA 1V2RT 1IHSH 1C1WH 1AZ8A 3MU1A 1BHXB 2Z6BD 3BTHE 4H42U 2D26C 1U6QA 4J1YA 4MPXA 1B5GH 1O5EH 2R2MB 1TX6A 2ZDNA 1C4Y2 2GDDA 3TJOA 1ESBA 3A82A 4JZ1A 3SU3A 4Y0YE 2G4UA 1JOUB 3PTBA 3LDXH 1K1MA 4ABDA 1SGYE 1FNIA 1SOTA 4WWYA 5A8XA 3P92A 2GCTB 2QXIA 1O3HA 3SUDA 1FY1A 3GY3A 4IMZA 4KGAA 1KXAA 2PKAB 3H5CB 3FP8E 3PO1B 2H1UA 2JH6D 2XC4A 1T8MA 1GJDB 3KQDA 3SI4H 1MD8A 1P2IA 4MTBA 2A4RA 1Z8RA 8ESTE 2OTVA 1TWXB 2GV6A 2XBWA 3U8TH 1GI4A 1EP5A 1AN1E 1V2ST 4FUCA 2G00A 1P3EA 1Z8GA 1V2JT 3TU7H 2VWOA 1QRWA 1HAZB 1L2EA 3RXKA 1BA8B 5EU8A 1P9SA 4X1NU 1HIAA 4TPIZ 1WU1A 1O3OA 1EOJA 4K3JA 4X1RU 3GY6A 1ZR0A 4XDEA 4UFEH 4NSVA 1MTVA 1TMUH 3GYLB 1K1OA 1TOCB 1P2OA 4KTCA 3RC6A 4TWYA 2B8OH 2BMGB 1SBWA 4A1TA 1G30B 1SLWB 5JB9S 8GCHF 2H9EH 1P2QA 1S83A 3RXPA 1WV7H 4MQAA 1T4VH 2BDGA 5J4QA 1KDQB 1ZPBA 3KIDU 3KQEA 3SJIA 1EJAA 4NZQA 3H7TA 3PWBA 1ACBE 2VH6A 3Q3XA 4I32A 2FWWA 4AB8A 2BY8X 4DY7B 3SHCH 2B0FA 2Y5GA 1C2HA 3F9EA 1A5HA 1XUGA 2NU2E 1NRRH 2BLWA 1LO6A 4YLQH 4X8UH 4CH8B 2P95A 1MAYA 2THFB 1P05A 1P2JA 4CRDA 2W7UA 2TBSA 3EA9A 4O3TA 4X0WU 4ABFA 1P2KA 3BTKE 1GJ7B 3NUMA 2WV4A 1PQ7A 5B6OA 1GBTA 3HKIB 2ZP0H 5GPIB 2A45B 1GI9B 1GJ8B 1OXGA 3KEEA 1ELEE 1EP6A 1RIWB 1C1RA 1F5LA 1E36B 1QL9A 3RMOH 1GBEA 1AFQB 1OYTH 3ZVEA 1CO7E 2R2WU 4D9QA 2GTBA 1SGFA 2QF3A 3AW0A 1IQMA 4X2VA 9LPRA 4KELA 4ZHAA 3GCOA 1DXWA 1T8NA 4XFQA 1L0ZA 1FXYA 1C5SA 1V6DA 1GBJA 2W5EA 3NCLA 3RXHA 1DT2A 1PPGE 1BTXA 1SGCA 3MU0A 4ABIA 4AGKA 2P3TB 2Q6FA 2BY9X 4FUBA 4ISIH 2CN0H 4YTAA 1MKWK 2PGBB 2HALA 1FQ3A 1DWBH 5E2PA 1GI2A 4GSOA 1GBDA 2BDHA 1E35B