1GBCA

Alpha-lytic protease with met 190 replaced by ala and gly 216 replaced by ala complex with methoxysuccinyl-ala-ala-pro-leucine boronic acid
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGANVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbcA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbcA01
5TJXA 1TNIA 5LGOA 2BLQA 1OX1A 1ZMJA 5GDSH 1BMNH 2ZGBH 1UTMA 3SHCH 3TLOA 4UFDH 2XWAA 4IN1A 4D7FA 3GYLB 1DWEH 1UK3A 1HAGE 4GVUA 2QYIA 1O34A 1EPTA 1S5SA 1C2FA 2CMYA 1W10U 1KDQA 1BJUA 2GCHF 2Q6DA 3O8DA 1ZJDA 3QLPH 3DD2H 4CREA 4O03A 1C2HA 2EEKA 1NU7B 3S9BA 1V3XA 2AGGX 1FNIA 3PMHB 5LH8A 1FLEE 1N6XA 1GWAA 3BF6H 3EAJA 3W95A 1QL9A 4O3TA 2Y80A 1WCZA 4ISHH 2CN0H 1P2NA 1CGHA 1Z6JH 2Y5GA 3GCTG 2PHBA 4Y0ZE 2ZF0H 1GHAG 2QXJA 3B9FH 4OS1A 5A0AE 1VJ9U 2A2QH 1NFUA 1TBQH 1W3CA 1BTWA 4K1TA 1SGPE 5EODA 2TPIZ 4RKOB 5GWZA 2ZIQH 2AS9A 3B8JA 2ZCLP 1Y5BT 1O2VA 1P3CA 2A5IA 1BTXA 1ESTA 2NU3E 2H5DA 2H9HA 5DP4A 5AFZH 1GBCA 3S69A 2FDAA 4ZKRU 4ABEA 1HAIH 1GJAB 3Q76A 4ZH8A 3RXOA 4ABHA 2ZC9H 2ZGHA 1V2RT 3HKIB 1MQ5A 3U8TH 4WH8A 1SPJA 1H4WA 3R0FA 3L6PA 1BOQA 3P70B 1ELBA 3B23B 3MI4A 3MOCA 4TWYA 1KXDA 5GCHG 5K7RA 2XCFA 4WMEA 2QXHA 4NSVA 1O33A 4AOQA 3D62A 1OKXA 3RMMH 1O3AA 3PMAB 3NKKA 1EZUC 1QFKH 3TK9A 3M7TA 3BN9A 2ODYB 1Z7KA 3M3VA 3ZZ9A 3RP2A 3VPKA 1QY6A 4Y7AA 3DT0H 3SUGA 1K1PA 3VGCC 1GJ9B 3Q3KA 4YM9A 1CHOG 3IG6B 3SNBA 2DE8A 2C8YB 2J38A 2D26C 8LPRA 1NRPH 4MLFB 1HFDA 1LMWB 5C20A 2J2UA 4E7RG 2JKHA 1IQGA 2G51A 1TPPA 4X6PA 1AWHB 2D1JA 1JRTA 1G36A 3KN2A 1F5KU 1GI6A 1UVSH 2BY7X 1A1RA 1D3TB 4AG1A 1SL3A 2PTCE 3T27A 1BRCE 3M5OA 2QC2A 1TPSA 3QK1A 2FIRH 3SV7A 3SJIA 1AUTC 1A3EH 4MNYA 2B8OH 3P8NA 1P04A 2AIPA 3EA7A 2Y7ZA 1IQKA 2BB4A 5GJ4B 2BDAA 1V2QT 5I25A 4UFEH 3LDXH 3UREA 2JH0D 2CJIA 1XVMA 3A86A 1C5NH 1NZQH 3TJVA 1TNKA 1XUGA 3R3GB 3SJOA 1IQEA 2FOHA 2A5KA 1MBQA 1ZHMA 2NU0E 4WWYA 2SGDE 1P11E 1O2KA 3M5MA 4AYVB 3SV6A 1KLJH 1TMUH 1G2MA 1ZPCA 4IN2A 2EI8A 4Z0KA 2G52A 1OS8A 4GCHG 1PQ5A 2PGBB 1O5BB 1ANBA 1Y3XA 1Z8GA 1THPB 4Z6AH 3MO9A 5LPRA 4XSKU 1C2JA 4BANB 3UY9A 2BY6X 1QBNA 5PTPA 1SGRE 1TA2A 2VIQA 1JWTA 2ZQ1A 1FQ3A 1KYNA 1FIWA 7LPRA 5C1XA 3GCTF 2XW9A 3MU1A 2UUKB 4ZXYH 3VB5A 1KTTB 1GJ7B 1GL1A 1DWBH 2VVCA 1HAOH 3GYMA 1SOZA 1NN6A 4Y71A 3TJUA 2O8MA 4TY6A 1WQVH 2P93A 4FUBA 3GDUA 1TWXB 4TWWA 1P05A 2W3KA 1QQUA 4YOGA 3SW2B 2OC8A 2Y5HA 1UCYK 2QY0B 4INKA 1TQ7B 5DP3A 3SI3H 3KQEA 1O2MA 2C4FH 3RXKA 1WTHD 3V13A 1ELGA 2ZDAH 3QGNB 1BCUH 2VU8E 4JYUH 2D2DA 1HPGA 2IPHA 4D8NA 3NUMA 1HIAA 2Z7FE 5DP6A 2PFEA 5AVDA 3GDSA 3BG4B 4DJZB 5AHGH 3U8RH 1MQ6A 2W7SA 2W26A 3ZVAA 4X8TH 1K21H 3H7OA 1MZAA 5EW2H 5GCHF 4CBNA 4SGBE 1GJ8B 2FXRA 3BG4C 1QRXA 3GOVB 1QJ1B 1H9LB 1ELEE 4WY3A 4NA7A 2Q1JA 1OYQA 1P57B 1E35B 1KLIH 5FPYA 3ZZ7A 3IWMA 3SU3A 3U69H 1EAXA 3H7TA 1QA7A 2J4IA 1NTPA 1CT4E 2J92A 3UWJH 3KNXA 1Y3VA 5A0BA 3MFJA 2FTLE 2ZZUH 4K60A 3PTNA 1ZPZA 1CT0E 4AX9H 2HPPH 3L3TA 1Z1IA 2FI5E 3URDA 1GJ4H 1FAKH 2P8OB 3VB4A 1VITH 3M35A 4CHAB 2F9BH 1P06A 3SUEA 2FOMB 3KEEA 1A4WH 1DS2E 1GI8B 3FP8E 4KKDA 2ANMH 1AGJA 1C1UH 1OP2A 1QCPA 5FCKA 2P8OC 1CVWH 2JETB 1RTKA 3TK5A 4CHAC 2XBXA 1JBUH 1BTHH 2K1QA 3P6ZB 1J15A 1GHBG 2A4RA 4JZ1A 4BAHB 1C5XB 1K1OA 1MKXK 4BAOB 1DWDH 2FOCA 3NZIA 2AGIX 3RM2H 2BTCE 4IMZA 3NXPA 1A61H 2GT8A 4M7GA 1SSXA 4JYTA 3LC3A 1RTFB 1V2JT 2BD7A 1GJBB 1BRAA 3GCOA 2VINA 3ZVBA 1OYTH 4RSPA 4MG3A 1GBFA 1C1PA 1IAUA 4FVBA 5T6DA 4AYYB 1RD3B 3U9AH 2EC9H 2GZ9A 1ZPBA 1TGBA 1FPHH 4NWKA 1YCPK 4GLYA 1YC0A 2SFAA 1D6RA 2PR3A 3EGKH 4DW2U 4I8LA 1W11U 1TB6H 2SGQE 1BBRK 4K69A 1O3MA 3MU5A 2VIDA 4AG2A 4CRGA 3M5NA 3RXQA 2A31A 4ZXXH 1TOCB 2Z3EA 2HNTE 5K0HA 1FY8E 1PPGE 3M5LA 1OWIA 3BSQA 3TGKE 5FAHA 1C2GA 1ZTKA 5IDKA 5JBCS 1WSSH 3A7ZA 1FV9A 2FESH 2ILNA 1Y8TA 1OP0A 2EI6A 3A8AA 1L2EA 2BLVA 4OS2A 2I6QA 3LPRA 1O2IA 1GI2A 1HNEE 4X2XA 3DHKH 1BHXF 1MTWA 3GCHB 4AZ2B 2Q6FA 2UUJB 3LGTA 1AFQB 1NRSH 5JYIA 3MTYA 2VGCC 3QDZB 1O38A 4GHQA 4ISNA 4YLUA 2ZTZA 1IQFA 1DSUA 2ZFPH 4FUIA 1O2ZA 1S0QA 3A85A 1SOTA 3O8RA 1GI7B 2ZFTA 4FUCA 1CO7E 2Y82A 4IS5A 1AE5A 4ABGA 4U30A 2GP9B 5E2OA 1SVPA 2FLBH 3AAVA 2SNWA 1VCQA 2ESTE 2QXIA 2XNIA 3M36A 2H9TH 1C1WH 4X0WU 3S7HB 4Y79A 5C67A 1UCYH 3UUZA 4B2CA 4BOHA 5EU8A 1NRRH 1TIOA 3S9CA 3ATLA 3ZZBA 1MTUA 3OY5U 2BQ6B 3K65B 1P2MA 1CA8B 1UO6A 3P17H 3RXDA 1EP6A 1G37A 1IQJA 3A80A 2BMGB 1DY9A 2VWMA 4NZLA 2P59A 4DOQA 2WPMS 2AMQA 3JZ1B 2FOBA 5LPEA 4O97A 3A81A 4Y8ZA 2FMJA 1AKSB 1EOLA 4YOIA 1YPHE 4PROA 1DT2A 4DG4A 2CHAC 3SBKA 2AIQA 1FIZA 1V6DA 1S83A 2A0QB 2O8UA 3MH7A 4A1VA 1DUAA 1DM4B 3PTBA 2BYAX 2GTBA 3NPSA 3OYPA 3S7KB 2AYWA 2F9OA 1LO6A 3LJJA 4CR5A 1OOKB 1WUNH 2HNTF 1GDNA 4E06H 3DA9B 1DX5M 1DOJA 4AFUA 3TGIE 2RDLA 5GIBA 5BPEA 5C1YA 1KSNA 1T31A 3ZZ5A 3ZV8A 2PKAB 1VITG 4ZROA 1OP8A 2PV9B 4GUXA 1GHBF 3FFGA 1XUJA 4INLA 1O2TA 2DE9A 1DSTA 3A88A 5E8EH 1EUFA 1C1MA 1UTNA 3BTDE 2P3TB 1T8MA 2BVRH 1ANCA 4DT7B 5DPAA 1ZGVA 1SLUB 2O9QA 1T7CA 1YKTA 4Q80A 2GMTB 2KAIA 2F3CE 3P8GA 2ZQ2A 1TRYA 1XUIA 4I8KA 1Z8JB 1UHBB 3RXMA 4UDWH 3T5FH 2OC7A 3A7YA 3V7TA 5EQSA 2ZHEH 4FUDA 1GBMA 3WY8A 3Q3XA 2Z6BD 4I8GA 4ABDA 1TFXA 3D65E 4NWLA 2HALA 3UFAA 1MKXH 5HM2A 4MQAA 2FM2A 4R0IA 1GBJA 3P8FA 1YPEH 3SU0A 1NO9H 1C2KA 1LPGB 2VJ1A 2PKSB 1INCA 1GDUA 1TMBH 3BV9B 3LJOA 1FN8A 5L2ZH 4IGDA 2RCEA 1JOUB 2AMPA 4FU9A 4K8YA 4NZQA 1C1VH 1O5AB 4MPXA 1GMHF 1NFWA 1QURH 3HGPA 1P8VC 1QL8A 3SI4H 1ZSJA 4MPVA 1V2MT 3GY3A 3BTGE 4BTTB 4UFGH 4NIVA 1V2LT 2BVSH 2VB0A 4HFPB 1YCPH 4I8HA 5G4BA 2TGDA 1F5RA 2WINI 1C1SA 4LK4A 3VXEH 1MKWK 1O3CA 1GG6B 1KIGH 4X1QU 3ZYEA 1YPGH 1THRH 1ZMLA 1K1MA 5JB9S 1F0SA 1GBIA 2G4TA 1BBRH 2ZHFH 2FOAA 4MPWA 3KHVA 4ESTE 1SB1H 1HUTH 1UVOA 3E3TA 1ZGIA 3GDVA 1LKAA 3ZZ4A 4J2YB 2PGQB 1TNGA 1P01A 4BXSA 1D6WA 1UVPA 2F91A 1GG6C 3STIA 1HAVB 1SHHB 1GPZA 2Z9JA 1SGQE 1ELTA 2C93B 2ZDVH 2ZU4A 2CGAA 4JMYA 1O2OA 2ZHDA 1EJAA 4E7NA 2F9UA 2A32A 1MTSA 1O3GA 1SC8U 1P2KA 2OBOA 2UUYA 4D9QA 3LH3A 2C3SA 4CRDA 3EA8A 1Y5UT 1TONA 1GVZA 2Z9IA 1P2JA 1CGIE 1D3QB 1RIWB 7ESTE 6ESTA 3RU4D 1DDJA 3I78A 2ZFRH 3PMBB 3RXVA 2VIOA 9LPRA 4OS7A 7GCHG 1WQSA 4Q2KA 1FONA 1ELDE 1G3EA 3PROA 4X2YA 1RIWC 1AHTH 1VZQH 4YTAA 2ZPQA 1Q3XA 2Z9LA 4DIHH 3MU0A 4ZHMU 2CXVA 2VVUA 1QL7A 1WOFA 4H6TA 1P02A 3CENA 3M7QA 2GGVB 5DP8A 1LPZB 1IQHA 2STAE 3O8BA 1C5WB 1FJSA 1ANEA 1O39A 1YLCA 4ZKOU 3RU4T 3TNTA 5JBAS 2OINA 4JK6A 1AZZA 3T62A 3ZZ8A 3V12A 1IQNA 4X6OA 4ZAEA 4FUJA 1HXEH 2PTNA 3RMLH 1WYKA 1GMDG 1K1JA 1N1LA 3JZ2B 1G3BA 2VWOA 3PWCA 4JYVH 1Z8IB 4JZIA 1N8OB 1A0LA 1UVUH 1GGDB 1QJ7B 3VB3A 1VITF 1LQEA 4ZKSU 1FI8A 1SQTA 3P92A 1A46H 4AB9A 3KGPA 1NC6A 3F68H 4ABFA 1O31A 2BDYA 2BD3A 5A0CA 2OP9A 1YLDA 2FOGA 4WXIA 1AD8H 2A5AA 3K9XB 2GDDA 3UOPA 2ZTXA 1NFXA 3RC6A 4B76A 1HGTH 3GICB 1NFYA 2ZFQH 2XWBI 2B5TB 4Y8XA 1OWEA 4Q7ZA 1GDQA 4NA9H 1HB0B 2A4QA 3ESTA 3BTHE 2ANWA 1HRTH 3HPTB 4AFZA 1NROH 1DANH 3PV4A 2V0BA 3LGWA 2P3UB 3OTJE 5EXLA 4K1EA 5HXFA 3A8BA 4CRFA 1PQAA 5BRRE 2ZCHP 4XDEA 2H2ZA 4A1XA 2BY9X 4B71A 3MNBA 3U98H 4IBLH 1XVOA 1PPHE 1GBEA 4YZUA 3IITA 8ESTE 2Y7XA 1TNHA 1SLVB 3T25A 5E2PA 3DFLA 4NFFA 2OC1A 1A3BH 1A2CH 1L1GA 4RKJB 3RXCA 3UOUA 1E36B 1AMHA 1BB0B 1GI1A 3TPIZ 2BD9A 2B0FA 2XTTB 2IOTA 1VJAU 1O32A 3M3TA 5EW1H 1LHCH 4XBDA 4MNVA 5EQRA 4OGXA 4Y7BA 3URCA 2TRMA 4ABAA 1TMTH 3K6YA 3FANA 2FOEA 1V2OT 1B0FA 2QCYA 3Q3YA 1CGJE 2F9NA 2VH0A 1CT2E 1UTOA 2YNAA 4BTUB 1OXGA 3E6PH 1K1IA 1LVBA 2BXTH 1MKWH 3ATMA 3E8LA 1ORFA 1O0DH 2ZEBA 5E0GA 1GVKB 1GHVH 4IW4E 2BDBA 1GHAF 1TGNA 1AVGH 3BEIB 5EXNA 3SO3A 5TCAA 5F03A 4MPUA 2GV6A 5FPSA 2BD8A 2SGEE 2OUAA 1AN1E 1TX6A 5E0HA 1EQ9A 3SU1A 2BOHB 3L33A 1PPCE 7GCHF 2V3HH 1CU1A 1DWCH 2FODA 2PW8H 1P2IA 2TGPZ 3ZVEA 1BT7A 1C2MA 2P95A 4Y0YE 1FMGA 4X6MA 3RXFA 1OWHA 5LPFA 4MTBA 1BIOA 1GBBA 1ZSLA 3ENSB 3BEUA 4DGJA 1K22H 3AVZA 1WBGB 1EZQA 2A4GA 2BDIA 5GXPA 1TA6A 1HJAB 2A2XH 1DUEA 3EYDA 3RXBA 3UIRA 3UNSA 2GZ7A 1K28D 4KTCA 1UTJA 8GCHG 4FVDA 1MH0A 2WPLS 3TGJE 5T6GA 1W0YH 5FCRA 1UTLM 2J9NA 2BDCA 3RXSA 1HJAC 1XXFA 1H9IE 5EGMA 1ACBE 3PLKA 1HLTH 3G01A 1V2KT 5CE1A 1G9IE 1QGFA 4I8JA 2OD3B 3QN7A 1GMDF 1W13U 2FOFA 4THNH 5ESTE 2A7CA 3E91A 1CHOF 2B9LA 2QIQA 4HI3A 1YPKH 2G00A 3AAUA 2XBVA 5C2ZA 2ANYA 2TBSA 3VB7A 1O3HA 5DGJA 1NT1A 1L0ZA 1NRNH 1ABJH 2C8WB 2LNCA 1P2OA 2Z94A 1C5TA 4ZUHA 1NU9A 1WU1A 4MVNA 2VNTA 2A1DB 4CR9A 1MBMA 2XYAA 1H8DH 1NPMA 3ITIA 1C9PA 6GCHG 2BDHA 1TQ0B 2BX4A 4Q7XA 1S81A 3A7TA 1ZMNA 4KTUA 3E16B 1LHFH 1YP9A 5AF9H 4YT6H 3MO6A 4BAQB 2XC0A 3M37A 1YPMH 1BMMH 4WJG2 1CHGA 4I7YH 5DJ7A 2OCVB 1BTZA 3HK3B 4OS5A 1P10A 1RRKA 1MU8B 3VFEA 3MNXA 2Y81A 3LKWA 3T28A 1AUJA 4TPIZ 2JETC 2TIOA 1XKAC 1C2DA 4XBBA 5CMXH 1O5CB 4MNWA 1SGIB 1O3PB 1TYNA 3AW0A 1UTQA 1MCVA 3SUDA 3BIVH 3BTQE 4K8BA 2C8ZB 2SGPE 4DIIH 1QIXB 2BLWA 3MH5A 1SGEE 3QWCH 1O35A 4MNXA 2J34A 2ZP0H 1UMAH 1C1NA 1XUFA 1FDPA 1M9UA 1KXEA 3UQVA 1QR3E 4GCHF 5FPTA 3UQOA 1C1OA 2Q6GA 4JZFH 5DO4H 3RXEA 1G3DA 2XBYA 4NCYA 1C4V2 1H8IH 1CA0B 4B74A 1AVWA 3GY6A 2WPHS 3LGIA 2W3IA 1DFPA 3GISB 1F0TA 1EAUA 2BD4A 1W0ZU 3A87A 3CS7A 5FHTA 1JRSA 1IHTH 1S6FA 3UTUH 2ZG0H 3P95A 1V2VT 2LPRA 3SNEA 4IC5A 1XM1A 2OC0A 4Y11E 2M5TA 1GVLA 1OWJA 4H42U 3NCLA 5A8ZA 1DVAH 1DXPA 3NK8A 1GBHA 1PFXC 3FP7E 1GJCB 5J4QA 1LDTT 1EB2A 3OY6U 1O36A 1O5DH 5CHAB 4D7GA 1MAXA 2GVFA 3F6UH 1THSH 1BITA 1PQ7A 1TOMH 5C5NA 1O2RA 5EPYA 1LHEH 1O3FA 3UNRA 3MNCA 4WF8A 4K5ZA 5IYTA 5DP5A 4TY7A 3VXFH 1GI3A 4IC6A 3PM3A 1BHXB 4U01A 1ELCA 2QF0A 1O3JA 2UWLA 3CP7A 3M7UA 4A1TA 2ZPRA 3F9EA 3GCHC 1S84A 4CBOA 1Z1JA 3LGYA 1ZTJA 3A8DA 2ALVA 5EQQA 1AFQC 1PYTD 4ZMAH 4UEHH 1Q2WA 1C9TA 1ELFA 2GCHG 1BA8B 1C1QA 1L1NA 1HAYB 1QBOA 1ZRBA 1TPOA 1FY3A 2QAAA 1O2LA 4DCDA 3UNQA 3SV9A 4NFEA 3V3MA 1FY1A 1W7XH 1G2LA 3T29A 1F92A 1SGCA 1LTOA 2C90B 2SNVA 3QTOH 4D76A 4I32A 1WV7H 2Z9KA 1A5IA 1QTFA 2HLCA 4OS4A 3RLWH 1W8BH 2ZPSA 1A5HA 1XKBC 5JBTA 3TK6A 4ZKNU 5A09A 3S0NA 2O8TA 4NSYA 1PYTC 1GMCG 2ZDKA 3UR6A 3SOSA 1ARBA 1ZYOA 1FN6A 1RXPA 2SGAA 3E90B 2THFB 3PO1B 1OSSA 4ZHAA 3MU4A 2G81E 4JCNA 1EB1H 1YBWA 1TRMA 1Y3UA 3TJNA 3ZV9A 4HZHA 4INHA 3LOXA 1ESBA 1O2UA 1HJ9A 2STBE 6GCHF 1D4PB 1P12E 1SLXB 1J9CH 4H4FA 3ELAH 1ZJKA 4UFFH 3SJKA 3E0PB 1TLDA 1BQYA 3RXGA 2ULLA 4BXWA 1V2TT 4AGKA 4XFQA 2OLGA 1TPAE 5EXMA 1NRQH 5F8ZA 1DE7H 2Y6TA 2WUCA 2ZECA 1T4VH 1VCWA 2KAIB 1AKSA 2ODQA 1BJVA 1SG8B 2XRCA 3TU7H 3SUFA 8KME2 5DP9A 4X1PU 4TPYA 1AE8H 1J17T 2ZHWH 1O3IA 4LOYH 1ZOMA 1HDTH 1MD7A 1SQOA 2BY8X 2HPQH 2GD4B 3D49H 1FUJA 1LQDB 5C5OA 1PPZA 3VB6A 1J8AA 2WYGA 3F9GA 5E0JA 1EX3A 3TH2H 2ASUB 1HAHH 3MO3A 2AERH 2VIVA 1EKBB 1ETSH 1Q31A 1TGSZ 3F9FA 4X8SH 2J95A 4Y76A 3PB1E 4ZHLU 1E34B 3EE0B 1NESE 2GMTC 1RGQA 3ODFA 3DUXH 1EAIA 1D3PB 2PKAA 3U8OH 1ETTH 4AFSA 3RU4E 5SGAE 3LC5A 3NWUA 3BG8A 3T26A 3BTME 3A8CA 5A8XA 1SGDE 1J16A 4X2VA 1C5OH 3RXLA 1V2ST 4KP0A 3V0XA 2ZTYA 1IHSH 1QHRB 4JZEH 5AFYH 1IQLA 4AFQA 1O2QA 2PKSC 2IJOB 2BQWB 3S9AA 4AORA 3I29A 3MH6A 1EPTB 2W7UA 3FP6E 4NIYA 1UHBA 5JPMH 6LPRA 1MZDA 1KDQB 1Y5AT 2WYJA 4WH6A 2BM2A 1C5MD 1EASA 3EA9A 4B2BA 2WUBA 4ABBA 3QTVH 3RC4A 3RXIA 1A7SA 1ZLRA 4GPGA 1EPTC 2QF3A 3ZVFA 3MWIU 4UE7H 1F0UA 1CSOE 2NU2E 1GHYH 1W2KH 2F9PA 2FS9A 1C2EA 2O8WA 1O2HA 1BTYA 2WPJS 2J94A 1SGNE 3LGVA 2G5NA 3OX7U 3FAOA 5I46H 1MUEB 4GAWA 2RA0A 3ZVGA 5T6FA 1TE0A 3SGBE 1YPHC 1ZHPA 4KTSA 1GI9B 1O30A 1GBAA 5FXLA 1YYY1 2B7DH 3KQDA 4XOJA 1C5SA 2BX3A 4GHTA 1QQ4A 2FLRH 1FAXA 2A45B 1O5FH 4I31A 1BRBE 1P2QA 1AFEH 4DY7B 3PLBA 1SBWA 1HAVA 3TH3H 1LPKB 3KF2A 1UVTH 4FU7A 4HTCH 2ANKH 1QJ6B 2ZDNA 1EATA 3SV8A 1P03A 3LGUA 3GY4A 1CQQA 4Q7YA 2A7JA 4B73A 1GMCF 1HAPH 1JIMA 2BZAA 3SNAA 2OBQA 2OQUA 2XC4A 3F1SB 1O3NA 3RC5A 3SU2A 1TGCA 2AFQB 1V2UT 1XX9A 1CBWB 5EPNA 4IMQA 3MNSA 4X1SU 3BTEE 3EDXB 4JK5A 1ESAA 1RTLA 1DITH 1O3OA 1VR1H 2ALPA 2FPZA 3RMNH 5FBEA 1CBWC 1YCPM 2BVXH 1GBDA 3W94A 3I77A 2ZI2H 5JDUB 1TX7A 3PWBA 3ZZ6A 1UJ1A 2XXLA 3ODDA 3VGCB 2O8LA 2BD2A 2GKVE 3RM0H 2NU4E 2VVVA 2PUQH 4A6LA 1PJPA 1C2IA 1G3CA 1N8OC 1ZZZA 1GGDC 3ZZAA 4ABIA 1KXBA 2UWPA 4K2YA 2HRVA 1P9UA 3RXPA 3LH1A 1TGTA 3DFJA 1XXDA 3M3SA 4ASHA 1AU8A 1UCYE 2FX6A 6CHAB 1LHDH 3RUOA 1V2NT 1YGCH 4A7IB 2R9PA 1SR5C 1C5LH 1QA0A 1T8NA 2CF9H 4A92A 2ZFFH 2OXSA 5H4IB 3GY2A 3GCNA 4CH8B 4YT7H 1A0JA 1AI8H 4KGAA 6CHAC 2EA3A 3M61U 4B75A 1UK2A 5DG6A 4NA8A 4FU8A 5EOKA 3GY8A 1SI5H 3AW1A 2GCTB 2W5EA 1UK4A 3F9HA 4AGJA 1LKBA 1UTPA 1BRUP 3D23A 3ATWA 3ZYDA 1K2I1 1C5UA 5J4SA 3HGNA 5HGGA 2GCTC 2PUXB 2R2MB 2ODPA 5TCCA 1SHYA 1BMLA 1TBZH 1O37A 2BOKA 2JH6D 4CRBA 2AGEX 1C5YB 4U2WA 1O2PA 1W14U 1GI0A 3RMOH 1DXWA 2R3YA 1NS3A 1L4ZA 1AB9B 2SGFE 4VGCB 2GV7A 1Z6EA 1E38B 1ZRKA 2PLXA 3MHWU 3N7OA 3GY7A 3HK6B 1OPHB 1W7GH 4BNRA 2ZU2A 1QRWA 3K6ZA 4YLQH 1Z8RA 1Z71A 2R3UA 4YESB 2H5CA 7KMEH 1AB9C 4VGCC 4F4OC 4FUGA 2ZNKH 1HXFH 1ANDA 1GL0E 2H1UA 2R0LA 3RDZA 2G55A 5HMAA 5FX5A 1MMJN 2RG3A 2Z9GA 2PSYA 1XUHA 3BEFB 1F0RA 2Z3CA 1F5LA 1KTSB 3KIDU 1HIAB 2FZZA 1GI5A 4O3UA 1VGCB 1DLKB 2YOLA 1HBTH 2V3OH 1S82A 2QXGA 4X1NU 5DK1A 3QX5H 4FUHA 5HM9A 1UTKA 3TIUA 1SMFE 3RXRA 4X8VH 1VGCC 2FWWA 2FYQA 1DY8A 1DLEA 1LVOA 1C4U2 5F8XA 4A5TS 2FX4A 4AB8A 2FYRA 1QB1A 3A89A 1TABE 5GPIB 1AO5A 4NIXA 1KXAA 1EJMA 1QB6A 3SQEE 3MMGA 2GT7A 2VIWA 1PQ8A 1BBRE 2TGTA 4OS6A 1ID5H 1XUKA 4WMFA 1HCGA 5F6MA 2ZGXH 3MU8A 3VEQB 3ZVCA 3FZDA 2VWLA 1Y59T 2TGAA 1SQAA 1T32A 2A4OA 1B5GH 3PMJA 2F83A 5C1UA 2OTVA 3E1XB 1SGFG 1O2NA 3C27B 2FTMA 2FP7B 1AIXH 1C5QA 2GZ8A 2NWNA 5ESBA 5JBBS 1GHZA 1C5RA 2AH4X 2G4UA 4J1YA 1HJ8A 3TVJB 3SGAE 3RXUA 3BTWE 4X6NA 4B1TA 1SGYE 1C1TA 1NM6A 4XBCA 1EOJA 1GHXH 3LONA 2BXUH 2D8WA 2EI7A 3ZZ3A 1BZXE 4ISOA 5F8TA 3P8OA 1Y3WA 3MYWA 2HOBA 3T2NA 1F2SE 1AQ7A 1AY6H 1O2XA 3TITA 4K3JA 2AMDA 3SQHE 1RFNA 2C8XB 1YPLH 5L30H 1QBVH 5DKMA 1CE5A 1D3DB 1P9SA 2V35A 4LZ4B 3FVFB 1YPJH 2ZWLH 3BTFE 2G8TA 1AVXA 3RXTA 3RXAA 3SU5A 2QV1A 4UONA 2ZGCA 1PPBH 2UUFB 1O2JA 2ZA5A 2CF8H 4NGAH 1BTUA 1SGTA 4CRAA 2FO9A 3KQBA 1ZTLA 2H6MA 1AZ8A 1MTVA 4U32A 2V6NA 1JMOH 4ABJA 2VH6A 2FEQH 3ZVDA 2QGRA 4D9RA 5L2YH 4I33A 1C5ZB 1D9IA 2G5VA 1TNLA 1MU6B 3MH4A 1OWDA 1ELAA 2R2WU 1WTGH 4B2AA 3UPEA 2CV3A 2XBWA 2P94A 1E0FD 1YF4A 3U1IB 1QB9A 1ZSKA 1X7AC 2BZ6H 1O3EA 1Y3YA 2GX4A 4NG9H 1V2PT 1RJXB 2JH5D 2VWNA 3SV2H 1J14A 1O3BA 1O2YA 3SJ9A 2BLOA 4TYDA 1O5GH 4MDSA 1VCPA 2R0KA 3A84A 1CA0C 1FXYA 9ESTA 2BQ7B 1TNJA 1DPOA 1C1RA 2ZU1A 3STJA 4DURA 1V2WT 3FZZA 1P3EA 3SU6A 1TALA 5FX6A 1QNJA 2WV4A 1OWKA 1NY22 1QRZA 1GMHG 1G30B 1EJNA 4X8UH 5HYOA 4F49A 4WVPE 1MTNB 4H6SB 5C3NA 1K1LA 2PWXA 1MCTA 1XMNB 5ABWA 5A8YA 1P0SH 1GBKA 4SGAE 1O2WA 3GY5A 5DP7A 4DVAU 1B0EA 1TX8A 4Y10E 4FUFA 4YO9A 4X2WA 1KY9A 5CHAC 2ZO3H 3LU9B 1MTNC 3UR9A 3OU0A 2VGCB 3KL6A 3SNDA 1H1BA 2ZFSA 2H9EH 2VIPA 2QN5T 1C2LA 4Y6DA 1U6QA 1F7ZA 3SHAH 1KXFA 1ABIH 2ZGJA 1O5EH 2FS8A 3U1JB 4K1SA 4BAMB 1LVYA 1TRNA 2WPIS 2XC5A 3PLPA 8GCHF 5ETXA 1HAZB 2A7HA 4CH2B 1GBLA 4X1RU 1L4DA 1IQIA 3LIWA 2I6SA 1O2SA 2HWLB 1ETRH 1GHWH 2FI4E 2NU1E 5B6OA 1GBTA 3SU4A 4UD9H 1DICA 3QO6A 1MAYA 1EP5A 3QGJA 2P16A 1K9OE 3HKJB 4WMDA 4LZ1H 3K2UA 1LVMA 4WXVA 2PSXA 1YM0A 3KCGH 4O9VA 4FXGH 4RN6A 3BTKE 3ATKA 3QZRA 3SN8A 3A82A 2ZDLA 4FUEA 1SFQB 4HGCA 2FI3E 3OSYA 5L6NH 2ZKSA 3QZQA 3C1KA 3UWIA 1ZR0A 2CHAB 1PPEE 4JZDH 4ISLA 2HVXA 2BY5X 1MD8A 1BDAA 2OQ5A 3PO1C 1P09A 1A5GH 5EG4A 1LHGH 3RXJA 1BUIA 1T8LA 3TJOA 3O8CA 3TH4H 2QA9E 2Y5FA 3PYHA 1SGFA 1ZHRA 3SNCA 2GDEH 3A83A 4Y8YA 3TNSA 3A7XA 5FBIA 2BHGA 3A7VA 4R8TB 1IQMA 1FZZA 1ARCA 2WPKS 1C5PA 3LT3A 1RS0A 1S0RA 4QT8C 2YNBA 2BDGA 2BD5A 3Q77A 1O3DA 3BTTE 4KELA 3SZNA 1FPCH 2DUCA 1HAXB 1K1NA 2ZCKP 3AASA 4ISIH 1IOEA 1EZSC 2HNTC 1BMAA 1LCYA 1T4UH 3HATH 1GI4A 1PPFE 4XE4A 3ZZDA 1B7XB 1FY5A 1JIRA 1O3LA 3SGQE 2P3FH 2AEIH 1H9HE 3KQCA 1EAWA 2ZHQH 2ZU5A 3EQ0H 4NIWA 1GJDB 1O3KA 1GJ5H 2ZU3A 1GCDA 3ZZCA 3Q00A 1W12U 2RA3A 3ATIA 1EZXC 1KXCA 1EXFA 3E0NB 3H5CB 3RXHA 2WV5A 3SORA 1SFIA 4OGYA 1AWFH 1TAWA 4LXBH 1G32B 1T8OA 5T3HA 4E05H 4GSOA 1HYLA 1FY4A 2HGTH 1SLWB 1GCTB 4CRCA 5JB8S 1C5VA 1TBRH 1ELVA 3BIUH 1A0HB 3RLYH 3SJ8A 2ZDMA 1JXPA 2F9VA 1HV7A 1WAYB 1E37B 1GCTC 1N6YA 4BTIB 4YOJA 1S85A 4BAKB 2UWOA 4AN7A 2Z3DA 3CS0A 1GJ6A 1C4Y2 1BTPA 5A2MH 1L1JA 3QUMP 1O2GH 1S6HA 2IN2A 2XCNA 3A7WA 1KLTA
chains in the Genus database with same CATH superfamily
5TJXA 1TNIA 5LGOA 2BLQA 1OX1A 2XOKD 1ZMJA 5GDSH 2J98B 1BMNH 2ZGBH 1UTMA 3SHCH 3TLOA 4UFDH 2XWAA 4IN1A 4D7FA 3GYLB 1DWEH 1UK3A 1HAGE 4GVUA 2QYIA 1O34A 1EPTA 1S5SA 1C2FA 2CMYA 1W10U 1KDQA 1BJUA 2GCHF 2KCPA 2PP6A 2Q6DA 3O8DA 1ZJDA 3QLPH 3DD2H 4CREA 4O03A 1C2HA 2EEKA 1NU7B 3S9BA 1V3XA 2AGGX 1FNIA 3PMHB 5LH8A 1FLEE 1N6XA 1GWAA 3BF6H 3EAJA 3W95A 1QL9A 4O3TA 2Y80A 1WCZA 4ISHH 2CN0H 1P2NA 1CGHA 3PRBA 1Z6JH 2Y5GA 3GCTG 2PHBA 4Y0ZE 2ZF0H 1GHAG 2QXJA 3B9FH 4OS1A 5A0AE 1VJ9U 2A2QH 1NFUA 1TBQH 1W3CA 1BTWA 4K1TA 1SGPE 5EODA 2TPIZ 4RKOB 5GWZA 2ZIQH 2AS9A 3B8JA 2ZCLP 1Y5BT 1O2VA 3PV5A 1P3CA 2A5IA 1BTXA 1ESTA 2NU3E 2H5DA 2H9HA 5DP4A 5AFZH 1GBCA 3S69A 2FDAA 4ZKRU 4ABEA 1HAIH 1GJAB 3Q76A 4ZH8A 3RXOA 4ABHA 2ZC9H 2ZGHA 1V2RT 3HKIB 1MQ5A 3U8TH 4WH8A 1SPJA 1H4WA 3R0FA 3L6PA 1BOQA 3P70B 1ELBA 3B23B 3MI4A 3MOCA 4TWYA 1KXDA 5GCHG 5K7RA 2XCFA 4WMEA 2QXHA 4NSVA 1O33A 4AOQA 3D62A 1OKXA 3RMMH 1O3AA 3PMAB 3NKKA 1EZUC 1QFKH 3TK9A 3M7TA 3BN9A 2ODYB 1Z7KA 3M3VA 3ZZ9A 3RP2A 3VPKA 1QY6A 4Y7AA 3DT0H 3SUGA 1K1PA 3VGCC 1GJ9B 1VKYA 3Q3KA 4YM9A 1CHOG 3IG6B 3SNBA 2DE8A 2C8YB 2J38A 2D26C 8LPRA 1NRPH 4MLFB 1HFDA 1LMWB 5C20A 2J2UA 4E7RG 2JKHA 2CK3D 1IQGA 2G51A 1TPPA 4X6PA 1AWHB 2IJD1 2D1JA 1JRTA 3DCLA 1G36A 3KN2A 1F5KU 1GI6A 1UVSH 2BY7X 3F2GA 1A1RA 1D3TB 4AG1A 1SL3A 2PTCE 3T27A 1BRCE 3M5OA 2QC2A 1TPSA 3QK1A 2FIRH 3SV7A 3SJIA 1AUTC 1A3EH 4MNYA 2B8OH 3P8NA 1P04A 2AIPA 4Q63A 3EA7A 2Y7ZA 1IQKA 2BB4A 5GJ4B 2BDAA 1V2QT 5I25A 4UFEH 1WXRA 3LDXH 3UREA 2JH0D 2CJIA 1XVMA 3A86A 1C5NH 1NZQH 3TJVA 1TNKA 1XUGA 3R3GB 3SJOA 1IQEA 2FOHA 2A5KA 1MBQA 1ZHMA 2NU0E 4WWYA 2SGDE 1P11E 1KMHB 1O2KA 3M5MA 4AYVB 3SV6A 1KLJH 1TMUH 1G2MA 1ZPCA 4IN2A 2EI8A 4Z0KA 2G52A 1OS8A 4GCHG 1PQ5A 2PGBB 2HVYB 1O5BB 1ANBA 1Y3XA 3KYGA 1Z8GA 1THPB 4Z6AH 3MO9A 3CNRA 5LPRA 4XSKU 1C2JA 4BANB 3UY9A 2BY6X 1QBNA 5PTPA 1SGRE 1TA2A 2L74A 2VIQA 1JWTA 4RT0A 5HKKD 2ZQ1A 1FQ3A 1KYNA 1FIWA 7LPRA 3GS9A 3GCTF 5C1XA 2XW9A 3MU1A 2UUKB 4ZXYH 3VB5A 1KTTB 1GJ7B 1GL1A 1DWBH 2VVCA 1HAOH 3GYMA 3SYJA 1SOZA 1NN6A 4Y71A 3TJUA 2O8MA 4YXWD 4TY6A 1WQVH 2P93A 4FUBA 3GDUA 1TWXB 4TWWA 1P05A 2W3KA 1QQUA 4YOGA 3SW2B 2OC8A 2Y5HA 1EFRD 1UCYK 2QY0B 4INKA 1TQ7B 5DP3A 3SI3H 3KQEA 1O2MA 2C4FH 3RXKA 4AC9A 1WTHD 3V13A 1ELGA 2WSSD 2ZDAH 3QGNB 1BCUH 2VU8E 4JYUH 3WWBA 2D2DA 1HPGA 2IPHA 3EE7A 3NUMA 4D8NA 1HIAA 2Z7FE 5DP6A 2PFEA 1NBMD 5AVDA 3GDSA 3BG4B 4DJZB 5AHGH 3U8RH 1MQ6A 5B6LA 2W7SA 2W26A 3ZVAA 2KX4A 4X8TH 1K21H 3H7OA 1MZAA 5EW2H 5GCHF 4CBNA 4SGBE 1GJ8B 2FXRA 3BG4C 1QRXA 3GOVB 1QJ1B 3N7EA 1H9LB 1ELEE 4WY3A 4NA7A 2Q1JA 1OYQA 1P57B 1E35B 1KLIH 5FPYA 3ZZ7A 3IWMA 3SU3A 3U69H 1EAXA 3H7TA 1QA7A 2J4IA 1NTPA 1CT4E 2J92A 3UWJH 3KNXA 1Y3VA 3N99A 3MFJA 5A0BA 2FTLE 2ZZUH 4K60A 3PTNA 1ZPZA 1CT0E 4AX9H 2HPPH 3L3TA 1Z1IA 2FI5E 3URDA 1GJ4H 1FAKH 2P8OB 3VB4A 1VITH 3M35A 4CHAB 3UB0A 2F9BH 1P06A 3SUEA 2FOMB 3KEEA 1A4WH 1DS2E 1GI8B 3FP8E 4KKDA 2ANMH 1AGJA 1C1UH 1OP2A 5CDFE 1QCPA 5FCKA 2P8OC 1CVWH 2JETB 1RTKA 3TK5A 4CHAC 2XBXA 1JBUH 1BTHH 2K1QA 3P6ZB 3PV2A 1J15A 1GHBG 2A4RA 4JZ1A 4BAHB 1C5XB 1K1OA 1MKXK 4BAOB 1DWDH 2FOCA 3NZIA 2AGIX 3RM2H 2BTCE 4IMZA 3DSPA 3NXPA 1A61H 2GT8A 4M7GA 1SSXA 4JYTA 3LC3A 1RTFB 1V2JT 2BD7A 2L6OA 1GJBB 1BRAA 3GCOA 2VINA 4ZCNA 3ZVBA 1OYTH 4RSPA 4MG3A 1GBFA 1C1PA 1IAUA 4FVBA 5T6DA 4AYYB 2HLDD 1RD3B 3U9AH 2EC9H 2GZ9A 1ZPBA 1TGBA 1FPHH 4NWKA 1YCPK 4GLYA 1YC0A 3N7DA 2SFAA 1D6RA 2PR3A 3EGKH 4DW2U 4I8LA 1W11U 1TB6H 2SGQE 1BBRK 4K69A 1O3MA 3MU5A 2VIDA 4AG2A 4CRGA 3M5NA 3RXQA 4ASUD 2A31A 4ZXXH 1TOCB 2Z3EA 2HNTE 5K0HA 1FY8E 1PPGE 3M5LA 1OWIA 3BSQA 3TGKE 5FAHA 1C2GA 1ZTKA 5IDKA 5JBCS 1WSSH 3A7ZA 1FV9A 2AHME 2FESH 2ILNA 1Y8TA 1OP0A 2EI6A 3A8AA 1L2EA 2BLVA 4OS2A 2I6QA 3LPRA 1O2IA 1GI2A 1HNEE 4X2XA 3DHKH 1BHXF 1MTWA 3GCHB 4AZ2B 2Q6FA 2UUJB 3LGTA 1AFQB 1NRSH 5JYIA 3MTYA 2VGCC 2W6JD 3QDZB 1O38A 4GHQA 4ISNA 4YLUA 2ZTZA 1IQFA 1DSUA 2ZFPH 2K0QA 4FUIA 1O2ZA 2RDEA 1S0QA 3A85A 1SOTA 3O8RA 1GI7B 3ZIAD 2ZFTA 4FUCA 1CO7E 2Y82A 4IS5A 1AE5A 4ABGA 1YY3A 4U30A 2GP9B 5E2OA 1SVPA 2FLBH 3AAVA 2SNWA 1VCQA 2ESTE 2QXIA 2XNIA 3M36A 2H9TH 1C1WH 4X0WU 3S7HB 4Y79A 1COWD 5C67A 1UCYH 3UUZA 4B2CA 4BOHA 5EU8A 1NRRH 1TIOA 3S9CA 3ATLA 3ZZBA 1MTUA 3OY5U 2BQ6B 3K65B 1P2MA 1CA8B 1UO6A 3P17H 3RXDA 1EP6A 2KCAA 1G37A 1IQJA 3A80A 2BMGB 1DY9A 2VWMA 4NZLA 5T1VA 2P59A 4P00A 4DOQA 2WPMS 2AMQA 3JZ1B 2FOBA 5LPEA 4O97A 3A81A 4Y8ZA 2FMJA 1AKSB 1EOLA 4YOIA 1YPHE 4PROA 1DT2A 4DG4A 2CHAC 3SBKA 2AIQA 1FIZA 1V6DA 1S83A 2A0QB 2O8UA 3MH7A 4A1VA 1DUAA 1DM4B 3PTBA 2BYAX 2GTBA 3NPSA 3OYPA 3S7KB 2AYWA 2F9OA 1LO6A 3LJJA 4CR5A 1OOKB 1WUNH 2HNTF 1GDNA 4E06H 3DA9B 1DX5M 1DOJA 4AFUA 3TGIE 2V3MA 2RDLA 5GIBA 3WWFA 5BPEA 5C1YA 4Q4LA 1KSNA 1H8HD 1T31A 3ZZ5A 3ZV8A 2PKAB 1VITG 4ZROA 1OP8A 2PV9B 1BMFD 4GUXA 1GHBF 3FFGA 1XUJA 4INLA 1O2TA 2DE9A 1DSTA 3A88A 5E8EH 1EUFA 1C1MA 1UTNA 3BTDE 2P3TB 1T8MA 2BVRH 1ANCA 4DT7B 3FO8D 5DPAA 1ZGVA 1SLUB 2O9QA 1T7CA 1YKTA 4Q80A 2GMTB 2KAIA 5FL7D 2F3CE 3P8GA 2ZQ2A 1TRYA 1XUIA 2WHXA 4I8KA 1Z8JB 1UHBB 3RXMA 4UDWH 3T5FH 2OC7A 3A7YA 3V7TA 5EQSA 2ZHEH 4FUDA 1GBMA 5HIZA 3Q3XA 3WY8A 2Z6BD 4I8GA 4ABDA 1TFXA 3D65E 4NWLA 4FOUC 2HALA 3UFAA 1MKXH 5HM2A 4MQAA 2FM2A 4R0IA 1GBJA 3P8FA 1YPEH 3SU0A 1NO9H 1C2KA 1LPGB 2VJ1A 1INCA 1GDUA 1TMBH 2PKSB 3BV9B 3LJOA 1FN8A 5L2ZH 4IGDA 2RCEA 1JOUB 2AMPA 4FU9A 4K8YA 4NZQA 1C1VH 1O5AB 4HG6A 4MPXA 1GMHF 1NFWA 1QURH 3HGPA 1P8VC 1QL8A 3SI4H 1ZSJA 4MPVA 1V2MT 3GY3A 3BTGE 4BTTB 4UFGH 4NIVA 1V2LT 2BVSH 2VB0A 4HFPB 1YCPH 4I8HA 5G4BA 2TGDA 1F5RA 3FOAA 2WINI 1C1SA 4LK4A 3VXEH 1MKWK 1O3CA 4M9FA 1GG6B 1KIGH 4X1QU 3ZYEA 1YPGH 1THRH 1ZMLA 1K1MA 5JB9S 1F0SA 1GBIA 2G4TA 1BBRH 2ZHFH 2FOAA 4MPWA 3KHVA 4ESTE 1SB1H 1HUTH 4F48B 1UVOA 3E3TA 1ZGIA 3GDVA 1LKAA 3ZZ4A 4J2YB 2PGQB 1TNGA 1P01A 4BXSA 1D6WA 1UVPA 2F91A 4XD7D 1GG6C 3STIA 4TT3D 1HAVB 2KM0A 1SHHB 1GPZA 2Z9JA 1SGQE 1ELTA 2C93B 2ZDVH 2ZU4A 2CGAA 4JMYA 1O2OA 2ZHDA 1EJAA 4E7NA 2OK5A 2F9UA 2A32A 1MTSA 1O3GA 1SC8U 1P2KA 2OBOA 2UUYA 4D9QA 3LH3A 2J98A 2C3SA 4CRDA 3EA8A 1Y5UT 1TONA 1GVZA 2Z9IA 1P2JA 1CGIE 1D3QB 1RIWB 7ESTE 6ESTA 3RU4D 1DDJA 3I78A 2ZFRH 3SZEA 3PMBB 3RXVA 2VIOA 9LPRA 4OS7A 7GCHG 1WQSA 4Q2KA 1FONA 1ELDE 1G3EA 3PROA 4X2YA 5EJLA 1RIWC 1AHTH 1VZQH 4YTAA 2ZPQA 1Q3XA 3F0OA 2Z9LA 4DIHH 3MU0A 4ZHMU 2CXVA 2VVUA 1QL7A 1WOFA 4H6TA 1P02A 3CENA 3M7QA 2GGVB 5DP8A 1LPZB 1IQHA 2STAE 3O8BA 1C5WB 1FJSA 1ANEA 1O39A 1YLCA 5GNDA 4ZKOU 3RU4T 3TNTA 5JBAS 2OINA 4JK6A 1AZZA 3T62A 3ZZ8A 3V12A 1IQNA 4X6OA 4ZAEA 4FUJA 3VG8A 1HXEH 2PTNA 3RMLH 1WYKA 1GMDG 1K1JA 1N1LA 3JZ2B 1G3BA 2VWOA 3PWCA 4JYVH 1K0HA 1Z8IB 4JZIA 1N8OB 1A0LA 1UVUH 1GGDB 1QJ7B 3VB3A 1VITF 1LQEA 4ZKSU 1FI8A 1SQTA 3P92A 1A46H 4AB9A 3KGPA 1NC6A 3F68H 4ABFA 1O31A 2BDYA 2BD3A 5A0CA 2OP9A 2JIZD 1YLDA 2FOGA 4WXIA 1AD8H 2A5AA 3K9XB 2GDDA 3UOPA 2ZTXA 1NFXA 3RC6A 4B76A 1HGTH 3GICB 1NFYA 2ZFQH 2XWBI 2B5TB 4Y8XA 1OWEA 4Q7ZA 1GDQA 4NA9H 1HB0B 2A4QA 3ESTA 3BTHE 2ANWA 1HRTH 3HPTB 4AFZA 1NROH 1DANH 3PV4A 2V0BA 3LGWA 2P3UB 3OTJE 5EXLA 4K1EA 5HXFA 3A8BA 4CRFA 1PQAA 2VBCA 5BRRE 2ZCHP 4XDEA 2H2ZA 4A1XA 2BY9X 3F3BA 4B71A 3MNBA 3U98H 4IBLH 1XVOA 1PPHE 1GBEA 4YZUA 3IITA 8ESTE 2Y7XA 1TNHA 2KR7A 1SLVB 3T25A 5E2PA 3DFLA 4NFFA 2OC1A 1A3BH 1A2CH 1L1GA 4RKJB 3RXCA 3UOUA 1E36B 1AMHA 1BB0B 1GI1A 3TPIZ 2BD9A 2B0FA 2XTTB 2IOTA 1VJAU 1O32A 3M3TA 5EW1H 1LHCH 4XBDA 3OEED 4MNVA 5EQRA 4OGXA 4Y7BA 3URCA 2TRMA 4ABAA 1TMTH 3K6YA 3FANA 2FOEA 1V2OT 1B0FA 2QCYA 3Q3YA 1CGJE 2F9NA 2VH0A 1CT2E 1UTOA 2YNAA 4BTUB 1OXGA 3E6PH 1K1IA 1LVBA 1W0JD 2BXTH 1MKWH 3ATMA 3E8LA 1ORFA 1O0DH 2ZEBA 5E0GA 1GVKB 1GHVH 4IW4E 2BDBA 1GHAF 1TGNA 1AVGH 3BEIB 5EXNA 3SO3A 5TCAA 5F03A 4MPUA 2GV6A 5FPSA 2BD8A 2SGEE 2OUAA 1AN1E 1TX6A 5E0HA 1EQ9A 3SU1A 2BOHB 3L33A 1PPCE 7GCHF 2V3HH 1CU1A 1DWCH 2FODA 2KCYA 2PW8H 1P2IA 2TGPZ 3ZVEA 1BT7A 1C2MA 2P95A 4Y0YE 1FMGA 4X6MA 3RXFA 1OWHA 5LPFA 4MTBA 1BIOA 1GBBA 1ZSLA 3ENSB 3BEUA 4DGJA 1K22H 3AVZA 1WBGB 1EZQA 2A4GA 2BDIA 5GXPA 1TA6A 1HJAB 2A2XH 1DUEA 3EYDA 3RXBA 3UIRA 3UNSA 2GZ7A 1K28D 4KTCA 1UTJA 8GCHG 4FVDA 1MH0A 2WPLS 3TGJE 5T6GA 1W0YH 5FCRA 1UTLM 2J9NA 2BDCA 3RXSA 1HJAC 1XXFA 1H9IE 2GJGA 5EGMA 1ACBE 3MQKC 3PLKA 1HLTH 4FETA 3G01A 1V2KT 5CE1A 1G9IE 1QGFA 2KCOA 4I8JA 3AK5A 2OD3B 3QN7A 1GMDF 1W13U 2FOFA 4THNH 5ESTE 2A7CA 3E91A 1CHOF 2B9LA 2QIQA 4HI3A 1YPKH 2G00A 3AAUA 2XBVA 5C2ZA 5F53A 2ANYA 2TBSA 3VB7A 1O3HA 5DGJA 1NT1A 1L0ZA 1NRNH 1ABJH 2C8WB 2LNCA 1P2OA 3OEHD 2Z94A 1C5TA 4ZUHA 1NU9A 1WU1A 4MVNA 2VNTA 2A1DB 4CR9A 1MBMA 2XYAA 1H8DH 1E1QD 1NPMA 3ITIA 1C9PA 6GCHG 2BDHA 1TQ0B 2BX4A 4Q7XA 1S81A 3A7TA 1ZMNA 4KTUA 3E16B 1LHFH 1YP9A 5AF9H 4YT6H 3MO6A 4BAQB 2XC0A 3M37A 1YPMH 1BMMH 4WJG2 1CHGA 4I7YH 5DJ7A 2OCVB 1BTZA 3HK3B 4OS5A 5IK2D 1P10A 1RRKA 1MU8B 3VFEA 3MNXA 2Y81A 3LKWA 3T28A 1AUJA 4TPIZ 2JETC 2TIOA 1XKAC 1C2DA 1QZ8A 3DSGA 4XBBA 5CMXH 1O5CB 4MNWA 2QF4A 1SGIB 5DN6D 1O3PB 1TYNA 3AW0A 1UTQA 1MCVA 3SUDA 3BIVH 3BTQE 4K8BA 2C8ZB 2SGPE 4DIIH 1QIXB 2BLWA 3MH5A 1SGEE 3QWCH 1O35A 4MNXA 2J34A 2RFKC 2ZP0H 1UMAH 1C1NA 1XUFA 1FDPA 1M9UA 1KXEA 2JDID 3UQVA 1QR3E 4GCHF 5FPTA 3UQOA 1C1OA 2Q6GA 4P02A 4JZFH 5DO4H 3RXEA 1G3DA 2XBYA 4NCYA 1C4V2 4DT4A 1H8IH 1CA0B 4B74A 1AVWA 3GY6A 2WPHS 3LGIA 2W3IA 1DFPA 3GISB 1F0TA 1EAUA 2BD4A 1W0ZU 3A87A 3CS7A 5FHTA 5KECA 1JRSA 1IHTH 1S6FA 3UTUH 2ZG0H 3P95A 1V2VT 2LPRA 3SNEA 4IC5A 1XM1A 2OC0A 4Y11E 2M5TA 1GVLA 1OWJA 4H42U 3NCLA 5A8ZA 1DVAH 1DXPA 3NK8A 1GBHA 1PFXC 3FP7E 3W1EA 1GJCB 5J4QA 1LDTT 1EB2A 3OY6U 1O36A 1O5DH 2EY4C 5CHAB 4D7GA 5C17A 1MAXA 2GVFA 3F6UH 1THSH 1BITA 1PQ7A 1TOMH 5C5NA 1O2RA 5EPYA 1LHEH 1O3FA 3UNRA 3MNCA 4WF8A 4K5ZA 5IYTA 5DP5A 4TY7A 3VXFH 1GI3A 4IC6A 3PM3A 1BHXB 4U01A 1ELCA 2QF0A 1O3JA 2UWLA 3CP7A 3M7UA 4A1TA 2QF5A 2ZPRA 3F9EA 3GCHC 1S84A 4CBOA 1Z1JA 3LGYA 1ZTJA 2JJ1D 2ALVA 3A8DA 1AFQC 1PYTD 5EQQA 4ZMAH 4UEHH 1Q2WA 1C9TA 1ELFA 2GCHG 1W0KD 1BA8B 1C1QA 1L1NA 1HAYB 1QBOA 2F4LA 1ZRBA 1TPOA 1FY3A 2QAAA 1O2LA 4DCDA 3UNQA 3SV9A 4NFEA 3V3MA 1FY1A 1W7XH 1G2LA 3T29A 1F92A 1SGCA 1LTOA 2C90B 2SNVA 3QTOH 4D76A 4I32A 1WV7H 2Z9KA 1A5IA 3KYFA 1QTFA 2HLCA 4OS4A 3RLWH 1W8BH 2ZPSA 1A5HA 1XKBC 5JBTA 3TK6A 4ZKNU 5A09A 3S0NA 2O8TA 4NSYA 1PYTC 1GMCG 2ZDKA 1E79D 3UR6A 3SOSA 1ARBA 1ZYOA 1FN6A 1RXPA 2SGAA 3E90B 2THFB 3PO1B 1E1RD 5EJ1A 1OSSA 4ZHAA 3MU4A 2F43B 2G81E 4JCNA 1EB1H 1YBWA 1TRMA 1Y3UA 3OAAD 3TJNA 3ZV9A 4HZHA 4INHA 3LOXA 2M2AA 1ESBA 1O2UA 1HJ9A 2STBE 6GCHF 1D4PB 1P12E 1SLXB 1J9CH 4H4FA 3ELAH 1ZJKA 4UFFH 3SJKA 2XNDD 3E0PB 1TLDA 1BQYA 3RXGA 2ULLA 3F2HA 4BXWA 1V2TT 2LELA 4AGKA 4XFQA 2OLGA 1TPAE 5EXMA 1NRQH 5F8ZA 1DE7H 4RI0A 2Y6TA 2WUCA 2ZECA 1T4VH 1VCWA 2KAIB 1AKSA 2ODQA 1BJVA 1SG8B 2XRCA 3TU7H 3SUFA 8KME2 5DP9A 4X1PU 4TPYA 1AE8H 1J17T 2ZHWH 1O3IA 4LOYH 1WDIA 1ZOMA 1HDTH 1MD7A 1SQOA 2BY8X 2HPQH 2GD4B 2W6ID 1FUJA 3D49H 1LQDB 5C5OA 5HIYA 1PPZA 3VB6A 1J8AA 2WYGA 3F9GA 5E0JA 1EX3A 3TH2H 2ASUB 1HAHH 3MO3A 4B6FA 2AERH 2VIVA 1EKBB 1ETSH 1Q31A 1TGSZ 3F9FA 4RT1A 4X8SH 2J95A 4Y76A 3PB1E 4ZHLU 1E34B 3EE0B 5C0TA 1NESE 2GMTC 1RGQA 3ODFA 3DUXH 1EAIA 1D3PB 2PKAA 3U8OH 1ETTH 3FKSD 3RU4E 4AFSA 5SGAE 4XRNA 3LC5A 3NWUA 3BG8A 3T26A 3BTME 3A8CA 5A8XA 1SGDE 1J16A 4X2VA 1C5OH 3RXLA 1V2ST 4KP0A 3V0XA 5DSFA 2ZTYA 1IHSH 1QHRB 4JZEH 5AFYH 1IQLA 4AFQA 1O2QA 2PKSC 2IJOB 2BQWB 3S9AA 4AORA 3I29A 3MH6A 1EPTB 2W7UA 3FP6E 4NIYA 1UHBA 5JPMH 2JJ2D 6LPRA 1MZDA 1KDQB 1Y5AT 2WYJA 4WH6A 2BM2A 1C5MD 1EASA 3EA9A 4B2BA 2WUBA 4ABBA 3QTVH 3RC4A 3RXIA 1A7SA 1ZLRA 4GPGA 1EPTC 2QF3A 3ZVFA 3MWIU 4UE7H 1F0UA 1CSOE 2NU2E 1GHYH 1W2KH 3OTPA 2F9PA 2FS9A 1C2EA 2O8WA 1O2HA 1BTYA 2WPJS 2J94A 1SGNE 3LGVA 2G5NA 3OX7U 3FAOA 5I46H 1MUEB 4GAWA 2RA0A 3ZVGA 5T6FA 1TE0A 3SGBE 1YPHC 1ZHPA 4KTSA 4Z1MD 1GI9B 1O30A 1GBAA 5FXLA 1YYY1 2B7DH 3KQDA 4XOJA 1C5SA 2BX3A 4GHTA 1QQ4A 2FLRH 1FAXA 2A45B 1O5FH 3UAIC 4I31A 1BRBE 1P2QA 1AFEH 4ACBA 4DY7B 3PLBA 1SBWA 1HAVA 3TH3H 1LPKB 3KF2A 1UVTH 4FU7A 4HTCH 2ANKH 1QJ6B 2ZDNA 1EATA 3SV8A 1P03A 3LGUA 3GY4A 1CQQA 4Q7YA 2A7JA 4B73A 1GMCF 1HAPH 1JIMA 2BZAA 3SNAA 2OBQA 2OQUA 2XC4A 2KFWA 1SQRA 3F1SB 1O3NA 3RC5A 3SU2A 1TGCA 2AFQB 1V2UT 1XX9A 1CBWB 5EPNA 4IMQA 3MNSA 4X1SU 3BTEE 3EDXB 4JK5A 1ESAA 1RTLA 1DITH 1O3OA 1VR1H 2ALPA 2FPZA 3RMNH 3F2FA 5FBEA 1CBWC 1YCPM 2BVXH 1GBDA 3W94A 3I77A 2ZI2H 5JDUB 1TX7A 3PWBA 2WZQA 3ZZ6A 1UJ1A 2XXLA 3ODDA 3VGCB 2O8LA 2BD2A 2GKVE 3RM0H 2NU4E 2VVVA 2PUQH 4A6LA 1PJPA 1C2IA 1G3CA 1N8OC 1ZZZA 4OM9A 1GGDC 3ZZAA 4ABIA 1KXBA 2UWPA 4K2YA 2HRVA 1P9UA 3RXPA 3LH1A 1TGTA 3DFJA 1XXDA 5CHBA 3M3SA 4ASHA 1AU8A 1UCYE 2FX6A 6CHAB 1LHDH 3RUOA 1V2NT 1YGCH 4A7IB 2R9PA 1SR5C 1C5LH 1QA0A 1T8NA 2CF9H 4A92A 2ZFFH 2OXSA 5H4IB 3GY2A 3GCNA 4CH8B 4YT7H 1A0JA 1AI8H 4KGAA 6CHAC 2EA3A 3M61U 4B75A 1UK2A 5C94A 4ACAA 1MABB 5DG6A 4NA8A 4FU8A 5EOKA 3GY8A 1SI5H 3AW1A 2GCTB 2W5EA 1UK4A 3F9HA 4AGJA 1LKBA 1UTPA 1BRUP 3D23A 3ATWA 3ZYDA 1K2I1 1C5UA 5J4SA 1NBME 3HGNA 5HGGA 2GCTC 2PUXB 2R2MB 2ODPA 5TCCA 1SHYA 1BMLA 1TBZH 1O37A 2BOKA 2JH6D 4CRBA 2AGEX 3WW7A 1C5YB 4U2WA 1O2PA 1W14U 1GI0A 3RMOH 1DXWA 2R3YA 1NS3A 1L4ZA 1AB9B 2SGFE 4VGCB 2GV7A 1Z6EA 1E38B 1ZRKA 2PLXA 3MHWU 3N7OA 2IPQX 3GY7A 3HK6B 1OPHB 3PRDA 1W7GH 4BNRA 2ZU2A 1QRWA 3K6ZA 4YLQH 1Z8RA 1Z71A 2R3UA 4YESB 2H5CA 3F0PA 1AB9C 4VGCC 4F4OC 7KMEH 4FUGA 2ZNKH 1HXFH 1ANDA 1GL0E 5KGOA 2H1UA 2R0LA 3RDZA 2G55A 2J5UA 5HMAA 5FX5A 1MMJN 2RG3A 2Z9GA 2PSYA 1XUHA 3BEFB 1F0RA 2J97A 1F5LA 1KTSB 2Z3CA 3KIDU 2V7QD 1HIAB 2FZZA 1GI5A 4O3UA 1VGCB 1DLKB 2YOLA 1HBTH 2V3OH 1S82A 2QXGA 4X1NU 5DK1A 3QX5H 4FUHA 5HM9A 1UTKA 3TIUA 1SMFE 3RXRA 4X8VH 1VGCC 2FWWA 2FYQA 1DY8A 1DLEA 1LVOA 1C4U2 5F8XA 3DSOA 4A5TS 2FX4A 4AB8A 2FYRA 1QB1A 3A89A 1TABE 2EQNA 5GPIB 1AO5A 4NIXA 1KXAA 1EJMA 1QB6A 3SQEE 3MMGA 2GT7A 2VIWA 2K8IA 2WV9A 1PQ8A 1BBRE 2TGTA 4OS6A 1ID5H 1XUKA 4WMFA 1HCGA 4B6EA 5F6MA 2ZGXH 3MU8A 3VEQB 3ZVCA 3FZDA 2VWLA 3U28C 1Y59T 2TGAA 1SQAA 1T32A 2A4OA 1B5GH 3PMJA 2F83A 5C1UA 2OTVA 3E1XB 1SGFG 1O2NA 1S6LA 3C27B 2FTMA 2FP7B 1AIXH 1C5QA 2GZ8A 2NWNA 5ESBA 5JBBS 4I86A 1GHZA 1C5RA 2AH4X 2G4UA 4J1YA 1HJ8A 3TVJB 3SGAE 3RXUA 3BTWE 4X6NA 4B1TA 1SGYE 1C1TA 1NM6A 4XBCA 1EOJA 1GHXH 3LONA 2BXUH 2D8WA 2EI7A 3ZZ3A 1BZXE 4ISOA 5F8TA 1OHHD 1Y3WA 3MYWA 3P8OA 2HOBA 3T2NA 1F2SE 1AQ7A 1AY6H 1O2XA 3TITA 4K3JA 2AMDA 3SQHE 1RFNA 2C8XB 1YPLH 5L30H 1QBVH 5DKMA 1CE5A 1D3DB 1P9SA 2V35A 4LZ4B 3FVFB 1YPJH 2ZWLH 3BTFE 2G8TA 1AVXA 3RXTA 4F55A 3RXAA 3SU5A 2QV1A 4UONA 2ZGCA 1PPBH 2UUFB 1O2JA 2ZA5A 2CF8H 4NGAH 1BTUA 1SGTA 4CRAA 2FO9A 3KQBA 1ZTLA 2H6MA 1AZ8A 1MTVA 4U32A 2V6NA 1JMOH 4ABJA 2VH6A 2FEQH 3ZVDA 2QGRA 4D9RA 5L2YH 4I33A 1C5ZB 1D9IA 2G5VA 1TNLA 5EJZA 1MU6B 3MH4A 1OWDA 1ELAA 2R2WU 1WTGH 4B2AA 3UPEA 2CV3A 2XBWA 2P94A 1FX0B 1E0FD 1YF4A 3U1IB 1QB9A 1ZSKA 1X7AC 2BZ6H 1O3EA 1Y3YA 2GX4A 4NG9H 1V2PT 1RJXB 2JH5D 2VWNA 3SV2H 1J14A 1O3BA 1O2YA 3SJ9A 2BLOA 4TYDA 1O5GH 4TSFD 4MDSA 1VCPA 2R0KA 3A84A 1CA0C 1FXYA 9ESTA 2BQ7B 1TNJA 1DPOA 1C1RA 2ZU1A 3STJA 4DURA 1V2WT 3FZZA 1P3EA 1H8ED 3SU6A 1TALA 5FX6A 1QNJA 2WV4A 1OWKA 1NY22 1QRZA 1GMHG 5KEDA 1G30B 3OE7D 1EJNA 4X8UH 5HYOA 3NRLA 4F49A 4WVPE 1MTNB 4H6SB 5C3NA 1K1LA 2QE7D 2PWXA 1MCTA 1XMNB 5ABWA 5A8YA 1P0SH 1GBKA 4SGAE 1O2WA 3GY5A 5DP7A 4DVAU 1B0EA 1TX8A 4Y10E 4FUFA 4YO9A 4X2WA 1KY9A 5CHAC 2ZO3H 3LU9B 1MTNC 3UR9A 3OU0A 2VGCB 3KL6A 3SNDA 3FN8A 1H1BA 2ZFSA 2H9EH 2VIPA 2QN5T 1C2LA 4Y6DA 1U6QA 1F7ZA 3SHAH 1KXFA 1ABIH 2ZGJA 1O5EH 2FS8A 3U1JB 4K1SA 4BAMB 1LVYA 1TRNA 2WPIS 2XC5A 3PLPA 8GCHF 5ETXA 1HAZB 2A7HA 4CH2B 1GBLA 4X1RU 1L4DA 1IQIA 3LIWA 2I6SA 1O2SA 2HWLB 1ETRH 1GHWH 2FI4E 2NU1E 5B6OA 1GBTA 3SU4A 4UD9H 1DICA 3QO6A 1MAYA 1EP5A 3QGJA 2P16A 3H09A 1K9OE 3HKJB 4WMDA 4LZ1H 3K2UA 1LVMA 4WXVA 2PSXA 1YM0A 3OFND 3KCGH 4O9VA 4FXGH 4RN6A 3BTKE 2LP6A 3ATKA 3QZRA 3SN8A 3A82A 2ZDLA 4FUEA 1SFQB 4HGCA 2FI3E 3OSYA 5L6NH 2ZKSA 3QZQA 3C1KA 3UWIA 1ZR0A 2CHAB 1PPEE 4JZDH 4ISLA 2HVXA 2BY5X 1MD8A 5C0UA 1BDAA 2OQ5A 3PO1C 1P09A 1A5GH 5EG4A 1LHGH 3RXJA 1BUIA 1T8LA 3TJOA 3O8CA 3TH4H 2QA9E 2Y5FA 3PYHA 1SGFA 1ZHRA 3SNCA 2GDEH 3A83A 2YMSD 4Y8YA 3TNSA 3A7XA 5FBIA 2BHGA 3A7VA 4R8TB 1IQMA 1FZZA 1ARCA 2WPKS 1C5PA 3LT3A 1RS0A 1S0RA 4QT8C 2YNBA 2BDGA 2BD5A 3Q77A 1O3DA 3BTTE 4KELA 3SZNA 1FPCH 2DUCA 1HAXB 1K1NA 1YWUA 2ZCKP 3AASA 4ISIH 1IOEA 1EZSC 2HNTC 1BMAA 2KZ4A 1LCYA 2YMSB 1T4UH 5EIYA 1UW7A 3HATH 1GI4A 1PPFE 4XE4A 3ZZDA 1B7XB 1FY5A 1JIRA 1O3LA 3SGQE 2P3FH 2AEIH 1H9HE 3KQCA 1EAWA 2ZHQH 2ZU5A 3EQ0H 4NIWA 2YMSC 1GJDB 1O3KA 1GJ5H 2ZU3A 1GCDA 3ZZCA 3Q00A 1W12U 2RA3A 3ATIA 1EZXC 1KXCA 1EXFA 3E0NB 3H5CB 3RXHA 2WV5A 3SORA 1SFIA 4OGYA 1AWFH 1TAWA 4LXBH 1G32B 1T8OA 5T3HA 1SKYE 1YLNA 4E05H 4GSOA 3KQ5A 1HYLA 1FY4A 2HGTH 1SLWB 1GCTB 4CRCA 5JB8S 1C5VA 1TBRH 1ELVA 3BIUH 1A0HB 3RLYH 3SJ8A 2ZDMA 2WPDD 1JXPA 2F9VA 1HV7A 1WAYB 1E37B 1GCTC 1N6YA 4BTIB 4YOJA 1S85A 4BAKB 2UWOA 4AN7A 2Z3DA 3CS0A 1GJ6A 1C4Y2 1BTPA 5A2MH 1L1JA 3QUMP 1O2GH 1S6HA 2IN2A 2XCNA 3A7WA 1KLTA
chains in the Genus database with same CATH topology
5TJXA 1TNIA 5LGOA 2BLQA 1OX1A 1ZMJA 5GDSH 1BMNH 2ZGBH 1UTMA 3SHCH 3TLOA 4UFDH 2XWAA 4IN1A 4D7FA 3GYLB 1DWEH 1UK3A 1HAGE 4GVUA 2QYIA 1O34A 1EPTA 1S5SA 1C2FA 2CMYA 1W10U 1KDQA 1BJUA 2GCHF 2Q6DA 3O8DA 1ZJDA 3QLPH 3DD2H 4CREA 4O03A 1C2HA 2EEKA 1NU7B 3S9BA 1V3XA 2AGGX 1FNIA 3PMHB 5LH8A 1FLEE 1N6XA 1GWAA 3BF6H 3EAJA 3W95A 1QL9A 4O3TA 2Y80A 1WCZA 4ISHH 2CN0H 1P2NA 1CGHA 1Z6JH 2Y5GA 3GCTG 2PHBA 4Y0ZE 2ZF0H 1GHAG 2QXJA 3B9FH 4OS1A 5A0AE 1VJ9U 2A2QH 1NFUA 1TBQH 1W3CA 1BTWA 4K1TA 1SGPE 5EODA 2TPIZ 4RKOB 5GWZA 2ZIQH 2AS9A 3B8JA 2ZCLP 1Y5BT 1O2VA 1P3CA 2A5IA 1BTXA 1ESTA 2NU3E 2H5DA 2H9HA 5DP4A 5AFZH 1GBCA 3S69A 2FDAA 4ZKRU 4ABEA 1HAIH 1GJAB 3Q76A 4ZH8A 3RXOA 4ABHA 2ZC9H 2ZGHA 1V2RT 3HKIB 1MQ5A 3U8TH 4WH8A 1SPJA 1H4WA 3R0FA 3L6PA 1BOQA 3P70B 1ELBA 3B23B 3MI4A 3MOCA 4TWYA 1KXDA 5GCHG 5K7RA 2XCFA 4WMEA 2QXHA 4NSVA 1O33A 4AOQA 3D62A 1OKXA 3RMMH 1O3AA 3PMAB 3NKKA 1EZUC 1QFKH 3TK9A 3M7TA 3BN9A 2ODYB 1Z7KA 3M3VA 3ZZ9A 3RP2A 3VPKA 1QY6A 4Y7AA 3DT0H 3SUGA 1K1PA 3VGCC 1GJ9B 3Q3KA 4YM9A 1CHOG 3IG6B 3SNBA 2DE8A 2C8YB 2J38A 2D26C 8LPRA 1NRPH 4MLFB 1HFDA 1LMWB 5C20A 2J2UA 4E7RG 2JKHA 1IQGA 2G51A 1TPPA 4X6PA 1AWHB 2D1JA 1JRTA 1G36A 3KN2A 1F5KU 1GI6A 1UVSH 2BY7X 1A1RA 1D3TB 4AG1A 1SL3A 2PTCE 3T27A 1BRCE 3M5OA 2QC2A 1TPSA 3QK1A 2FIRH 3SV7A 3SJIA 1AUTC 1A3EH 4MNYA 2B8OH 3P8NA 1P04A 2AIPA 3EA7A 2Y7ZA 1IQKA 2BB4A 5GJ4B 2BDAA 1V2QT 5I25A 4UFEH 3LDXH 3UREA 2JH0D 2CJIA 1XVMA 3A86A 1C5NH 1NZQH 3TJVA 1TNKA 1XUGA 3R3GB 3SJOA 1IQEA 2FOHA 2A5KA 1MBQA 1ZHMA 2NU0E 4WWYA 2SGDE 1P11E 1O2KA 3M5MA 4AYVB 3SV6A 1KLJH 1TMUH 1G2MA 1ZPCA 4IN2A 2EI8A 4Z0KA 2G52A 1OS8A 4GCHG 1PQ5A 2PGBB 1O5BB 1ANBA 1Y3XA 1Z8GA 1THPB 4Z6AH 3MO9A 5LPRA 4XSKU 1C2JA 4BANB 3UY9A 2BY6X 1QBNA 5PTPA 1SGRE 1TA2A 2VIQA 1JWTA 2ZQ1A 1FQ3A 1KYNA 1FIWA 7LPRA 5C1XA 3GCTF 2XW9A 3MU1A 2UUKB 4ZXYH 3VB5A 1KTTB 1GJ7B 1GL1A 1DWBH 2VVCA 1HAOH 3GYMA 1SOZA 1NN6A 4Y71A 3TJUA 2O8MA 4TY6A 1WQVH 2P93A 4FUBA 3GDUA 1TWXB 4TWWA 1P05A 2W3KA 1QQUA 4YOGA 3SW2B 2OC8A 2Y5HA 1UCYK 2QY0B 4INKA 1TQ7B 5DP3A 3SI3H 3KQEA 1O2MA 2C4FH 3RXKA 1WTHD 3V13A 1ELGA 2ZDAH 3QGNB 1BCUH 2VU8E 4JYUH 2D2DA 1HPGA 2IPHA 4D8NA 3NUMA 1HIAA 2Z7FE 5DP6A 2PFEA 5AVDA 3GDSA 3BG4B 4DJZB 5AHGH 3U8RH 1MQ6A 2W7SA 2W26A 3ZVAA 4X8TH 1K21H 3H7OA 1MZAA 5EW2H 5GCHF 4CBNA 4SGBE 1GJ8B 2FXRA 3BG4C 1QRXA 3GOVB 1QJ1B 1H9LB 1ELEE 4WY3A 4NA7A 2Q1JA 1OYQA 1P57B 1E35B 1KLIH 5FPYA 3ZZ7A 3IWMA 3SU3A 3U69H 1EAXA 3H7TA 1QA7A 2J4IA 1NTPA 1CT4E 2J92A 3UWJH 3KNXA 1Y3VA 5A0BA 3MFJA 2FTLE 2ZZUH 4K60A 3PTNA 1ZPZA 1CT0E 4AX9H 2HPPH 3L3TA 1Z1IA 2FI5E 3URDA 1GJ4H 1FAKH 2P8OB 3VB4A 1VITH 3M35A 4CHAB 2F9BH 1P06A 3SUEA 2FOMB 3KEEA 1A4WH 1DS2E 1GI8B 3FP8E 4KKDA 2ANMH 1AGJA 1C1UH 1OP2A 1QCPA 5FCKA 2P8OC 1CVWH 2JETB 1RTKA 3TK5A 4CHAC 2XBXA 1JBUH 1BTHH 2K1QA 3P6ZB 1J15A 1GHBG 2A4RA 4JZ1A 4BAHB 1C5XB 1K1OA 1MKXK 4BAOB 1DWDH 2FOCA 3NZIA 2AGIX 3RM2H 2BTCE 4IMZA 3NXPA 1A61H 2GT8A 4M7GA 1SSXA 4JYTA 3LC3A 1RTFB 1V2JT 2BD7A 1GJBB 1BRAA 3GCOA 2VINA 3ZVBA 1OYTH 4RSPA 4MG3A 1GBFA 1C1PA 1IAUA 4FVBA 5T6DA 4AYYB 1RD3B 3U9AH 2EC9H 2GZ9A 1ZPBA 1TGBA 1FPHH 4NWKA 1YCPK 4GLYA 1YC0A 2SFAA 1D6RA 2PR3A 3EGKH 4DW2U 4I8LA 1W11U 1TB6H 2SGQE 1BBRK 4K69A 1O3MA 3MU5A 2VIDA 4AG2A 4CRGA 3M5NA 3RXQA 2A31A 4ZXXH 1TOCB 2Z3EA 2HNTE 5K0HA 1FY8E 1PPGE 3M5LA 1OWIA 3BSQA 3TGKE 5FAHA 1C2GA 1ZTKA 5IDKA 5JBCS 1WSSH 3A7ZA 1FV9A 2FESH 2ILNA 1Y8TA 1OP0A 2EI6A 3A8AA 1L2EA 2BLVA 4OS2A 2I6QA 3LPRA 1O2IA 1GI2A 1HNEE 4X2XA 3DHKH 1BHXF 1MTWA 3GCHB 4AZ2B 2Q6FA 2UUJB 3LGTA 1AFQB 1NRSH 5JYIA 3MTYA 2VGCC 3QDZB 1O38A 4GHQA 4ISNA 4YLUA 2ZTZA 1IQFA 1DSUA 2ZFPH 4FUIA 1O2ZA 1S0QA 3A85A 1SOTA 3O8RA 1GI7B 2ZFTA 4FUCA 1CO7E 2Y82A 4IS5A 1AE5A 4ABGA 4U30A 2GP9B 5E2OA 1SVPA 2FLBH 3AAVA 2SNWA 1VCQA 2ESTE 2QXIA 2XNIA 3M36A 2H9TH 1C1WH 4X0WU 3S7HB 4Y79A 5C67A 1UCYH 3UUZA 4B2CA 4BOHA 5EU8A 1NRRH 1TIOA 3S9CA 3ATLA 3ZZBA 1MTUA 3OY5U 2BQ6B 3K65B 1P2MA 1CA8B 1UO6A 3P17H 3RXDA 1EP6A 1G37A 1IQJA 3A80A 2BMGB 1DY9A 2VWMA 4NZLA 2P59A 4DOQA 2WPMS 2AMQA 3JZ1B 2FOBA 5LPEA 4O97A 3A81A 4Y8ZA 2FMJA 1AKSB 1EOLA 4YOIA 1YPHE 4PROA 1DT2A 4DG4A 2CHAC 3SBKA 2AIQA 1FIZA 1V6DA 1S83A 2A0QB 2O8UA 3MH7A 4A1VA 1DUAA 1DM4B 3PTBA 2BYAX 2GTBA 3NPSA 3OYPA 3S7KB 2AYWA 2F9OA 1LO6A 3LJJA 4CR5A 1OOKB 1WUNH 2HNTF 1GDNA 4E06H 3DA9B 1DX5M 1DOJA 4AFUA 3TGIE 2RDLA 5GIBA 5BPEA 5C1YA 1KSNA 1T31A 3ZZ5A 3ZV8A 2PKAB 1VITG 4ZROA 1OP8A 2PV9B 4GUXA 1GHBF 3FFGA 1XUJA 4INLA 1O2TA 2DE9A 1DSTA 3A88A 5E8EH 1EUFA 1C1MA 1UTNA 3BTDE 2P3TB 1T8MA 2BVRH 1ANCA 4DT7B 5DPAA 1ZGVA 1SLUB 2O9QA 1T7CA 1YKTA 4Q80A 2GMTB 2KAIA 2F3CE 3P8GA 2ZQ2A 1TRYA 1XUIA 4I8KA 1Z8JB 1UHBB 3RXMA 4UDWH 3T5FH 2OC7A 3A7YA 3V7TA 5EQSA 2ZHEH 4FUDA 1GBMA 3WY8A 3Q3XA 2Z6BD 4I8GA 4ABDA 1TFXA 3D65E 4NWLA 2HALA 3UFAA 1MKXH 5HM2A 4MQAA 2FM2A 4R0IA 1GBJA 3P8FA 1YPEH 3SU0A 1NO9H 1C2KA 1LPGB 2VJ1A 2PKSB 1INCA 1GDUA 1TMBH 3BV9B 3LJOA 1FN8A 5L2ZH 4IGDA 2RCEA 1JOUB 2AMPA 4FU9A 4K8YA 4NZQA 1C1VH 1O5AB 4MPXA 1GMHF 1NFWA 1QURH 3HGPA 1P8VC 1QL8A 3SI4H 1ZSJA 4MPVA 1V2MT 3GY3A 3BTGE 4BTTB 4UFGH 4NIVA 1V2LT 2BVSH 2VB0A 4HFPB 1YCPH 4I8HA 5G4BA 2TGDA 1F5RA 2WINI 1C1SA 4LK4A 3VXEH 1MKWK 1O3CA 1GG6B 1KIGH 4X1QU 3ZYEA 1YPGH 1THRH 1ZMLA 1K1MA 5JB9S 1F0SA 1GBIA 2G4TA 1BBRH 2ZHFH 2FOAA 4MPWA 3KHVA 4ESTE 1SB1H 1HUTH 1UVOA 3E3TA 1ZGIA 3GDVA 1LKAA 3ZZ4A 4J2YB 2PGQB 1TNGA 1P01A 4BXSA 1D6WA 1UVPA 2F91A 1GG6C 3STIA 1HAVB 1SHHB 1GPZA 2Z9JA 1SGQE 1ELTA 2C93B 2ZDVH 2ZU4A 2CGAA 4JMYA 1O2OA 2ZHDA 1EJAA 4E7NA 2F9UA 2A32A 1MTSA 1O3GA 1SC8U 1P2KA 2OBOA 2UUYA 4D9QA 3LH3A 2C3SA 4CRDA 3EA8A 1Y5UT 1TONA 1GVZA 2Z9IA 1P2JA 1CGIE 1D3QB 1RIWB 7ESTE 6ESTA 3RU4D 1DDJA 3I78A 2ZFRH 3PMBB 3RXVA 2VIOA 9LPRA 4OS7A 7GCHG 1WQSA 4Q2KA 1FONA 1ELDE 1G3EA 3PROA 4X2YA 1RIWC 1AHTH 1VZQH 4YTAA 2ZPQA 1Q3XA 2Z9LA 4DIHH 3MU0A 4ZHMU 2CXVA 2VVUA 1QL7A 1WOFA 4H6TA 1P02A 3CENA 3M7QA 2GGVB 5DP8A 1LPZB 1IQHA 2STAE 3O8BA 1C5WB 1FJSA 1ANEA 1O39A 1YLCA 4ZKOU 3RU4T 3TNTA 5JBAS 2OINA 4JK6A 1AZZA 3T62A 3ZZ8A 3V12A 1IQNA 4X6OA 4ZAEA 4FUJA 1HXEH 2PTNA 3RMLH 1WYKA 1GMDG 1K1JA 1N1LA 3JZ2B 1G3BA 2VWOA 3PWCA 4JYVH 1Z8IB 4JZIA 1N8OB 1A0LA 1UVUH 1GGDB 1QJ7B 3VB3A 1VITF 1LQEA 4ZKSU 1FI8A 1SQTA 3P92A 1A46H 4AB9A 3KGPA 1NC6A 3F68H 4ABFA 1O31A 2BDYA 2BD3A 5A0CA 2OP9A 1YLDA 2FOGA 4WXIA 1AD8H 2A5AA 3K9XB 2GDDA 3UOPA 2ZTXA 1NFXA 3RC6A 4B76A 1HGTH 3GICB 1NFYA 2ZFQH 2XWBI 2B5TB 4Y8XA 1OWEA 4Q7ZA 1GDQA 4NA9H 1HB0B 2A4QA 3ESTA 3BTHE 2ANWA 1HRTH 3HPTB 4AFZA 1NROH 1DANH 3PV4A 2V0BA 3LGWA 2P3UB 3OTJE 5EXLA 4K1EA 5HXFA 3A8BA 4CRFA 1PQAA 5BRRE 2ZCHP 4XDEA 2H2ZA 4A1XA 2BY9X 4B71A 3MNBA 3U98H 4IBLH 1XVOA 1PPHE 1GBEA 4YZUA 3IITA 8ESTE 2Y7XA 1TNHA 1SLVB 3T25A 5E2PA 3DFLA 4NFFA 2OC1A 1A3BH 1A2CH 1L1GA 4RKJB 3RXCA 3UOUA 1E36B 1AMHA 1BB0B 1GI1A 3TPIZ 2BD9A 2B0FA 2XTTB 2IOTA 1VJAU 1O32A 3M3TA 5EW1H 1LHCH 4XBDA 4MNVA 5EQRA 4OGXA 4Y7BA 3URCA 2TRMA 4ABAA 1TMTH 3K6YA 3FANA 2FOEA 1V2OT 1B0FA 2QCYA 3Q3YA 1CGJE 2F9NA 2VH0A 1CT2E 1UTOA 2YNAA 4BTUB 1OXGA 3E6PH 1K1IA 1LVBA 2BXTH 1MKWH 3ATMA 3E8LA 1ORFA 1O0DH 2ZEBA 5E0GA 1GVKB 1GHVH 4IW4E 2BDBA 1GHAF 1TGNA 1AVGH 3BEIB 5EXNA 3SO3A 5TCAA 5F03A 4MPUA 2GV6A 5FPSA 2BD8A 2SGEE 2OUAA 1AN1E 1TX6A 5E0HA 1EQ9A 3SU1A 2BOHB 3L33A 1PPCE 7GCHF 2V3HH 1CU1A 1DWCH 2FODA 2PW8H 1P2IA 2TGPZ 3ZVEA 1BT7A 1C2MA 2P95A 4Y0YE 1FMGA 4X6MA 3RXFA 1OWHA 5LPFA 4MTBA 1BIOA 1GBBA 1ZSLA 3ENSB 3BEUA 4DGJA 1K22H 3AVZA 1WBGB 1EZQA 2A4GA 2BDIA 5GXPA 1TA6A 1HJAB 2A2XH 1DUEA 3EYDA 3RXBA 3UIRA 3UNSA 2GZ7A 1K28D 4KTCA 1UTJA 8GCHG 4FVDA 1MH0A 2WPLS 3TGJE 5T6GA 1W0YH 5FCRA 1UTLM 2J9NA 2BDCA 3RXSA 1HJAC 1XXFA 1H9IE 5EGMA 1ACBE 3PLKA 1HLTH 3G01A 1V2KT 5CE1A 1G9IE 1QGFA 4I8JA 2OD3B 3QN7A 1GMDF 1W13U 2FOFA 4THNH 5ESTE 2A7CA 3E91A 1CHOF 2B9LA 2QIQA 4HI3A 1YPKH 2G00A 3AAUA 2XBVA 5C2ZA 2ANYA 2TBSA 3VB7A 1O3HA 5DGJA 1NT1A 1L0ZA 1NRNH 1ABJH 2C8WB 2LNCA 1P2OA 2Z94A 1C5TA 4ZUHA 1NU9A 1WU1A 4MVNA 2VNTA 2A1DB 4CR9A 1MBMA 2XYAA 1H8DH 1NPMA 3ITIA 1C9PA 6GCHG 2BDHA 1TQ0B 2BX4A 4Q7XA 1S81A 3A7TA 1ZMNA </