1GBCA

Alpha-lytic protease with met 190 replaced by ala and gly 216 replaced by ala complex with methoxysuccinyl-ala-ala-pro-leucine boronic acid
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGANVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ALPHA-LYTIC PROTEASE
total genus 52
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbcA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbcA01
2ZIQH 4KTSA 5A8XA 2BD2A 2HOBA 1HAYB 4OGYA 1FPCH 2RA0A 1HAIH 1O3JA 1JWTA 1MZAA 1K1OA 2R3YA 3LH3A 5EW1H 1SGTA 5DJ7A 1NT1A 1WUNH 1EZSC 2CXVA 1O3MA 4AGJA 1TABE 1A3BH 3URDA 1BTYA 3TH4H 3QDZB 2FMJA 3MU1A 5JDUB 3SNCA 1NFYA 4A1XA 3RXIA 4LOYH 1CU1A 1C2DA 1PQ8A 1EPTB 2HGTH 3URCA 5EQSA 3TGKE 2FYRA 3M5OA 3A8AA 3CS0A 1PJPA 2SGAA 4WMEA 4K60A 3W94A 1H9HE 1ELEE 4X2WA 2CGAA 3QGNB 4NFEA 3E16B 2M5TA 3UOUA 2RCEA 1C5SA 3SI3H 5FHTA 4Y10E 1HCGA 1NN6A 4BTUB 2AS9A 1EPTC 2GX4A 2CMYA 2ZDNA 3E90B 1RIWB 4A6LA 1MTSA 3FZDA 4IMZA 2GP9B 1W7GH 3MNBA 5F03A 3H7TA 1V6DA 5DG6A 1RRKA 1FZZA 1F2SE 1C4U2 1Y3VA 2ZPQA 3T26A 1AWFH 3RXPA 2GDEH 1K22H 2A32A 3ZVAA 5GIBA 4RSPA 1IQFA 4HTCH 1E36B 1DWEH 1DSUA 1AD8H 4Y8YA 2FX4A 2FXRA 2FS8A 1O3IA 3ELAH 4MLFB 2VU8E 3SJIA 3ITIA 3TGJE 1VCQA 4XDEA 4WH6A 4BXSA 4ABEA 5GCHF 3DHKH 1Y5BT 1TMUH 1G36A 3QTVH 1QB6A 5AFZH 1HAPH 3NKKA 5K0HA 3FFGA 3U1JB 2HALA 4XBDA 2GGVB 1XUFA 4OS4A 2ZGHA 2H9HA 1L1JA 2UWPA 1FY3A 1O2LA 2A45B 5DK1A 1Z8IB 2J4IA 3GCHB 3TNTA 3V13A 4GPGA 4ZMAH 1QJ1B 1SG8B 1C2IA 4I8JA 1FIWA 2OC0A 3ZV9A 2A7JA 2TPIZ 3RXBA 1GMHF 3VB5A 4AG2A 4BANB 2GZ7A 1JRSA 1UTQA 1OP2A 3HK6B 2VH6A 1OKXA 1F5LA 4INKA 3KHVA 1XMNB 1O37A 1LPGB 5TCCA 5H4IB 4YM9A 1MTNC 2GKVE 2Y82A 2ZU1A 1A4WH 5PTPA 1DM4B 2C8YB 1FN6A 1KXFA 1A2CH 1GBCA 2D8WA 1GCTB 4A1VA 3K9XB 4AFSA 3SNEA 1ZGVA 2VVVA 4DURA 1SGYE 3LJJA 2FIRH 4AFZA 3A7VA 3GDUA 2AMQA 3I77A 4CH8B 3SV6A 3Q77A 1Z7KA 3A7XA 4NIXA 1D9IA 4AN7A 4D76A 3PROA 5EGMA 5EXNA 1FMGA 1C5RA 1FY4A 3L3TA 2BY5X 2PSXA 2QXGA 2WV4A 3SU3A 3ZZBA 3T5FH 1C4Y2 2VGCC 4ZUHA 1AUJA 1P2IA 1GHBF 3F9GA 1THSH 4U32A 2FM2A 1ZLRA 2FOFA 1C2JA 6CHAB 4I8HA 2HNTE 1SFIA 4IN2A 3ATMA 1AHTH 1K2I1 3UIRA 1HAGE 4I31A 4YTAA 3P8NA 1CHOG 3MNXA 2W5EA 3O8RA 2THFB 2Z94A 4ZH8A 3O8CA 3O8BA 1EASA 2ALVA 3NUMA 1O31A 1G2MA 3BTFE 2BDYA 1HAZB 3ZYDA 1JBUH 3V12A 1BA8B 1UVUH 1CHOF 1SB1H 3P8GA 4SGBE 2FI3E 3SGBE 4OS6A 1D3PB 4DIHH 2Z3EA 1KLIH 4RKJB 4NFFA 3KQBA 3K6YA 2Z3CA 3DD2H 1N6YA 1Y3YA 2QXJA 2RDLA 3MHWU 3B8JA 2XBWA 1LTOA 1FY5A 3PB1E 1EKBB 4ABDA 5EU8A 1GBAA 1O39A 2CV3A 1BMLA 2FTMA 1TA2A 4UFEH 1IQJA 8GCHF 2R0KA 3VFEA 1UK3A 2ZHEH 4MPUA 2AMDA 1ELAA 1QBOA 1PPHE 1TMTH 2ZHWH 2BVXH 4ZHAA 2XXLA 4B74A 1FONA 1CVWH 1BRCE 1TX6A 1DY8A 1GJ8B 4Y8ZA 2H5CA 4ABIA 1ESBA 1W3CA 3ODFA 6LPRA 1OYTH 5B6OA 1Y59T 2VIWA 4B76A 3KQEA 4OS2A 1O33A 1F0TA 3A7YA 3EAJA 1G3CA 3EYDA 3SNAA 2F9NA 4CRAA 1ELBA 2ODQA 4JYUH 4CRFA 1EOJA 3GCTG 3H5CB 2PUXB 4YESB 3IITA 4X6MA 1PPCE 1SVPA 1ZJKA 3VB6A 1YPMH 2JETC 1SLWB 5E0JA 1OWJA 5TJXA 1GG6C 3A83A 3TGIE 1VJ9U 1SHYA 1Y5AT 2FWWA 3T27A 2J34A 1C2LA 4I8LA 1ANBA 1O5DH 1AVGH 2EA3A 1N8OB 1P2MA 2F83A 2TGAA 2G81E 1C5YB 1G32B 2ZKSA 5DP7A 4CRCA 1OWKA 4INLA 1UTMA 9ESTA 2WPKS 2NWNA 4AX9H 2A4GA 4B2AA 5JPMH 4H4FA 4MQAA 3RXQA 1EAUA 4HFPB 3BV9B 1F5KU 9LPRA 1K1JA 1Z6EA 1H9LB 3T62A 5EG4A 2QF3A 4WH8A 1QRZA 1TGCA 5LPEA 2F9OA 1UO6A 1EAXA 2A4OA 4PROA 3MWIU 4FVBA 2H1UA 4WMFA 4CBOA 2F3CE 1NROH 1UTJA 5F8XA 4FUBA 4DY7B 5L2ZH 1LHCH 3BN9A 1BCUH 1MBQA 4AZ2B 4FUHA 1D3DB 5JB9S 2G5NA 1HV7A 1MZDA 2SGEE 1O2HA 3TU7H 1K1PA 4X8TH 3MH6A 4GUXA 3TK9A 1BZXE 5DP4A 1E38B 5FAHA 1BRBE 1RTLA 1F92A 1UTLM 1ZPBA 3K6ZA 2OBQA 1L1GA 3ESTA 3MU5A 4QT8C 1KY9A 1O5AB 2AIPA 3RXUA 3TITA 2QXHA 4WMDA 2WPJS 3BTDE 1O3OA 3MI4A 5A0CA 4LK4A 3RC5A 4X1NU 1QBNA 3EA8A 1S84A 5I46H 4XOJA 1C2EA 1BMMH 1KYNA 4NGAH 1KDQA 3PV4A 3S69A 1HLTH 3KIDU 1DX5M 3GYMA 1GI6A 1KXEA 3M3TA 3UPEA 2BYAX 1EZUC 2ZHFH 1O2RA 3SUEA 4H6TA 1BMAA 3RUOA 2Z9IA 3SJOA 1MKWK 3SORA 3K2UA 2DE9A 3GCHC 3T29A 4X2YA 2QN5T 4JZFH 4KTCA 3Q3YA 1YGCH 2D26C 5A0AE 1UTKA 4CRBA 4AB8A 1GBJA 1EP6A 1W0ZU 3Q3KA 4WVPE 1BBRH 1P01A 5FCRA 1L4ZA 5E0HA 2A2XH 3BTME 4XFQA 1GPZA 1A3EH 3MH4A 2TGPZ 1ZHRA 2VWMA 4KP0A 1TX7A 2A4RA 1GJDB 4NSVA 2V3HH 1OP0A 2BVRH 3EE0B 3U8RH 1MQ5A 1O3NA 4E7NA 5L30H 1YPJH 3SGQE 3UWIA 2ZFSA 1K1MA 4D7FA 1GHBG 1TPOA 1LKAA 4JK6A 1S6FA 3R3GB 3SZNA 1GHZA 3E6PH 1SGQE 3OTJE 3QO6A 3BEFB 1Z8RA 1KTTB 1CGHA 1O3EA 3N7OA 2OINA 2UWLA 2G4TA 2ALPA 3LGIA 1TPPA 4J2YB 3BG4B 1MAXA 6CHAC 1D3QB 1YBWA 1XX9A 1J15A 5GDSH 3QX5H 3BEUA 3BTHE 1W0YH 1OX1A 1K21H 4ZKSU 2PKAA 3RXLA 2HLCA 3PTNA 1EZXC 1F0UA 3ZZ9A 1PQAA 2ZDVH 4X6OA 1C2GA 1CT4E 2ZU3A 4XSKU 5J4QA 1ZZZA 3RC6A 2QGRA 3RC4A 5A0BA 1UCYK 2Z9JA 1IQMA 1O2UA 1EZQA 2ZQ2A 1EJMA 1EJNA 3GY2A 1BRUP 1S0QA 1UHBA 3SUFA 2PKSC 2XRCA 1L4DA 4YZUA 3S9CA 2JKHA 1CA8B 1HJ9A 3LONA 1GJBB 3SUGA 5L2YH 1TNLA 2XCNA 1UJ1A 1BTHH 1TGNA 3SU4A 5JBTA 4JMYA 5EPNA 3EA7A 3RXAA 2K1QA 1L2EA 1GI0A 1BOQA 3RXEA 5E2OA 3LGVA 1IQNA 3P70B 4MPVA 1QA0A 1GGDB 2W3IA 2PLXA 4ZKNU 2GDDA 3BG4C 2ANWA 1K1LA 1TRYA 3DFJA 3TPIZ 2SGDE 1H4WA 5FCKA 2XC5A 3D62A 1NO9H 4RN6A 1MUEB 1EOLA 2PSYA 4X2XA 4CBNA 3ODDA 1HDTH 5IYTA 3BTEE 2BLVA 3MYWA 2BDHA 1O5CB 4TYDA 1V2LT 4DGJA 1P12E 3A88A 2TIOA 3LPRA 2P59A 2Y7ZA 1G9IE 1O2OA 2ZHDA 3AVZA 3VB4A 1PQ5A 1EQ9A 1KXBA 3V7TA 3VGCB 2SGPE 2F91A 3I29A 3SV8A 2OQUA 1AGJA 2P95A 2WPMS 1SOZA 2WPIS 2XBXA 1GI4A 3ZZ6A 3PWCA 1Z71A 1MBMA 2FOBA 2JH5D 5ETXA 2ZGXH 5JBCS 4UEHH 1W12U 2ZZUH 1RXPA 2VIQA 2QA9E 4NA9H 1P8VC 1VZQH 4K8YA 5TCAA 1HAOH 2A7HA 1VR1H 2SFAA 1XUGA 2CHAB 2BOHB 2ANKH 5FX6A 3S7HB 2GV7A 2FS9A 1C5VA 2G5VA 1CBWB 1GI2A 2AGEX 3W95A 3FANA 1P2JA 2ESTE 3JZ1B 2ZGBH 1TBQH 1ZHPA 1J16A 2HRVA 3F9FA 4YOIA 1V2PT 3UNSA 1OOKB 3OX7U 2EEKA 3RMNH 1G3BA 1ANCA 4VGCC 1VJAU 3RP2A 5GXPA 1HPGA 5ESTE 4B73A 5C1XA 1QL7A 1YYY1 1ABJH 4YT7H 1O2SA 1QL9A 3BTWE 1A1RA 2NU3E 2RG3A 4U01A 4Y6DA 2B5TB 1K1NA 1TE0A 1F5RA 2FDAA 4JZDH 3PMJA 1O2WA 3SQEE 4JZEH 5EODA 2FPZA 3BTKE 3HKIB 1P9UA 3OYPA 3A89A 5AF9H 1WTHD 1Q3XA 1V2QT 2BQWB 1NRRH 1GBIA 3SU2A 2G8TA 4MPWA 5C5NA 1C1RA 1GDQA 3ATWA 1AU8A 3RXSA 1WV7H 2AEIH 1DXPA 1O30A 1GBEA 3UOPA 2GVFA 3TIUA 1XVMA 1PQ7A 3LGTA 3EGKH 1NS3A 1Z1IA 2XC4A 4CR5A 3DA9B 2IPHA 1FPHH 1O36A 1C2MA 3PMBB 2CF8H 3SNBA 2J92A 1ANDA 1C5ZB 1KXDA 3T28A 4O9VA 4K1EA 1CA0B 2V3OH 3LC5A 3SJ9A 4Y0ZE 3RXFA 1DANH 1OP8A 3A7TA 2Z3DA 3F68H 1AFEH 4ISIH 4X1PU 8LPRA 3F9HA 1EXFA 1J8AA 1V2WT 5HMAA 3VXEH 2BY9X 3PM3A 3P17H 2FI4E 1O32A 4FUCA 5GPIB 2G4UA 1AKSA 1FI8A 1MTWA 3A80A 4K8BA 4MPXA 4WWYA 1C5WB 4ABAA 1HXFH 1DS2E 4Q80A 1N6XA 1NFUA 1UTOA 2ANMH 1SQOA 1D6RA 5ABWA 1AMHA 1DLKB 1NESE 2ZDKA 5T6FA 2ZPSA 1HIAB 1KDQB 3RDZA 1DE7H 1C2HA 2Y80A 3OSYA 4I32A 2QC2A 2FI5E 1BJVA 1P02A 4NIYA 1UTNA 1W8BH 2XWAA 2WPLS 1O3GA 2A5KA 3VPKA 1GMDG 1Z8GA 1ZPCA 3BEIB 3BIUH 1G30B 4ZHMU 5C1YA 1FAKH 3OY5U 3UNQA 1S83A 7GCHG 4GSOA 5FPYA 1PPBH 1C4V2 1C1NA 3RXKA 2W3KA 3RMMH 5DP3A 3SHAH 2D2DA 1O3AA 1GI7B 2O8TA 1W11U 3QWCH 5C1UA 1GBMA 5C3NA 1QRXA 1E35B 1OSSA 3GOVB 1ANEA 1PPEE 2PGQB 3M36A 1ELFA 4BAKB 1CE5A 3D23A 1GBFA 1V2JT 1JXPA 1BHXB 2HPPH 2AIQA 3V0XA 4WF8A 3ZVGA 2PFEA 1NFWA 3R0FA 2XNIA 1DWCH 1TRNA 3P95A 5HYOA 1IQGA 3RXOA 1VGCC 2G55A 2Z9LA 4X6PA 2V6NA 1PPGE 2P94A 4GVUA 4K1TA 1TBRH 1O5EH 4YO9A 1GBHA 1EB1H 5DP9A 1LHGH 1XUKA 4X1RU 1NY22 2SNVA 1D4PB 3KGPA 4IMQA 3MH7A 4IBLH 1MMJN 2EI6A 2GT8A 3VXFH 1BTXA 1TNHA 1OPHB 2OTVA 2Y5GA 3UFAA 3GISB 2A5IA 1SQTA 2VGCB 4B1TA 1T8OA 3HATH 4CRDA 2WYGA 1AE8H 1BJUA 2YOLA 2BD7A 1VITG 3A81A 1NC6A 2ZWLH 1LDTT 2ZF0H 2J9NA 1O2YA 2FESH 4XBCA 1AWHB 3D65E 1GHYH 1T8MA 2IOTA 3ZZDA 3A8BA 2VVCA 1ZGIA 1GMCF 1Y3WA 1O35A 2OC7A 3M5MA 3TH2H 2ZHQH 4MVNA 4FVDA 3SQHE 1V2RT 1YCPK 1K28D 2TGTA 2VVUA 3FAOA 1O3DA 4U2WA 1TBZH 1LPZB 2ZA5A 3AASA 2B7DH 2BXTH 2OP9A 1TGSZ 1NU9A 3GY6A 3SU1A 3Q3XA 1X7AC 1BDAA 5EQRA 3RU4T 1ZMNA 1U6QA 1MCVA 3ZZ3A 1GVLA 1T32A 2HNTC 4CREA 3GCNA 1O34A 4UFDH 1V2NT 1GHAF 1C1UH 1YPEH 1M9UA 1AVXA 5CHAB 4B2BA 3TJVA 2ZTZA 1KLTA 2H9EH 4WY3A 4Y79A 1GJAB 1OWDA 4LZ4B 1ESAA 1Y8TA 1D6WA 4IC5A 3FP6E 1LMWB 1GG6B 1PPZA 3SU0A 1LPKB 1HFDA 2H2ZA 3M7TA 4SGAE 1H1BA 1QURH 4NA8A 3ZVDA 5E2PA 1F0RA 3MH5A 5CMXH 1EAIA 1UVSH 1S82A 2QY0B 3L6PA 4GAWA 1QJ7B 4DCDA 7GCHF 1W2KH 4ZXYH 1OWIA 1PPFE 3TJUA 1DOJA 3VEQB 3SGAE 4NWLA 2R0LA 2ZU4A 1QL8A 2BD3A 1XXFA 2VIDA 2B9LA 5C20A 2A4QA 3HK3B 1DDJA 3QK1A 3ZVBA 1WYKA 1DSTA 1A46H 1THRH 5LPFA 3SV9A 2BHGA 2XCFA 4ISOA 2AMPA 4LZ1H 1E0FD 2ZU5A 3LKWA 1RD3B 2A1DB 2KAIA 4M7GA 1V2ST 1BTWA 2XWBI 3KN2A 3RLYH 5AVDA 1GJCB 2PWXA 4JYTA 1BT7A 3Q76A 4DT7B 1V2VT 1XVOA 1HBTH 1YLDA 2HVXA 2Y7XA 3AAUA 2P8OC 3PWBA 3WY8A 1TX8A 3NWUA 3A7ZA 4X8UH 2ZDLA 2J38A 3U8TH 1OWEA 2C8XB 1EUFA 3MU8A 3O8DA 3OY6U 1SGRE 1G3EA 1SLXB 1CSOE 3OU0A 4IC6A 1BBRK 2XC0A 4X8SH 4FUIA 2ZU2A 4KELA 1SGNE 3RMOH 4DVAU 2BD8A 1NRPH 1O3BA 3KEEA 1G3DA 3K65B 4FUEA 3P8OA 5DGJA 4NZLA 3LGWA 4ABFA 1ESTA 1TIOA 1GJ9B 2BDCA 1ELGA 2Q1JA 1THPB 3S7KB 2O9QA 2OQ5A 1CGJE 3SI4H 1TA6A 4FUDA 1DLEA 1UHBB 2BLWA 4MNWA 3RXHA 3UUZA 1GBDA 3CENA 2ILNA 1HYLA 4UFFH 1AIXH 1C5OH 3DT0H 4OGXA 1YLCA 2VB0A 1T4VH 1B5GH 5GWZA 5GCHG 3ATKA 3HKJB 2ZDMA 3LDXH 3B9FH 3LH1A 2OLGA 2OBOA 5LPRA 1CA0C 2BZAA 1N1LA 4MNXA 1O3FA 5F8TA 2PUQH 1AN1E 5FX5A 3ZZAA 2QCYA 2GTBA 3RXVA 2AERH 3AW1A 2F9BH 2DUCA 2BD5A 5F8ZA 1CT0E 1O0DH 2O8UA 1ELDE 1DWBH 1QTFA 1HJ8A 1CT2E 1LCYA 3KF2A 3V3MA 2P3FH 4FU7A 1O2PA 4F4OC 3UTUH 1ABIH 5E8EH 1A0JA 5JYIA 1TOCB 1GWAA 2FLBH 1FUJA 1DT2A 2ZTYA 1C5NH 3ZYEA 1DUEA 1MQ6A 3KCGH 2Z9KA 1EAWA 2PR3A 4NCYA 2ZG0H 1BB0B 3LOXA 1T8NA 1ZRBA 2ZCHP 4AYYB 2WINI 1KXAA 1C1OA 5DPAA 2FP7B 1NRSH 5F6MA 2Y81A 3TNSA 4H42U 3U9AH 1C9TA 1WOFA 2IN2A 5EOKA 1ZJDA 3ZVCA 5GJ4B 2OXSA 1CHGA 1HAHH 3QTOH 5HM2A 1P57B 4MNVA 3F1SB 1Y3UA 2NU4E 3SV7A 1TLDA 4NG9H 5FXLA 1WSSH 5BPEA 1TNJA 2XYAA 2ZFTA 4INHA 2TRMA 3G01A 1P06A 1OWHA 4CR9A 2UUJB 3QZQA 1FQ3A 3ZZ4A 1C2KA 1D3TB 1RJXB 2SGQE 1OS8A 1VITH 2VIOA 1HJAC 2VWLA 1BUIA 4B2CA 1UCYH 2UUYA 4YLUA 3LU9B 1QRWA 2GCTB 3EA9A 3MU0A 4MTBA 4ASHA 1BTPA 1JIMA 2QAAA 3ZV8A 1JIRA 3RU4E 1XKAC 4BTTB 4AFUA 1SGFA 1YPGH 1AB9C 4D8NA 3RXCA 1IQEA 1ACBE 1KSNA 1IQHA 2GV6A 2GT7A 1PFXC 4I33A 1E34B 1FLEE 1C1TA 2FLRH 2JH0D 1HB0B 2ZQ1A 3E8LA 1P03A 1BBRE 3T25A 1S85A 4KGAA 1O5FH 1NRNH 2BY7X 2A5AA 5AFYH 2P8OB 1A5GH 4UD9H 3M5NA 1MKXH 1GJ7B 1V2KT 4KKDA 3TK6A 5I25A 3UR9A 2KAIB 4BAHB 2AGIX 3T2NA 4NSYA 4DJZB 1XUHA 2ZGJA 3FVFB 2G51A 4ISNA 2ASUB 3FZZA 4J1YA 2NU0E 4GCHF 1YPHC 3E0NB 1G2LA 1V3XA 1GCTC 3M7QA 1BHXF 1GJ4H 2O8WA 2XW9A 3GY4A 4Y8XA 3VGCC 1WTGH 1SPJA 3MU4A 1C5LH 4Y11E 1EX3A 4X8VH 1MU8B 2WYJA 3GDVA 6GCHF 1AE5A 2GCHF 1GDNA 1ETTH 1Y3XA 1AVWA 2OUAA 5A2MH 3F6UH 1BMNH 4VGCB 1NU7B 1QA7A 2FEQH 4HZHA 1SGDE 1TAWA 1HNEE 1V2UT 2D1JA 2F9UA 2GMTC 2ODPA 4AORA 3SOSA 4IW4E 2SNWA 1MH0A 4ABGA 2UWOA 1H8DH 3P92A 3LT3A 1AZZA 1GHVH 3TK5A 1C5XB 4DOQA 1CBWC 2FO9A 3B23B 3SJ8A 3F9EA 5SGAE 4AFQA 3UREA 1DITH 2F9PA 2GD4B 3SUDA 1C2FA 4FUJA 2C3SA 5L6NH 5CHAC 1S6HA 1P3EA 3U98H 3PO1C 4MDSA 5DP8A 1CO7E 2ZC9H 2UUFB 1SC8U 3SU5A 2EI8A 2H9TH 4JYVH 4TPYA 4B71A 4FUGA 2G00A 4Y76A 3ENSB 1LQEA 1T8LA 2BMGB 4K5ZA 2J2UA 6ESTA 3M35A 4Y71A 3NPSA 1BITA 2F9VA 4O3UA 1P10A 4AOQA 5A09A 3CP7A 3E3TA 1O2ZA 4I8GA 1J17T 2PTCE 4H6SB 2ANYA 4THNH 3TVJB 2ZO3H 1IQIA 4NA7A 1GMCG 1TNKA 1ZR0A 2ZNKH 3ZZ8A 1OXGA 3BSQA 1C1QA 2P93A 1W10U 2CF9H 4ABJA 2STAE 3GY3A 3SO3A 5JBAS 4BAOB 3TJNA 1LHFH 2PW8H 3MO9A 1AZ8A 1W14U 3MFJA 3RMLH 4ESTE 1RTKA 4CH2B 1P11E 4JZIA 1L0ZA 2W7SA 1HXEH 1TRMA 4IN1A 5DP6A 2FX6A 4TY7A 1GDUA 1UVPA 3PTBA 4FU8A 3A85A 2BLOA 1MTVA 1ETRH 1LVBA 1L1NA 1GI8B 3GY7A 2BXUH 3RXDA 3SN8A 4E7RG 1ETSH 4K1SA 2WUBA 2Z6BD 1SR5C 2QXIA 5A8ZA 1ZTKA 3A8DA 1VCPA 1BQYA 4GHQA 3U8OH 1ARBA 1YPKH 1KXCA 3ZZ7A 2H5DA 1GBLA 1SLVB 1P09A 1QR3E 3PLKA 2C90B 1TPSA 1GCDA 4DG4A 3TLOA 1TGTA 3SU6A 2STBE 1LHDH 4K2YA 1YCPM 3KQDA 1DPOA 2P3TB 3AAVA 4UDWH 2BD4A 1DUAA 1DFPA 1F7ZA 3KNXA 1W7XH 1P05A 1SLUB 2OC8A 4HI3A 1HAXB 1AI8H 1EPTA 1GL1A 3L33A 2HPQH 1GHXH 1LVYA 4I8KA 3D49H 4F49A 1FAXA 1S0RA 3IG6B 2Y5HA 1TGBA 3AW0A 1TWXB 3MTYA 1P9SA 1XM1A 3SBKA 5EW2H 1P2KA 2A2QH 1B0EA 2Q6GA 1GMDF 3SW2B 3S0NA 1HIAA 3EQ0H 1UTPA 2BQ6B 1SOTA 3MO3A 3PYHA 1SFQB 1ELCA 4R0IA 2AH4X 4Q7YA 3MNSA 1EP5A 1J14A 2FOMB 2GCTC 3SNDA 1AO5A 4I7YH 4Z0KA 1QQ4A 1YP9A 3E0PB 5EXMA 4Z6AH 1O2MA 3C1KA 3PLBA 3M37A 4ZXXH 1SL3A 4BNRA 4ZKOU 2WV5A 1TNIA 4TY6A 1O3LA 3KL6A 5C2ZA 1MAYA 1RGQA 1RS0A 2OCVB 1P0SH 2Q6DA 4ZROA 4B75A 2I6QA 1SSXA 1P2OA 4O97A 2O8MA 2VH0A 2FOEA 3DFLA 1TQ0B 2AGGX 3CS7A 2A7CA 3A86A 1E37B 1GJ5H 1QJ6B 3SV2H 3NZIA 4Y7AA 1B0FA 3LIWA 4RKOB 2P3UB 4X0WU 4YOGA 1T31A 3RXMA 2NU2E 2DE8A 1TFXA 1NM6A 3RXRA 4D9RA 1FY1A 2BM2A 3RXTA 2BDGA 3UQOA 1KLJH 3ATLA 1AQ7A 3RU4D 1TMBH 1LHEH 2VWNA 1AFQB 2PGBB 2B8OH 3LJOA 4NZQA 1HAVA 2XBYA 2VJ1A 1S81A 4BAQB 3M5LA 1EJAA 1B7XB 2CN0H 1JRTA 3NCLA 5T6DA 3BIVH 1UK4A 1C1VH 2ZFFH 4ABHA 4UFGH 1EB2A 5ESBA 1C5QA 4NIWA 2QV1A 3TH3H 1TALA 2FOGA 3PMAB 2IJOB 2TGDA 1AB9B 1YCPH 1OYQA 1HAVB 3RM2H 1P3CA 3QN7A 4FXGH 1VITF 5HM9A 1FY8E 1GHAG 1GJ6A 2OD3B 3FP7E 3ZZ5A 3P8FA 1WQSA 1GVKB 1N8OC 2R2WU 2C8ZB 1MTUA 3KQCA 3MO6A 1SMFE 2ZGCA 5BRRE 3Q00A 1GBTA 2QF0A 2GZ9A 4ISLA 7KMEH 3UNRA 3U69H 2C4FH 1C1MA 1YKTA 3GCOA 7LPRA 3UY9A 3RLWH 1C1WH 4A92A 1O3KA 2FTLE 4OS1A 4GLYA 5DP5A 1C5TA 2J94A 5DKMA 3U1IB 4D9QA 1WBGB 2QIQA 3HPTB 2RA3A 3MOCA 2BZ6H 1C1PA 3PO1B 1IHTH 1Z1JA 3QLPH 2VINA 2I6SA 4BOHA 5EQQA 1LKBA 1XUJA 5LH8A 1C9PA 4U30A 1GBKA 1BTZA 1K1IA 1VGCB 2EC9H 2LPRA 2A0QB 4FU9A 5EPYA 4JZ1A 2R9PA 4GHTA 4OS5A 2VWOA 1GVZA 4Q7ZA 2JETB 1QQUA 2C8WB 4WXVA 1GHWH 4CHAB 4BTIB 1FXYA 1ID5H 2WUCA 1O2TA 1V2OT 1GI5A 1ZSKA 5LGOA 4JK5A 4ZAEA 1QNJA 2UUKB 1ZSLA 1K9OE 3E91A 1C1SA 1IAUA 3M3SA 1O5BB 3E1XB 1BIOA 1Q31A 3RXGA 1TYNA 1V2MT 1ZTLA 3M61U 1QIXB 4CHAC 3GCTF 6GCHG 1LVMA 3MNCA 4UONA 2ZECA 1A61H 4D7GA 1YPLH 2W26A 1NTPA 4CRGA 1TONA 2HNTF 1TOMH 1IHSH 1J9CH 1F0SA 3FP8E 4K69A 5C5OA 2BB4A 3ZVEA 1O2VA 2R3UA 4Q2KA 1ORFA 1Z8JB 4XE4A 3IWMA 3MMGA 3STIA 3PMHB 3GDSA 1EATA 2ULLA 2YNBA 1SGPE 3VB3A 1O3HA 2ZFRH 3BTTE 3HGPA 1QBVH 2BY8X 2ZTXA 1BTUA 3STJA 5FBIA 1T4UH 4AGKA 1JMOH 2TBSA 1QHRB 1O2GH 3TJOA 2ZFQH 3SHCH 1VCWA 1DICA 1NPMA 1FIZA 2FOHA 2ZDAH 2GZ8A 2GCHG 4A5TS 2BQ7B 1ZPZA 2ZP0H 3VB7A 1MCTA 1UCYE 3UWJH 1MD8A 1SQAA 3LGYA 1O2KA 1A5HA 1INCA 4MG3A 1JOUB 4MNYA 5JBBS 2W7UA 2VIPA 1ARCA 1A0HB 2A31A 1S5SA 1KTSB 5IDKA 1LO6A 4Y7BA 2ZEBA 2VNTA 4ISHH 1ZYOA 3UR6A 1BRAA 3H7OA 1CGIE 1QFKH 1C5PA 2ZFPH 1C5UA 1FDPA 3M3VA 3QUMP 2PHBA 1ZOMA 1WQVH 1NZQH 3ATIA 4IGDA 2QYIA 1FV9A 1P04A 3A8CA 3HGNA 4A1TA 3NXPA 4O03A 3QGJA 1O2QA 2Y5FA 3A82A 4ZHLU 3S9BA 2BOKA 2PKSB 5G4BA 1H8IH 4DIIH 1DWDH 1LVOA 1UK2A 1ZSJA 2XTTB 5JB8S 2OC1A 1GMHG 1O2IA 4X1QU 1O2JA 1QCPA 2ODYB 1O5GH 1XKBC 4HGCA 4AB9A 2SGFE 4WJG2 1PYTC 2WPHS 4O3TA 1V2TT 1IQLA 1ZRKA 4X1SU 3RXJA 5CE1A 1MKWH 1A7SA 5FPSA 2ZCKP 1W13U 2CHAC 5AHGH 5FBEA 1DVAH 3QZRA 1RIWC 1MKXK 3EDXB 4X6NA 2G52A 1AFQC 1XXDA 1HUTH 2Z9GA 2ZPRA 2HWLB 1FN8A 7ESTE 2BDIA 4AG1A 1DY9A 1NRQH 1ELTA 5J4SA 4UE7H 1TB6H 3S9AA 3ZVFA 3I78A 1O2XA 2Y6TA 1H9IE 1TPAE 2P16A 5DO4H 3BTQE 2FYQA 4OS7A 3SJKA 1G37A 2H6MA 1QGFA 3NK8A 2CJIA 1GBBA 2FOAA 3M7UA 2V0BA 1RFNA 4ABBA 2VIVA 3LGUA 1P2QA 3RM0H 3A7WA 1WAYB 2JH6D 1AY6H 4YT6H 3A84A 4BAMB 2PV9B 3GY8A 1HRTH 2GMTB 3BF6H 5HGGA 5HXFA 1GGDC 4YOJA 1YF4A 1AKSB 1UVOA 4KTUA 2PTNA 3BTGE 2FZZA 1PYTD 1UMAH 2J95A 3BG8A 1YC0A 3C27B 3UQVA 1C5MD 1RTFB 1T7CA 1ZTJA 1ZHMA 4JCNA 8KME2 1P2NA 2B0FA 2ZI2H 5FPTA 1ZMJA 1WU1A 1QB9A 1MD7A 1SGEE 1NFXA 1SHHB 4E06H 1CQQA 1LQDB 4TWYA 4DW2U 2FOCA 1SBWA 1GI9B 1ELVA 1MU6B 1KIGH 1O3PB 1WCZA 4NIVA 1HGTH 2Q6FA 1A5IA 3GICB 4ZKRU 1FNIA 2R2MB 3DUXH 4X2VA 4Y0YE 4TPIZ 4AYVB 3JZ2B 4WXIA 4YLQH 1IOEA 2LNCA 1O38A 2BD9A 1FJSA 2YNAA 2AYWA 2EI7A 4FUFA 5C67A 1Y5UT 4R8TB 5A8YA 2PKAB 1SGCA 8GCHG 1ZMLA 5EXLA 1QB1A 2BDBA 1A0LA 1GI1A 1O2NA 2V35A 3GYLB 1YPHE 1UVTH 1O3CA 1XUIA 4GCHG 5K7RA 1AUTC 1GL0E 2BTCE 1DXWA 2NU1E 2Z7FE 4LXBH 4TWWA 1HJAB 4A7IB 5E0GA 2BX4A 1Z6JH 3PLPA 3A87A 1GI3A 5T3HA 4E05H 1TNGA 8ESTE 1MTNB 1TQ7B 2O8LA 3ZZCA 1Q2WA 1IQKA 4Q7XA 4NWKA 3GY5A 2BDAA 2BVSH 5T6GA 2XBVA 1YM0A 1SI5H 2AFQB 4IS5A 4BXWA 3LC3A 1SGFG 2BLQA 4XBBA 1QY6A 2FODA 2ZCLP 2C93B 4K3JA 1SGIB 3P6ZB 2BX3A 2BY6X
chains in the Genus database with same CATH superfamily
2ZIQH 4KTSA 5A8XA 2BD2A 2HOBA 1HAYB 4OGYA 1FPCH 2RA0A 1HAIH 1O3JA 1JWTA 3OFND 1MZAA 1K1OA 2R3YA 3LH3A 5EW1H 1SGTA 5DJ7A 1NT1A 1WUNH 1EZSC 2CXVA 1O3MA 4AGJA 1TABE 1A3BH 3URDA 1BTYA 3TH4H 2JJ2D 3QDZB 2FMJA 3MU1A 5JDUB 3SNCA 1NFYA 4A1XA 3RXIA 4LOYH 1CU1A 1C2DA 1PQ8A 1EPTB 5C0UA 2HGTH 1YY3A 3URCA 5EQSA 3TGKE 2FYRA 3M5OA 3A8AA 3CS0A 1PJPA 2SGAA 4WMEA 3OTPA 4K60A 3W94A 1H9HE 1ELEE 4X2WA 2CGAA 3QGNB 4NFEA 3PRBA 3E16B 2M5TA 3UOUA 2RCEA 1C5SA 3SI3H 5FHTA 4Y10E 1HCGA 1NN6A 4BTUB 1H8HD 2AS9A 1EPTC 2GX4A 2CMYA 2ZDNA 3E90B 1RIWB 4A6LA 1MTSA 3FZDA 4IMZA 2GP9B 1W7GH 3MNBA 5F03A 3H7TA 1V6DA 5DG6A 1RRKA 1FZZA 1F2SE 1C4U2 1Y3VA 2ZPQA 3T26A 1AWFH 3RXPA 2GDEH 1K22H 2A32A 3ZVAA 5GIBA 4RSPA 1IQFA 4HTCH 3GS9A 1E36B 1VKYA 1DWEH 1DSUA 1AD8H 4Y8YA 2FX4A 2FXRA 2FS8A 1O3IA 3N7DA 3ELAH 4MLFB 2VU8E 3SJIA 3ITIA 3TGJE 1VCQA 2YMSB 4XDEA 4WH6A 4BXSA 4ABEA 5GCHF 3DHKH 1Y5BT 5GNDA 1TMUH 1G36A 3QTVH 1QB6A 5AFZH 1HAPH 3NKKA 5K0HA 3FFGA 3U1JB 2HALA 4XBDA 2GGVB 1XUFA 2WHXA 4OS4A 2ZGHA 2H9HA 3N99A 1L1JA 4YXWD 1E1QD 2UWPA 1FY3A 1O2LA 2A45B 5DK1A 1Z8IB 2J4IA 3GCHB 3TNTA 3V13A 4GPGA 4ZMAH 1QJ1B 1SG8B 1C2IA 4I8JA 5DN6D 3PV2A 1FIWA 2OC0A 3ZV9A 2A7JA 2TPIZ 3RXBA 1GMHF 3VB5A 4AG2A 4BANB 2GZ7A 1JRSA 1UTQA 1OP2A 3HK6B 2VH6A 1OKXA 1F5LA 4INKA 3KHVA 1XMNB 1O37A 1COWD 1LPGB 5TCCA 5H4IB 4YM9A 1MTNC 2GKVE 2Y82A 2ZU1A 1A4WH 5PTPA 1DM4B 2C8YB 1FN6A 1KXFA 1A2CH 1GBCA 2D8WA 1GCTB 4A1VA 3K9XB 4AFSA 3SNEA 3W1EA 1ZGVA 2VVVA 4DURA 1SGYE 3LJJA 2FIRH 4AFZA 3A7VA 3GDUA 2AMQA 3I77A 1BMFD 4CH8B 3SV6A 3Q77A 1Z7KA 3A7XA 4NIXA 1D9IA 4AN7A 4D76A 3PROA 5EGMA 5EXNA 1FMGA 1C5RA 1K0HA 1FY4A 3L3TA 2BY5X 2PSXA 2QXGA 2WV4A 3SU3A 3ZZBA 3T5FH 1C4Y2 2VGCC 4ZUHA 3WW7A 1AUJA 1P2IA 1GHBF 3F9GA 1THSH 4U32A 2FM2A 1ZLRA 2FOFA 1C2JA 6CHAB 4I8HA 2HNTE 1SFIA 4IN2A 3ATMA 1AHTH 1K2I1 3UIRA 1HAGE 4I31A 3FOAA 4YTAA 3P8NA 1CHOG 3MNXA 2W5EA 3O8RA 2THFB 2Z94A 4ZH8A 3O8CA 3O8BA 1EASA 2ALVA 3NUMA 1O31A 3F3BA 1G2MA 3BTFE 2BDYA 1HAZB 3ZYDA 1JBUH 3V12A 1BA8B 1UVUH 1CHOF 1SB1H 3P8GA 4SGBE 2FI3E 3SGBE 4OS6A 1D3PB 2EQNA 4DIHH 2Z3EA 1KLIH 4RKJB 4NFFA 2RDEA 3KQBA 3K6YA 2Z3CA 3DD2H 1N6YA 1Y3YA 2QXJA 2RDLA 3F2HA 3MHWU 1WXRA 3B8JA 2XBWA 1LTOA 1FY5A 3PB1E 1EKBB 4ABDA 5EU8A 1GBAA 1O39A 2CV3A 1BMLA 2FTMA 1TA2A 4UFEH 1IQJA 8GCHF 2R0KA 3VFEA 3OEED 1UK3A 2ZHEH 4MPUA 2AMDA 1ELAA 1QBOA 2KCAA 4AC9A 1PPHE 1TMTH 2ZHWH 2BVXH 4ZHAA 2XXLA 4B74A 1FONA 1CVWH 1E1RD 1BRCE 1TX6A 1DY8A 1GJ8B 4Y8ZA 2H5CA 4ABIA 1ESBA 1W3CA 3ODFA 6LPRA 1OYTH 5B6OA 3KQ5A 1Y59T 2VIWA 4B76A 3KQEA 4OS2A 1O33A 1F0TA 3A7YA 3EAJA 1G3CA 3EYDA 3SNAA 2F9NA 2V3MA 4CRAA 1ELBA 2ODQA 4JYUH 4CRFA 1EOJA 3GCTG 3H5CB 2PUXB 4YESB 3IITA 4X6MA 1PPCE 1SVPA 1ZJKA 3VB6A 1YPMH 2JETC 1SLWB 5E0JA 1OWJA 5TJXA 1GG6C 3A83A 3TGIE 1VJ9U 1SHYA 1Y5AT 2FWWA 3T27A 2J34A 1C2LA 4RT0A 1KMHB 1ANBA 1O5DH 1AVGH 2EA3A 4I8LA 1N8OB 2TGAA 1P2MA 2F83A 2G81E 1C5YB 1G32B 2ZKSA 5DP7A 4CRCA 1OWKA 4INLA 1UTMA 9ESTA 2WPKS 2KZ4A 2NWNA 4AX9H 2A4GA 4B2AA 5JPMH 4H4FA 4MQAA 3RXQA 1EAUA 4HFPB 3BV9B 1F5KU 9LPRA 1K1JA 1Z6EA 1H9LB 3T62A 5EG4A 2QF3A 4WH8A 1QRZA 1TGCA 5LPEA 2F9OA 1UO6A 1EAXA 2A4OA 4PROA 3MWIU 4FVBA 2H1UA 4WMFA 4CBOA 2F3CE 1NROH 1UTJA 5F8XA 4FUBA 4DY7B 5L2ZH 1LHCH 3BN9A 1BCUH 1MBQA 4AZ2B 4FUHA 1D3DB 5JB9S 2G5NA 1HV7A 1MZDA 2SGEE 1O2HA 3TU7H 1K1PA 4X8TH 3MH6A 4GUXA 3TK9A 1BZXE 5DP4A 1E38B 5FAHA 1BRBE 1RTLA 1F92A 1UTLM 1ZPBA 3K6ZA 2OBQA 1L1GA 3ESTA 3MU5A 4QT8C 1KY9A 1O5AB 2AIPA 3RXUA 3TITA 2QXHA 4WMDA 2WPJS 3BTDE 1O3OA 3MI4A 5A0CA 4LK4A 3RC5A 4X1NU 3VG8A 1QBNA 3EA8A 1S84A 5I46H 4XOJA 1C2EA 1BMMH 1KYNA 4NGAH 1KDQA 3PV4A 3S69A 1HLTH 3KIDU 1DX5M 3GYMA 1GI6A 1KXEA 3M3TA 3UPEA 2BYAX 1EZUC 3F0PA 3FO8D 2ZHFH 1O2RA 3SUEA 4H6TA 1BMAA 3RUOA 2Z9IA 3SJOA 1MKWK 3SORA 2J98A 3K2UA 2DE9A 3GCHC 3T29A 4X2YA 2QN5T 4JZFH 4KTCA 3Q3YA 1YGCH 1W0KD 2D26C 5A0AE 1UTKA 4CRBA 4AB8A 1GBJA 1EP6A 1NBMD 1W0ZU 3Q3KA 4WVPE 1BBRH 1P01A 5FCRA 1L4ZA 5E0HA 3NRLA 1QZ8A 2A2XH 3BTME 3OEHD 4XFQA 1GPZA 1A3EH 3MH4A 2TGPZ 1ZHRA 2VWMA 4KP0A 1TX7A 2A4RA 1GJDB 4NSVA 2V3HH 1OP0A 2BVRH 3EE0B 3U8RH 1MQ5A 1O3NA 4E7NA 5L30H 5EJLA 1YPJH 1SQRA 3SGQE 3UWIA 2JDID 2ZFSA 1K1MA 4D7FA 1GHBG 1TPOA 1LKAA 4JK6A 1S6FA 2J98B 3R3GB 3SZNA 1GHZA 3E6PH 1SGQE 3OTJE 3QO6A 3BEFB 1Z8RA 1KTTB 1CGHA 1O3EA 3N7OA 2OINA 2UWLA 2G4TA 2ALPA 3LGIA 1TPPA 2F43B 4J2YB 3BG4B 1MAXA 6CHAC 5HKKD 1D3QB 1YBWA 1XX9A 1J15A 5GDSH 3QX5H 3BEUA 3BTHE 1W0YH 1OX1A 1K21H 4ZKSU 2PKAA 4RI0A 3RXLA 2HLCA 3PTNA 1EZXC 1F0UA 3ZZ9A 1PQAA 2ZDVH 4X6OA 1C2GA 1CT4E 2ZU3A 4XSKU 5J4QA 1ZZZA 3RC6A 2QGRA 3RC4A 5A0BA 1UCYK 2Z9JA 1IQMA 1O2UA 1EZQA 2ZQ2A 1EJMA 5EJZA 1EJNA 3GY2A 1BRUP 1S0QA 1UHBA 3SUFA 3PV5A 2PKSC 2XRCA 1L4DA 4YZUA 2IJD1 3S9CA 2JKHA 1CA8B 1HJ9A 3LONA 1GJBB 3SUGA 5L2YH 1TNLA 2XCNA 1UJ1A 1BTHH 1TGNA 3SU4A 5JBTA 4JMYA 5EPNA 3EA7A 5HIYA 3RXAA 2K1QA 1L2EA 1GI0A 1BOQA 3RXEA 5E2OA 3LGVA 1IQNA 3P70B 4MPVA 1QA0A 1GGDB 2W3IA 2PLXA 4ZKNU 2GDDA 3BG4C 2ANWA 1K1LA 1TRYA 3DFJA 3TPIZ 2SGDE 1H4WA 5FCKA 2XC5A 3D62A 1NO9H 4RN6A 1MUEB 1EOLA 2PSYA 4X2XA 4CBNA 3ODDA 1HDTH 5IYTA 3BTEE 2BLVA 3MYWA 2BDHA 1O5CB 4TYDA 1V2LT 4DGJA 1P12E 3A88A 2TIOA 3LPRA 2P59A 2Y7ZA 1G9IE 1O2OA 2ZHDA 3AVZA 3VB4A 1PQ5A 1EQ9A 1KXBA 3V7TA 3VGCB 2SGPE 2F91A 3I29A 3SV8A 2OQUA 1AGJA 2P95A 2WPMS 1SOZA 2LP6A 2WPIS 2XBXA 1GI4A 3ZZ6A 3PWCA 1Z71A 1MBMA 2FOBA 2JH5D 5ETXA 2ZGXH 5JBCS 4UEHH 1W12U 2ZZUH 1RXPA 2VIQA 2QA9E 4NA9H 1P8VC 1FX0B 1VZQH 3N7EA 4K8YA 5TCAA 1HAOH 2A7HA 2J5UA 1VR1H 2SFAA 1XUGA 2KX4A 5DSFA 2CHAB 2BOHB 2ANKH 5FX6A 3S7HB 2GV7A 2FS9A 1C5VA 2G5VA 1CBWB 1GI2A 2AGEX 3W95A 3FANA 1P2JA 2ESTE 3JZ1B 2ZGBH 1TBQH 1ZHPA 1J16A 2HRVA 3F9FA 4YOIA 1V2PT 3UNSA 5HIZA 1OOKB 3OX7U 2EEKA 3RMNH 1G3BA 1ANCA 4VGCC 1VJAU 3RP2A 5GXPA 1HPGA 5ESTE 5KGOA 4B73A 1QL7A 1YYY1 3KYGA 5C1XA 1ABJH 4YT7H 1O2SA 1QL9A 3BTWE 1A1RA 2RG3A 2NU3E 4U01A 4Y6DA 2L6OA 2B5TB 1K1NA 1TE0A 1F5RA 2CK3D 2FDAA 4JZDH 3PMJA 1O2WA 3SQEE 4JZEH 5EODA 2FPZA 3BTKE 3HKIB 1P9UA 3OYPA 3A89A 5AF9H 1WTHD 1Q3XA 1V2QT 2BQWB 1NRRH 1GBIA 3SU2A 2G8TA 4MPWA 5C5NA 1C1RA 1GDQA 3ATWA 1AU8A 3RXSA 1WV7H 2AEIH 2K0QA 2WSSD 1DXPA 1O30A 1GBEA 3UOPA 2GVFA 3TIUA 1XVMA 1PQ7A 3LGTA 3EGKH 1NS3A 1Z1IA 2XC4A 4CR5A 3DA9B 2IPHA 1FPHH 1O36A 1C2MA 3PMBB 2CF8H 3SNBA 2J92A 1ANDA 1C5ZB 1KXDA 3T28A 4O9VA 4K1EA 1CA0B 2V3OH 3LC5A 3SJ9A 4Y0ZE 3RXFA 1DANH 1OP8A 3A7TA 2Z3DA 3F68H 1AFEH 4ISIH 4X1PU 8LPRA 3F9HA 1EXFA 1J8AA 1V2WT 5HMAA 3VXEH 2BY9X 3PM3A 1H8ED 3P17H 2FI4E 1O32A 4FUCA 5GPIB 2G4UA 1AKSA 1FI8A 1MTWA 3ZIAD 3A80A 4K8BA 4MPXA 4WWYA 1C5WB 4ABAA 1HXFH 1DS2E 4Q80A 1EFRD 1N6XA 1NFUA 1UTOA 5CDFE 2ANMH 1SQOA 1D6RA 5ABWA 1AMHA 1DLKB 1NESE 2ZDKA 5T6FA 2ZPSA 1HIAB 2AHME 1KDQB 3RDZA 1DE7H 1C2HA 2Y80A 3OSYA 4I32A 2QC2A 2FI5E 1BJVA 1P02A 4NIYA 1UTNA 1W8BH 2L74A 2XWAA 2WPLS 1O3GA 2A5KA 3VPKA 1GMDG 1Z8GA 1ZPCA 3BEIB 3BIUH 1G30B 4ZHMU 5C1YA 1FAKH 3OY5U 1E79D 3UNQA 1S83A 7GCHG 4GSOA 5FPYA 1PPBH 1C4V2 1C1NA 3RXKA 2W3KA 3RMMH 5DP3A 3SHAH 5IK2D 2D2DA 1O3AA 1GI7B 2O8TA 1W11U 3QWCH 5C1UA 1GBMA 5C3NA 1QRXA 1E35B 1OSSA 3GOVB 1ANEA 1PPEE 2PGQB 3M36A 1ELFA 4BAKB 1CE5A 3D23A 1GBFA 1V2JT 1JXPA 1BHXB 2HPPH 2AIQA 3V0XA 4WF8A 3ZVGA 2PFEA 1NFWA 3R0FA 2XNIA 1DWCH 1TRNA 3P95A 5HYOA 1IQGA 3RXOA 1VGCC 2G55A 2Z9LA 4X6PA 2V6NA 1PPGE 2P94A 4GVUA 4K1TA 1TBRH 1O5EH 4YO9A 1GBHA 1EB1H 5DP9A 1LHGH 1XUKA 4X1RU 1NY22 2SNVA 1D4PB 3KGPA 4IMQA 2F4LA 3MH7A 4IBLH 1MMJN 2EI6A 2GT8A 3VXFH 1BTXA 2J97A 1TNHA 1OPHB 2OTVA 2Y5GA 3UFAA 3GISB 2A5IA 1SQTA 2VGCB 4B1TA 1T8OA 3HATH 4CRDA 2WYGA 1AE8H 2JJ1D 1BJUA 2YOLA 2BD7A 1VITG 3A81A 1NC6A 2ZWLH 1LDTT 2ZF0H 2J9NA 1O2YA 2FESH 4XBCA 1AWHB 3D65E 1GHYH 1T8MA 2IOTA 3ZZDA 3A8BA 2VVCA 1ZGIA 1GMCF 1Y3WA 1O35A 2OC7A 3M5MA 3TH2H 2ZHQH 4MVNA 4FVDA 3SQHE 1V2RT 1YCPK 1K28D 2TGTA 2VVUA 2HLDD 3FAOA 1O3DA 4U2WA 1TBZH 1LPZB 2ZA5A 3AASA 2B7DH 2BXTH 5EIYA 2OP9A 1TGSZ 1NU9A 3GY6A 3SU1A 3Q3XA 1X7AC 1BDAA 5EQRA 3RU4T 1ZMNA 1U6QA 1MCVA 3ZZ3A 1GVLA 1T32A 2HNTC 4CREA 3GCNA 1O34A 2KCPA 1V2NT 1GHAF 4UFDH 1C1UH 1YPEH 1M9UA 1AVXA 5CHAB 4B2BA 3TJVA 2ZTZA 1KLTA 2H9EH 4WY3A 4Y79A 1GJAB 1OWDA 4LZ4B 1ESAA 1Y8TA 1D6WA 4IC5A 3FP6E 1LMWB 1GG6B 1PPZA 3SU0A 1LPKB 1HFDA 2H2ZA 3M7TA 4SGAE 2OK5A 1H1BA 1QURH 4NA8A 3ZVDA 5E2PA 1F0RA 3MH5A 5CMXH 1EAIA 1UVSH 1S82A 4I86A 2QY0B 3L6PA 4GAWA 4RT1A 1QJ7B 5KEDA 2YMSD 4DCDA 7GCHF 1W2KH 4ZXYH 1OWIA 1PPFE 3TJUA 1DOJA 3VEQB 3SGAE 4NWLA 2R0LA 2ZU4A 1QL8A 2BD3A 1XXFA 2VIDA 2B9LA 5C20A 2A4QA 3HK3B 1DDJA 2KCOA 3QK1A 3ZVBA 1WYKA 1DSTA 1A46H 1THRH 5LPFA 3SV9A 2BHGA 2XCFA 2LELA 2AMPA 4ISOA 4LZ1H 1E0FD 2ZU5A 3LKWA 1RD3B 2A1DB 2KAIA 4M7GA 1V2ST 1BTWA 2XWBI 3KN2A 3RLYH 5AVDA 1GJCB 2PWXA 4JYTA 1BT7A 3Q76A 4DT7B 1V2VT 1XVOA 1HBTH 1YLDA 2HVXA 2Y7XA 3AAUA 2P8OC 3PWBA 3WWFA 3WY8A 1TX8A 3NWUA 3A7ZA 4X8UH 2ZDLA 2J38A 2KCYA 3U8TH 1OWEA 2C8XB 1EUFA 3MU8A 3O8DA 3OY6U 1SGRE 1G3EA 1SLXB 1CSOE 3OU0A 4IC6A 1BBRK 4HG6A 2XC0A 4X8SH 4FUIA 1UW7A 2ZU2A 4KELA 1SGNE 3RMOH 4DVAU 2BD8A 1NRPH 1O3BA 3KEEA 1G3DA 3K65B 4FUEA 3P8OA 5DGJA 4NZLA 3LGWA 4ABFA 1ESTA 1TIOA 1GJ9B 2BDCA 1ELGA 4ASUD 2Q1JA 1THPB 3S7KB 2O9QA 1W0JD 3WWBA 2OQ5A 1CGJE 3SI4H 4OM9A 1TA6A 4FUDA 1DLEA 1UHBB 2BLWA 4MNWA 3RXHA 3UUZA 1GBDA 3CENA 2ILNA 1HYLA 4UFFH 1AIXH 1C5OH 3DT0H 4OGXA 1YLCA 2VB0A 1T4VH 1B5GH 5GWZA 3FKSD 3F0OA 3ATKA 5GCHG 3HKJB 2ZDMA 3LDXH 3B9FH 3LH1A 2OLGA 2OBOA 5LPRA 1CA0C 2BZAA 1N1LA 4MNXA 1O3FA 5F8TA 2PUQH 1AN1E 2PP6A 5FX5A 3ZZAA 2QCYA 2GTBA 3RXVA 2AERH 3AW1A 2F9BH 2DUCA 2BD5A 5F8ZA 1CT0E 3SZEA 1O0DH 2O8UA 1ELDE 1DWBH 1QTFA 1HJ8A 2HVYB 1CT2E 1LCYA 3KF2A 3V3MA 2P3FH 4FU7A 1O2PA 3OAAD 4F4OC 3UTUH 1ABIH 5E8EH 1A0JA 5JYIA 1TOCB 1GWAA 2FLBH 1FUJA 1DT2A 2ZTYA 1C5NH 3ZYEA 4TT3D 1DUEA 1MQ6A 3KCGH 5C94A 2Z9KA 1EAWA 2PR3A 4NCYA 2ZG0H 1BB0B 3LOXA 1T8NA 1ZRBA 2ZCHP 4AYYB 2WINI 1KXAA 1C1OA 5DPAA 2FP7B 2GJGA 1NRSH 5F6MA 2Y81A 3TNSA 4H42U 3U9AH 1C9TA 1WOFA 2IN2A 5EOKA 1ZJDA 3ZVCA 5GJ4B 2OXSA 5B6LA 1CHGA 1HAHH 3QTOH 5HM2A 1P57B 4MNVA 3F1SB 1Y3UA 2NU4E 3SV7A 1TLDA 4NG9H 5FXLA 1WSSH 5BPEA 1TNJA 2XYAA 4XRNA 2XNDD 2ZFTA 4INHA 4FOUC 2TRMA 3G01A 1P06A 1OWHA 4CR9A 2UUJB 3QZQA 1FQ3A 3ZZ4A 1C2KA 1D3TB 1RJXB 2SGQE 1OS8A 1VITH 2VIOA 1HJAC 2VWLA 1BUIA 4B2CA 1UCYH 2UUYA 4YLUA 3LU9B 1QRWA 2V7QD 2GCTB 3EA9A 3MU0A 4MTBA 4ASHA 1BTPA 1JIMA 2QAAA 3ZV8A 1JIRA 3RU4E 2JIZD 1XKAC 4BTTB 4AFUA 1SGFA 1YPGH 1AB9C 4D8NA 3RXCA 1IQEA 1ACBE 1KSNA 1IQHA 2GV6A 3DCLA 2GT7A 1PFXC 4I33A 1E34B 1FLEE 1C1TA 2FLRH 2JH0D 1HB0B 2ZQ1A 3E8LA 1P03A 1BBRE 3T25A 1S85A 4KGAA 1O5FH 1NRNH 2BY7X 2A5AA 4Q63A 5AFYH 2P8OB 1A5GH 4UD9H 3M5NA 1MKXH 1GJ7B 1V2KT 4KKDA 2XOKD 3TK6A 5I25A 4ACBA 3UR9A 2KAIB 4BAHB 2AGIX 3T2NA 4NSYA 4DJZB 1XUHA 2ZGJA 3FVFB 2G51A 4ISNA 2ASUB 3FZZA 4J1YA 2NU0E 2W6ID 4GCHF 1YPHC 3E0NB 1G2LA 1V3XA 1GCTC 3M7QA 1BHXF 1GJ4H 2O8WA 2XW9A 3GY4A 4Y8XA 3F2GA 3VGCC 1WTGH 1SPJA 3MU4A 1C5LH 4Y11E 1EX3A 4X8VH 1MU8B 2WYJA 3GDVA 6GCHF 1AE5A 2GCHF 1GDNA 1ETTH 1Y3XA 1AVWA 2OUAA 5A2MH 3F6UH 1BMNH 4VGCB 1NU7B 1QA7A 2FEQH 4HZHA 1SGDE 1TAWA 1HNEE 1V2UT 2D1JA 2F9UA 2GMTC 2ODPA 4AORA 3SOSA 4IW4E 2SNWA 1MH0A 4ABGA 2UWOA 1H8DH 3P92A 3LT3A 1AZZA 1GHVH 3TK5A 1C5XB 4DOQA 1CBWC 2FO9A 3B23B 3SJ8A 3F9EA 5SGAE 4AFQA 3UREA 1DITH 2F9PA 2GD4B 3SUDA 5C0TA 1C2FA 4FUJA 2C3SA 5L6NH 5CHAC 1S6HA 1P3EA 3U98H 3PO1C 4MDSA 5DP8A 1CO7E 2ZC9H 2UUFB 1SC8U 3SU5A 2EI8A 2H9TH 4JYVH 1SKYE 4TPYA 4B71A 4FUGA 2G00A 4Y76A 3ENSB 1LQEA 1T8LA 2BMGB 4K5ZA 2J2UA 6ESTA 1OHHD 3M35A 4Y71A 3NPSA 1BITA 2F9VA 4O3UA 1P10A 4AOQA 5A09A 3CP7A 3E3TA 1O2ZA 4I8GA 1J17T 2PTCE 4H6SB 2ANYA 4THNH 5T1VA 3TVJB 2ZO3H 1IQIA 4NA7A 1GMCG 1TNKA 2K8IA 1ZR0A 2ZNKH 3ZZ8A 1OXGA 3BSQA 1C1QA 2P93A 1W10U 2CF9H 2M2AA 2STAE 3GY3A 3SO3A 4ABJA 4BAOB 5JBAS 3TJNA 1LHFH 2PW8H 3MO9A 1AZ8A 1W14U 3MFJA 3RMLH 4ESTE 1RTKA 4CH2B 1P11E 4JZIA 1L0ZA 2W7SA 1HXEH 1TRMA 4IN1A 5DP6A 2FX6A 4TY7A 1GDUA 1UVPA 3PTBA 4FU8A 3A85A 2BLOA 4TSFD 1MTVA 1ETRH 1LVBA 1L1NA 1GI8B 4F55A 3GY7A 2BXUH 3RXDA 3SN8A 4E7RG 1ETSH 3DSOA 2WUBA 2Z6BD 4K1SA 1SR5C 2QXIA 5A8ZA 1ZTKA 3A8DA 1VCPA 1BQYA 4GHQA 3U8OH 1ARBA 1YPKH 1KXCA 3ZZ7A 2H5DA 1GBLA 2QF4A 1SLVB 1P09A 1QR3E 3PLKA 2C90B 1TPSA 1GCDA 4DG4A 3TLOA 1TGTA 4DT4A 3SU6A 2STBE 1LHDH 4K2YA 1YCPM 3KQDA 1DPOA 2P3TB 3AAVA 4UDWH 2BD4A 1DUAA 1DFPA 1F7ZA 3KNXA 1W7XH 1P05A 1SLUB 2OC8A 4HI3A 1HAXB 1AI8H 1EPTA 1GL1A 3L33A 2HPQH 1GHXH 1LVYA 4I8KA 3D49H 3U28C 4F49A 1FAXA 1S0RA 3IG6B 2Y5HA 1TGBA 3AW0A 1TWXB 2VBCA 3MTYA 1P9SA 1WDIA 1XM1A 3SBKA 5EW2H 1P2KA 2A2QH 1B0EA 2Q6GA 1GMDF 3SW2B 3S0NA 1HIAA 3EQ0H 1UTPA 2BQ6B 2KM0A 1SOTA 3MO3A 3PYHA 1SFQB 3OE7D 1ELCA 4R0IA 2AH4X 4Q7YA 3MNSA 1EP5A 1J14A 2FOMB 2GCTC 3SNDA 1AO5A 4I7YH 4Z0KA 1QQ4A 1YP9A 3E0PB 5EXMA 4Z6AH 1O2MA 3C1KA 3PLBA 3M37A 4ZXXH 1SL3A 4BNRA 4ZKOU 2WV5A 1TNIA 4TY6A 1O3LA 3KL6A 5C2ZA 1MAYA 4P00A 1RGQA 1RS0A 2OCVB 1P0SH 2Q6DA 4ZROA 4B75A 2I6QA 1SSXA 1P2OA 4O97A 1NBME 2O8MA 2VH0A 2QF5A 2FOEA 3DFLA 1TQ0B 2AGGX 3CS7A 2A7CA 3A86A 1E37B 1GJ5H 1QJ6B 3SV2H 3NZIA 4Y7AA 1B0FA 3LIWA 4RKOB 2P3UB 4X0WU 4YOGA 1T31A 3RXMA 2NU2E 5FL7D 2DE8A 1TFXA 1NM6A 3RXRA 4D9RA 1FY1A 2BM2A 3RXTA 2BDGA 3UQOA 5EJ1A 1KLJH 3ATLA 1AQ7A 2WPDD 3RU4D 1TMBH 1LHEH 2VWNA 1AFQB 2PGBB 2B8OH 3LJOA 4NZQA 1HAVA 2XBYA 2VJ1A 1S81A 4BAQB 3M5LA 1EJAA 1B7XB 2CN0H 1JRTA 3H09A 3NCLA 5T6DA 3BIVH 1UK4A 1C1VH 2ZFFH 4ABHA 4UFGH 1EB2A 5ESBA 1C5QA 4NIWA 2QV1A 3TH3H 1TALA 2FOGA 3PMAB 2IJOB 2TGDA 1AB9B 1YCPH 1OYQA 1HAVB 3RM2H 1P3CA 3QN7A 4FXGH 1VITF 5HM9A 1FY8E 1GHAG 1GJ6A 2OD3B 3FP7E 3ZZ5A 3P8FA 1WQSA 1GVKB 1N8OC 3F2FA 2R2WU 2C8ZB 1MTUA 3KQCA 3MO6A 1SMFE 2ZGCA 5BRRE 3Q00A 1GBTA 2QF0A 2GZ9A 4ISLA 7KMEH 3UNRA 3U69H 2EY4C 2C4FH 1C1MA 1YKTA 3GCOA 7LPRA 3UY9A 3RLWH 1C1WH 4A92A 1O3KA 2FTLE 4OS1A 4GLYA 5DP5A 1C5TA 2J94A 5DKMA 3U1IB 4D9QA 1WBGB 2KFWA 2QIQA 3HPTB 2RA3A 3MOCA 2BZ6H 1C1PA 3PO1B 1IHTH 1Z1JA 3SYJA 3QLPH 2VINA 2I6SA 4BOHA 5EQQA 1LKBA 1XUJA 5LH8A 1C9PA 4U30A 1GBKA 1BTZA 1K1IA 1VGCB 2EC9H 2LPRA 2A0QB 4FU9A 5EPYA 4JZ1A 2R9PA 4GHTA 4OS5A 4Z1MD 2VWOA 3MQKC 1GVZA 4Q7ZA 3DSPA 2JETB 1QQUA 2C8WB 4WXVA 3EE7A 1GHWH 1YWUA 4CHAB 4BTIB 1FXYA 1ID5H 2WUCA 1O2TA 1V2OT 1GI5A 1ZSKA 5LGOA 4JK5A 4ZAEA 1QNJA 2UUKB 1ZSLA 1K9OE 3E91A 1C1SA 1IAUA 3M3SA 1O5BB 3E1XB 1BIOA 1Q31A 3RXGA 1TYNA 1V2MT 1ZTLA 3M61U 1QIXB 4CHAC 3GCTF 6GCHG 1LVMA 3MNCA 4UONA 4M9FA 2ZECA 1A61H 4D7GA 1YPLH 2W26A 1NTPA 4CRGA 1TONA 2HNTF 1TOMH 1IHSH 1J9CH 1F0SA 3FN8A 3FP8E 4K69A 5C5OA 2BB4A 3ZVEA 1O2VA 2R3UA 4Q2KA 1ORFA 1Z8JB 4XE4A 3IWMA 3MMGA 3STIA 3PMHB 1YLNA 3GDSA 1EATA 2ULLA 2YNBA 1SGPE 3VB3A 1O3HA 2ZFRH 3BTTE 3HGPA 1QBVH 2BY8X 2ZTXA 1BTUA 3STJA 5FBIA 1T4UH 4AGKA 1JMOH 2TBSA 1QHRB 1O2GH 3TJOA 2ZFQH 3SHCH 1VCWA 1DICA 1NPMA 1FIZA 2FOHA 2ZDAH 2GZ8A 2GCHG 4A5TS 2BQ7B 1ZPZA 2ZP0H 3VB7A 1MCTA 1UCYE 3UWJH 1MD8A 1SQAA 3LGYA 1O2KA 1A5HA 1INCA 4MG3A 1JOUB 4MNYA 5JBBS 2VIPA 2W7UA 1ARCA 1A0HB 2A31A 1S5SA 1KTSB 5IDKA 1LO6A 4Y7BA 3KYFA 2ZEBA 2VNTA 4ISHH 1ZYOA 3UR6A 1BRAA 3H7OA 1CGIE 2RFKC 2W6JD 1QFKH 1C5PA 2ZFPH 4XD7D 1C5UA 1FDPA 3M3VA 4B6EA 3QUMP 2PHBA 1ZOMA 1WQVH 1NZQH 3ATIA 4IGDA 2QYIA 1FV9A 1P04A 3A8CA 3HGNA 4A1TA 3NXPA 4O03A 5KECA 3QGJA 1O2QA 2Y5FA 3A82A 4ZHLU 3S9BA 2BOKA 2PKSB 5G4BA 1H8IH 2WV9A 4DIIH 1DWDH 1LVOA 1UK2A 1ZSJA 2XTTB 5JB8S 2OC1A 1GMHG 1O2IA 4X1QU 1O2JA 3DSGA 1QCPA 2ODYB 1O5GH 1XKBC 4HGCA 4AB9A 2SGFE 4WJG2 1PYTC 2WPHS 4O3TA 1V2TT 1IQLA 1ZRKA 2KR7A 4X1SU 3RXJA 4ZCNA 5CE1A 1MKWH 3AK5A 1A7SA 5FPSA 2ZCKP 4P02A 1W13U 2CHAC 1MABB 5AHGH 5FBEA 1DVAH 3QZRA 1RIWC 1MKXK 3EDXB 4X6NA 2G52A 1AFQC 1XXDA 1HUTH 2Z9GA 2ZPRA 2HWLB 1FN8A 7ESTE 2BDIA 4AG1A 1DY9A 1NRQH 1ELTA 3UB0A 5J4SA 4UE7H 1TB6H 3S9AA 3ZVFA 3I78A 1O2XA 2Y6TA 1H9IE 1TPAE 2P16A 3PRDA 5C17A 5DO4H 3BTQE 4Q4LA 2FYQA 4OS7A 3SJKA 1G37A 2H6MA 1QGFA 3NK8A 2CJIA 1GBBA 2FOAA 3M7UA 2V0BA 1RFNA 4ABBA 2VIVA 3LGUA 4FETA 1P2QA 3RM0H 3A7WA 1WAYB 2JH6D 1AY6H 4YT6H 3A84A 4BAMB 2PV9B 3GY8A 1HRTH 2GMTB 3BF6H 5HGGA 5HXFA 1GGDC 4YOJA 1YF4A 1AKSB 1UVOA 4KTUA 2PTNA 3BTGE 2FZZA 1PYTD 1UMAH 2J95A 3BG8A 1YC0A 3C27B 3UQVA 1C5MD 1RTFB 1T7CA 1ZTJA 1ZHMA 4JCNA 8KME2 1P2NA 2B0FA 2ZI2H 5FPTA 1ZMJA 1WU1A 1QB9A 1MD7A 1SGEE 1NFXA 1SHHB 4E06H 1CQQA 1LQDB 4TWYA 2YMSC 4DW2U 2FOCA 1SBWA 1GI9B 1ELVA 1MU6B 1KIGH 1O3PB 1WCZA 4NIVA 4ACAA 1HGTH 2Q6FA 1A5IA 3GICB 4ZKRU 1FNIA 2R2MB 3DUXH 4X2VA 4Y0YE 4TPIZ 4AYVB 3JZ2B 4WXIA 4YLQH 1IOEA 2LNCA 1O38A 2BD9A 1FJSA 2YNAA 2AYWA 2EI7A 4FUFA 5C67A 1Y5UT 4R8TB 5A8YA 2PKAB 1SGCA 5CHBA 8GCHG 1ZMLA 5EXLA 1QB1A 2BDBA 1A0LA 1GI1A 1O2NA 5F53A 2V35A 3GYLB 1YPHE 1UVTH 1O3CA 1XUIA 4GCHG 5K7RA 1AUTC 1GL0E 2BTCE 1DXWA 2NU1E 2Z7FE 4LXBH 4TWWA 1HJAB 4A7IB 5E0GA 2BX4A 1Z6JH 2WZQA 4B6FA 3PLPA 3A87A 1GI3A 5T3HA 4E05H 1TNGA 8ESTE 3UAIC 1MTNB 1TQ7B 3CNRA 2O8LA 4F48B 3ZZCA 1Q2WA 1IQKA 4Q7XA 4NWKA 3GY5A 2BDAA 2BVSH 5T6GA 2XBVA 1YM0A 1SI5H 2AFQB 4IS5A 4BXWA 3LC3A 1SGFG 2BLQA 4XBBA 1QY6A 1S6LA 2FODA 2ZCLP 2C93B 4K3JA 1SGIB 2IPQX 3P6ZB 2BX3A 2QE7D 2BY6X
chains in the Genus database with same CATH topology
2ZIQH 4KTSA 5A8XA 2BD2A 2HOBA 1HAYB 4OGYA 1FPCH 2RA0A 1HAIH 1O3JA 1JWTA 1MZAA 1K1OA 2R3YA 3LH3A 5EW1H 1SGTA 5DJ7A 1NT1A 1WUNH 1EZSC 2CXVA 1O3MA 4AGJA 1TABE 1A3BH 3URDA 1BTYA 3TH4H 3QDZB 2FMJA 3MU1A 5JDUB 3SNCA 1NFYA 4A1XA 3RXIA 4LOYH 1CU1A 1C2DA 1PQ8A 1EPTB 2HGTH 3URCA 5EQSA 3TGKE 2FYRA 3M5OA 3A8AA 3CS0A 1PJPA 2SGAA 4WMEA 4K60A 3W94A 1H9HE 1ELEE 4X2WA 2CGAA 3QGNB 4NFEA 3E16B 2M5TA 3UOUA 2RCEA 1C5SA 3SI3H 5FHTA 4Y10E 1HCGA 1NN6A 4BTUB 2AS9A 1EPTC 2GX4A 2CMYA 2ZDNA 3E90B 1RIWB 4A6LA 1MTSA 3FZDA 4IMZA 2GP9B 1W7GH 3MNBA 5F03A 3H7TA 1V6DA 5DG6A 1RRKA 1FZZA 1F2SE 1C4U2 1Y3VA 2ZPQA 3T26A 1AWFH 3RXPA 2GDEH 1K22H 2A32A 3ZVAA 5GIBA 4RSPA 1IQFA 4HTCH 1E36B 1DWEH 1DSUA 1AD8H 4Y8YA 2FX4A 2FXRA 2FS8A 1O3IA 3ELAH 4MLFB 2VU8E 3SJIA 3ITIA 3TGJE 1VCQA 4XDEA 4WH6A 4BXSA 4ABEA 5GCHF 3DHKH 1Y5BT 1TMUH 1G36A 3QTVH 1QB6A 5AFZH 1HAPH 3NKKA 5K0HA 3FFGA 3U1JB 2HALA 4XBDA 2GGVB 1XUFA 4OS4A 2ZGHA 2H9HA 1L1JA 2UWPA 1FY3A 1O2LA 2A45B 5DK1A 1Z8IB 2J4IA 3GCHB 3TNTA 3V13A 4GPGA 4ZMAH 1QJ1B 1SG8B 1C2IA 4I8JA 1FIWA 2OC0A 3ZV9A 2A7JA 2TPIZ 3RXBA 1GMHF 3VB5A 4AG2A 4BANB 2GZ7A 1JRSA 1UTQA 1OP2A 3HK6B 2VH6A 1OKXA 1F5LA 4INKA 3KHVA 1XMNB 1O37A 1LPGB 5TCCA 5H4IB 4YM9A 1MTNC 2GKVE 2Y82A 2ZU1A 1A4WH 5PTPA 1DM4B 2C8YB 1FN6A 1KXFA 1A2CH 1GBCA 2D8WA 1GCTB 4A1VA 3K9XB 4AFSA 3SNEA 1ZGVA 2VVVA 4DURA 1SGYE 3LJJA 2FIRH 4AFZA 3A7VA 3GDUA 2AMQA 3I77A 4CH8B 3SV6A 3Q77A 1Z7KA 3A7XA 4NIXA 1D9IA 4AN7A 4D76A 3PROA 5EGMA 5EXNA 1FMGA 1C5RA 1FY4A 3L3TA 2BY5X 2PSXA 2QXGA 2WV4A 3SU3A 3ZZBA 3T5FH 1C4Y2 2VGCC 4ZUHA 1AUJA 1P2IA 1GHBF 3F9GA 1THSH 4U32A 2FM2A 1ZLRA 2FOFA 1C2JA 6CHAB 4I8HA 2HNTE 1SFIA 4IN2A 3ATMA 1AHTH 1K2I1 3UIRA 1HAGE 4I31A 4YTAA 3P8NA 1CHOG 3MNXA 2W5EA 3O8RA 2THFB 2Z94A 4ZH8A 3O8CA 3O8BA 1EASA 2ALVA 3NUMA 1O31A 1G2MA 3BTFE 2BDYA 1HAZB 3ZYDA 1JBUH 3V12A 1BA8B 1UVUH 1CHOF 1SB1H 3P8GA 4SGBE 2FI3E 3SGBE 4OS6A 1D3PB 4DIHH 2Z3EA 1KLIH 4RKJB 4NFFA 3KQBA 3K6YA 2Z3CA 3DD2H 1N6YA 1Y3YA 2QXJA 2RDLA 3MHWU 3B8JA 2XBWA 1LTOA 1FY5A 3PB1E 1EKBB 4ABDA 5EU8A 1GBAA 1O39A 2CV3A 1BMLA 2FTMA 1TA2A 4UFEH 1IQJA 8GCHF 2R0KA 3VFEA 1UK3A 2ZHEH 4MPUA 2AMDA 1ELAA 1QBOA 1PPHE 1TMTH 2ZHWH 2BVXH 4ZHAA 2XXLA 4B74A 1FONA 1CVWH 1BRCE 1TX6A 1DY8A 1GJ8B 4Y8ZA 2H5CA 4ABIA 1ESBA 1W3CA 3ODFA 6LPRA 1OYTH 5B6OA 1Y59T 2VIWA 4B76A 3KQEA 4OS2A 1O33A 1F0TA 3A7YA 3EAJA 1G3CA 3EYDA 3SNAA 2F9NA 4CRAA 1ELBA 2ODQA 4JYUH 4CRFA 1EOJA 3GCTG 3H5CB 2PUXB 4YESB 3IITA 4X6MA 1PPCE 1SVPA 1ZJKA 3VB6A 1YPMH 2JETC 1SLWB 5E0JA 1OWJA 5TJXA 1GG6C 3A83A 3TGIE 1VJ9U 1SHYA 1Y5AT 2FWWA 3T27A 2J34A 1C2LA 4I8LA 1ANBA 1O5DH 1AVGH 2EA3A 1N8OB 1P2MA 2F83A 2TGAA 2G81E 1C5YB 1G32B 2ZKSA 5DP7A 4CRCA 1OWKA 4INLA 1UTMA 9ESTA 2WPKS 2NWNA 4AX9H 2A4GA 4B2AA 5JPMH 4H4FA 4MQAA 3RXQA 1EAUA 4HFPB 3BV9B 1F5KU 9LPRA 1K1JA 1Z6EA 1H9LB 3T62A 5EG4A 2QF3A 4WH8A 1QRZA 1TGCA 5LPEA 2F9OA 1UO6A 1EAXA 2A4OA 4PROA 3MWIU 4FVBA 2H1UA 4WMFA 4CBOA 2F3CE 1NROH 1UTJA 5F8XA 4FUBA 4DY7B 5L2ZH 1LHCH 3BN9A 1BCUH 1MBQA 4AZ2B 4FUHA 1D3DB 5JB9S 2G5NA 1HV7A 1MZDA 2SGEE 1O2HA 3TU7H 1K1PA 4X8TH 3MH6A 4GUXA 3TK9A 1BZXE 5DP4A 1E38B 5FAHA 1BRBE 1RTLA 1F92A 1UTLM 1ZPBA 3K6ZA 2OBQA 1L1GA 3ESTA 3MU5A 4QT8C 1KY9A 1O5AB 2AIPA 3RXUA 3TITA 2QXHA 4WMDA 2WPJS 3BTDE 1O3OA 3MI4A 5A0CA 4LK4A 3RC5A 4X1NU 1QBNA 3EA8A 1S84A 5I46H 4XOJA 1C2EA 1BMMH 1KYNA 4NGAH 1KDQA 3PV4A 3S69A 1HLTH 3KIDU 1DX5M 3GYMA 1GI6A 1KXEA 3M3TA 3UPEA 2BYAX 1EZUC 2ZHFH 1O2RA 3SUEA 4H6TA 1BMAA 3RUOA 2Z9IA 3SJOA 1MKWK 3SORA 3K2UA 2DE9A 3GCHC 3T29A 4X2YA 2QN5T 4JZFH 4KTCA 3Q3YA 1YGCH 2D26C 5A0AE 1UTKA 4CRBA 4AB8A 1GBJA 1EP6A 1W0ZU 3Q3KA 4WVPE 1BBRH 1P01A 5FCRA 1L4ZA 5E0HA 2A2XH 3BTME 4XFQA 1GPZA 1A3EH 3MH4A 2TGPZ 1ZHRA 2VWMA 4KP0A 1TX7A 2A4RA 1GJDB 4NSVA 2V3HH 1OP0A 2BVRH 3EE0B 3U8RH 1MQ5A 1O3NA 4E7NA 5L30H 1YPJH 3SGQE 3UWIA 2ZFSA 1K1MA 4D7FA 1GHBG 1TPOA 1LKAA 4JK6A 1S6FA 3R3GB 3SZNA 1GHZA 3E6PH 1SGQE 3OTJE 3QO6A 3BEFB 1Z8RA 1KTTB 1CGHA 1O3EA 3N7OA 2OINA 2UWLA 2G4TA 2ALPA 3LGIA 1TPPA 4J2YB 3BG4B 1MAXA 6CHAC 1D3QB 1YBWA 1XX9A 1J15A 5GDSH 3QX5H 3BEUA 3BTHE 1W0YH 1OX1A 1K21H 4ZKSU 2PKAA 3RXLA 2HLCA 3PTNA 1EZXC 1F0UA 3ZZ9A 1PQAA 2ZDVH 4X6OA 1C2GA 1CT4E 2ZU3A 4XSKU 5J4QA 1ZZZA 3RC6A 2QGRA 3RC4A 5A0BA 1UCYK 2Z9JA 1IQMA 1O2UA 1EZQA 2ZQ2A 1EJMA 1EJNA 3GY2A 1BRUP 1S0QA 1UHBA 3SUFA 2PKSC 2XRCA 1L4DA 4YZUA 3S9CA 2JKHA 1CA8B 1HJ9A 3LONA 1GJBB 3SUGA 5L2YH 1TNLA 2XCNA 1UJ1A 1BTHH 1TGNA 3SU4A 5JBTA 4JMYA 5EPNA 3EA7A 3RXAA 2K1QA 1L2EA 1GI0A 1BOQA 3RXEA 5E2OA 3LGVA 1IQNA 3P70B 4MPVA 1QA0A 1GGDB 2W3IA 2PLXA 4ZKNU 2GDDA 3BG4C 2ANWA 1K1LA 1TRYA 3DFJA 3TPIZ 2SGDE 1H4WA 5FCKA 2XC5A 3D62A 1NO9H 4RN6A 1MUEB 1EOLA 2PSYA 4X2XA 4CBNA 3ODDA 1HDTH 5IYTA 3BTEE 2BLVA 3MYWA 2BDHA 1O5CB 4TYDA 1V2LT 4DGJA 1P12E 3A88A 2TIOA 3LPRA 2P59A 2Y7ZA 1G9IE 1O2OA 2ZHDA 3AVZA 3VB4A 1PQ5A 1EQ9A 1KXBA 3V7TA 3VGCB 2SGPE 2F91A 3I29A 3SV8A 2OQUA 1AGJA 2P95A 2WPMS 1SOZA 2WPIS 2XBXA 1GI4A 3ZZ6A 3PWCA 1Z71A 1MBMA 2FOBA 2JH5D 5ETXA 2ZGXH 5JBCS 4UEHH 1W12U 2ZZUH 1RXPA 2VIQA 2QA9E 4NA9H 1P8VC 1VZQH 4K8YA 5TCAA 1HAOH 2A7HA 1VR1H 2SFAA 1XUGA 2CHAB 2BOHB 2ANKH 5FX6A 3S7HB 2GV7A 2FS9A 1C5VA 2G5VA 1CBWB 1GI2A 2AGEX 3W95A 3FANA 1P2JA 2ESTE 3JZ1B 2ZGBH 1TBQH 1ZHPA 1J16A 2HRVA 3F9FA 4YOIA 1V2PT 3UNSA 1OOKB 3OX7U 2EEKA 3RMNH 1G3BA 1ANCA 4VGCC 1VJAU 3RP2A 5GXPA 1HPGA 5ESTE 4B73A 5C1XA 1QL7A 1YYY1 1ABJH 4YT7H 1O2SA 1QL9A 3BTWE 1A1RA 2NU3E 2RG3A 4U01A 4Y6DA 2B5TB 1K1NA 1TE0A 1F5RA 2FDAA 4JZDH 3PMJA 1O2WA 3SQEE 4JZEH 5EODA 2FPZA 3BTKE 3HKIB 1P9UA 3OYPA 3A89A 5AF9H 1WTHD 1Q3XA 1V2QT 2BQWB 1NRRH 1GBIA 3SU2A 2G8TA 4MPWA 5C5NA 1C1RA 1GDQA 3ATWA 1AU8A 3RXSA 1WV7H 2AEIH 1DXPA 1O30A 1GBEA 3UOPA 2GVFA 3TIUA 1XVMA 1PQ7A 3LGTA 3EGKH 1NS3A 1Z1IA 2XC4A 4CR5A 3DA9B 2IPHA 1FPHH 1O36A 1C2MA 3PMBB 2CF8H 3SNBA 2J92A 1ANDA 1C5ZB 1KXDA 3T28A 4O9VA 4K1EA 1CA0B 2V3OH 3LC5A 3SJ9A 4Y0ZE 3RXFA 1DANH 1OP8A 3A7TA 2Z3DA 3F68H 1AFEH 4ISIH 4X1PU 8LPRA 3F9HA 1EXFA 1J8AA 1V2WT 5HMAA 3VXEH 2BY9X 3PM3A 3P17H 2FI4E 1O32A 4FUCA 5GPIB 2G4UA 1AKSA 1FI8A 1MTWA 3A80A 4K8BA 4MPXA 4WWYA 1C5WB 4ABAA 1HXFH 1DS2E 4Q80A 1N6XA 1NFUA 1UTOA 2ANMH 1SQOA 1D6RA 5ABWA 1AMHA 1DLKB 1NESE 2ZDKA 5T6FA 2ZPSA 1HIAB 1KDQB 3RDZA 1DE7H 1C2HA 2Y80A 3OSYA 4I32A 2QC2A 2FI5E 1BJVA 1P02A 4NIYA 1UTNA 1W8BH 2XWAA 2WPLS 1O3GA 2A5KA 3VPKA 1GMDG 1Z8GA 1ZPCA 3BEIB 3BIUH 1G30B 4ZHMU 5C1YA 1FAKH 3OY5U 3UNQA 1S83A 7GCHG 4GSOA 5FPYA 1PPBH 1C4V2 1C1NA 3RXKA 2W3KA 3RMMH 5DP3A 3SHAH 2D2DA 1O3AA 1GI7B 2O8TA 1W11U 3QWCH 5C1UA 1GBMA 5C3NA 1QRXA 1E35B 1OSSA 3GOVB 1ANEA 1PPEE 2PGQB 3M36A 1ELFA 4BAKB 1CE5A 3D23A 1GBFA 1V2JT 1JXPA 1BHXB 2HPPH 2AIQA 3V0XA 4WF8A 3ZVGA 2PFEA 1NFWA 3R0FA 2XNIA 1DWCH 1TRNA 3P95A 5HYOA 1IQGA 3RXOA 1VGCC 2G55A 2Z9LA 4X6PA 2V6NA 1PPGE 2P94A 4GVUA 4K1TA 1TBRH 1O5EH 4YO9A 1GBHA 1EB1H 5DP9A 1LHGH 1XUKA 4X1RU 1NY22 2SNVA 1D4PB 3KGPA 4IMQA 3MH7A 4IBLH 1MMJN 2EI6A 2GT8A 3VXFH 1BTXA 1TNHA 1OPHB 2OTVA 2Y5GA 3UFAA 3GISB 2A5IA 1SQTA 2VGCB 4B1TA 1T8OA 3HATH 4CRDA 2WYGA 1AE8H 1BJUA 2YOLA 2BD7A 1VITG 3A81A 1NC6A 2ZWLH 1LDTT 2ZF0H 2J9NA 1O2YA 2FESH 4XBCA 1AWHB 3D65E 1GHYH 1T8MA 2IOTA 3ZZDA 3A8BA 2VVCA 1ZGIA 1GMCF 1Y3WA 1O35A 2OC7A 3M5MA 3TH2H 2ZHQH 4MVNA 4FVDA 3SQHE 1V2RT 1YCPK 1K28D 2TGTA 2VVUA 3FAOA 1O3DA 4U2WA 1TBZH 1LPZB 2ZA5A 3AASA 2B7DH 2BXTH 2OP9A 1TGSZ 1NU9A 3GY6A 3SU1A 3Q3XA 1X7AC 1BDAA 5EQRA 3RU4T 1ZMNA 1U6QA 1MCVA 3ZZ3A 1GVLA 1T32A 2HNTC 4CREA 3GCNA 1O34A 4UFDH 1V2NT 1GHAF 1C1UH 1YPEH 1M9UA 1AVXA 5CHAB 4B2BA 3TJVA 2ZTZA 1KLTA 2H9EH 4WY3A 4Y79A 1GJAB 1OWDA 4LZ4B 1ESAA 1Y8TA 1D6WA 4IC5A 3FP6E 1LMWB 1GG6B 1PPZA 3SU0A 1LPKB 1HFDA 2H2ZA 3M7TA 4SGAE 1H1BA 1QURH 4NA8A 3ZVDA 5E2PA 1F0RA 3MH5A 5CMXH 1EAIA 1UVSH 1S82A 2QY0B 3L6PA 4GAWA 1QJ7B 4DCDA 7GCHF 1W2KH 4ZXYH 1OWIA 1PPFE 3TJUA 1DOJA 3VEQB 3SGAE 4NWLA 2R0LA 2ZU4A 1QL8A 2BD3A 1XXFA 2VIDA 2B9LA 5C20A 2A4QA 3HK3B 1DDJA 3QK1A 3ZVBA 1WYKA 1DSTA 1A46H 1THRH 5LPFA 3SV9A 2BHGA 2XCFA 4ISOA 2AMPA 4LZ1H 1E0FD 2ZU5A 3LKWA 1RD3B 2A1DB 2KAIA 4M7GA 1V2ST