1GBCA

Alpha-lytic protease with met 190 replaced by ala and gly 216 replaced by ala complex with methoxysuccinyl-ala-ala-pro-leucine boronic acid
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
198
structure length
198
Chain Sequence
b'ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGANVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
molecule tags Hydrolase/hydrolase inhibitor
source organism Lysobacter enzymogenes
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
total genus 52
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbcA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbcA01
1TNIA 2BQ7B 2ZFTA 3TGKE 1G3DA 3MNBA 4XFQA 3QGNB 3RXRA 4B2AA 1Y5UT 1LVMA 2EC9H 4WWYA 1QA7A 1Y3UA 1C2LA 2GX4A 1RD3B 2PSYA 2K1QA 1K1JA 2OD3B 1TA2A 3LOXA 2FMJA 1ANEA 2A2QH 2IJOB 2TGAA 5EXNA 3RMMH 1LQDB 5B6OA 1QBVH 1JXPA 2FESH 4ZMAH 4X1QU 2ZIQH 5F8XA 2J94A 1AFQC 3MO6A 4AB9A 2XBVA 1G32B 2BOKA 2I6QA 2GCHG 1RGQA 3M35A 1NRNH 2VGCB 1SLUB 1AN1E 3QX5H 4FVBA 4OS1A 1PPBH 2BY9X 1V2UT 3KQCA 3LDXH 3F9HA 1MQ6A 2GDDA 1CT0E 1SOTA 1O5FH 1TNLA 3A8CA 4MNXA 3K2UA 4H4FA 1CO7E 2RG3A 3VXFH 3T29A 5HM9A 2VWMA 3PO1B 3MU1A 3M36A 4X1PU 1BITA 3SHAH 1TMTH 5JPMH 1A46H 1DLEA 9ESTA 4R0IA 2VGCC 2Y5GA 3PYHA 1TX6A 1RRKA 3PTBA 2UWPA 3TJOA 4B2BA 4XOJA 3FAOA 1EP5A 1OSSA 4KP0A 4UONA 4DURA 5L2YH 3GY8A 4E7NA 1ZOMA 1YBWA 4MTBA 3UNSA 1ELGA 1GHAG 2ZFPH 1WYKA 4JK6A 1D3TB 2BZAA 4WF8A 3RXCA 3T5FH 1GBLA 1OX1A 1QRZA 1GHAF 2XCFA 2H6MA 1UCYH 1TALA 1CA0B 5JDUB 2NU2E 4TY7A 4VGCB 2GZ7A 3TJVA 4J1YA 1W7XH 4FUGA 1AB9B 1XM1A 3SNBA 1YCPH 1W2KH 3BG4B 1HYLA 1HAXB 4X8SH 3SU5A 1C5OH 2F3CE 2ZPRA 1EOJA 1GHVH 1V2ST 5K0HA 3KF2A 1DWCH 2ZQ2A 1XUHA 4XBBA 3ZV8A 3P6ZB 1O3GA 3GCOA 1MBQA 4IN1A 3NZIA 1C2GA 3LT3A 2CN0H 4DW2U 1HIAA 1ELCA 4OS7A 4BANB 2SGFE 1BRCE 1FN6A 4OS6A 6CHAC 4IS5A 3U8RH 1P0SH 4MNVA 2FOCA 2BD2A 1YLDA 3F1SB 2BXUH 1IHSH 2C90B 1HJ9A 2PW8H 1TIOA 2BY6X 3ITIA 1LVOA 1GDQA 5C20A 5IDKA 4X8VH 1ETRH 1W11U 4Y11E 5CHAC 2EI7A 1OWEA 5DP6A 1GHBF 3PV4A 1PPHE 1WCZA 3FFGA 3NCLA 3BG4C 1NS3A 1BA8B 2ZGHA 4MVNA 2C4FH 2UUYA 1TNJA 2ZU2A 2BDHA 3SNCA 1KXDA 1MKWH 1KDQB 1WOFA 2RA3A 4ABFA 1QFKH 2ZG0H 2FLBH 1MZAA 4GLYA 4Y0YE 5K7RA 3K9XB 3GICB 3LGYA 4Y8XA 4HFPB 3F9GA 4B76A 1AWFH 5A2MH 1GBEA 4I8HA 1C5ZB 3ZZ3A 2FOAA 1NRPH 1SB1H 3SQHE 1EPTB 2J9NA 1ELVA 4KKDA 5L30H 3M5OA 1AIXH 4CRBA 4BOHA 3OY5U 2G00A 2TIOA 3V7TA 1EJNA 3Q77A 1O36A 1LHGH 2ZCLP 3RMNH 4BTTB 1HJ8A 3MMGA 1C5LH 1Z8GA 2FOHA 2QXHA 4HI3A 4LXBH 1TBZH 3A83A 2JETC 2SGPE 4JMYA 2GMTB 1AVWA 1NFYA 1QB1A 2VWNA 5EOKA 1XMNB 2VIOA 4KELA 1KXCA 4D76A 3KL6A 2XBYA 3TIUA 1Z1IA 1GHWH 1GJDB 4FUBA 1O2JA 1UTPA 2OQUA 3DUXH 3U98H 4WXIA 1OWHA 1EQ9A 3ATKA 3CS0A 1TX8A 5IYTA 4E06H 4Y7BA 3PMAB 2VNTA 3L33A 1C5NH 1C5PA 1GMHG 2F9VA 1GJ4H 1PYTC 2TGDA 1P3CA 3H7TA 1O3IA 1W12U 3BF6H 2TPIZ 2QAAA 2R2MB 4CRCA 1Z7KA 1LPKB 2Q6GA 1O2TA 1GL1A 2FOEA 1FMGA 1PQ7A 4Y76A 2HNTF 1GI9B 3A7TA 1QL9A 3HGNA 3QK1A 1HBTH 3OY6U 1NN6A 1GI1A 1O3DA 2JETB 2ZTXA 1OYQA 1MTNB 1ZHPA 2Z7FE 3QN7A 4FU7A 1C1WH 3SNEA 3IG6B 1A2CH 1ZSKA 1ESTA 3O8RA 1K28D 2CGAA 4ISIH 4OS5A 4BAOB 3RMLH 1GHYH 4DOQA 2F9OA 2Z3EA 1MTNC 4WMFA 5J4SA 2FOMB 1ZYOA 3SJOA 5LH8A 3LGUA 2AGEX 1AU8A 1ZPCA 2CMYA 2WV4A 2JH0D 1UVSH 4I8JA 1HCGA 2A2XH 1P09A 3ATIA 1ZSJA 2OQ5A 3ENSB 2F9PA 1GMDG 5FCRA 1VJ9U 4D9QA 3T25A 2XC4A 4NWLA 4ZAEA 2QGRA 3SOSA 3PROA 1TNKA 5T6DA 4B1TA 1ORFA 2XWAA 1ZLRA 2VIWA 1K1MA 1B7XB 3S7KB 1GBFA 1O31A 2HALA 1TLDA 2XCNA 1GVZA 4AYYB 1D4PB 1OOKB 1OWKA 1JIMA 3UOUA 4DT7B 1IQHA 1IHTH 2PKAA 1GJ5H 5E2PA 1T8OA 2SGQE 2XC0A 3GY3A 2H2ZA 1MTWA 3MU4A 3PMBB 5DJ7A 1MBMA 1EX3A 1S6FA 3A8DA 3U1IB 2AGIX 2D1JA 1HAGE 1LHCH 3A7VA 4MQAA 1AZ8A 1GCTC 4UFEH 1SQAA 3O8BA 1QGFA 1C1OA 3SQEE 2HVXA 4BAMB 2FP7B 3SU2A 1SPJA 1DLKB 4Q7ZA 4ESTE 1P2IA 1YPHE 1ZPBA 1O2OA 2VWOA 3F9FA 3QWCH 1C1VH 2ZFRH 1O3MA 1EZSC 1IAUA 2H9HA 1TBQH 2F83A 1H1BA 5I25A 4ABAA 2O8UA 5FX5A 1SMFE 2AIPA 1Z71A 5CHAB 2V35A 1Y5BT 4PROA 2PGQB 3UUZA 2WPIS 3K6YA 1AI8H 2STBE 3ZZ8A 3HKJB 3SGBE 3BTFE 3EA8A 5E0JA 5HM2A 5EU8A 4O9VA 3A82A 4HGCA 4RKJB 1DITH 2BZ6H 1PPZA 1K1PA 1LHFH 4X6PA 2XRCA 3PMHB 1ZHRA 1O37A 4NFFA 2GDEH 2CV3A 4K1EA 1VJAU 4H6SB 4TY6A 3A8BA 4I8KA 4AX9H 2BQ6B 1JRTA 1Q31A 2ANYA 1UTOA 2XC5A 3RLYH 2A4OA 1WQSA 1TE0A 1WQVH 3TK9A 4YT7H 1EB1H 4TWWA 1V2WT 3NXPA 1SQOA 1HDTH 1EPTC 5ESBA 3MH5A 1O5CB 2ZKSA 2GCTC 1H8DH 2BDYA 3TH4H 5JBBS 4WH8A 3BTTE 4ISHH 2Q6FA 1GCDA 1UK2A 1PPFE 3K65B 4MNWA 1P05A 3QTVH 2G4TA 3GY6A 1WTHD 3Q76A 1FIWA 1UK4A 1HAYB 1L1GA 4FXGH 1ETSH 1Z8IB 1MKWK 1GJ6A 1S0QA 1CGJE 1O2UA 1YM0A 2CF9H 3T26A 1B5GH 1TMBH 1A3BH 4FU9A 3MTYA 2GV7A 2GVFA 2BLWA 1CE5A 4I8LA 1O3BA 4J2YB 1ID5H 1HLTH 4A92A 1UO6A 1VCPA 3SV6A 2EEKA 2FOGA 2ZDVH 1IQNA 3V3MA 2F91A 4YLQH 2ILNA 1BTPA 2V6NA 4D8NA 4AGKA 2ZTZA 1GG6C 1LPGB 1W0YH 1GDUA 4TPIZ 2BTCE 5A8XA 2ZGJA 1SVPA 1KYNA 3W94A 1SGRE 2TBSA 1SGNE 3I29A 3ZVGA 2P3FH 2ZDKA 5EPNA 4BNRA 5AFYH 1NC6A 2AMDA 4Z6AH 1B0FA 1A1RA 2W26A 3RXDA 4FUDA 2A7HA 2OBQA 1O2MA 1ESBA 1GGDC 1BBRH 2BD8A 2Q6DA 1ELBA 8ESTE 4I32A 4YTAA 1FZZA 2AEIH 1SGTA 2ALPA 3M7UA 1GMDF 2QA9E 1W7GH 2NU4E 1C2HA 3BTGE 5C1XA 5DO4H 1UHBA 1AWHB 4X1NU 1XX9A 4YZUA 1BHXB 1EAXA 1SGPE 2BD3A 4ABJA 1WBGB 2H1UA 3CS7A 1A3EH 2BLQA 2C8WB 4ZKRU 5FPTA 1P2QA 3UQVA 2ZU3A 1EXFA 3UR9A 1QNJA 2FS9A 2A31A 2P8OC 2FX4A 2BDBA 1TPOA 4F4OC 1OPHB 5T3HA 3UY9A 2OTVA 4K60A 1CGIE 4JZEH 1SGIB 3A7ZA 5FPSA 3BTME 3VB5A 1ETTH 1QB6A 2AIQA 1KXFA 2A4QA 4U32A 3SI4H 3TNSA 1TQ0B 1KTSB 4CH2B 1D3PB 5C1YA 3PLKA 4DG4A 4AFUA 1Y3VA 1O2YA 1MU8B 4XBDA 1HAIH 3GOVB 1DWBH 4RKOB 1HAVB 3U8TH 4DCDA 1EATA 1F0TA 1MU6B 7LPRA 3ZZ7A 1VGCC 2BD9A 2Z9LA 1T8LA 4A7IB 1VITF 2VVCA 1C4Y2 1E36B 1G37A 1C2IA 1V2MT 2GKVE 2BD7A 4O3UA 3A88A 5LGOA 4TPYA 3I78A 1ZMJA 2O8MA 1NZQH 2QV1A 3TVJB 1S6HA 1FNIA 1G2MA 3SU0A 2ZU1A 3TH2H 1DSTA 2O9QA 5FXLA 3RM2H 3UPEA 1PYTD 1HAHH 2RDLA 4K8YA 2YNAA 5EQSA 2PUXB 3ZVDA 5GCHG 1LQEA 1LVYA 1DDJA 3QLPH 1J16A 6CHAB 6GCHG 3ZZ9A 2BD5A 6ESTA 1GI7B 1D3QB 2BX3A 7GCHF 3GCHB 1C5SA 1NFWA 1NRQH 2BHGA 1P12E 1XXDA 5DG6A 2A45B 3ZVCA 2ZHFH 3GCTF 2STAE 3A87A 5AHGH 1PQ8A 1P04A 3SUDA 4UFDH 1KIGH 2PWXA 2WINI 2CXVA 5E2OA 3IWMA 4UEHH 4NZQA 4BXWA 1ZPZA 3SV2H 1WU1A 3KGPA 1RJXB 1GJBB 3M5NA 3M5MA 1XVOA 1DICA 1EZUC 8GCHG 2W7SA 4YT6H 2OXSA 3UQOA 1C2EA 1TRNA 1GJCB 4GCHG 2NU1E 1XXFA 5FBEA 5DP8A 3BG8A 1MUEB 1ZJDA 4CREA 1MH0A 1IOEA 2ODPA 1ZTLA 2SNVA 3RXOA 1YPMH 5EPYA 3RM0H 3LJJA 1H9LB 1J8AA 1BTYA 3H7OA 2WPHS 3RC5A 2D8WA 3F9EA 3LPRA 4K5ZA 2ZNKH 1NRSH 1LPZB 3SHCH 1SGCA 1TGBA 2TRMA 2OINA 1FUJA 1O3OA 2VIDA 3P8FA 1O5DH 4XSKU 1CGHA 4WVPE 1J15A 1O35A 3M61U 1GJAB 3SUGA 1BTHH 3MU8A 2SGDE 1C5UA 4ZHAA 1K1IA 1SL3A 3TITA 2VJ1A 4WXVA 1QCPA 1N1LA 1S81A 1O32A 2UWLA 2OCVB 1GHZA 2AGGX 1YYY1 4YOIA 4ZH8A 3ZVAA 1EZXC 4INHA 4GAWA 5TCAA 2BX4A 1O34A 1TWXB 4B75A 3RU4D 1G36A 3P17H 1VZQH 1YLCA 1BTWA 1C5XB 2WYGA 4GPGA 6LPRA 4AN7A 1W10U 4INKA 1QURH 1DT2A 4YO9A 3BIUH 1W13U 3E0NB 2HNTC 3M3SA 3TNTA 1SGYE 1EASA 1HIAB 3ZZDA 3Q00A 3ATMA 1BMMH 1NU7B 3GCHC 4OS2A 3SV7A 1C1MA 1QTFA 3A7XA 3B23B 3DFJA 5E8EH 1OKXA 2R0LA 1N6YA 2WPMS 3E16B 1ZHMA 3RXVA 1AVXA 3RP2A 2EI8A 4CRFA 1L1JA 3GCTG 4GVUA 1PQAA 1DY9A 1HRTH 1FN8A 3KN2A 3GY5A 4I7YH 2YNBA 1BRAA 2Y7XA 2A1DB 2A5IA 3MOCA 4CRGA 1TPAE 1RTFB 1L4DA 2R0KA 2FOFA 2UUFB 1QB9A 5FX6A 5BPEA 8GCHF 2C93B 3ZZ6A 1E34B 1DS2E 1QQUA 1YPLH 3STJA 2G51A 3P8GA 3EGKH 1BB0B 1IQIA 1DX5M 3P70B 5A0BA 3URCA 5JBCS 3S0NA 1LVBA 1NFXA 2CHAC 1NRRH 1GI8B 2OP9A 1ABIH 1DANH 1SSXA 4AFZA 3VPKA 1CT2E 2Z9IA 3HPTB 1AO5A 1SC8U 5F8ZA 2AS9A 3W95A 2V0BA 4JYUH 4IBLH 3OSYA 4Y71A 5GCHF 3KQEA 1O3JA 3RXIA 3SU4A 1TPPA 2B8OH 4FUIA 3ATWA 5EGMA 2BY5X 7GCHG 2BYAX 1FIZA 1KLIH 4ASHA 2WV5A 1S5SA 1GI2A 1O33A 5LPFA 2ZHWH 3A7WA 3SORA 3T2NA 1YCPM 2ZPQA 5F8TA 1ZMLA 5HGGA 1QRXA 2TGTA 1O5BB 3BIVH 1SGFA 1GI4A 2XTTB 4IC5A 1V2PT 1TOMH 1ZRKA 1NFUA 4NFEA 2VH6A 1BMLA 5GXPA 5DP5A 5AFZH 2C8YB 2VU8E 2DE9A 1W3CA 2GD4B 2Z94A 3B9FH 5FPYA 3V13A 4CRDA 1N8OC 1UVTH 1NPMA 3TH3H 1DPOA 1AVGH 4UD9H 1D3DB 3CENA 1C1RA 4UFFH 4BAHB 2GZ8A 3SUEA 4ZUHA 1HAZB 3DFLA 1GBKA 4THNH 5G4BA 5JB8S 1AHTH 2Y82A 1YKTA 1UTKA 3ZYDA 1IQMA 1V2TT 2GT7A 1NY22 5TCCA 1V3XA 5E0GA 4MPVA 1GBCA 3U9AH 4K8BA 1P3EA 1TNHA 3FANA 4YOGA 1HXFH 4X2YA 1SI5H 3F6UH 2W3IA 4BTUB 4TYDA 5C5NA 3QDZB 1HXEH 3JZ1B 4YM9A 4LZ4B 1LDTT 1O2RA 1Y3YA 1V2VT 2Z3CA 2QN5T 2A32A 1HJAB 1JIRA 5C3NA 3FP8E 1BBRK 4Q80A 1SGDE 3CP7A 1CT4E 2ZEBA 3MNXA 1GBHA 2O8LA 2B9LA 4IMZA 4NIXA 3UWJH 4AB8A 2FX6A 1E38B 1G2LA 1PQ5A 1W8BH 1S85A 1O3AA 1C1TA 3RXAA 2HNTE 1GBJA 4AOQA 1ELDE 1Z6JH 2PHBA 1LHDH 3PTNA 1X7AC 1TX7A 1LKAA 4B2CA 4IN2A 4I33A 1TRMA 1SLWB 5F6MA 4VGCC 1YPGH 1LTOA 3TJUA 1XVMA 2GP9B 4O97A 5A8ZA 1O2XA 1C5YB 3ESTA 1NO9H 1O2GH 3RXPA 1FY4A 1IQGA 1GBMA 4YESB 5F03A 1G3CA 2ZQ1A 2VIPA 1DM4B 3E6PH 2FO9A 4UDWH 1C5MD 3GYLB 1GBTA 1FONA 2QIQA 1HNEE 2KAIB 3GYMA 3S69A 2P93A 4JCNA 3AAVA 1AFEH 2VWLA 4NA9H 1C2DA 1GJ9B 2BD4A 2ZFFH 4ZROA 3L3TA 1GJ8B 3M3TA 1H9HE 4X2WA 1EAWA 2B7DH 4JZDH 1VITH 2VB0A 1JRSA 1DFPA 4U01A 2ZU5A 1TONA 4D7FA 2BDGA 3FVFB 4GHTA 4H42U 2JH6D 4JZIA 5ABWA 1KXBA 5A0AE 1CBWC 1DOJA 1MTUA 4HTCH 3MHWU 4CBOA 1GPZA 1DE7H 3ZZ5A 1P8VC 1F7ZA 1O30A 2FXRA 1GHXH 3PWCA 3VEQB 1O3CA 3JZ2B 3ZZCA 3URDA 1C5RA 2PKAB 4JK5A 3Q3XA 1Z1JA 4IW4E 1O2LA 2FI3E 4NSYA 3UTUH 3DD2H 7KMEH 1MKXK 2HGTH 2RA0A 3A86A 2G5VA 2PSXA 1DUAA 1ARBA 4TWYA 1GL0E 3ZYEA 1O2HA 4X8TH 4A6LA 1JMOH 4Q7XA 1YGCH 1H9IE 4X6OA 2I6SA 1AUJA 3UWIA 1A0JA 1J14A 2V3OH 1EKBB 3RXKA 4KTUA 3PWBA 1FAXA 1YCPK 1Y5AT 5C1UA 2YOLA 5DP3A 2ZA5A 5E0HA 1P06A 1TRYA 1ZJKA 1A5HA 4R8TB 1B0EA 1MAXA 5FAHA 3B8JA 5SGAE 1Y8TA 3KEEA 4AORA 3D62A 3OTJE 4FUJA 2ZECA 4I31A 3RDZA 4A1TA 1XUIA 2OC7A 2ZU4A 5GWZA 1RXPA 1SOZA 1XKAC 1F92A 4DIHH 4NA8A 2TGPZ 1DY8A 3FZDA 1ZRBA 1T4UH 1GBAA 2G4UA 1GGDB 1INCA 2ZDAH 1KLTA 1MD7A 3BSQA 3SU1A 4RSPA 1TGCA 5DK1A 2PTNA 1CSOE 1O5GH 1S0RA 3EE0B 3RU4T 1E0FD 2ZHDA 2SFAA 1QIXB 2Q1JA 2BVSH 2DE8A 1O3NA 2QF0A 3EYDA 1ZMNA 4AGJA 2GGVB 1Y59T 3A89A 1LO6A 1BRBE 3SZNA 4A1XA 2BXTH 3TLOA 2AYWA 1P2NA 1LHEH 3ZVBA 1UVUH 3LGWA 5AVDA 1NTPA 1KY9A 3FP7E 1GMCG 3T27A 1GVLA 2PLXA 1U6QA 1UCYE 1MCVA 4GUXA 2LPRA 2H5DA 4YLUA 1GBDA 1C5QA 1N8OB 3PMJA 1TBRH 1G30B 2F9UA 2AMPA 3MYWA 2XBWA 5EW1H 4BAKB 1KLJH 1ELAA 4ZKSU 3LGVA 3KCGH 3SGAE 4ZXYH 2ZHEH 4MG3A 1YP9A 2QF3A 1GVKB 1FY1A 3QZQA 2VIVA 1EP6A 3LU9B 3AW1A 1GCTB 3TGIE 1FJSA 4U2WA 2R2WU 1SLVB 2CF8H 1O3PB 1KXAA 1W0ZU 1V2JT 2J2UA 2WPJS 2ZC9H 4Z0KA 1SLXB 4K3JA 1V2RT 3RXJA 2HRVA 1A5IA 2F9NA 5C67A 2GTBA 3M37A 3BV9B 4FUFA 4Y7AA 1SG8B 1V2OT 2QY0B 2UWOA 1O2ZA 2G5NA 3SN8A 1O2IA 1YPKH 1UTJA 2G81E 4MLFB 1P10A 4CR5A 1UVPA 1IQLA 1XUGA 3U8OH 3S9BA 2J4IA 1GI0A 1MMJN 3LH1A 1H8IH 2ZP0H 2UUKB 2QXJA 3RXTA 1F5LA 5EODA 1HUTH 2CJIA 4Y10E 2FIRH 1WV7H 1RIWC 4B71A 2UUJB 2C8ZB 4DVAU 3F68H 3RU4E 1FY5A 4CR9A 4B74A 1TGTA 2DUCA 4D9RA 3E3TA 4NG9H 3C1KA 1DXWA 1O2KA 2M5TA 4JZFH 3A80A 4Q7YA 2ZTYA 5C2ZA 1LKBA 3RLWH 1T31A 1N6XA 5A8YA 3SJKA 5DP9A 5GJ4B 2D26C 2VIQA 4HZHA 1UMAH 4NZLA 3TU7H 4X8UH 1EJMA 3A8AA 1ELEE 2V3HH 3LGIA 4MDSA 3MH4A 3MU0A 3VXEH 3MO9A 4OGXA 3TPIZ 4NIWA 2XYAA 3OU0A 3SNDA 1CBWB 1SHYA 1ESAA 3LGTA 4WH6A 1Z8RA 3G01A 3TK5A 2OC1A 2A4GA 2FDAA 2Y6TA 1NU9A 5A09A 1QL7A 5HYOA 2ZZUH 2H5CA 4AZ2B 3MI4A 3P92A 3RC6A 2Y7ZA 3QTOH 1O3FA 4ZHLU 1SFQB 3FP6E 1WSSH 2ZFQH 3BTQE 1KDQA 1F5RA 1UTMA 2WUBA 3SW2B 3HK3B 2D2DA 2Y80A 3P8NA 4ABHA 4GCHF 2A5KA 1C4U2 1FDPA 3SI3H 4JZ1A 2OUAA 1C9PA 3DT0H 2GV6A 4AG1A 4ABEA 2P16A 3SUFA 2BMGB 1HGTH 2PKSB 2J95A 4IC6A 4ISOA 3P95A 3PO1C 1O39A 1P11E 3EDXB 1BMNH 2OC0A 4X0WU 1LMWB 4ZXXH 4Y6DA 3ZVEA 3UR6A 1FY3A 4Y8ZA 5LPEA 3U69H 1MZDA 1OWJA 5JBAS 1CVWH 1PPEE 3MNSA 3E90B 3PLBA 3BTKE 1JOUB 2IN2A 1AKSB 4IMQA 4GSOA 1Q3XA 1OS8A 2ANKH 2AMQA 1MQ5A 1GDNA 3TJNA 3GDSA 1OP8A 1ZTJA 1OXGA 3UNQA 1C2KA 1SHHB 4NWKA 3OYPA 2J34A 3ZVFA 2VVUA 1GJ7B 1CA0C 1H4WA 4WMEA 2ZDNA 1F0UA 4NSVA 1MCTA 2VINA 4XBCA 1O38A 1QA0A 4KGAA 1DSUA 2AH4X 5GDSH 4ABGA 3KHVA 4LK4A 1BTZA 3VGCB 1EZQA 1OP2A 4NA7A 5AF9H 1E35B 4ABDA 1O2PA 2A7JA 1Y3XA 2ZHQH 4D7GA 1EAIA 1VCWA 1YF4A 4B73A 1QHRB 1D9IA 4Y8YA 1UTNA 1BRUP 1TGSZ 2Z9GA 1FPCH 3QGJA 3LONA 3GY2A 2HWLB 3GY7A 1AY6H 5T6FA 1NESE 4AFQA 1XUKA 2A4RA 1QY6A 1K21H 1P03A 1BQYA 3SJ9A 4JYTA 4BAQB 5L2ZH 5EQRA 3QZRA 3EQ0H 4X2VA 1FV9A 2BM2A 4X6NA 2XNIA 1HB0B 3ATLA 3BEFB 3SJIA 3GCNA 1O2SA 1YC0A 1O2VA 1WUNH 4Y79A 4M7GA 1BCUH 2FODA 6GCHF 2W5EA 3BTWE 1DWEH 3QUMP 5CE1A 3KIDU 3RXHA 1P9UA 1KXEA 1MTSA 4O03A 3RXUA 1O3EA 3BEUA 1THSH 4CHAB 2SNWA 2ZPSA 4DJZB 5T6GA 2R3YA 4MNYA 1G9IE 3MWIU 2ZCKP 3BTEE 5CMXH 1TPSA 3RXLA 2ULLA 3EA9A 1GBBA 1UCYK 4FUCA 2FWWA 1J9CH 3GY4A 4CRAA 1BTXA 1C4V2 3K6ZA 5PTPA 3MFJA 1QR3E 1RFNA 3E1XB 2GCHF 1ABJH 3NWUA 1ZZZA 3KQDA 2BVXH 1P2MA 3VB7A 3AW0A 4SGBE 1O2WA 2XXLA 3BEIB 1ANDA 1GI6A 1C1QA 4X1RU 2H9EH 3VFEA 1TYNA 3PB1E 3DA9B 1BJVA 2LNCA 3RC4A 1BHXF 4NCYA 2BY7X 1GHBG 4XDEA 4ABBA 4CHAC 3ODFA 1DXPA 5LPRA 4FUEA 5L6NH 5ETXA 4JYVH 1TMUH 1PPCE 3D65E 3NK8A 4DIIH 2FYQA 2HOBA 1TA6A 1TQ7B 4X2XA 1C2JA 1G3EA 5EW2H 2ANMH 3VB3A 2B0FA 2BDAA 1HAPH 2PR3A 2B5TB 4CBNA 2C8XB 1JBUH 1PJPA 4E7RG 9LPRA 1A61H 2ZCHP 3FZZA 2WPKS 2P3TB 5GIBA 1O2NA 3Q3YA 5FHTA 3RXFA 5EQQA 1G3BA 3QO6A 3STIA 4A1VA 1O3HA 1S84A 1S83A 1TNGA 2ZGBH 2IPHA 1CHOF 2BOHB 1Z8JB 2OC8A 2WUCA 3UIRA 1P2OA 4K1SA 1QQ4A 4UFGH 5BRRE 2KAIA 1AE8H 3E0PB 3D49H 2PGBB 2ZFSA 1ZR0A 1C1PA 1C1NA 1C5VA 1A7SA 1A5GH 4LZ1H 1MTVA 3I77A 2HPQH 3PLPA 4K1TA 1SGQE 1UK3A 4QT8C 2FLRH 1GMHF 3SO3A 1C2MA 2G55A 3H5CB 5DKMA 3MU5A 1QBNA 2G8TA 1QRWA 1GMCF 2HPPH 2IOTA 3U1JB 2GZ9A 4RN6A 3V12A 2QYIA 3SJ8A 5JB9S 3NPSA 3P8OA 3OX7U 1A4WH 1A0LA 1SGEE 1QJ7B 5GPIB 1NROH 3N7OA 2ALVA 2WYJA 1ANBA 1YPHC 1C1SA 4ZHMU 2VVVA 3A81A 1AB9C 4BTIB 3BTDE 1T32A 1P2KA 5EXMA 3V0XA 1TFXA 3SV9A 1VCQA 1C5WB 3UNRA 1OYTH 2XBXA 2J38A 2PKSC 3UFAA 2ZI2H 3RXBA 1HJAC 2ESTE 2GT8A 1BT7A 1BBRE 3S9CA 3GDUA 2QC2A 1P57B 2FS8A 5FBIA 1V2QT 1GWAA 1T8NA 1XUFA 1AZZA 4DGJA 5FCKA 2CHAB 2FYRA 1PFXC 4K69A 3HK6B 4OS4A 3ELAH 3GISB 1ZGVA 8KME2 1QBOA 4DY7B 2QXIA 4WMDA 1TAWA 2BVRH 2THFB 4IGDA 2BY8X 3ZZAA 1THPB 1L1NA 1UTLM 2NU0E 2A5AA 2Y5HA 1K2I1 4KTSA 1C2FA 3RXSA 2R9PA 1AMHA 1AE5A 1O5EH 1UJ1A 3D23A 3EAJA 2XW9A 1F5KU 5DP4A 2ANWA 3SU6A 2ASUB 1QL8A 4NGAH 5DGJA 3WY8A 3MH6A 1SBWA 2EA3A 3SGQE 2XWBI 4AG2A 1MAYA 1OP0A 1FI8A 4X1SU 7ESTE 1CA8B 3TK6A 2BQWB 2P94A 3LH3A 2AERH 1EAUA 1XUJA 1FXYA 2ODQA 3DHKH 5DP7A 5EXLA 2ZGCA 1LCYA 1ZGIA 3RXMA 1O3LA 3RMOH 3TGJE 2O8WA 4OGYA 1RIWB 1P9SA 2AFQB 1E37B 2O8TA 1YPJH 5JYIA 1BMAA 2PV9B 3T28A 3LJOA 2VH0A 4WY3A 1KTTB 3BN9A 3LC5A 1BIOA 1L0ZA 2FPZA 1HAOH 1AGJA 2FI4E 2PFEA 3MO3A 2HLCA 3ZV9A 3KNXA 1VGCB 1P02A 3T62A 2H9TH 4ISLA 4LOYH 2ZDMA 1UHBB 2Z3DA 1AKSA 1HV7A 3ZZ4A 4FUHA 1Y3WA 2PTCE 3HATH 5TJXA 2QCYA 1DUEA 2FOBA 3RXGA 1GG6B 2RCEA 3LIWA 1GBIA 8LPRA 4Y0ZE 3L6PA 1ANCA 4WJG2 3AASA 4FU8A 1ACBE 3Q3KA 2FI5E 5DPAA 1ZSLA 2OBOA 3S7HB 5ESTE 1Z6EA 2JH5D 3A84A 4O3TA 1EB2A 2Y81A 2J92A 1BTUA 1SQTA 3M7QA 2P8OB 1GI5A 1ARCA 2FTLE 2W3KA 3EA7A 3E91A 2A0QB 4I8GA 1V6DA 2BB4A 1D6WA 4XE4A 3VB6A 2FEQH 3M3VA 3HGPA 2BLVA 1EPTA 1HFDA 3SU3A 2Z9JA 4FVDA 1SR5C 3BTHE 2ODYB 4MPWA 1IQFA 1C9TA 1QJ1B 2C3SA 2FZZA 3NUMA 5A0CA 3A7YA 1WAYB 1RTLA 1O3KA 3LKWA 4MPXA 4H6TA 1K9OE 2P59A 1TGNA 1BJUA 1AD8H 1AQ7A 1VITG 2GCTB 1CU1A 1FAKH 1TB6H 3AAUA 2BLOA 4Q2KA 4X6MA 4E05H 2P3UB 2ZWLH 3UREA 1DVAH 1ZTKA 2W7UA 2WPLS 3R0FA 1O0DH 1L2EA 2PUQH 4KTCA 1YPEH 4ABIA 1IQJA 1W14U 5EG4A 3SV8A 1IQKA 1XKBC 1MD8A 3O8DA 4ISNA 3GDVA 1QJ6B 1WTGH 3E8LA 1MKXH 2ZDLA 1FQ3A 2R3UA 1EUFA 5I46H 3NKKA 4MPUA 1P2JA 1F0RA 1C1UH 1K1OA 1EOLA 3PM3A 1J17T 2SGEE 1T8MA 1D6RA 1O2QA 3RXEA 1GI3A 1V2LT 4AFSA 4CH8B 1BDAA 3S9AA 1BZXE 2P95A 1HPGA 3O8CA 1CHGA 1O5AB 4SGAE 5H4IB 2SGAA 1EJAA 1IQEA 1NM6A 1TOCB 2OLGA 2NU3E 1K22H 2FM2A 1F0SA 1FLEE 3LC3A 3UOPA 4GHQA 2QXGA 1BUIA 5HMAA 1UVOA 5HXFA 2BDCA 1JWTA 2ZF0H 3SNAA 2JKHA 3C27B 5J4QA 3M5LA 3SBKA 2NWNA 3MNCA 1UTQA 1FPHH 2Z9KA 1HAVA 2A7CA 1FY8E 5JBTA 1Q2WA 2ZO3H 1T4VH 2EI6A 1CHOG 4F49A 4NIYA 1RS0A 4AYVB 1THRH 1C5TA 3VGCC 1SFIA 4ZKNU 1V2KT 1NT1A 1A0HB 3KQBA 4INLA 2F9BH 1OWIA 1P01A 4U30A 3HKIB 5C5OA 1PPGE 2GMTC 1F2SE 3IITA 4K2YA 4UE7H 1S82A 1T7CA 1M9UA 2ZGXH 1AUTC 1SGFG 1AFQB 1BOQA 2FTMA 3R3GB 2Y5FA 2BDIA 2Z6BD 4BXSA 1K1NA 3MH7A 1L4ZA 4NIVA 3M7TA 1ELTA 3RXQA 3VB4A 1K1LA 3RUOA 3AVZA 1RTKA 2G52A 1CQQA 4YOJA 1VR1H 3ODDA 1ELFA 1OWDA 1TABE 4ZKOU 1KSNA 3A85A 3ZZBA 1DWDH 4A5TS 1V2NT
chains in the Genus database with same CATH superfamily
1TNIA 2BQ7B 3W1EA 2ZFTA 3TGKE 1G3DA 3MNBA 4XFQA 3QGNB 3RXRA 4B2AA 1Y5UT 1LVMA 2EC9H 4WWYA 1QA7A 1W0KD 1Y3UA 3CNRA 1C2LA 2GX4A 1RD3B 2PSYA 2K1QA 1K1JA 2OD3B 1TA2A 3LOXA 2FMJA 1ANEA 2A2QH 2IJOB 2TGAA 3DSGA 5EXNA 3RMMH 1LQDB 5B6OA 1QBVH 1JXPA 2FESH 4ZMAH 4X1QU 2ZIQH 5F8XA 2J94A 1AFQC 3MO6A 4AB9A 2XBVA 1G32B 2BOKA 2I6QA 2GCHG 1RGQA 3M35A 1NRNH 2VGCB 1SLUB 1AN1E 3QX5H 4FVBA 4OS1A 1PPBH 2BY9X 1V2UT 3KQCA 3LDXH 3F9HA 1MQ6A 2GDDA 1CT0E 1SOTA 1O5FH 1TNLA 3A8CA 4MNXA 3K2UA 3OEHD 1CO7E 4H4FA 5KGOA 2RG3A 3VXFH 3T29A 5HM9A 2VWMA 3PO1B 3MU1A 3M36A 4X1PU 1SQRA 1BITA 3SHAH 1TMTH 5JPMH 1A46H 1DLEA 9ESTA 4R0IA 2VGCC 2Y5GA 3PYHA 1TX6A 1RRKA 3PTBA 2UWPA 3TJOA 4B2BA 4XOJA 3FAOA 1EP5A 1OSSA 4KP0A 4UONA 4DURA 5L2YH 3GY8A 4E7NA 1ZOMA 1YBWA 4MTBA 3UNSA 1ELGA 1GHAG 2ZFPH 1WYKA 4HG6A 4JK6A 1D3TB 2BZAA 4WF8A 3RXCA 3T5FH 1GBLA 1OX1A 1QRZA 1GHAF 2XCFA 2H6MA 1UCYH 1TALA 1CA0B 5JDUB 2NU2E 4TY7A 4VGCB 2GZ7A 3TJVA 4J1YA 1W7XH 4FUGA 1AB9B 1XM1A 3SNBA 1YCPH 1W2KH 3BG4B 1HYLA 1HAXB 4X8SH 3SU5A 1C5OH 2F3CE 2ZPRA 1EOJA 1GHVH 1V2ST 5K0HA 3KF2A 1DWCH 2ZQ2A 1XUHA 4XBBA 3ZV8A 3P6ZB 1O3GA 3GCOA 1MBQA 4IN1A 3NZIA 1C2GA 3LT3A 2CN0H 3UB0A 4DW2U 1HIAA 1ELCA 4OS7A 4BANB 2SGFE 1BRCE 1FN6A 4OS6A 6CHAC 5DN6D 4IS5A 3U8RH 1P0SH 4MNVA 2FOCA 2BD2A 1YLDA 3F1SB 5EJ1A 2BXUH 1IHSH 4ASUD 2C90B 1HJ9A 2PW8H 1TIOA 2BY6X 2RFKC 3ITIA 2V3MA 1LVOA 1GDQA 5C20A 5IDKA 4X8VH 1ETRH 1W11U 4Y11E 5CHAC 2EI7A 1OWEA 5DP6A 1GHBF 3PV4A 1PPHE 1WCZA 2GJGA 3FFGA 3KYGA 3NCLA 3BG4C 1NS3A 1BA8B 2ZGHA 4MVNA 2C4FH 2UUYA 1TNJA 2ZU2A 2BDHA 3SNCA 1KXDA 1MKWH 3KQ5A 1KDQB 1WOFA 2RA3A 4ABFA 1QFKH 2ZG0H 5HIZA 2FLBH 1MZAA 4GLYA 4Y0YE 5K7RA 3K9XB 3GICB 3LGYA 4Y8XA 4HFPB 3F9GA 4B76A 1AWFH 5A2MH 1GBEA 4I8HA 5C0TA 1C5ZB 3ZZ3A 2FOAA 1NRPH 1SB1H 3SQHE 1EPTB 2J9NA 1ELVA 4KKDA 5L30H 3M5OA 1AIXH 4CRBA 4BOHA 3OY5U 2G00A 2TIOA 3V7TA 1EJNA 3Q77A 1O36A 1LHGH 2ZCLP 4TSFD 3RMNH 4BTTB 1HJ8A 3DSPA 3MMGA 1C5LH 1Z8GA 2FOHA 2QXHA 4HI3A 4LXBH 1TBZH 3A83A 5HKKD 2JETC 2SGPE 4JMYA 3AK5A 2GMTB 1AVWA 1NFYA 1QB1A 2VWNA 5EOKA 1XMNB 2VIOA 4KELA 1FX0B 1KXCA 4D76A 3KL6A 2XBYA 3TIUA 1Z1IA 1GHWH 1GJDB 4FUBA 1O2JA 1UTPA 2OQUA 3DUXH 3U98H 4WXIA 1OWHA 1EQ9A 3ATKA 3CS0A 1TX8A 5IYTA 4E06H 4Y7BA 3PMAB 2VNTA 3L33A 1C5NH 1C5PA 1GMHG 2F9VA 1GJ4H 1PYTC 2TGDA 1P3CA 3H7TA 1O3IA 1W12U 3BF6H 2TPIZ 2QAAA 2R2MB 4CRCA 1Z7KA 1LPKB 2Q6GA 2J97A 1O2TA 3F2HA 1GL1A 2FOEA 1FMGA 1PQ7A 4Y76A 2HNTF 1GI9B 3A7TA 1QL9A 3HGNA 3QK1A 1HBTH 2KCYA 4OM9A 3OY6U 1NN6A 1GI1A 1O3DA 2JETB 2ZTXA 1OYQA 1MTNB 1ZHPA 2Z7FE 3QN7A 4FU7A 1C1WH 3SNEA 3IG6B 1A2CH 1ZSKA 1ESTA 3O8RA 1K28D 4FOUC 2CGAA 4ISIH 4OS5A 4BAOB 3RMLH 1GHYH 4DOQA 1H8HD 2F9OA 2Z3EA 1MTNC 4WMFA 5J4SA 2FOMB 1ZYOA 3SJOA 5LH8A 3LGUA 2AGEX 1AU8A 1ZPCA 2CMYA 2WV4A 2JH0D 1UVSH 4I8JA 1HCGA 2A2XH 1P09A 3ATIA 1ZSJA 2OQ5A 3ENSB 2F9PA 1GMDG 5FCRA 1VJ9U 4D9QA 3T25A 2XC4A 4NWLA 4ZAEA 2QGRA 3SOSA 3PROA 1TNKA 5T6DA 4B1TA 1ORFA 2XWAA 1ZLRA 2VIWA 1K1MA 3PRDA 1B7XB 3S7KB 1GBFA 1O31A 2HALA 1TLDA 4FETA 2XCNA 1GVZA 4AYYB 1D4PB 1OOKB 1OWKA 1JIMA 3UOUA 4DT7B 1IQHA 1IHTH 2PKAA 1GJ5H 5E2PA 2XNDD 1T8OA 2SGQE 2XC0A 3GY3A 2H2ZA 1MTWA 3MU4A 3PMBB 5DJ7A 1MBMA 1EX3A 1S6FA 3A8DA 3U1IB 2AGIX 2M2AA 2D1JA 1HAGE 1LHCH 3A7VA 4MQAA 1AZ8A 1GCTC 4UFEH 1SQAA 3O8BA 1QGFA 1C1OA 3SQEE 2HVXA 4BAMB 2FP7B 3SU2A 1SPJA 1DLKB 4Q7ZA 2V7QD 4ESTE 1P2IA 1YPHE 1ZPBA 1O2OA 2VWOA 3F9FA 3QWCH 1C1VH 2ZFRH 1EFRD 1O3MA 1EZSC 1IAUA 2H9HA 1TBQH 2F83A 2YMSD 1H1BA 5I25A 4ABAA 2O8UA 5FX5A 1SMFE 2AIPA 1Z71A 5CHAB 2V35A 1Y5BT 4PROA 2PGQB 3UUZA 2WPIS 3K6YA 1AI8H 2STBE 3ZZ8A 3HKJB 3SGBE 3BTFE 3DSOA 3EA8A 5E0JA 5HM2A 5EU8A 4O9VA 3A82A 4HGCA 4RKJB 1DITH 2BZ6H 1PPZA 2RDEA 1K1PA 1LHFH 4X6PA 2XRCA 4Z1MD 3PMHB 1ZHRA 1O37A 4NFFA 2GDEH 2CV3A 4K1EA 1VJAU 4H6SB 4TY6A 3A8BA 4I8KA 4AX9H 3WWBA 2BQ6B 1JRTA 1Q31A 2ANYA 1UTOA 2XC5A 3RLYH 2A4OA 1WQSA 1TE0A 1WQVH 3TK9A 4YT7H 1EB1H 4TWWA 1V2WT 3NXPA 1SQOA 1HDTH 1EPTC 3WWFA 5ESBA 3MH5A 1O5CB 2ZKSA 2GCTC 1H8DH 2BDYA 3TH4H 5JBBS 4WH8A 3BTTE 4ISHH 2Q6FA 1GCDA 1UK2A 1PPFE 3K65B 4MNWA 1P05A 3QTVH 2G4TA 3GY6A 1WTHD 3Q76A 1FIWA 1UK4A 1HAYB 1L1GA 4FXGH 1ETSH 1Z8IB 1MKWK 1GJ6A 1S0QA 2KCOA 1CGJE 1O2UA 1YM0A 2CF9H 3T26A 1B5GH 1TMBH 1A3BH 4FU9A 3MTYA 2GV7A 2GVFA 2BLWA 1CE5A 4I8LA 1O3BA 4J2YB 1ID5H 1HLTH 4A92A 1UO6A 1VCPA 3SV6A 2EEKA 2FOGA 2ZDVH 1IQNA 3V3MA 2F91A 4YLQH 2ILNA 1BTPA 2V6NA 4D8NA 4AGKA 2ZTZA 1GG6C 1LPGB 1W0YH 1GDUA 4TPIZ 2BTCE 5A8XA 2ZGJA 1SVPA 1KYNA 1WDIA 3W94A 1SGRE 2TBSA 1SGNE 3I29A 3ZVGA 2P3FH 2ZDKA 5EPNA 4BNRA 5AFYH 1NC6A 2AMDA 4Z6AH 1B0FA 1A1RA 2W26A 3RXDA 4FUDA 2A7HA 2OBQA 1O2MA 1ESBA 1GGDC 2HVYB 1BBRH 2BD8A 2Q6DA 1ELBA 8ESTE 4I32A 3SYJA 4YTAA 1W0JD 1FZZA 2AEIH 1SGTA 2ALPA 3M7UA 1GMDF 2QA9E 1W7GH 2NU4E 1C2HA 3BTGE 5C1XA 5DO4H 1UHBA 1AWHB 4X1NU 1XX9A 4YZUA 1BHXB 1EAXA 1SGPE 2BD3A 4ABJA 1WBGB 2H1UA 3CS7A 1A3EH 2BLQA 2C8WB 4ZKRU 5FPTA 1P2QA 3UQVA 2ZU3A 1EXFA 3F0OA 4TT3D 3UR9A 1QNJA 2FS9A 4Q63A 2A31A 2P8OC 2FX4A 2BDBA 1TPOA 4F4OC 1OPHB 5T3HA 3UY9A 2OTVA 4K60A 1CGIE 4JZEH 1SGIB 3A7ZA 5FPSA 3BTME 3VB5A 1ETTH 1QB6A 2AIQA 1KXFA 2A4QA 4U32A 3SI4H 3TNSA 1TQ0B 1KTSB 4CH2B 1D3PB 5C1YA 3PLKA 4DG4A 4AFUA 1Y3VA 1O2YA 1MU8B 4XBDA 4ZCNA 1HAIH 3GOVB 1DWBH 4RKOB 1E1RD 1HAVB 3U8TH 4DCDA 2JIZD 1EATA 1F0TA 1MU6B 7LPRA 3ZZ7A 1VGCC 2BD9A 2Z9LA 1T8LA 4A7IB 1VITF 4P00A 2VVCA 1C4Y2 1E36B 1G37A 1C2IA 1V2MT 2GKVE 2BD7A 4O3UA 2CK3D 3A88A 5LGOA 4TPYA 3I78A 1ZMJA 2O8MA 1NZQH 2QV1A 3GS9A 3TVJB 1S6HA 1FNIA 1G2MA 3SU0A 2ZU1A 3TH2H 1DSTA 2O9QA 5FXLA 3RM2H 3UPEA 1PYTD 1HAHH 2RDLA 4K8YA 2YNAA 5EQSA 2PUXB 3ZVDA 5GCHG 1LQEA 1LVYA 1DDJA 3QLPH 1J16A 6CHAB 6GCHG 4M9FA 2BD5A 3ZZ9A 6ESTA 1GI7B 1D3QB 2BX3A 7GCHF 3GCHB 3F0PA 1C5SA 1NFWA 1NRQH 2BHGA 3VG8A 1P12E 1XXDA 5DG6A 2A45B 3ZVCA 2ZHFH 3GCTF 2STAE 3A87A 5AHGH 1PQ8A 1P04A 3SUDA 4UFDH 1KIGH 2PWXA 2WINI 2CXVA 5E2OA 3IWMA 4UEHH 4NZQA 4BXWA 1ZPZA 3SV2H 1WU1A 3KGPA 1RJXB 1GJBB 3M5NA 3M5MA 1XVOA 1DICA 1YLNA 1EZUC 2LP6A 8GCHG 2W7SA 4YT6H 2OXSA 3UQOA 3SZEA 1C2EA 1TRNA 1GJCB 4GCHG 2NU1E 1XXFA 5FBEA 5DP8A 3BG8A 1MUEB 1ZJDA 4CREA 1MH0A 1IOEA 2ODPA 1ZTLA 2SNVA 3RXOA 1YPMH 5EPYA 3ZIAD 3RM0H 3LJJA 5HIYA 1H9LB 4ACAA 1J8AA 1BTYA 3H7OA 2WPHS 3RC5A 2D8WA 3F9EA 3LPRA 4K5ZA 2F43B 2ZNKH 1NRSH 1LPZB 3DCLA 3SHCH 1SGCA 1TGBA 2TRMA 2OINA 1FUJA 1O3OA 2VIDA 3P8FA 1O5DH 4XSKU 1CGHA 4WVPE 1J15A 1O35A 3M61U 1GJAB 3SUGA 1BTHH 3MU8A 2SGDE 1C5UA 4ZHAA 1K1IA 1SL3A 3TITA 2VJ1A 4WXVA 1QCPA 1N1LA 1S81A 1O32A 2UWLA 2OCVB 1GHZA 2AGGX 1YYY1 4YOIA 4ZH8A 3ZVAA 1EZXC 4INHA 4GAWA 5TCAA 2BX4A 1O34A 1TWXB 4B75A 3RU4D 1G36A 3P17H 1VZQH 1YLCA 1BTWA 1C5XB 2WYGA 4GPGA 6LPRA 4AN7A 5IK2D 1W10U 4INKA 1QURH 1DT2A 4YO9A 3BIUH 5B6LA 1W13U 2WV9A 3E0NB 2HNTC 4B6EA 3M3SA 3TNTA 1SGYE 1EASA 1HIAB 3ZZDA 3Q00A 3ATMA 1BMMH 1NU7B 3GCHC 4OS2A 3SV7A 1C1MA 1QTFA 3A7XA 3B23B 3DFJA 5E8EH 1OKXA 2KR7A 1N6YA 2R0LA 2WPMS 3E16B 1ZHMA 3RXVA 1AVXA 3RP2A 2EI8A 4CRFA 1L1JA 3GCTG 4GVUA 4XRNA 1PQAA 1DY9A 1HRTH 1FN8A 3KN2A 3GY5A 4I7YH 2YNBA 1BRAA 2Y7XA 2A1DB 2A5IA 3MOCA 4CRGA 1TPAE 1RTFB 4XD7D 1L4DA 2R0KA 2FOFA 2UUFB 1QB9A 3PRBA 5EJLA 5FX6A 5BPEA 8GCHF 2C93B 3ZZ6A 1E34B 3H09A 1DS2E 1QQUA 1YPLH 3STJA 2G51A 3P8GA 3EGKH 1BB0B 1IQIA 1E1QD 1DX5M 2EQNA 3P70B 5A0BA 3URCA 5JBCS 3S0NA 1LVBA 1NFXA 2CHAC 1NRRH 1GI8B 2OP9A 1ABIH 1DANH 1SSXA 4AFZA 3VPKA 1CT2E 2Z9IA 3HPTB 1AO5A 1SC8U 5F8ZA 2AS9A 3W95A 2V0BA 4JYUH 4IBLH 3OSYA 4Y71A 5GCHF 3KQEA 1O3JA 3RXIA 3SU4A 1TPPA 2B8OH 4FUIA 3ATWA 5EGMA 2BY5X 3WW7A 7GCHG 2BYAX 1FIZA 1QZ8A 1KLIH 4ASHA 2WV5A 1S5SA 1GI2A 1O33A 5LPFA 2ZHWH 3A7WA 3SORA 3U28C 3T2NA 1YCPM 2ZPQA 5F8TA 1ZMLA 5HGGA 1QRXA 2TGTA 1O5BB 3BIVH 2KX4A 1SGFA 1GI4A 2XTTB 4IC5A 1V2PT 1TOMH 1ZRKA 1NFUA 4NFEA 2VH6A 1BMLA 5GXPA 3N7DA 5DP5A 5AFZH 2C8YB 2VU8E 1UW7A 2DE9A 1W3CA 2GD4B 2Z94A 3B9FH 5FPYA 3V13A 4CRDA 1N8OC 1UVTH 1NPMA 3TH3H 1DPOA 1AVGH 4UD9H 1D3DB 3CENA 1C1RA 4UFFH 4BAHB 2GZ8A 3SUEA 4ZUHA 1HAZB 3DFLA 1GBKA 4THNH 5G4BA 2L6OA 5JB8S 1AHTH 2Y82A 1YKTA 1UTKA 3ZYDA 1IQMA 1V2TT 2GT7A 1NY22 5TCCA 1V3XA 5E0GA 4MPVA 1GBCA 3U9AH 4K8BA 1P3EA 1TNHA 3FANA 4YOGA 1HXFH 4X2YA 1SI5H 3F6UH 3PV2A 2W3IA 4BTUB 4TYDA 5C5NA 3QDZB 1HXEH 3N99A 3JZ1B 4YM9A 4LZ4B 1LDTT 1O2RA 1Y3YA 1V2VT 2Z3CA 2QN5T 2A32A 1HJAB 1JIRA 5C3NA 3F2GA 3FP8E 1BBRK 4Q80A 1SGDE 3CP7A 2LELA 1CT4E 2ZEBA 3MNXA 1GBHA 2O8LA 2B9LA 4IMZA 4NIXA 2JDID 3UWJH 4AB8A 2FX6A 3OTPA 1E38B 1G2LA 1PQ5A 1W8BH 1S85A 1O3AA 1C1TA 2WZQA 3RXAA 2HNTE 1GBJA 4AOQA 1ELDE 1Z6JH 2PHBA 1LHDH 2KCAA 3PTNA 1X7AC 5GNDA 1TX7A 1LKAA 4B2CA 4IN2A 4I33A 1TRMA 1SLWB 5F6MA 4VGCC 1YPGH 1LTOA 3TJUA 1XVMA 2GP9B 4O97A 5A8ZA 1O2XA 1C5YB 3ESTA 1NO9H 1O2GH 3RXPA 1FY4A 1IQGA 1GBMA 4YESB 5F03A 1G3CA 2ZQ1A 2VIPA 1DM4B 3E6PH 2FO9A 4UDWH 1C5MD 3GYLB 1GBTA 1FONA 2QIQA 1HNEE 2KAIB 3GYMA 3S69A 2P93A 4JCNA 3AAVA 1AFEH 2VWLA 4NA9H 1C2DA 1GJ9B 2BD4A 2ZFFH 4ZROA 2KM0A 3L3TA 1GJ8B 3M3TA 1H9HE 2KFWA 2JJ1D 4X2WA 1EAWA 2B7DH 4JZDH 1VITH 2VB0A 1JRSA 1DFPA 4U01A 2ZU5A 1TONA 1NBME 4D7FA 2BDGA 3FVFB 4GHTA 4H42U 2JH6D 4JZIA 5ABWA 1KXBA 5A0AE 1CBWC 1DOJA 1MTUA 4HTCH 3MHWU 4CBOA 1GPZA 1DE7H 3ZZ5A 1P8VC 1F7ZA 1O30A 2FXRA 1GHXH 3PWCA 3VEQB 1O3CA 3JZ2B 3ZZCA 3URDA 1C5RA 2PKAB 4JK5A 3Q3XA 1Z1JA 4IW4E 1O2LA 2FI3E 4NSYA 3UTUH 3DD2H 7KMEH 1MKXK 2HGTH 2RA0A 3A86A 2G5VA 2PSXA 1DUAA 1ARBA 4TWYA 1GL0E 3ZYEA 1O2HA 4X8TH 4A6LA 1JMOH 4Q7XA 2XOKD 1YGCH 1H9IE 4X6OA 2I6SA 1AUJA 3UWIA 1A0JA 1J14A 2V3OH 1EKBB 3RXKA 4KTUA 3PWBA 1FAXA 1YCPK 1Y5AT 5C1UA 2YOLA 5DP3A 2ZA5A 5E0HA 1P06A 1TRYA 1ZJKA 1A5HA 4R8TB 1B0EA 1MAXA 5FAHA 3B8JA 5SGAE 1Y8TA 3KEEA 4AORA 3D62A 3OTJE 4FUJA 1YWUA 2ZECA 4I31A 3F2FA 3RDZA 4A1TA 1XUIA 2OC7A 2ZU4A 5GWZA 1RXPA 1SOZA 1XKAC 1F92A 4DIHH 2YMSB 4NA8A 5FL7D 2TGPZ 1DY8A 3FZDA 1ZRBA 1T4UH 1GBAA 2G4UA 1GGDB 1INCA 2ZDAH 1KLTA 1MD7A 3BSQA 3SU1A 5KEDA 2J98A 4RSPA 1TGCA 5DK1A 5CDFE 2PTNA 1CSOE 1O5GH 1S0RA 3EE0B 3RU4T 1E0FD 2ZHDA 3OE7D 2SFAA 1QIXB 2Q1JA 2BVSH 2DE8A 1O3NA 2QF0A 3EYDA 1ZMNA 4AGJA 2GGVB 1Y59T 3A89A 1LO6A 1BRBE 3SZNA 4A1XA 2BXTH 3TLOA 2AYWA 1P2NA 1LHEH 3ZVBA 1UVUH 3LGWA 5AVDA 1NTPA 1KY9A 3FP7E 1GMCG 3T27A 1GVLA 2PLXA 1U6QA 1UCYE 1MCVA 4GUXA 2LPRA 2H5DA 4YLUA 1GBDA 1C5QA 1N8OB 3PMJA 1TBRH 1G30B 2F9UA 2AMPA 3MYWA 2XBWA 5EW1H 4BAKB 1H8ED 1KLJH 1ELAA 4ZKSU 3LGVA 3KCGH 3SGAE 4ZXYH 2ZHEH 2VBCA 4MG3A 1YP9A 2QF3A 1GVKB 1FY1A 3QZQA 2VIVA 1EP6A 3LU9B 3AW1A 1GCTB 3TGIE 1FJSA 4U2WA 2R2WU 1SLVB 2CF8H 1O3PB 1KXAA 1W0ZU 1V2JT 2J2UA 2WPJS 2ZC9H 4Z0KA 1SLXB 4K3JA 1V2RT 3RXJA 2HRVA 1A5IA 2F9NA 5C67A 2GTBA 3M37A 3BV9B 4FUFA 4Y7AA 1SG8B 1V2OT 2QY0B 2UWOA 5F53A 1O2ZA 2G5NA 3SN8A 1O2IA 1YPKH 1UTJA 2G81E 4MLFB 1P10A 4CR5A 1UVPA 1IQLA 1XUGA 3U8OH 3S9BA 2J4IA 1GI0A 1MMJN 3LH1A 1H8IH 2ZP0H 2UUKB 2QXJA 3RXTA 1F5LA 5EODA 1HUTH 2CJIA 4Y10E 2FIRH 1WV7H 1RIWC 4B71A 4I86A 2UUJB 2C8ZB 4DVAU 2HLDD 3F68H 3RU4E 1FY5A 4CR9A 4B74A 1TGTA 2DUCA 4D9RA 3E3TA 4NG9H 3C1KA 1DXWA 2PP6A 1O2KA 2M5TA 4JZFH 3A80A 4Q7YA 2ZTYA 3FN8A 5C2ZA 1LKBA 3RLWH 1T31A 1N6XA 5A8YA 3SJKA 5DP9A 5GJ4B 2D26C 2VIQA 4HZHA 1UMAH 4NZLA 3TU7H 4X8UH 1EJMA 3A8AA 1ELEE 2YMSC 2V3HH 3LGIA 4MDSA 3MH4A 3MU0A 3VXEH 3MO9A 4OGXA 3TPIZ 4NIWA 2XYAA 4Q4LA 2K8IA 3OU0A 3SNDA 1CBWB 1SHYA 1ESAA 2QF4A 3LGTA 4WH6A 1Z8RA 3G01A 3TK5A 2OC1A 1MABB 2A4GA 2FDAA 2Y6TA 1NU9A 5A09A 1QL7A 5HYOA 2ZZUH 2H5CA 4AZ2B 3MI4A 3P92A 3RC6A 2Y7ZA 3QTOH 1O3FA 4ZHLU 1SFQB 3FP6E 1WSSH 2ZFQH 3BTQE 1KDQA 1F5RA 1UTMA 2WUBA 3SW2B 3HK3B 2D2DA 2Y80A 3P8NA 4ABHA 4GCHF 2A5KA 1C4U2 1FDPA 3SI3H 4JZ1A 2OUAA 4RT0A 1C9PA 3DT0H 2GV6A 4AG1A 4ABEA 2P16A 3SUFA 2BMGB 1HGTH 2PKSB 2J95A 4IC6A 4ISOA 3P95A 4DT4A 3PO1C 1O39A 1P11E 3EDXB 1BMNH 2OC0A 4X0WU 1LMWB 4ZXXH 4Y6DA 3ZVEA 3UR6A 1FY3A 4Y8ZA 5LPEA 1OHHD 3U69H 1MZDA 1OWJA 5JBAS 1CVWH 1PPEE 3MNSA 3E90B 3PLBA 3OEED 3BTKE 1JOUB 2IN2A 1AKSB 4IMQA 4GSOA 1Q3XA 1OS8A 2ANKH 2AMQA 1MQ5A 1GDNA 2W6JD 3TJNA 3GDSA 1OP8A 1ZTJA 1OXGA 3UNQA 1C2KA 1SHHB 4NWKA 3OYPA 2J34A 1WXRA 3ZVFA 2VVUA 1GJ7B 1CA0C 1H4WA 4WMEA 2ZDNA 1F0UA 4NSVA 1MCTA 2VINA 4XBCA 1O38A 1QA0A 4KGAA 1DSUA 2AH4X 5GDSH 4ABGA 3KHVA 4LK4A 1BTZA 3VGCB 1EZQA 1OP2A 4NA7A 5AF9H 4ACBA 1E35B 4ABDA 1O2PA 2A7JA 1Y3XA 2ZHQH 4D7GA 1EAIA 1VCWA 1YF4A 4B73A 1QHRB 1D9IA 4Y8YA 1UTNA 1BRUP 1TGSZ 2Z9GA 1FPCH 3QGJA 3LONA 3GY2A 2L74A 2HWLB 3GY7A 1AY6H 5T6FA 1NESE 4AFQA 1XUKA 2A4RA 1QY6A 1K21H 1P03A 1BQYA 4RI0A 3SJ9A 4JYTA 4BAQB 5L2ZH 5EQRA 3QZRA 3EQ0H 4X2VA 1FV9A 2BM2A 4X6NA 2XNIA 1HB0B 3ATLA 3BEFB 3SJIA 3GCNA 1O2SA 1YC0A 1O2VA 3KYFA 1WUNH 4Y79A 4M7GA 1BCUH 2FODA 6GCHF 2W5EA 3BTWE 1DWEH 3QUMP 5CE1A 3KIDU 3OAAD 3RXHA 1P9UA 1KXEA 1MTSA 4O03A 3RXUA 1O3EA 3BEUA 1THSH 4CHAB 2SNWA 2ZPSA 4DJZB 5T6GA 2R3YA 4MNYA 1G9IE 3MWIU 2ZCKP 3BTEE 3OFND 5CMXH 1TPSA 3RXLA 2ULLA 3EA9A 1GBBA 1UCYK 4FUCA 2FWWA 1J9CH 3GY4A 4CRAA 1BTXA 1C4V2 3K6ZA 5PTPA 3MFJA 1QR3E 1RFNA 2F4LA 3E1XB 2GCHF 1ABJH 3NWUA 1ZZZA 3KQDA 2BVXH 1P2MA 3VB7A 3AW0A 4SGBE 1O2WA 1KMHB 2XXLA 3BEIB 1ANDA 1GI6A 5EJZA 1C1QA 4X1RU 2H9EH 3VFEA 1TYNA 3PB1E 2WHXA 3DA9B 1BJVA 2LNCA 3RC4A 1BHXF 4NCYA 2BY7X 1GHBG 5C0UA 4XDEA 4ABBA 4CHAC 3ODFA 1DXPA 5LPRA 4FUEA 5L6NH 5ETXA 4JYVH 1TMUH 1PPCE 3D65E 2IPQX 3NK8A 4DIIH 2FYQA 2HOBA 1TA6A 1TQ7B 4X2XA 1C2JA 1G3EA 5EW2H 2ANMH 3VB3A 2B0FA 2BDAA 1HAPH 2PR3A 2B5TB 4CBNA 2C8XB 1JBUH 1PJPA 4E7RG 1K0HA 9LPRA 1A61H 2ZCHP 3FOAA 3FZZA 2WPKS 2P3TB 5GIBA 1O2NA 3Q3YA 2OK5A 5FHTA 3RXFA 5EQQA 1G3BA 3QO6A 3STIA 4A1VA 5T1VA 1O3HA 1S84A 1S83A 1TNGA 2ZGBH 2IPHA 1CHOF 2BOHB 1Z8JB 2OC8A 2WUCA 3UIRA 1P2OA 4K1SA 1QQ4A 4UFGH 5BRRE 2KAIA 1AE8H 3E0PB 3D49H 2PGBB 2ZFSA 1ZR0A 1C1PA 2WSSD 4P02A 4YXWD 1C1NA 1C5VA 1A7SA 1A5GH 4LZ1H 1MTVA 3I77A 2HPQH 3PLPA 4K1TA 1SGQE 1UK3A 4QT8C 2FLRH 1GMHF 3SO3A 1BMFD 1C2MA 2G55A 3H5CB 5DKMA 3MU5A 1QBNA 2G8TA 1QRWA 1GMCF 2HPPH 2IOTA 3U1JB 3NRLA 2GZ9A 4RN6A 3V12A 2QYIA 3FKSD 3SJ8A 5JB9S 3NPSA 3P8OA 3OX7U 1A4WH 1A0LA 1SGEE 1COWD 1QJ7B 5GPIB 1NROH 3N7OA 2ALVA 2WYJA 1ANBA 5C94A 1YPHC 1C1SA 4ZHMU 2KCPA 2VVVA 3A81A 1AB9C 4BTIB 3BTDE 1T32A 1P2KA 5EXMA 3V0XA 1TFXA 3SV9A 1VCQA 1C5WB 3UNRA 1OYTH 2XBXA 2J38A 2PKSC 3UFAA 2ZI2H 3RXBA 1HJAC 2ESTE 2GT8A 1BT7A 1BBRE 3S9CA 3GDUA 2QC2A 2IJD1 1P57B 2FS8A 5FBIA 1V2QT 1GWAA 1T8NA 1XUFA 1AZZA 4DGJA 5FCKA 2CHAB 2FYRA 1PFXC 5DSFA 4K69A 2K0QA 3HK6B 4OS4A 3ELAH 5CHBA 3GISB 1ZGVA 8KME2 1QBOA 4DY7B 2QXIA 4WMDA 1TAWA 2BVRH 2THFB 4IGDA 2BY8X 3ZZAA 1THPB 2QE7D 1L1NA 1UTLM 2NU0E 2A5AA 2Y5HA 1K2I1 4KTSA 1C2FA 3RXSA 2R9PA 1AMHA 1AE5A 1O5EH 1UJ1A 3D23A 3EAJA 2XW9A 1F5KU 5DP4A 2ANWA 3SU6A 2ASUB 1QL8A 4NGAH 5DGJA 3WY8A 3MH6A 1SBWA 2EA3A 3SGQE 5C17A 3F3BA 2XWBI 4AG2A 1MAYA 1OP0A 1FI8A 4X1SU 7ESTE 1S6LA 1CA8B 3TK6A 2BQWB 2P94A 3LH3A 2AERH 1EAUA 1XUJA 5EIYA 1FXYA 2ODQA 3DHKH 5DP7A 5EXLA 2ZGCA 1LCYA 1ZGIA 3RXMA 1O3LA 3RMOH 3TGJE 2O8WA 4OGYA 1RIWB 1P9SA 2AFQB 1E37B 2O8TA 1YPJH 5JYIA 1BMAA 2PV9B 3T28A 5KECA 3LJOA 2VH0A 4WY3A 1KTTB 3BN9A 2EY4C 3LC5A 1BIOA 1L0ZA 2FPZA 1HAOH 1AGJA 2FI4E 2PFEA 3MO3A 2HLCA 3ZV9A 3KNXA 1VGCB 1P02A 3T62A 2H9TH 4ISLA 4LOYH 1YY3A 2ZDMA 1UHBB 2Z3DA 3N7EA 1AKSA 1HV7A 3ZZ4A 4FUHA 1Y3WA 2PTCE 3HATH 5TJXA 2QCYA 1DUEA 2FOBA 3RXGA 1GG6B 2RCEA 3LIWA 1GBIA 8LPRA 4Y0ZE 3L6PA 1ANCA 4WJG2 3AASA 4FU8A 1ACBE 3Q3KA 2FI5E 5DPAA 1ZSLA 2OBOA 3S7HB 5ESTE 1Z6EA 2JH5D 3A84A 4O3TA 1EB2A 2Y81A 2J92A 1BTUA 1SQTA 3M7QA 2P8OB 1GI5A 3PV5A 1ARCA 2FTLE 2J5UA 3MQKC 2W3KA 3EA7A 3E91A 2A0QB 4I8GA 1V6DA 2BB4A 1D6WA 4B6FA 4XE4A 3VB6A 2QF5A 2FEQH 3M3VA 3HGPA 2BLVA 1EPTA 1HFDA 3SU3A 2Z9JA 4FVDA 1SR5C 3BTHE 2ODYB 4MPWA 1IQFA 1C9TA 1QJ1B 2C3SA 2FZZA 3NUMA 5A0CA 3A7YA 1WAYB 1RTLA 1O3KA 3LKWA 4MPXA 4H6TA 1E79D 1K9OE 2P59A 1TGNA 1BJUA 1AD8H 1AQ7A 1VITG 2GCTB 1CU1A 2JJ2D 1FAKH 1TB6H 3AAUA 2BLOA 2WPDD 4Q2KA 4X6MA 4E05H 2P3UB 2ZWLH 3UREA 4F48B 1DVAH 1ZTKA 2W7UA 2WPLS 3R0FA 1O0DH 1L2EA 2PUQH 4KTCA 1YPEH 4ABIA 1IQJA 1W14U 5EG4A 3SV8A 1IQKA 1XKBC 1MD8A 3O8DA 4ISNA 2AHME 3GDVA 1QJ6B 1WTGH 3E8LA 1MKXH 2J98B 1NBMD 2ZDLA 1FQ3A 2R3UA 1EUFA 5I46H 3NKKA 4MPUA 1P2JA 2KZ4A 1F0RA 1C1UH 1K1OA 1EOLA 2W6ID 3PM3A 1J17T 2SGEE 1T8MA 1D6RA 1O2QA 3UAIC 3RXEA 1GI3A 1V2LT 4AFSA 3FO8D 4CH8B 1BDAA 3S9AA 1BZXE 2P95A 1HPGA 3O8CA 1CHGA 1O5AB 4SGAE 5H4IB 2SGAA 1EJAA 1IQEA 1NM6A 1TOCB 2OLGA 2NU3E 1K22H 4AC9A 2FM2A 1F0SA 1FLEE 3LC3A 3UOPA 4GHQA 2QXGA 1BUIA 5HMAA 1UVOA 5HXFA 2BDCA 1JWTA 2ZF0H 3SNAA 2JKHA 3C27B 5J4QA 3M5LA 3SBKA 2NWNA 3MNCA 1UTQA 1FPHH 2Z9KA 1HAVA 2A7CA 1FY8E 5JBTA 1Q2WA 2ZO3H 1T4VH 2EI6A 1CHOG 4F49A 4NIYA 4F55A 1RS0A 1VKYA 1THRH 4AYVB 1C5TA 3VGCC 1SFIA 4ZKNU 1V2KT 1NT1A 1A0HB 3KQBA 4INLA 2F9BH 1OWIA 1P01A 4U30A 3HKIB 5C5OA 1PPGE 2GMTC 1F2SE 3EE7A 3IITA 4K2YA 4UE7H 1S82A 1T7CA 1M9UA 4RT1A 2ZGXH 1AUTC 1SGFG 1AFQB 1BOQA 2FTMA 3R3GB 2Y5FA 2BDIA 2Z6BD 4BXSA 1K1NA 3MH7A 1L4ZA 4NIVA 3M7TA 1ELTA 3RXQA 3VB4A 1K1LA 3RUOA 3AVZA 1RTKA 2G52A 1CQQA 4YOJA 1VR1H 3ODDA 1ELFA 1OWDA 1TABE 4ZKOU 1KSNA 1SKYE 3A85A 3ZZBA 1DWDH 4A5TS 1V2NT
chains in the Genus database with same CATH topology
1TNIA 2BQ7B 2ZFTA 3TGKE 1G3DA 3MNBA 4XFQA 3QGNB 3RXRA 4B2AA 1Y5UT 1LVMA 2EC9H 4WWYA 1QA7A 1Y3UA 1C2LA 2GX4A 1RD3B 2PSYA 2K1QA 1K1JA 2OD3B 1TA2A 3LOXA 2FMJA 1ANEA 2A2QH 2IJOB 2TGAA 5EXNA 3RMMH 1LQDB 5B6OA 1QBVH 1JXPA 2FESH 4ZMAH 4X1QU 2ZIQH 5F8XA 2J94A 1AFQC 3MO6A 4AB9A 2XBVA 1G32B 2BOKA 2I6QA 2GCHG 1RGQA 3M35A 1NRNH 2VGCB 1SLUB 1AN1E 3QX5H 4FVBA 4OS1A 1PPBH 2BY9X 1V2UT 3KQCA 3LDXH 3F9HA 1MQ6A 2GDDA 1CT0E 1SOTA 1O5FH 1TNLA 3A8CA 4MNXA 3K2UA 4H4FA 1CO7E 2RG3A 3VXFH 3T29A 5HM9A 2VWMA 3PO1B 3MU1A 3M36A 4X1PU 1BITA 3SHAH 1TMTH 5JPMH 1A46H 1DLEA 9ESTA 4R0IA 2VGCC 2Y5GA 3PYHA 1TX6A 1RRKA 3PTBA 2UWPA 3TJOA 4B2BA 4XOJA 3FAOA 1EP5A 1OSSA 4KP0A 4UONA 4DURA 5L2YH 3GY8A 4E7NA 1ZOMA 1YBWA 4MTBA 3UNSA 1ELGA 1GHAG 2ZFPH 1WYKA 4JK6A 1D3TB 2BZAA 4WF8A 3RXCA 3T5FH 1GBLA 1OX1A 1QRZA 1GHAF 2XCFA 2H6MA 1UCYH 1TALA 1CA0B 5JDUB 2NU2E 4TY7A 4VGCB 2GZ7A 3TJVA 4J1YA 1W7XH 4FUGA 1AB9B 1XM1A 3SNBA 1YCPH 1W2KH 3BG4B 1HYLA 1HAXB 4X8SH 3SU5A 1C5OH 2F3CE 2ZPRA 1EOJA 1GHVH 1V2ST 5K0HA 3KF2A 1DWCH 2ZQ2A 1XUHA 4XBBA 3ZV8A 3P6ZB 1O3GA 3GCOA 1MBQA 4IN1A 3NZIA 1C2GA 3LT3A 2CN0H 4DW2U 1HIAA 1ELCA 4OS7A 4BANB 2SGFE 1BRCE 1FN6A 4OS6A 6CHAC 4IS5A 3U8RH 1P0SH 4MNVA 2FOCA 2BD2A 1YLDA 3F1SB 2BXUH 1IHSH 2C90B 1HJ9A 2PW8H 1TIOA 2BY6X 3ITIA 1LVOA 1GDQA 5C20A 5IDKA 4X8VH 1ETRH 1W11U 4Y11E 5CHAC 2EI7A 1OWEA 5DP6A 1GHBF 3PV4A 1PPHE 1WCZA 3FFGA 3NCLA 3BG4C 1NS3A 1BA8B 2ZGHA 4MVNA 2C4FH 2UUYA 1TNJA 2ZU2A 2BDHA 3SNCA 1KXDA 1MKWH 1KDQB 1WOFA 2RA3A 4ABFA 1QFKH 2ZG0H 2FLBH 1MZAA 4GLYA 4Y0YE 5K7RA 3K9XB 3GICB 3LGYA 4Y8XA 4HFPB 3F9GA 4B76A 1AWFH 5A2MH 1GBEA 4I8HA 1C5ZB 3ZZ3A 2FOAA 1NRPH 1SB1H 3SQHE 1EPTB 2J9NA 1ELVA 4KKDA 5L30H 3M5OA 1AIXH 4CRBA 4BOHA 3OY5U 2G00A 2TIOA 3V7TA 1EJNA 3Q77A 1O36A 1LHGH 2ZCLP 3RMNH 4BTTB 1HJ8A 3MMGA 1C5LH 1Z8GA 2FOHA 2QXHA 4HI3A 4LXBH 1TBZH 3A83A 2JETC 2SGPE 4JMYA 2GMTB 1AVWA 1NFYA 1QB1A 2VWNA 5EOKA 1XMNB 2VIOA 4KELA 1KXCA 4D76A 3KL6A 2XBYA 3TIUA 1Z1IA 1GHWH 1GJDB 4FUBA 1O2JA 1UTPA 2OQUA 3DUXH 3U98H 4WXIA 1OWHA 1EQ9A 3ATKA 3CS0A 1TX8A 5IYTA 4E06H 4Y7BA 3PMAB 2VNTA 3L33A 1C5NH 1C5PA 1GMHG 2F9VA 1GJ4H 1PYTC 2TGDA 1P3CA 3H7TA 1O3IA 1W12U 3BF6H 2TPIZ 2QAAA 2R2MB 4CRCA 1Z7KA 1LPKB 2Q6GA 1O2TA 1GL1A 2FOEA 1FMGA 1PQ7A 4Y76A 2HNTF 1GI9B 3A7TA 1QL9A 3HGNA 3QK1A 1HBTH 3OY6U 1NN6A 1GI1A 1O3DA 2JETB 2ZTXA 1OYQA 1MTNB 1ZHPA 2Z7FE 3QN7A 4FU7A 1C1WH 3SNEA 3IG6B 1A2CH 1ZSKA 1ESTA 3O8RA 1K28D 2CGAA 4ISIH 4OS5A 4BAOB 3RMLH 1GHYH 4DOQA 2F9OA 2Z3EA 1MTNC 4WMFA 5J4SA 2FOMB 1ZYOA 3SJOA 5LH8A 3LGUA 2AGEX 1AU8A 1ZPCA 2CMYA 2WV4A 2JH0D 1UVSH 4I8JA 1HCGA 2A2XH 1P09A 3ATIA 1ZSJA 2OQ5A 3ENSB 2F9PA 1GMDG 5FCRA 1VJ9U 4D9QA 3T25A 2XC4A 4NWLA 4ZAEA 2QGRA 3SOSA 3PROA 1TNKA 5T6DA 4B1TA 1ORFA 2XWAA 1ZLRA 2VIWA 1K1MA 1B7XB 3S7KB 1GBFA 1O31A 2HALA 1TLDA 2XCNA 1GVZA 4AYYB 1D4PB 1OOKB 1OWKA 1JIMA 3UOUA 4DT7B 1IQHA 1IHTH 2PKAA 1GJ5H 5E2PA 1T8OA 2SGQE 2XC0A 3GY3A 2H2ZA 1MTWA 3MU4A 3PMBB 5DJ7A 1MBMA 1EX3A 1S6FA 3A8DA 3U1IB 2AGIX 2D1JA 1HAGE 1LHCH 3A7VA 4MQAA 1AZ8A 1GCTC 4UFEH 1SQAA 3O8BA 1QGFA 1C1OA 3SQEE 2HVXA 4BAMB 2FP7B 3SU2A 1SPJA 1DLKB 4Q7ZA 4ESTE 1P2IA 1YPHE 1ZPBA 1O2OA 2VWOA 3F9FA 3QWCH 1C1VH 2ZFRH 1O3MA 1EZSC 1IAUA 2H9HA 1TBQH 2F83A 1H1BA 5I25A 4ABAA 2O8UA 5FX5A 1SMFE 2AIPA 1Z71A 5CHAB 2V35A 1Y5BT 4PROA 2PGQB 3UUZA 2WPIS 3K6YA 1AI8H 2STBE 3ZZ8A 3HKJB 3SGBE 3BTFE 3EA8A 5E0JA 5HM2A 5EU8A 4O9VA 3A82A 4HGCA 4RKJB 1DITH 2BZ6H 1PPZA 1K1PA 1LHFH 4X6PA 2XRCA 3PMHB 1ZHRA 1O37A 4NFFA 2GDEH 2CV3A 4K1EA 1VJAU 4H6SB 4TY6A 3A8BA 4I8KA 4AX9H 2BQ6B 1JRTA 1Q31A 2ANYA 1UTOA 2XC5A 3RLYH 2A4OA 1WQSA 1TE0A 1WQVH 3TK9A 4YT7H 1EB1H 4TWWA 1V2WT 3NXPA 1SQOA 1HDTH 1EPTC 5ESBA 3MH5A 1O5CB 2ZKSA 2GCTC 1H8DH 2BDYA 3TH4H 5JBBS 4WH8A 3BTTE 4ISHH 2Q6FA 1GCDA 1UK2A 1PPFE 3K65B 4MNWA 1P05A 3QTVH 2G4TA 3GY6A 1WTHD 3Q76A 1FIWA 1UK4A 1HAYB 1L1GA 4FXGH 1ETSH 1Z8IB 1MKWK 1GJ6A 1S0QA 1CGJE 1O2UA 1YM0A 2CF9H 3T26A 1B5GH 1TMBH 1A3BH 4FU9A 3MTYA 2GV7A 2GVFA 2BLWA 1CE5A 4I8LA 1O3BA 4J2YB 1ID5H 1HLTH 4A92A 1UO6A 1VCPA 3SV6A 2EEKA 2FOGA 2ZDVH 1IQNA 3V3MA 2F91A 4YLQH 2ILNA 1BTPA 2V6NA 4D8NA 4AGKA 2ZTZA 1GG6C 1LPGB 1W0YH 1GDUA 4TPIZ 2BTCE 5A8XA 2ZGJA 1SVPA 1KYNA 3W94A 1SGRE 2TBSA 1SGNE 3I29A 3ZVGA 2P3FH 2ZDKA 5EPNA 4BNRA 5AFYH 1NC6A 2AMDA 4Z6AH 1B0FA 1A1RA 2W26A 3RXDA 4FUDA 2A7HA 2OBQA 1O2MA 1ESBA 1GGDC 1BBRH 2BD8A 2Q6DA 1ELBA 8ESTE 4I32A 4YTAA 1FZZA 2AEIH 1SGTA 2ALPA 3M7UA 1GMDF 2QA9E 1W7GH 2NU4E 1C2HA 3BTGE 5C1XA 5DO4H 1UHBA 1AWHB 4X1NU 1XX9A 4YZUA 1BHXB 1EAXA 1SGPE 2BD3A 4ABJA 1WBGB 2H1UA 3CS7A 1A3EH 2BLQA 2C8WB 4ZKRU 5FPTA 1P2QA 3UQVA 2ZU3A 1EXFA 3UR9A 1QNJA 2FS9A 2A31A 2P8OC 2FX4A 2BDBA 1TPOA 4F4OC 1OPHB 5T3HA 3UY9A 2OTVA 4K60A 1CGIE 4JZEH 1SGIB 3A7ZA 5FPSA 3BTME 3VB5A 1ETTH 1QB6A 2AIQA 1KXFA 2A4QA 4U32A 3SI4H 3TNSA 1TQ0B 1KTSB 4CH2B 1D3PB 5C1YA 3PLKA 4DG4A 4AFUA 1Y3VA 1O2YA 1MU8B 4XBDA 1HAIH 3GOVB 1DWBH 4RKOB 1HAVB 3U8TH 4DCDA 1EATA 1F0TA 1MU6B 7LPRA 3ZZ7A 1VGCC 2BD9A 2Z9LA 1T8LA 4A7IB 1VITF 2VVCA 1C4Y2 1E36B 1G37A 1C2IA 1V2MT 2GKVE 2BD7A 4O3UA 3A88A 5LGOA 4TPYA 3I78A 1ZMJA 2O8MA 1NZQH 2QV1A 3TVJB 1S6HA 1FNIA 1G2MA 3SU0A 2ZU1A 3TH2H 1DSTA 2O9QA 5FXLA 3RM2H 3UPEA 1PYTD 1HAHH 2RDLA 4K8YA 2YNAA 5EQSA 2PUXB 3ZVDA 5GCHG 1LQEA 1LVYA 1DDJA 3QLPH 1J16A 6CHAB 6GCHG 3ZZ9A 2BD5A 6ESTA 1GI7B 1D3QB 2BX3A 7GCHF 3GCHB 1C5SA 1NFWA 1NRQH 2BHGA 1P12E 1XXDA 5DG6A 2A45B 3ZVCA 2ZHFH 3GCTF 2STAE 3A87A 5AHGH 1PQ8A 1P04A 3SUDA 4UFDH 1KIGH 2PWXA 2WINI 2CXVA 5E2OA 3IWMA 4UEHH 4NZQA 4BXWA 1ZPZA 3SV2H 1WU1A 3KGPA 1RJXB 1GJBB 3M5NA 3M5MA 1XVOA 1DICA 1EZUC 8GCHG 2W7SA 4YT6H 2OXSA 3UQOA 1C2EA 1TRNA 1GJCB 4GCHG 2NU1E 1XXFA 5FBEA 5DP8A 3BG8A 1MUEB 1ZJDA 4CREA 1MH0A 1IOEA 2ODPA 1ZTLA 2SNVA 3RXOA 1YPMH 5EPYA 3RM0H 3LJJA 1H9LB 1J8AA 1BTYA 3H7OA 2WPHS 3RC5A 2D8WA 3F9EA 3LPRA 4K5ZA 2ZNKH 1NRSH 1LPZB 3SHCH 1SGCA 1TGBA 2TRMA 2OINA 1FUJA 1O3OA 2VIDA 3P8FA 1O5DH 4XSKU 1CGHA 4WVPE 1J15A 1O35A 3M61U 1GJAB 3SUGA 1BTHH 3MU8A 2SGDE 1C5UA 4ZHAA 1K1IA 1SL3A 3TITA 2VJ1A 4WXVA 1QCPA 1N1LA 1S81A 1O32A 2UWLA 2OCVB 1GHZA 2AGGX 1YYY1 4YOIA 4ZH8A 3ZVAA 1EZXC 4INHA 4GAWA 5TCAA 2BX4A 1O34A 1TWXB 4B75A 3RU4D 1G36A 3P17H 1VZQH 1YLCA 1BTWA 1C5XB 2WYGA 4GPGA 6LPRA 4AN7A 1W10U 4INKA 1QURH 1DT2A 4YO9A 3BIUH 1W13U 3E0NB 2HNTC 3M3SA 3TNTA 1SGYE 1EASA 1HIAB 3ZZDA 3Q00A 3ATMA 1BMMH 1NU7B 3GCHC 4OS2A 3SV7A 1C1MA 1QTFA 3A7XA 3B23B 3DFJA 5E8EH 1OKXA 2R0LA 1N6YA 2WPMS 3E16B 1ZHMA 3RXVA 1AVXA 3RP2A 2EI8A 4CRFA 1L1JA 3GCTG 4GVUA 1PQAA 1DY9A 1HRTH 1FN8A 3KN2A 3GY5A 4I7YH 2YNBA 1BRAA 2Y7XA 2A1DB 2A5IA 3MOCA 4CRGA 1TPAE 1RTFB 1L4DA 2R0KA 2FOFA 2UUFB 1QB9A 5FX6A 5BPEA 8GCHF 2C93B 3ZZ6A 1E34B 1DS2E 1QQUA 1YPLH 3STJA 2G51A 3P8GA 3EGKH 1BB0B 1IQIA 1DX5M 3P70B 5A0BA 3URCA 5JBCS 3S0NA 1LVBA 1NFXA 2CHAC 1NRRH 1GI8B 2OP9A 1ABIH 1DANH 1SSXA 4AFZA 3VPKA 1CT2E 2Z9IA 3HPTB 1AO5A 1SC8U 5F8ZA 2AS9A 3W95A 2V0BA 4JYUH 4IBLH 3OSYA 4Y71A 5GCHF 3KQEA 1O3JA 3RXIA 3SU4A 1TPPA 2B8OH 4FUIA 3ATWA 5EGMA 2BY5X 7GCHG 2BYAX 1FIZA 1KLIH 4ASHA 2WV5A 1S5SA 1GI2A 1O33A 5LPFA 2ZHWH 3A7WA 3SORA 3T2NA 1YCPM 2ZPQA 5F8TA 1ZMLA 5HGGA 1QRXA 2TGTA 1O5BB 3BIVH 1SGFA 1GI4A 2XTTB 4IC5A 1V2PT 1TOMH 1ZRKA 1NFUA 4NFEA 2VH6A 1BMLA 5GXPA 5DP5A 5AFZH 2C8YB 2VU8E 2DE9A 1W3CA 2GD4B 2Z94A 3B9FH 5FPYA 3V13A 4CRDA 1N8OC 1UVTH 1NPMA 3TH3H 1DPOA 1AVGH 4UD9H 1D3DB 3CENA 1C1RA 4UFFH 4BAHB 2GZ8A 3SUEA 4ZUHA 1HAZB 3DFLA 1GBKA 4THNH 5G4BA 5JB8S 1AHTH 2Y82A 1YKTA 1UTKA 3ZYDA 1IQMA 1V2TT 2GT7A 1NY22 5TCCA 1V3XA 5E0GA 4MPVA 1GBCA 3U9AH 4K8BA 1P3EA 1TNHA 3FANA 4YOGA 1HXFH 4X2YA 1SI5H 3F6UH 2W3IA 4BTUB 4TYDA 5C5NA 3QDZB 1HXEH 3JZ1B 4YM9A 4LZ4B 1LDTT 1O2RA 1Y3YA 1V2VT 2Z3CA 2QN5T 2A32A 1HJAB 1JIRA 5C3NA 3FP8E 1BBRK 4Q80A 1SGDE 3CP7A 1CT4E 2ZEBA 3MNXA 1GBHA 2O8LA 2B9LA 4IMZA 4NIXA 3UWJH 4AB8A 2FX6A 1E38B 1G2LA 1PQ5A 1W8BH 1S85A 1O3AA 1C1TA 3RXAA 2HNTE 1GBJA 4AOQA 1ELDE 1Z6JH 2PHBA 1LHDH 3PTNA 1X7AC 1TX7A 1LKAA 4B2CA 4IN2A 4I33A 1TRMA 1SLWB 5F6MA 4VGCC 1YPGH 1LTOA 3TJUA 1XVMA 2GP9B 4O97A 5A8ZA