1GBCA

Alpha-lytic protease with met 190 replaced by ala and gly 216 replaced by ala complex with methoxysuccinyl-ala-ala-pro-leucine boronic acid
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
198
structure length
198
Chain Sequence
b'ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGANVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbcA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbcA01
3E6PH 1G3CA 3UWJH 1BRUP 2FI5E 3ZVAA 2A4GA 5EW2H 1A0LA 2OUAA 2VH0A 4FU7A 1AN1E 2BD5A 1L1JA 4AN7A 1QBVH 2BD3A 3A7TA 2VVVA 1LHCH 2G5VA 1CQQA 2FOAA 1OX1A 2ZU2A 2A7JA 1OYTH 3NCLA 4YOGA 1PPGE 3KF2A 1RTFB 1ELEE 4X6OA 1EAUA 3TIUA 4AGJA 1OYQA 1EOJA 2ZDNA 1QB6A 2VVCA 3P95A 2F3CE 3IITA 1CBWB 3LPRA 1SGFG 3SOSA 1P2JA 1O3OA 1W12U 3R3GB 9LPRA 1QTFA 3A8AA 7LPRA 3PROA 1DSUA 2J38A 1FY3A 1XVMA 1UTKA 4X2VA 2ZGCA 2SNVA 4AFQA 2WINI 2THFB 1O5EH 2Z9KA 4Y7BA 5E2OA 1Y5BT 2GZ7A 3PYHA 1EB2A 1T8OA 2HWLB 4WH8A 5DP9A 1P2QA 1M9UA 1JXPA 4KP0A 2QY0B 3SI4H 1A2CH 5JB9S 1HXFH 1TQ7B 1P05A 1J8AA 2Y80A 1TX7A 1Z8IB 1C2EA 1MU6B 4OGYA 5FCKA 4DW2U 1YM0A 4B73A 4TY6A 2VIDA 1SGDE 1TX6A 3PLKA 1J15A 4ABHA 3ATWA 1LVOA 1XUKA 1BHXF 1C5RA 4TWWA 1Z8GA 2ZFFH 1NU9A 2VINA 1ZHPA 1C1OA 1SOZA 2Y7ZA 2EC9H 2C93B 3L3TA 3O8BA 1BBRH 3BEFB 1W7GH 5BPEA 5FCRA 1BTWA 3EGKH 2Z3DA 1DY9A 1S6HA 1ARBA 1V2VT 2NU1E 1FY4A 1TB6H 2ANMH 3PO1B 5T6DA 5JB8S 3PWBA 1W0ZU 3RXBA 1QJ7B 3EDXB 4F49A 1OWEA 5FBEA 2OCVB 2ZDAH 4Q2KA 5C3NA 4RN6A 4CRFA 4DIHH 1SFQB 1E34B 2PR3A 2ZHDA 3SJKA 2K1QA 3URCA 3RM2H 3ATMA 1EP6A 3ZVBA 1HGTH 1C2DA 1ORFA 3FZDA 2NU3E 5C1UA 2NWNA 1NESE 1W7XH 1C5SA 1BHXB 2ODQA 1ZLRA 1SGQE 1FY8E 4BTIB 1OWHA 4CRGA 1KXBA 1XUFA 3QGJA 2AIQA 2G55A 2QV1A 3D23A 5FPYA 1UMAH 2XBXA 1CBWC 3ZZ5A 2A5KA 3RP2A 2ZHQH 1DUAA 4FUJA 1VITF 4GLYA 1V6DA 1GGDB 1P2NA 2H6MA 3BN9A 2BVSH 4I7YH 4BAMB 1HJAB 1O2HA 2XYAA 2O8TA 3V3MA 4E05H 1LHGH 3GY2A 1ZHRA 3OTJE 3RXFA 2ZFSA 2DE8A 2FOFA 2VU8E 1ZR0A 3TNSA 1MKXH 1UK3A 1JIRA 3PLPA 3SV6A 2BB4A 1FAXA 5F03A 1B0FA 2ANKH 2F9BH 1HDTH 1MKWH 1O2SA 2F9NA 3MYWA 3A88A 4Y8XA 1RD3B 4UFFH 2BY9X 2FI4E 4X6NA 1BJUA 1QL9A 1SQTA 1YGCH 1HAIH 4YLQH 1UTQA 5A2MH 1YYY1 2BY8X 1F5RA 1VITG 4JZDH 1BQYA 4NSYA 2BDYA 5F8ZA 5L2ZH 1D9IA 4UE7H 1UVTH 1YP9A 1LMWB 2BY7X 2VIPA 4M7GA 6LPRA 1GHAF 1HAPH 2F9OA 4JYTA 1C5WB 5DP4A 1O2NA 5J4QA 4BXWA 1NN6A 4UFGH 1FY5A 3C27B 4WXIA 3SI3H 1ESBA 5JBCS 1T7CA 3HKIB 1SGRE 3KEEA 5DGJA 5F8TA 3F9HA 2ZC9H 1EAWA 3ZZCA 3BTQE 3SU2A 2PGQB 4X1QU 1NY22 4JZFH 4BAOB 2P94A 3V13A 2V3OH 6ESTA 1MD8A 1C2GA 3MNSA 1GBCA 1MMJN 3KN2A 1L4DA 4NIWA 3U69H 3NWUA 2FEQH 5AHGH 6GCHF 2OBOA 3F6UH 3UR6A 1LKAA 4SGBE 1YPEH 1HV7A 1O3IA 1QBNA 1KXFA 2ODPA 2ZHEH 3BTFE 1O2GH 4WMFA 2AS9A 3SJ8A 8KME2 4IS5A 4GHQA 2OXSA 1JOUB 1P11E 2ZO3H 4OGXA 4A1XA 1UTNA 4NA8A 5JBTA 1O3FA 4D7FA 5HGGA 1MTNB 1QL8A 2ANWA 2H9EH 2ZHFH 1GGDC 2W7SA 1YPLH 3FFGA 1HJAC 5E8EH 3A89A 4U32A 4K1EA 1Z1IA 4BANB 2PTNA 4ZHMU 3U8RH 5GWZA 2XC0A 1HAYB 2UWLA 4SGAE 3SNDA 1B5GH 1GBKA 1QJ1B 2AGIX 3A8DA 4FUIA 1BZXE 1QGFA 3CENA 1KXEA 1GBBA 1UHBB 4U2WA 1UTLM 4A1TA 4ZKSU 2D1JA 1C5ZB 2A7HA 1KTSB 2QXGA 1BMMH 1CT2E 2ZGHA 3LH1A 5E0HA 4YTAA 4O3UA 2GV6A 2FIRH 1ZTLA 3RLWH 4UONA 1UHBA 3F68H 4K1TA 3SNAA 1G37A 4B2AA 3UTUH 2XRCA 1QURH 4B75A 2BVXH 1GL0E 4HTCH 1B7XB 1WYKA 2GTBA 1MUEB 2M5TA 1XMNB 1GJAB 1A5IA 3GY3A 2Z6BD 4ABIA 2A2XH 1GVZA 5EQSA 4YESB 2FYQA 5A8YA 3ZZDA 5FX5A 3UFAA 2VWLA 3QUMP 1HXEH 2FX6A 1DICA 2EI8A 4NIYA 3M7QA 3A87A 3RXKA 5EGMA 1O2VA 2O8MA 4HZHA 4TPYA 1S0RA 4YO9A 1A5HA 1AVXA 3SQHE 1AUTC 1VGCC 3RXHA 1C5YB 5AFYH 3A81A 3C1KA 2OQ5A 3QLPH 1DANH 4BTUB 1H8DH 3GDUA 1C2MA 1GMHF 4OS5A 1AI8H 2SGEE 3AW1A 2BZ6H 3RXRA 5DP3A 3LGUA 1A0JA 3RXLA 5A8XA 4AYYB 2ZPRA 2BM2A 5DG6A 3AAVA 2OC7A 3Q00A 1C5MD 3P8OA 3ZVFA 3SZNA 2RCEA 3ZVCA 3K65B 1C1NA 1MAYA 3Q3XA 1L0ZA 2AMQA 1FUJA 4UEHH 1TPAE 1H1BA 3RU4D 1V2TT 1OXGA 2GVFA 1AWHB 1BIOA 2PV9B 3MH6A 5F8XA 1HYLA 2TGDA 3ZZ8A 3MU4A 1SLXB 2FPZA 3EAJA 2SGPE 2ZP0H 2ZDVH 1C5VA 4DJZB 1NROH 1HLTH 1YPMH 3L33A 3A7VA 4CRCA 1BITA 3B8JA 1TNLA 1TQ0B 1HIAB 1UCYH 1MQ6A 2Y7XA 4INHA 3T27A 1AVWA 3O8DA 2C8YB 3A85A 3GY6A 1KY9A 2VVUA 2P3FH 1Z8JB 3UQOA 5HM2A 2FOMB 1OS8A 4AOQA 4FU8A 1HIAA 1QIXB 2GP9B 8GCHF 1CA0C 4K8YA 3GY8A 1PPBH 1ARCA 1VR1H 2JH0D 5CE1A 4I8LA 3N7OA 1OKXA 4AB8A 3M5OA 3LONA 1NRRH 1PQ8A 1YPHC 1GWAA 3I78A 2BXUH 1GHXH 2GKVE 1ABJH 2J95A 4I8KA 2XCFA 4MPUA 3MH5A 3ZZ3A 2ZFPH 1D3DB 2C8ZB 2VWOA 1C2HA 1KIGH 1V2PT 2OC8A 1IAUA 3QGNB 3GDSA 1QRXA 2PKSB 2G81E 1TRNA 2ZIQH 1A0HB 1C5OH 1DUEA 4X0WU 2CMYA 5TJXA 5FX6A 5EPYA 4FUGA 2FDAA 3RXSA 3GYLB 3SJIA 3RM0H 1AZ8A 2ZCHP 5E0JA 4Q7XA 1EAIA 3FZZA 1CHGA 3STJA 3UR9A 5ABWA 1TNIA 3LGVA 1Z1JA 3PWCA 3E3TA 1DDJA 1K1JA 3HK3B 1LHEH 3DFLA 1DWEH 1ESTA 2ZNKH 2PGBB 1AU8A 3KL6A 2OC0A 4CBOA 5A8ZA 2XBVA 1J14A 2A45B 3OX7U 1INCA 3PM3A 1IQIA 1GI3A 3OY6U 3S0NA 2W7UA 2AMPA 2A7CA 1P06A 5T6GA 1Y3WA 2YNBA 2FLRH 4GCHF 1BMLA 4D8NA 1SGNE 4ABFA 2C90B 4FUEA 4IC5A 1Y3VA 2A31A 2OLGA 2RDLA 3AVZA 2W26A 2SGFE 2Q1JA 1FJSA 4I8HA 1P2IA 5EODA 4B71A 1MQ5A 1DOJA 1MZDA 2A4OA 3SJOA 4ABEA 2A4QA 3M61U 3UOUA 1A7SA 4ABGA 1QA0A 1LO6A 1X7AC 1DSTA 1UO6A 3VB5A 2GGVB 4B1TA 1O5DH 3RXEA 2GX4A 2OP9A 1EXFA 1SL3A 1AFEH 1H9IE 1O5FH 1TGSZ 3TJNA 4DIIH 1BUIA 2OQUA 1BBRK 1O2IA 3LU9B 1AY6H 1BB0B 3PTNA 3STIA 3BG8A 4K69A 1W8BH 2LPRA 3QX5H 5C1YA 4LOYH 3VFEA 2HOBA 1KXDA 1C5LH 2A4RA 1FZZA 5LPRA 3BEIB 3RXGA 2FI3E 1P2OA 2ZDMA 4NSVA 1ZJDA 1GJBB 3WY8A 1ZPCA 1D4PB 2TRMA 1ELGA 2Z9LA 3MNBA 1ELFA 1SGTA 3Q76A 2Y5HA 1P01A 2LNCA 1OP2A 3MH4A 4MVNA 1P2KA 1IQJA 1EB1H 1SOTA 4B2CA 2ZU5A 1NS3A 3A80A 3LKWA 4H6SB 1IQGA 1QFKH 1YKTA 5T3HA 3VEQB 3MO9A 1C9TA 4MNWA 1EJNA 3ZZAA 5C20A 3ATLA 4NWKA 1ZPZA 1XUJA 2PW8H 3SU5A 1Y3YA 3BTEE 5F6MA 5LPEA 4NFFA 2R0LA 1WQVH 2IOTA 3Q3KA 1THRH 2BVRH 2VNTA 1TBRH 4AG2A 4X1SU 3RU4T 4Q7YA 2ZWLH 3MFJA 3NXPA 2Z3CA 5DP8A 1HB0B 2FWWA 3LIWA 1MTVA 5FBIA 2VIOA 1LPKB 1C2IA 3EA7A 1DXPA 1TIOA 2H5CA 1C5XB 2WPJS 3M37A 3UWIA 4XBCA 4MPWA 4O03A 2A0QB 3LGYA 2HALA 4NFEA 1AUJA 1IQKA 1HNEE 1TMBH 2VWMA 3SGQE 1O2QA 2HPPH 1Y8TA 1AIXH 2YOLA 1U6QA 4IN1A 3P8NA 1TX8A 4FUFA 3T28A 4E06H 2Z9JA 1HJ9A 2ZFQH 3SQEE 1BOQA 2ZEBA 4UFEH 1AHTH 1O2MA 1SGFA 2ALVA 3PB1E 4CRAA 4O9VA 1TOCB 1OWJA 1PPHE 1V2QT 4CRBA 4FVDA 1BMAA 2HNTF 5DPAA 2RA0A 3M36A 1L1NA 3RXQA 1ACBE 1O2ZA 2ILNA 4ZKNU 3UNRA 4LK4A 4U01A 3GISB 2OINA 1C2LA 4YT7H 1ZMNA 2I6SA 1L4ZA 1RJXB 3T62A 4BXSA 3ZZ9A 2O9QA 5A0AE 1AFQC 2R9PA 5DJ7A 2GCHG 1O32A 1GI8B 2PSXA 2ZZUH 3KQDA 1QQUA 3MNCA 1GI7B 1Y59T 2Z9GA 1AGJA 2D8WA 1F7ZA 1HCGA 1AE8H 1THSH 1TLDA 1EZQA 2B9LA 2PLXA 2XC4A 2FODA 4INLA 3U8OH 2ZU4A 2WPMS 1T8LA 4ZMAH 5A0BA 1PPZA 3RXUA 1CGIE 1DFPA 4B2BA 2GD4B 1GPZA 1DS2E 5HMAA 3MWIU 1NM6A 3BV9B 1GBHA 3K9XB 2FM2A 1NRPH 4WXVA 1N8OB 1SBWA 1EUFA 1J16A 4BAKB 2STBE 1JIMA 2BY5X 3VB4A 1AVGH 2XBWA 2BLVA 1SMFE 4H6TA 1GBMA 4ABDA 2GCTB 3MTYA 4NZLA 3M35A 5JYIA 2TGPZ 1FY1A 4Z6AH 3T2NA 1XUIA 1ZJKA 3ODFA 1QB1A 3BTDE 1DY8A 3K2UA 5G4BA 3VXFH 1GVKB 9ESTA 4YZUA 2C4FH 3RUOA 3RXPA 3ELAH 1Z6EA 2Z9IA 2FTMA 1MBQA 3PMBB 1OPHB 4MNYA 2BD7A 1XX9A 2V35A 2J34A 1E36B 1RS0A 1RRKA 1D6RA 4UD9H 3D49H 1DITH 1YCPM 2Q6GA 2ZI2H 4WF8A 1V2RT 4WWYA 1ZMJA 2ASUB 1TONA 1WU1A 4LZ1H 2BD8A 5JBBS 1ABIH 2AGGX 4Y76A 1TBQH 2IN2A 4Y79A 2Z7FE 4HGCA 2B5TB 1DWDH 1ZMLA 3MNXA 4KGAA 1KDQB 5CHAB 2GV7A 2PHBA 4O97A 2Y6TA 3SHCH 3DT0H 1EOLA 2H2ZA 1MD7A 2QC2A 4A92A 1BCUH 1S6FA 1LVBA 4AORA 1BMNH 1CGJE 2DE9A 1KDQA 1CGHA 1AKSB 1GDQA 1SGIB 4ESTE 3BF6H 1ETSH 1Y3UA 1UTPA 5GJ4B 4AFUA 1PPFE 1JBUH 1GMDF 2D26C 3PO1C 1QBOA 3SGAE 3ZVDA 4YOJA 2ZU1A 3RMLH 1Q3XA 4MDSA 1TNHA 1ZRBA 3ESTA 2CJIA 3O8CA 2A5AA 3M3SA 2BD2A 1GBTA 1GJCB 1WUNH 3SW2B 1AKSA 3AW0A 1TNGA 2TIOA 1L2EA 2H9HA 2GDEH 2UUKB 1UVOA 3BTME 3GYMA 4E7RG 1V2KT 1N8OC 2QXJA 2A2QH 1T31A 2HNTC 3F9GA 2ZA5A 3HPTB 3MU8A 1IHTH 4KTCA 1C5QA 1K1NA 2AMDA 1EQ9A 1GI6A 4D76A 1QRZA 3QTVH 1DWBH 2R0KA 2UWPA 3SNCA 1GMDG 2QF3A 2ZECA 1HUTH 1NPMA 1ANDA 1O5GH 2J2UA 4CREA 2FOBA 2ZFTA 5C67A 2P3TB 2PUXB 1O3LA 3RXOA 1O37A 1RTKA 3VB6A 2XNIA 1V2MT 1UCYK 2VB0A 2ZTZA 1GBIA 2V0BA 3RLYH 1ETRH 1DX5M 1TABE 2QXHA 4Y8YA 2FTLE 3GCHB 1PPEE 1BTPA 3F9EA 4XBDA 3BG4B 1F0UA 1SG8B 3PMHB 1MZAA 2P3UB 3HGNA 1A4WH 4F4OC 1WSSH 4I33A 3S7KB 3S9BA 1VZQH 1A1RA 1GBFA 4PROA 2AIPA 1YPKH 3SO3A 1OWKA 1GBLA 1ELVA 3GICB 3E8LA 1VCQA 1D6WA 1ZSKA 3QO6A 2QAAA 3KHVA 3QN7A 2QA9E 4YM9A 3HATH 1P12E 3S69A 1F0SA 2XWAA 5FPSA 4UDWH 2QYIA 5CHAC 1YLCA 1C1RA 1YC0A 1P9UA 2F9UA 1Z8RA 3GCNA 1O5CB 4GAWA 1GDNA 3MI4A 2ZDLA 1NFWA 1YF4A 1QHRB 4I8GA 2QF0A 3UREA 1YCPK 1O3DA 1NO9H 1QA7A 3TLOA 2O8UA 1IQEA 2BLQA 1XVOA 4AYVB 2ZFRH 2A32A 1BTHH 1JRSA 1TPOA 2XWBI 3Q3YA 1XXDA 4D7GA 4AZ2B 1CO7E 2SGDE 1UK4A 4ZROA 3BTKE 2OTVA 5ESTE 1LQDB 1A3EH 1F5KU 1K1MA 4NG9H 3GDVA 1GJ4H 2WV4A 2SGQE 3FP6E 3ENSB 1EASA 4ZAEA 1GL1A 2PWXA 1GI9B 4DG4A 5EW1H 4CR9A 1HPGA 2QCYA 2VIVA 3S7HB 4ABBA 1KXAA 1HAHH 3ZV9A 2QGRA 1GBDA 3QDZB 1GHWH 1BTZA 1C2KA 1LTOA 1TA6A 2WYGA 1MU8B 5FXLA 4B76A 3M7UA 1QCPA 1D3PB 1ZGVA 3EA8A 1MBMA 2O8LA 2HNTE 4X8SH 2WYJA 1MAXA 3TITA 4LXBH 4JYUH 2TBSA 4UFDH 1MTNC 1HJ8A 3MO3A 3URDA 1GI2A 1ESAA 1W13U 1N6YA 5LGOA 1W0YH 2DUCA 3S9AA 1A5GH 3T25A 1YLDA 1O5BB 4JCNA 3E16B 2P95A 1Q2WA 2R3UA 4A7IB 3RXTA 1GHBG 4ISLA 4YLUA 5E0GA 4TWYA 3TK5A 3TH3H 1BT7A 5HXFA 1ZOMA 3TK9A 1FQ3A 3QTOH 4FUDA 1O3NA 1NRQH 1RIWB 2P16A 1GJ5H 4A1VA 3M5NA 4OS6A 1GG6B 3HGPA 1EKBB 4NWLA 4JZEH 1C5NH 1P2MA 1FIWA 1UTMA 3VPKA 1S85A 2ZGBH 2HPQH 2OBQA 3W94A 1W14U 2AH4X 3EA9A 3P6ZB 2FX4A 1TOMH 4JZ1A 1QNJA 2H1UA 4TYDA 2GZ8A 1GJ6A 4MG3A 1FPHH 1PYTD 1ID5H 3TU7H 2WPKS 3M5MA 3UUZA 1UTJA 3V7TA 3QZRA 2F83A 2FOEA 3KIDU 1O38A 3RXIA 1V2NT 1ZTKA 2BZAA 2FOHA 3OSYA 6CHAB 4O3TA 3KQCA 5GPIB 4Y71A 3SU3A 1AWFH 3ATIA 1CSOE 3SUGA 1YBWA 3PV4A 1ELBA 2ODYB 1CHOF 4ISOA 1ETTH 1JMOH 1DT2A 5T6FA 3DD2H 1BBRE 4H4FA 1SFIA 1ELDE 2ZTYA 1F0RA 2G00A 1TNKA 5GXPA 1PQ5A 3SV7A 1QY6A 1J9CH 1AE5A 2NU4E 1FI8A 1P03A 3B9FH 1WQSA 3A82A 1LVMA 1GJ9B 2CXVA 1IOEA 3VGCB 3ITIA 1HAOH 3DHKH 1K1PA 2C8WB 3LGTA 4BOHA 1T4VH 1TE0A 1NRSH 4R0IA 2XTTB 1IHSH 1SSXA 1T8MA 3D65E 2J4IA 2CF8H 4IC6A 4LZ4B 1C4V2 2UUYA 1CHOG 3SU6A 4X2YA 1BDAA 3S9CA 1H4WA 1THPB 1TA2A 2BD4A 1C2JA 3UIRA 1TMUH 3ZZ7A 1Y5AT 1Z71A 1HAGE 4GVUA 5EQRA 1O2KA 1GBEA 1GHVH 2P93A 4AFSA 3L6PA 1EZUC 2J92A 2V3HH 2ZG0H 1FONA 1GVLA 1P8VC 4BNRA 3LDXH 3R0FA 3H7TA 1OWIA 4DCDA 4X1NU 4FXGH 2ZGXH 1H9HE 1GG6C 4NIXA 1O2OA 1P09A 2D2DA 1AMHA 3TJUA 1EX3A 3OU0A 4E7NA 3T5FH 2ANYA 1GCTB 3BTHE 1ZRKA 3I77A 3FP8E 5LPFA 4MPXA 3ZZ6A 2ZKSA 1FPCH 2STAE 3BTWE 1OOKB 2ZDKA 5HM9A 1IQMA 1NFYA 5K0HA 3A86A 4CR5A 5C5NA 2PFEA 1O2UA 2PKSC 2WUCA 3K6ZA 1UJ1A 5FPTA 4HI3A 1V2WT 1YPHE 1IQFA 2G4TA 1EJAA 1YPJH 5GIBA 1ANCA 2IPHA 2G52A 2BXTH 1GI4A 3FAOA 4X8VH 3FVFB 5L2YH 5GCHG 2BQ6B 1C4U2 1LVYA 1QL7A 4XOJA 2FP7B 1OP8A 1GJ7B 5AVDA 5EXMA 3ODDA 4OS4A 2JH6D 1O3EA 1WTGH 2W3IA 2ZPQA 3ZYDA 1O3GA 2EA3A 3RMMH 4AGKA 1AQ7A 1SQAA 3BTGE 2R2MB 2BX3A 4JK5A 3RXDA 2WUBA 2ULLA 4CHAB 3E0NB 5EG4A 1O3CA 1F2SE 5IYTA 1P9SA 4J2YB 1FDPA 1K9OE 3GY4A 5IDKA 2PSYA 2QN5T 3VGCC 1IQLA 4X2WA 5B6OA 3O8RA 2GZ9A 3EQ0H 1A61H 2FYRA 1MKXK 5C5OA 4DVAU 2GCHF 1PQAA 4ZXYH 5FAHA 2VJ1A 4BTTB 2BQWB 2BDCA 8LPRA 1MKWK 1E0FD 2ZHWH 4Y7AA 4K5ZA 1CA8B 2OC1A 4HFPB 3A8CA 4MNVA 3MO6A 5I25A 1Z7KA 3U98H 2BDIA 3FANA 1DVAH 7ESTE 3TVJB 3SU4A 2C8XB 4Q7ZA 1F5LA 3IWMA 2ZU3A 1WOFA 3B23B 1VCWA 4CH8B 1SHHB 1KLTA 1V2JT 1BRBE 2CF9H 2W3KA 4Y10E 4ZXXH 3V12A 1AB9B 3GOVB 2Y82A 4H42U 4RKJB 4INKA 1KSNA 3QWCH 1C1TA 1VJAU 1E37B 1NTPA 3HK6B 1SGCA 3SORA 2H9TH 1A46H 1GDUA 3A84A 2I6QA 1OWDA 3NZIA 3BIUH 1GMCF 1O3HA 1O35A 2F9PA 1V2ST 2C3SA 3PLBA 2HLCA 2R3YA 1K2I1 1GCTC 1S82A 1NC6A 4K3JA 2WPLS 2NU0E 3TNTA 3LJJA 3TPIZ 3KCGH 1QJ6B 4ASHA 1ZSLA 2SFAA 2P8OB 4CBNA 2BDHA 1VITH 1G9IE 2ESTE 1P3CA 4MQAA 4MPVA 4ISHH 5J4SA 4CRDA 2SNWA 1G2MA 3SNEA 1S81A 4MNXA 3SNBA 3GCTF 1WV7H 3TH2H 1DPOA 3CS7A 3RC5A 1S5SA 3VB3A 3ZYEA 1EJMA 2XXLA 5EU8A 4AX9H 1HFDA 1CT4E 1O5AB 4A5TS 2UWOA 4GSOA 3MH7A 4ZUHA 1SPJA 4XDEA 3NUMA 4OS2A 5DP7A 1GMCG 2VGCB 3U9AH 4WMEA 1O3AA 2FXRA 1CT0E 1K1IA 2BOKA 2CHAB 1GCDA 1MTUA 4J1YA 1F92A 4ABJA 4IW4E 4CHAC 3MOCA 4K1SA 3MU1A 1W11U 2GMTB 3UNQA 3VXEH 2AFQB 1BJVA 5JPMH 1LDTT 3K6YA 1FXYA 5L30H 1E35B 5JBAS 1BRCE 2Y5GA 2GT7A 4D9RA 1G3BA 2YNAA 3A7XA 3M5LA 4WVPE 1P3EA 3GCTG 4TPIZ 4Y6DA 1Y5UT 2ZTXA 2GT8A 2ZF0H 1FIZA 1O2WA 3BSQA 1SGPE 1RFNA 4ISNA 1OP0A 1C1PA 2TPIZ 3TGKE 2QIQA 3GY7A 2BY6X 1Y3XA 4KKDA 2XBYA 2Y5FA 1FAKH 5JDUB 1O2LA 2AERH 4MTBA 3UOPA 5DKMA 4BAHB 3U1JB 2FO9A 3JZ1B 3RMOH 1NFUA 1GHZA 4IMQA 1IQHA 3IG6B 1AO5A 4I8JA 1WAYB 1AB9C 1GJDB 5CMXH 3LH3A 1P57B 1O3PB 1HAXB 4ZH8A 1C2FA 1SLUB 3KQEA 1TRMA 2Q6DA 3P92A 1FV9A 1DLKB 3DA9B 1UCYE 1NU7B 5EPNA 3ZZ4A 4XFQA 2H5DA 1TPSA 5EXLA 5EOKA 2BMGB 3F1SB 3PTBA 1EZXC 3A83A 3M7TA 1CE5A 1K1LA 5C1XA 3TJOA 3D62A 4X1PU 1EAXA 1H8IH 1PQ7A 4X1RU 2G5NA 3MHWU 3T29A 1XKBC 3P70B 1K21H 1IQNA 2FOGA 2P8OC 2PKAB 1D3TB 3SV8A 1HAVB 1N1LA 2G51A 3UY9A 2SGAA 3M3TA 1PYTC 2EEKA 4FU9A 2JKHA 1FNIA 2Z3EA 3SGBE 2VWNA 1LPGB 2PKAA 4JZIA 3BEUA 4OS1A 2ZQ1A 1VGCB 1XM1A 1HAVA 1C1SA 2BX4A 1GBAA 1D3QB 4XSKU 3SUDA 1ZSJA 2BLWA 1SB1H 1O2JA 5DO4H 3E0PB 2VGCC 2BTCE 3V0XA 4NGAH 2TGAA 1L1GA 1QR3E 1DM4B 1VJ9U 1O30A 2GCTC 2VIWA 4DGJA 1V2OT 4ISIH 1TMTH 1SR5C 2AEIH 3LC3A 2CHAC 1C5UA 1SI5H 2BHGA 3QZQA 3LOXA 1ANEA 3OYPA 1UVSH 2GMTC 2JH5D 1TYNA 2FESH 4IMZA 1GHAG 1P10A 3QK1A 2ZCLP 3SV2H 3F9FA 1GI0A 3TK6A 2BDBA 2F91A 1O0DH 2BDAA 1B0EA 3A7YA 3AASA 4NIVA 1G2LA 4IBLH 1SLVB 5HYOA 3W95A 1RGQA 3LGWA 1C1VH 2G4UA 1SGYE 2Z94A 3GCOA 4JK6A 4NCYA 3ZV8A 1PJPA 1FN8A 3I29A 1KXCA 4RSPA 2FMJA 1EP5A 4FVBA 5EQQA 1EZSC 1O31A 4DY7B 2BDGA 5I46H 3T26A 1Q31A 2J9NA 1TPPA 3DUXH 4WY3A 3RU4E 2BQ7B 2AGEX 5TCCA 3HKJB 1O2PA 1NFXA 6GCHG 1T8NA 2F9VA 7GCHF 1BRAA 2B7DH 3P8GA 3SUFA 4X8TH 3E1XB 3PMJA 1CA0B 1Z6JH 2CV3A 1AD8H 3ZZBA 1S84A 5SGAE 3RC6A 1EPTB 1BTXA 4K8BA 1N6XA 1YPGH 1RTLA 4FUBA 2ZGJA 2IJOB 2A5IA 1TGNA 2QXIA 3SN8A 3RC4A 3RDZA 3A7WA 5DP5A 1C1MA 1GJ8B 1FLEE 1SHYA 2XCNA 5DK1A 3TJVA 2HGTH 3NK8A 1EATA 2WPIS 3ZVGA 4RKOB 1JWTA 3AAUA 1UK2A 1EPTA 3G01A 3MU5A 1TGTA 3GY5A 5TCAA 3KNXA 1H9LB 1K28D 5BRRE 1LCYA 1HRTH 1QB9A 4AFZA 1G3DA 1A3BH 2ZQ2A 1T4UH 2WPHS 1TALA 2VH6A 3SU1A 1SQOA 3LJOA 3H5CB 7GCHG 1GHBF 1NRNH 1ELAA 2AYWA 2RA3A 4ZKRU 5L6NH 1CVWH 1G32B 5A09A 1DLEA 4GPGA 4KTSA 4NZQA 1O2XA 1BTUA 5C2ZA 2CGAA 4Q80A 1S0QA 4R8TB 3P8FA 1JRTA 1DXWA 1E38B 4Y0ZE 4DOQA 4Y8ZA 3E91A 3OY5U 1TFXA 1WTHD 1WBGB 2ZCKP 3FP7E 2FZZA 2JETB 2R2WU 3UPEA 4NA7A 3LC5A 4Z0KA 1O2YA 2P59A 4K60A 1T32A 1LPZB 4XBBA 1QRWA 1ANBA 1P02A 2CN0H 5H4IB 4B74A 1K1OA 3RXVA 2A1DB 3NKKA 1G30B 1ZYOA 2FS9A 3GCHC 1C5PA 1F0TA 2G8TA 3RXJA 5PTPA 3BG4C 4YOIA 2BYAX 3EYDA 1C9PA 1ZTJA 3CP7A 1LQEA 2EI7A 1GMHG 1HAZB 1BTYA 1MTSA 3KQBA 1C1QA 3BTTE 1V2UT 4WH6A 1SGEE 1UTOA 4YT6H 3CS0A 1MCTA 1UVPA 1MCVA 1XUHA 1KLJH 3PMAB 3Q77A 1ZPBA 4QT8C 4CH2B 3E90B 4Y0YE 1O3KA 1ELCA 4D9QA 1ZHMA 1EPTC 4ZKOU 1W10U 1C1UH 4WJG2 4ZHLU 3UQVA 1P0SH 3VB7A 5AF9H 3KGPA 2XW9A 3SBKA 3SJ9A 2UUJB 1HBTH 1TRYA 4ZHAA 1FMGA 2WV5A 4U30A 4VGCB 1XKAC 2NU2E 1TNJA 1C1WH 4FUHA 1BA8B 1VCPA 1S83A 2W5EA 1SC8U 5AFZH 1TAWA 1YCPH 2FLBH 2PTCE 3LGIA 4I31A 3RXCA 5DP6A 1NT1A 2BLOA 1MTWA 4GHTA 1K22H 1OSSA 4KTUA 3U1IB 1O2RA 1V2LT 4MLFB 4X8UH 3NPSA 4A6LA 8GCHG 2KAIB 2Y81A 3EE0B 1SLWB 5ESBA 5LH8A 4DT7B 1GHYH 1O2TA 2XC5A 2TGTA 1MH0A 2J94A 4X6MA 2FS8A 2ALPA 5A0CA 1AZZA 3SHAH 3MMGA 1P04A 2Q6FA 2RG3A 2KAIA 2JETC 1O3JA 4IGDA 3DFJA 1XXFA 1O34A 1SVPA 3SU0A 1LHDH 3TH4H 2EI6A 3ZVEA 3LT3A 1QQ4A 1O3BA 2HVXA 5GDSH 4Y11E 3TGJE 3ATKA 1J17T 1ELTA 2GDDA 1FN6A 2B0FA 1GBJA 4GUXA 1C5TA 1LHFH 4KELA 2B8OH 1KYNA 1TGCA 4XE4A 4X6PA 1TBZH 4BAQB 5K7RA 3M3VA 4K2YA 1PFXC 7KMEH 1TGBA 4THNH 3TGIE 1O3MA 4IN2A 5GCHF 3MU0A 3SUEA 2PUQH 1XUGA 1RIWC 4DURA 4AB9A 1KTTB 1W3CA 3H7OA 4NA9H 4I32A 2BD9A 5EXNA 1LKBA 2HRVA 1GI1A 2V6NA 1WCZA 1ZGIA 4JMYA 1PPCE 5E2PA 1G3EA 1UVUH 3SV9A 2O8WA 4JYVH 4OS7A 2OD3B 1KLIH 1O36A 2BOHB 3RXMA 1RXPA 4WMDA 1W2KH 2UUFB 1AFQB 3P17H 4GCHG 3RMNH 1ZZZA 4ABAA 2FOCA 2VIQA 1O39A 3RXAA 1GI5A 3A8BA 1G36A 1O33A 4TY7A 6CHAC 3JZ2B 1DE7H 1CU1A 1NZQH 4X2XA 1V3XA 1C4Y2 4FUCA 3BIVH 8ESTE 2ZPSA 1TWXB 3A7ZA 3U8TH 4AG1A 5FHTA 4VGCC 5ETXA 3UNSA 1DWCH
chains in the Genus database with same CATH superfamily
3E6PH 1G3CA 3UWJH 1BRUP 2FI5E 3ZVAA 2A4GA 5EW2H 1A0LA 2OUAA 2VH0A 4FU7A 1AN1E 2BD5A 1L1JA 4AN7A 1QBVH 2BD3A 3A7TA 2VVVA 1LHCH 2G5VA 1CQQA 2FOAA 1OX1A 1VKYA 2ZU2A 2A7JA 1OYTH 3NCLA 4YOGA 1PPGE 3KF2A 1RTFB 1ELEE 4X6OA 1EAUA 3TIUA 4AGJA 1OYQA 1EOJA 2ZDNA 1QB6A 2VVCA 3WW7A 3P95A 2F3CE 3IITA 1CBWB 3LPRA 1SGFG 3SOSA 1P2JA 1O3OA 1W12U 3R3GB 9LPRA 1QTFA 3A8AA 7LPRA 3PROA 3DSGA 1DSUA 2J38A 1FY3A 1XVMA 1UTKA 4X2VA 2ZGCA 2SNVA 4AFQA 2WINI 2THFB 1O5EH 2Z9KA 4Y7BA 5E2OA 1Y5BT 2GZ7A 3PYHA 1EB2A 1T8OA 2HWLB 5KECA 4WH8A 5DP9A 1P2QA 1M9UA 1JXPA 4KP0A 2QY0B 3SI4H 1A2CH 5JB9S 1HXFH 1TQ7B 1P05A 1J8AA 2Y80A 1TX7A 1Z8IB 5EJZA 1C2EA 1MU6B 4OGYA 5FCKA 4DW2U 1YM0A 4B73A 4TY6A 2VIDA 1SGDE 1TX6A 3PLKA 1J15A 4ABHA 3ATWA 1LVOA 1XUKA 1BHXF 1C5RA 4TWWA 1Z8GA 2ZFFH 2WSSD 3VG8A 1NU9A 2VINA 1ZHPA 1C1OA 1SOZA 1YWUA 2Y7ZA 2EC9H 2C93B 3L3TA 3O8BA 1BBRH 3BEFB 1W7GH 5BPEA 5FCRA 5C0TA 1BTWA 3EGKH 2Z3DA 1MABB 1DY9A 1S6HA 2KCYA 1ARBA 1V2VT 2NU1E 1FY4A 1TB6H 2ANMH 3DSPA 3PO1B 5T6DA 3PWBA 5JB8S 1W0ZU 3RXBA 1QJ7B 3EDXB 4F49A 1OWEA 5FBEA 2OCVB 2ZDAH 4Q2KA 5C3NA 4RN6A 4CRFA 4DIHH 1SFQB 1E34B 2PR3A 2ZHDA 3SJKA 2K1QA 3URCA 3RM2H 3ATMA 3KYFA 1EP6A 3ZVBA 1HGTH 1C2DA 1ORFA 3FZDA 2NU3E 5C1UA 2NWNA 1NESE 1W7XH 1C5SA 1BHXB 2ODQA 1ZLRA 1SGQE 1FY8E 4BTIB 1OWHA 4CRGA 1KXBA 1XUFA 2XOKD 3QGJA 2KCPA 2AIQA 2G55A 2QV1A 3D23A 5FPYA 1UMAH 2XBXA 1CBWC 3ZZ5A 2A5KA 3RP2A 2ZHQH 1DUAA 4FUJA 1VITF 4GLYA 1V6DA 1GGDB 1P2NA 2H6MA 3BN9A 2BVSH 4I7YH 4BAMB 1HJAB 1O2HA 2XYAA 2O8TA 3V3MA 4E05H 3ZIAD 1LHGH 3GY2A 1ZHRA 3OTJE 3RXFA 4HG6A 2ZFSA 2DE8A 2FOFA 2VU8E 1ZR0A 3TNSA 1MKXH 1UK3A 1JIRA 3PLPA 3SV6A 2BB4A 1FAXA 5F03A 1B0FA 2ANKH 2F9BH 1HDTH 1MKWH 1O2SA 2F9NA 3MYWA 3A88A 2K0QA 4Y8XA 1RD3B 4UFFH 2BY9X 4YXWD 2FI4E 4X6NA 1BJUA 1QL9A 1SQTA 1YGCH 1HAIH 4YLQH 1UTQA 5A2MH 1YYY1 1H8ED 2BY8X 1F5RA 1VITG 4JZDH 1BQYA 4NSYA 2BDYA 5F8ZA 5L2ZH 1D9IA 4UE7H 1UVTH 1YP9A 1LMWB 2BY7X 2VIPA 4M7GA 6LPRA 1GHAF 1HAPH 2F9OA 3CNRA 3GS9A 4JYTA 1C5WB 5DP4A 1O2NA 5J4QA 4BXWA 1NN6A 4UFGH 1FY5A 3C27B 4WXIA 3SI3H 1ESBA 5JBCS 1T7CA 3W1EA 3HKIB 1SGRE 3KEEA 5DGJA 5F8TA 3F9HA 1H8HD 2ZC9H 1EAWA 3ZZCA 3BTQE 3SU2A 4P02A 2PGQB 4X1QU 1NY22 4JZFH 4BAOB 2PP6A 2P94A 3V13A 2V3OH 6ESTA 1MD8A 2JIZD 1C2GA 3MNSA 1GBCA 1MMJN 3KN2A 1L4DA 4NIWA 3U69H 5DSFA 3NWUA 2FEQH 5AHGH 6GCHF 2OBOA 3F6UH 3UR6A 1LKAA 4SGBE 1YPEH 1HV7A 1O3IA 1QBNA 1KXFA 2KR7A 2ODPA 2ZHEH 1O2GH 3BTFE 4WMFA 2AS9A 3SJ8A 8KME2 4IS5A 4GHQA 2OXSA 1JOUB 1P11E 2ZO3H 4OGXA 4A1XA 1UTNA 4NA8A 5JBTA 1O3FA 4D7FA 5HGGA 1MTNB 1QL8A 2ANWA 2H9EH 2ZHFH 1GGDC 2W7SA 1YPLH 3FFGA 5C94A 1HJAC 2JJ1D 5E8EH 3A89A 4U32A 4K1EA 1Z1IA 4BANB 2PTNA 4ZHMU 3U8RH 5GWZA 2XC0A 1HAYB 2UWLA 4SGAE 3SNDA 1B5GH 1GBKA 1QJ1B 2AGIX 3A8DA 4FUIA 1BZXE 4B6FA 1QGFA 3CENA 1KXEA 1GBBA 1UHBB 1W0JD 4U2WA 1UTLM 4A1TA 4ZKSU 2D1JA 1C5ZB 2A7HA 1KTSB 2QXGA 1BMMH 1CT2E 2ZGHA 3LH1A 5E0HA 4YTAA 4O3UA 2GV6A 2FIRH 1ZTLA 3RLWH 4UONA 1UHBA 3F68H 4K1TA 3SNAA 1G37A 4B2AA 3UTUH 2XRCA 1QURH 4B75A 2BVXH 1GL0E 4HTCH 1B7XB 1WYKA 2GTBA 1MUEB 2M5TA 1XMNB 1GJAB 1A5IA 3GY3A 2Z6BD 4ABIA 3N7DA 2W6ID 2J98B 2A2XH 1GVZA 4YESB 5EQSA 2FYQA 5A8YA 3ZZDA 5FX5A 3UFAA 2VWLA 3QUMP 1HXEH 2FX6A 1DICA 2EI8A 4NIYA 3M7QA 3A87A 3RXKA 5EGMA 1O2VA 2O8MA 4HZHA 4TPYA 1S0RA 4YO9A 1A5HA 2J98A 1AVXA 3OEED 3SQHE 1AUTC 1E1QD 1VGCC 3RXHA 1C5YB 5AFYH 3A81A 3C1KA 2OQ5A 3QLPH 1DANH 4BTUB 1H8DH 3GDUA 1C2MA 1GMHF 4OS5A 1AI8H 2SGEE 3AW1A 2BZ6H 3RXRA 5DP3A 3LGUA 1A0JA 3RXLA 5A8XA 4AYYB 2ZPRA 2BM2A 5DG6A 3AAVA 2OC7A 3Q00A 1C5MD 3P8OA 1YY3A 3SZNA 3ZVFA 5FL7D 2RCEA 1W0KD 3ZVCA 3K65B 1C1NA 1MAYA 3Q3XA 1L0ZA 2AMQA 1FUJA 4UEHH 1TPAE 1H1BA 3RU4D 1V2TT 1OXGA 2GVFA 1AWHB 1BIOA 2PV9B 3MH6A 5F8XA 1HYLA 2TGDA 3ZZ8A 2YMSD 4ASUD 3MU4A 1SLXB 2FPZA 4XRNA 3EAJA 2SGPE 2ZP0H 2ZDVH 1C5VA 2KZ4A 4DJZB 1NROH 1HLTH 1YPMH 3L33A 3A7VA 4CRCA 1BITA 3B8JA 1TNLA 1TQ0B 1HIAB 1UCYH 1MQ6A 2Y7XA 4INHA 3T27A 1AVWA 3O8DA 2C8YB 3A85A 5C0UA 3GY6A 1KY9A 2VVUA 2P3FH 1Z8JB 3UQOA 5HM2A 2FOMB 1OS8A 4AOQA 4FU8A 1HIAA 1QIXB 2GP9B 8GCHF 1CA0C 4K8YA 3GY8A 1PPBH 1ARCA 1VR1H 2JH0D 5CE1A 1QZ8A 4I8LA 3N7OA 1OKXA 5HIZA 4AB8A 3M5OA 3LONA 1NRRH 1PQ8A 1YPHC 1GWAA 3I78A 2BXUH 1GHXH 2GKVE 1ABJH 2J95A 1NBME 4I8KA 2XCFA 4MPUA 3MH5A 1FX0B 3ZZ3A 2ZFPH 1D3DB 2C8ZB 2VWOA 1C2HA 1KIGH 1V2PT 2OC8A 1IAUA 3QGNB 3GDSA 1QRXA 2PKSB 2G81E 1TRNA 2ZIQH 1A0HB 1C5OH 1DUEA 4X0WU 2CMYA 5TJXA 5FX6A 2RFKC 5EPYA 4FUGA 2FDAA 3RXSA 3GYLB 3SJIA 3RM0H 1AZ8A 2ZCHP 5E0JA 4Q7XA 1EAIA 3FZZA 1CHGA 2QF4A 3STJA 3UR9A 5ABWA 1TNIA 3LGVA 1Z1JA 3PWCA 3E3TA 1DDJA 2XNDD 1K1JA 3HK3B 1LHEH 3DFLA 1DWEH 3PV2A 1ESTA 2ZNKH 2PGBB 1AU8A 3KL6A 2OC0A 4CBOA 5A8ZA 2XBVA 1J14A 2A45B 3PRBA 3OX7U 1INCA 3PM3A 1IQIA 1GI3A 4Q63A 3OY6U 3S0NA 2W7UA 2L74A 2AMPA 2A7CA 1P06A 5T6GA 1Y3WA 2YNBA 2FLRH 4GCHF 3PRDA 1BMLA 4D8NA 1E79D 1SGNE 4ABFA 3KYGA 2C90B 4FUEA 4IC5A 1Y3VA 2A31A 1BMFD 2OLGA 2RDLA 3AVZA 2W26A 2SGFE 2Q1JA 1FJSA 2J97A 4I8HA 1P2IA 5EODA 4B71A 1MQ5A 1DOJA 1MZDA 2A4OA 3SJOA 2HVYB 4ABEA 2A4QA 3M61U 3UOUA 1A7SA 4ABGA 1QA0A 1LO6A 1X7AC 4I86A 1DSTA 1UO6A 3VB5A 2GGVB 4B1TA 1O5DH 3RXEA 2GX4A 5HKKD 2OP9A 1EXFA 1SL3A 5EIYA 1AFEH 1H9IE 2WHXA 1O5FH 1TGSZ 3TJNA 4DIIH 1BUIA 2OQUA 1BBRK 1O2IA 3LU9B 1AY6H 1BB0B 3PTNA 3STIA 3BG8A 4K69A 1W8BH 2LPRA 3QX5H 5C1YA 4LOYH 3VFEA 2HOBA 1KXDA 1C5LH 2A4RA 1FZZA 5LPRA 3BEIB 4RT0A 3RXGA 3WWFA 2FI3E 1P2OA 2ZDMA 4NSVA 3UAIC 1ZJDA 1GJBB 3WY8A 1ZPCA 3FN8A 1D4PB 2TRMA 1ELGA 2Z9LA 3MNBA 1ELFA 1SGTA 3Q76A 2Y5HA 1P01A 2LNCA 1OP2A 3MH4A 4MVNA 1P2KA 1IQJA 1EB1H 4F55A 1SOTA 4B2CA 2ZU5A 1NS3A 3A80A 3LKWA 4H6SB 1IQGA 1QFKH 1YKTA 3OE7D 5T3HA 3VEQB 3MO9A 1C9TA 4MNWA 1EJNA 3ZZAA 5C20A 3ATLA 4NWKA 1ZPZA 1XUJA 2PW8H 3SU5A 1Y3YA 3BTEE 5F6MA 5LPEA 4NFFA 2R0LA 4B6EA 1WQVH 2IOTA 3Q3KA 1THRH 2BVRH 2VNTA 1TBRH 4AG2A 4X1SU 3RU4T 4Q7YA 2ZWLH 3MFJA 3NXPA 2Z3CA 2F43B 5DP8A 1HB0B 2FWWA 3LIWA 1MTVA 5FBIA 2VIOA 1LPKB 1C2IA 3EA7A 1DXPA 1TIOA 2H5CA 2KCOA 1C5XB 2WPJS 3M37A 3UWIA 4XBCA 4MPWA 4O03A 2A0QB 3LGYA 2HALA 4NFEA 1AUJA 1IQKA 1HNEE 1TMBH 2VWMA 3SGQE 1O2QA 2HPPH 1Y8TA 1AIXH 2YOLA 1U6QA 4IN1A 3P8NA 1TX8A 4FUFA 3T28A 4E06H 2Z9JA 1HJ9A 3H09A 2ZFQH 3SQEE 1BOQA 2ZEBA 4UFEH 1AHTH 1O2MA 2YMSB 1SGFA 2ALVA 3PB1E 4CRAA 4O9VA 1TOCB 1OWJA 4RT1A 1PPHE 1V2QT 4CRBA 4FVDA 1BMAA 2HNTF 5DPAA 2RA0A 3M36A 1L1NA 3RXQA 1ACBE 1O2ZA 2ILNA 4ZKNU 3UNRA 4LK4A 4U01A 3GISB 2OINA 1C2LA 4YT7H 1ZMNA 2I6SA 1L4ZA 1RJXB 3DCLA 3T62A 4BXSA 2W6JD 2O9QA 3ZZ9A 5A0AE 1AFQC 2R9PA 5DJ7A 2GCHG 1O32A 1GI8B 2PSXA 2ZZUH 3KQDA 1QQUA 3MNCA 3OTPA 1GI7B 1Y59T 2Z9GA 1AGJA 2D8WA 1F7ZA 1HCGA 1AE8H 1THSH 1TLDA 1EZQA 2B9LA 2PLXA 3F2GA 2XC4A 2FODA 5C17A 4INLA 3U8OH 3PV5A 2ZU4A 2WPMS 1T8LA 4ZMAH 5A0BA 1PPZA 3RXUA 1CGIE 1DFPA 4B2BA 2GD4B 1GPZA 1DS2E 5HMAA 3MWIU 1NM6A 3BV9B 1GBHA 3K9XB 4DT4A 2FM2A 1NRPH 2V3MA 4WXVA 1N8OB 1SBWA 1EUFA 1J16A 4BAKB 2STBE 1JIMA 2BY5X 1EFRD 3VB4A 1AVGH 4RI0A 2XBWA 2BLVA 1SMFE 4H6TA 1GBMA 4ABDA 2GCTB 3MTYA 4NZLA 5EJ1A 3M35A 5JYIA 2TGPZ 1FY1A 4Z6AH 1COWD 3T2NA 1XUIA 1ZJKA 3ODFA 5T1VA 1QB1A 3BTDE 1DY8A 3K2UA 5G4BA 3VXFH 1GVKB 9ESTA 4YZUA 2C4FH 3RUOA 3RXPA 3ELAH 2KX4A 1Z6EA 2Z9IA 2FTMA 1MBQA 3PMBB 1OPHB 4MNYA 2BD7A 1XX9A 2V35A 2J34A 1E36B 1RS0A 1RRKA 1D6RA 4UD9H 1S6LA 3D49H 1DITH 1YCPM 2Q6GA 2ZI2H 4WF8A 1V2RT 4WWYA 2YMSC 1ZMJA 2ASUB 4F48B 1TONA 1WU1A 4LZ1H 1K0HA 2BD8A 5JBBS 1ABIH 2AGGX 4Y76A 1TBQH 2IN2A 4Y79A 2Z7FE 4HGCA 3MQKC 2B5TB 1DWDH 1ZMLA 3MNXA 3EE7A 4KGAA 1KDQB 5CHAB 2GV7A 4FETA 2PHBA 4O97A 2Y6TA 3SHCH 3DT0H 1EOLA 2H2ZA 1MD7A 2QC2A 4A92A 1BCUH 1S6FA 3UB0A 1LVBA 2V7QD 4AORA 1BMNH 1CGJE 2DE9A 1KDQA 1CGHA 1AKSB 1GDQA 1SGIB 4ESTE 3BF6H 1ETSH 1Y3UA 1UTPA 5GJ4B 4AFUA 1PPFE 1JBUH 1GMDF 2D26C 3PO1C 1QBOA 3SGAE 3ZVDA 4YOJA 2ZU1A 3RMLH 1Q3XA 4MDSA 1TNHA 1ZRBA 3ESTA 2CJIA 3O8CA 2A5AA 3M3SA 2BD2A 1GBTA 1GJCB 1WUNH 3SW2B 1AKSA 3AW0A 1TNGA 2GJGA 2TIOA 1L2EA 2H9HA 2GDEH 2UUKB 1UVOA 3BTME 2CK3D 3GYMA 4E7RG 1V2KT 1N8OC 2QXJA 2A2QH 1T31A 2HNTC 3F9GA 2ZA5A 3HPTB 3MU8A 1IHTH 4KTCA 1C5QA 1K1NA 2AMDA 1EQ9A 1GI6A 4D76A 1QRZA 3QTVH 1DWBH 2R0KA 2UWPA 3SNCA 1GMDG 2QF3A 2ZECA 1HUTH 1NPMA 1ANDA 1O5GH 3N99A 2J2UA 4CREA 2FOBA 2ZFTA 5C67A 2P3TB 2PUXB 1O3LA 3RXOA 1O37A 1RTKA 3VB6A 2XNIA 1V2MT 1UCYK 2VB0A 3F3BA 2ZTZA 1GBIA 2V0BA 3RLYH 5GNDA 1ETRH 1DX5M 1TABE 2QXHA 4ACAA 4Y8YA 2FTLE 3GCHB 1PPEE 1BTPA 3F9EA 4XBDA 3BG4B 1F0UA 1SG8B 3PMHB 1MZAA 2P3UB 3HGNA 1A4WH 4F4OC 1WSSH 4I33A 3S7KB 3S9BA 1VZQH 1A1RA 1GBFA 4PROA 2AIPA 1YPKH 3SO3A 1OWKA 1GBLA 3SYJA 1ELVA 3GICB 3E8LA 1VCQA 1D6WA 1ZSKA 3QO6A 2QAAA 3F2FA 3KHVA 3QN7A 2QA9E 4YM9A 3HATH 1P12E 3S69A 1F0SA 2XWAA 5FPSA 4UDWH 5KEDA 2QYIA 5CHAC 1YLCA 1C1RA 1YC0A 1P9UA 2F9UA 1Z8RA 3GCNA 1O5CB 4GAWA 1GDNA 3MI4A 2ZDLA 1NFWA 1YF4A 1QHRB 4I8GA 2QF0A 3UREA 1YCPK 1O3DA 1NO9H 1QA7A 2RDEA 3TLOA 3N7EA 2O8UA 1IQEA 2BLQA 1XVOA 4AYVB 2ZFRH 2A32A 1BTHH 1JRSA 1TPOA 2XWBI 3Q3YA 1XXDA 4D7GA 4AZ2B 1CO7E 2SGDE 1UK4A 4ZROA 3BTKE 2OTVA 5ESTE 1LQDB 1A3EH 1F5KU 4P00A 1K1MA 2QE7D 4NG9H 3GDVA 1GJ4H 2WV4A 2SGQE 3FP6E 3ENSB 1EASA 4ZAEA 1GL1A 2PWXA 1GI9B 4DG4A 5EW1H 4CR9A 1HPGA 2IJD1 2QCYA 2VIVA 3S7HB 4ABBA 1KXAA 1HAHH 3ZV9A 2QGRA 1GBDA 3QDZB 1GHWH 1BTZA 1C2KA 1LTOA 1TA6A 2WYGA 1MU8B 5FXLA 4B76A 3M7UA 1QCPA 1D3PB 1ZGVA 3EA8A 1MBMA 2O8LA 2HNTE 4X8SH 2WYJA 1MAXA 3TITA 4LXBH 4JYUH 2TBSA 4UFDH 1MTNC 1HJ8A 3MO3A 3URDA 1GI2A 1ESAA 1W13U 1N6YA 5LGOA 1W0YH 2DUCA 3S9AA 1A5GH 3T25A 1YLDA 1O5BB 4JCNA 3E16B 2P95A 1Q2WA 2R3UA 4A7IB 3RXTA 1GHBG 4ISLA 4YLUA 5E0GA 4TWYA 3TK5A 3TH3H 1BT7A 5HXFA 1ZOMA 3TK9A 1FQ3A 3QTOH 4FUDA 5F53A 1O3NA 1NRQH 1RIWB 2P16A 1GJ5H 4A1VA 3M5NA 4OS6A 1GG6B 3HGPA 1EKBB 4NWLA 4JZEH 1C5NH 1P2MA 1FIWA 1UTMA 3VPKA 1S85A 2ZGBH 2HPQH 2OBQA 3W94A 1W14U 2AH4X 3EA9A 3P6ZB 2FX4A 1TOMH 4JZ1A 1QNJA 2H1UA 4TYDA 2GZ8A 1GJ6A 4MG3A 1FPHH 1PYTD 1ID5H 3TU7H 2WPKS 3M5MA 3UUZA 1UTJA 3V7TA 3QZRA 2F83A 2FOEA 3KIDU 1O38A 3RXIA 1V2NT 1ZTKA 2BZAA 2FOHA 3OSYA 6CHAB 4O3TA 3KQCA 5GPIB 4Y71A 3SU3A 1AWFH 3ATIA 1CSOE 3SUGA 1YBWA 3PV4A 1ELBA 2ODYB 1CHOF 4ISOA 1ETTH 1JMOH 1DT2A 5T6FA 3DD2H 1BBRE 4H4FA 1SFIA 1ELDE 2ZTYA 1F0RA 2G00A 1TNKA 5GXPA 1PQ5A 3SV7A 1QY6A 1J9CH 3FKSD 1AE5A 2NU4E 1FI8A 1P03A 3B9FH 1WQSA 3A82A 1LVMA 1GJ9B 2CXVA 5EJLA 1IOEA 3VGCB 3ITIA 1HAOH 3DHKH 1K1PA 2C8WB 3LGTA 4BOHA 1T4VH 1TE0A 1NRSH 4R0IA 2XTTB 1IHSH 1SSXA 1T8MA 3D65E 2J4IA 2CF8H 4IC6A 4LZ4B 1C4V2 2UUYA 1CHOG 3SU6A 4X2YA 1BDAA 3S9CA 1H4WA 1THPB 1TA2A 2BD4A 1C2JA 2HLDD 1TMUH 3UIRA 3ZZ7A 1Y5AT 1Z71A 1HAGE 4GVUA 5EQRA 1O2KA 1GBEA 1GHVH 4ACBA 2P93A 4AFSA 3L6PA 1EZUC 2J92A 2V3HH 1UW7A 2ZG0H 1FONA 1GVLA 1NBMD 1P8VC 4BNRA 3LDXH 1OHHD 3R0FA 3H7TA 3OEHD 1OWIA 4DCDA 3U28C 4X1NU 4FXGH 2ZGXH 1H9HE 1GG6C 4NIXA 1O2OA 1P09A 2D2DA 1AMHA 2VBCA 3TJUA 1EX3A 3OU0A 4E7NA 3T5FH 2ANYA 1GCTB 3BTHE 1ZRKA 3I77A 3FP8E 5LPFA 4MPXA 3ZZ6A 2ZKSA 1FPCH 2STAE 3BTWE 1OOKB 2ZDKA 5HM9A 1IQMA 1NFYA 3OAAD 3A86A 5K0HA 4CR5A 5C5NA 2PFEA 1O2UA 2PKSC 2WUCA 3K6ZA 1UJ1A 5FPTA 4HI3A 1V2WT 1YPHE 1IQFA 2G4TA 1EJAA 1YPJH 5GIBA 1ANCA 2IPHA 2G52A 2BXTH 1GI4A 3FAOA 4X8VH 4XD7D 3FVFB 5L2YH 5GCHG 2BQ6B 1C4U2 1LVYA 1QL7A 4XOJA 2FP7B 1OP8A 3F0PA 1GJ7B 5AVDA 5EXMA 3ODDA 4OS4A 2JH6D 1O3EA 1WTGH 2W3IA 2ZPQA 3ZYDA 1O3GA 2EA3A 3RMMH 4AGKA 1AQ7A 1SQAA 3BTGE 2R2MB 2BX3A 4JK5A 3RXDA 2WUBA 2ULLA 4CHAB 3E0NB 5EG4A 1O3CA 1F2SE 2WV9A 5IYTA 1P9SA 4J2YB 1FDPA 1K9OE 3GY4A 5IDKA 2PSYA 2QN5T 3VGCC 1IQLA 4X2WA 5B6OA 3O8RA 2GZ9A 2EQNA 3EQ0H 1A61H 2FYRA 1MKXK 5C5OA 4DVAU 2GCHF 1PQAA 4ZXYH 5FAHA 2VJ1A 4BTTB 2BQWB 1E1RD 2BDCA 8LPRA 1MKWK 1E0FD 2ZHWH 4Y7AA 4K5ZA 1CA8B 4Z1MD 2OC1A 4HFPB 3A8CA 4MNVA 3MO6A 1SKYE 5I25A 1Z7KA 3U98H 2BDIA 3FANA 1DVAH 7ESTE 3TVJB 3SU4A 2C8XB 4Q7ZA 1F5LA 3IWMA 2ZU3A 1WOFA 3B23B 1VCWA 4CH8B 1SHHB 1KLTA 1V2JT 1BRBE 2CF9H 2W3KA 4TSFD 4Y10E 4ZXXH 3V12A 1AB9B 3GOVB 2Y82A 4H42U 1WDIA 4RKJB 4INKA 1KSNA 3QWCH 1C1TA 1VJAU 1E37B 1NTPA 3HK6B 1SGCA 3SORA 2H9TH 1A46H 1GDUA 3A84A 2I6QA 1OWDA 3NZIA 3BIUH 1GMCF 2F9PA 1O35A 1O3HA 1V2ST 2C3SA 3PLBA 2HLCA 2R3YA 1K2I1 1GCTC 1S82A 1NC6A 4K3JA 2WPLS 2NU0E 4FOUC 3TNTA 3LJJA 3TPIZ 3KCGH 1QJ6B 4ASHA 1ZSLA 2SFAA 2P8OB 4CBNA 2BDHA 1VITH 1G9IE 2ESTE 1P3CA 4MQAA 4MPVA 3F0OA 4ISHH 5J4SA 4CRDA 2SNWA 1G2MA 3SNEA 1S81A 4MNXA 3SNBA 3GCTF 1WV7H 3TH2H 1DPOA 3CS7A 3RC5A 1S5SA 3VB3A 3ZYEA 1EJMA 2XXLA 5EU8A 4AX9H 1HFDA 1CT4E 1O5AB 4A5TS 2UWOA 4GSOA 3MH7A 4ZUHA 1SPJA 3FOAA 4XDEA 3NUMA 4OS2A 2EY4C 5DP7A 1GMCG 4ZCNA 2VGCB 3U9AH 4WMEA 1O3AA 2FXRA 1CT0E 1K1IA 2BOKA 2CHAB 1GCDA 1MTUA 4J1YA 1F92A 4ABJA 4IW4E 2F4LA 4CHAC 1KMHB 3MOCA 4K1SA 3MU1A 5KGOA 1W11U 2AHME 2GMTB 3UNQA 3VXEH 2AFQB 1BJVA 5JPMH 1LDTT 3K6YA 1FXYA 5L30H 1E35B 5JBAS 1BRCE 2Y5GA 2GT7A 3F2HA 4D9RA 1G3BA 2YNAA 3A7XA 3M5LA 2IPQX 4WVPE 1P3EA 3GCTG 4TPIZ 4Y6DA 1Y5UT 2ZTXA 2GT8A 2ZF0H 1FIZA 1O2WA 3BSQA 1SGPE 4TT3D 1RFNA 4ISNA 3OFND 1OP0A 1C1PA 2TPIZ 3TGKE 2QIQA 3GY7A 5DN6D 2BY6X 1Y3XA 4KKDA 2JJ2D 2XBYA 2Y5FA 1FAKH 5JDUB 1O2LA 2AERH 4MTBA 3UOPA 5DKMA 4BAHB 3U1JB 2FO9A 3JZ1B 3RMOH 1NFUA 1GHZA 4IMQA 1IQHA 3IG6B 1AO5A 4I8JA 1WAYB 1AB9C 1GJDB 3NRLA 5CMXH 3LH3A 1P57B 1O3PB 1HAXB 4ZH8A 1C2FA 1SLUB 2M2AA 3KQEA 1TRMA 2Q6DA 3P92A 1FV9A 1DLKB 3DA9B 1UCYE 1NU7B 5EPNA 3ZZ4A 4XFQA 2H5DA 1TPSA 5EXLA 5EOKA 2BMGB 3F1SB 3PTBA 1EZXC 3A83A 3M7TA 1CE5A 1K1LA 5C1XA 3TJOA 3D62A 4X1PU 1EAXA 1H8IH 1PQ7A 4X1RU 2G5NA 3MHWU 3T29A 1XKBC 3P70B 1K21H 1IQNA 2FOGA 2P8OC 2PKAB 1D3TB 3SV8A 1HAVB 1N1LA 2G51A 3UY9A 2SGAA 3M3TA 1PYTC 2EEKA 4FU9A 3KQ5A 2JKHA 1FNIA 5IK2D 2Z3EA 3SGBE 2VWNA 1LPGB 2WZQA 2PKAA 4JZIA 3BEUA 4OS1A 2ZQ1A 1VGCB 1XM1A 1HAVA 1C1SA 2BX4A 1GBAA 1D3QB 4XSKU 3SUDA 1ZSJA 2BLWA 1SB1H 1O2JA 5DO4H 3E0PB 2VGCC 2BTCE 3V0XA 4NGAH 2TGAA 1L1GA 1QR3E 5B6LA 1DM4B 1VJ9U 1O30A 2GCTC 2VIWA 4DGJA 1V2OT 4ISIH 1TMTH 1SR5C 2AEIH 3FO8D 3LC3A 2CHAC 1C5UA 1SI5H 2BHGA 3QZQA 3LOXA 1ANEA 3OYPA 5CDFE 1UVSH 2GMTC 2JH5D 1TYNA 2FESH 4IMZA 1GHAG 1P10A 3DSOA 4M9FA 3QK1A 2ZCLP 3SV2H 3F9FA 1GI0A 3TK6A 2BDBA 2F91A 1O0DH 2BDAA 2LP6A 1B0EA 3A7YA 3AASA 4NIVA 1G2LA 4IBLH 1SLVB 5HYOA 3W95A 1RGQA 3LGWA 1C1VH 2G4UA 1SGYE 2Z94A 3GCOA 4JK6A 4NCYA 3ZV8A 1PJPA 1FN8A 3I29A 1KXCA 4RSPA 2FMJA 1EP5A 4FVBA 5EQQA 1EZSC 1O31A 4DY7B 2BDGA 5I46H 3T26A 1Q31A 2J9NA 1TPPA 3DUXH 4WY3A 3RU4E 2BQ7B 2AGEX 5TCCA 3HKJB 1O2PA 1NFXA 6GCHG 1T8NA 2F9VA 7GCHF 1BRAA 2B7DH 3P8GA 3SUFA 4X8TH 3E1XB 3PMJA 2KFWA 1CA0B 1Z6JH 2CV3A 1AD8H 3ZZBA 1S84A 5SGAE 3RC6A 1EPTB 1BTXA 4K8BA 1N6XA 1YPGH 1RTLA 2KCAA 4FUBA 2ZGJA 2IJOB 2A5IA 1TGNA 2QXIA 3SN8A 3RC4A 3RDZA 3A7WA 2JDID 5DP5A 1C1MA 1GJ8B 1FLEE 1SHYA 2XCNA 5DK1A 3TJVA 2HGTH 3NK8A 1EATA 2WPIS 3ZVGA 4RKOB 1JWTA 3AAUA 1UK2A 1EPTA 3G01A 3MU5A 1TGTA 3GY5A 5TCAA 3KNXA 1H9LB 1K28D 5BRRE 1LCYA 1HRTH 1QB9A 3AK5A 4AFZA 1G3DA 1A3BH 2ZQ2A 1T4UH 2WPHS 1TALA 2VH6A 3SU1A 4AC9A 1SQOA 3LJOA 3H5CB 7GCHG 1GHBF 1NRNH 1ELAA 2AYWA 2RA3A 4ZKRU 5L6NH 1CVWH 1G32B 2J5UA 5A09A 1DLEA 2L6OA 4GPGA 4KTSA 1O2XA 4NZQA 1BTUA 5C2ZA 2CGAA 4Q80A 1S0QA 4R8TB 3P8FA 1JRTA 1DXWA 1E38B 4Y0ZE 4DOQA 4Y8ZA 3E91A 3OY5U 1TFXA 1WTHD 1WBGB 2ZCKP 3FP7E 2FZZA 2JETB 2R2WU 3UPEA 4NA7A 3LC5A 4Z0KA 1O2YA 2P59A 4K60A 1T32A 1LPZB 4XBBA 1QRWA 1ANBA 1P02A 2CN0H 5H4IB 4B74A 1K1OA 3RXVA 2A1DB 3NKKA 1G30B 1ZYOA 2FS9A 3GCHC 1C5PA 1F0TA 2G8TA 3RXJA 5PTPA 3BG4C 4YOIA 2BYAX 3EYDA 5HIYA 1C9PA 1ZTJA 3CP7A 1LQEA 2EI7A 1GMHG 1HAZB 1BTYA 1MTSA 3KQBA 1C1QA 3BTTE 1V2UT 4WH6A 1SGEE 1UTOA 4YT6H 3CS0A 1MCTA 1UVPA 1MCVA 1XUHA 1KLJH 3PMAB 3Q77A 1ZPBA 4QT8C 4CH2B 3E90B 4Y0YE 1O3KA 1ELCA 4D9QA 1ZHMA 1EPTC 4ZKOU 1W10U 1C1UH 4WJG2 2QF5A 4ZHLU 3UQVA 1P0SH 3VB7A 5AF9H 3KGPA 2XW9A 3SBKA 3SJ9A 2UUJB 1HBTH 1TRYA 4ZHAA 1FMGA 2WV5A 4U30A 4VGCB 1XKAC 2NU2E 1TNJA 1C1WH 4FUHA 1BA8B 1VCPA 1S83A 2W5EA 1SC8U 5AFZH 1TAWA 1YCPH 2FLBH 2PTCE 3LGIA 4I31A 3RXCA 5DP6A 1NT1A 2BLOA 1MTWA 4GHTA 1K22H 1OSSA 2OK5A 4KTUA 3U1IB 1O2RA 1V2LT 4MLFB 4X8UH 3NPSA 3SZEA 4A6LA 8GCHG 2KAIB 2Y81A 3EE0B 1SLWB 5ESBA 5LH8A 4DT7B 1GHYH 1O2TA 2XC5A 2TGTA 1MH0A 2J94A 4X6MA 2FS8A 2WPDD 2ALPA 5A0CA 4Q4LA 1AZZA 3SHAH 3MMGA 1P04A 2Q6FA 2RG3A 1WXRA 2KAIA 2JETC 1O3JA 4IGDA 3DFJA 1XXFA 1O34A 1SVPA 5CHBA 1LHDH 3SU0A 3TH4H 2EI6A 3ZVEA 3LT3A 1QQ4A 1O3BA 2HVXA 5GDSH 4Y11E 1YLNA 3TGJE 3ATKA 1J17T 1ELTA 2GDDA 1FN6A 2B0FA 1GBJA 4GUXA 2K8IA 1C5TA 1LHFH 4KELA 2B8OH 1KYNA 1TGCA 4XE4A 4X6PA 1TBZH 4BAQB 5K7RA 3M3VA 4K2YA 1PFXC 7KMEH 1TGBA 4THNH 3TGIE 1O3MA 4IN2A 5GCHF 3MU0A 3SUEA 2PUQH 1XUGA 1RIWC 4DURA 4AB9A 1KTTB 1W3CA 3H7OA 4NA9H 4I32A 2BD9A 5EXNA 1LKBA 2HRVA 1GI1A 2V6NA 1WCZA 1ZGIA 4JMYA 1PPCE 5E2PA 1G3EA 1UVUH 3SV9A 2O8WA 1SQRA 4JYVH 4OS7A 2OD3B 1KLIH 1O36A 2BOHB 3RXMA 1RXPA 4WMDA 1W2KH 2UUFB 2KM0A 1AFQB 3P17H 4GCHG 3RMNH 1ZZZA 4OM9A 4ABAA 2FOCA 2VIQA 1O39A 3RXAA 1GI5A 3A8BA 1G36A 1O33A 2LELA 4TY7A 6CHAC 3JZ2B 1DE7H 1CU1A 1NZQH 4X2XA 1V3XA 1C4Y2 4FUCA 3BIVH 8ESTE 2ZPSA 1TWXB 3A7ZA 3U8TH 3WWBA 4AG1A 5FHTA 4VGCC 5ETXA 3UNSA 1DWCH
chains in the Genus database with same CATH topology
3E6PH 1G3CA 3UWJH 1BRUP 2FI5E 3ZVAA 2A4GA 5EW2H 1A0LA 2OUAA 2VH0A 4FU7A 1AN1E 2BD5A 1L1JA 4AN7A 1QBVH 2BD3A 3A7TA 2VVVA 1LHCH 2G5VA 1CQQA 2FOAA 1OX1A 2ZU2A 2A7JA 1OYTH 3NCLA 4YOGA 1PPGE 3KF2A 1RTFB 1ELEE 4X6OA 1EAUA 3TIUA 4AGJA 1OYQA 1EOJA 2ZDNA 1QB6A 2VVCA 3P95A 2F3CE 3IITA 1CBWB 3LPRA 1SGFG 3SOSA 1P2JA 1O3OA 1W12U 3R3GB 9LPRA 1QTFA 3A8AA 7LPRA 3PROA 1DSUA 2J38A 1FY3A 1XVMA 1UTKA 4X2VA 2ZGCA 2SNVA 4AFQA 2WINI 2THFB 1O5EH 2Z9KA 4Y7BA 5E2OA 1Y5BT 2GZ7A 3PYHA 1EB2A 1T8OA 2HWLB 4WH8A 5DP9A 1P2QA 1M9UA 1JXPA 4KP0A 2QY0B 3SI4H 1A2CH 5JB9S 1HXFH 1TQ7B 1P05A 1J8AA 2Y80A 1TX7A 1Z8IB 1C2EA 1MU6B 4OGYA 5FCKA 4DW2U 1YM0A 4B73A 4TY6A 2VIDA 1SGDE 1TX6A 3PLKA 1J15A 4ABHA 3ATWA 1LVOA 1XUKA 1BHXF 1C5RA 4TWWA 1Z8GA 2ZFFH 1NU9A 2VINA 1ZHPA 1C1OA 1SOZA 2Y7ZA 2EC9H 2C93B 3L3TA 3O8BA 1BBRH 3BEFB 1W7GH 5BPEA 5FCRA 1BTWA 3EGKH 2Z3DA 1DY9A 1S6HA 1ARBA 1V2VT 2NU1E 1FY4A 1TB6H 2ANMH 3PO1B 5T6DA 5JB8S 3PWBA 1W0ZU 3RXBA 1QJ7B 3EDXB 4F49A 1OWEA 5FBEA 2OCVB 2ZDAH 4Q2KA 5C3NA 4RN6A 4CRFA 4DIHH 1SFQB 1E34B 2PR3A 2ZHDA 3SJKA 2K1QA 3URCA 3RM2H 3ATMA 1EP6A 3ZVBA 1HGTH 1C2DA 1ORFA 3FZDA 2NU3E 5C1UA 2NWNA 1NESE 1W7XH 1C5SA 1BHXB 2ODQA 1ZLRA 1SGQE 1FY8E 4BTIB 1OWHA 4CRGA 1KXBA 1XUFA 3QGJA 2AIQA 2G55A 2QV1A 3D23A 5FPYA 1UMAH 2XBXA 1CBWC 3ZZ5A 2A5KA 3RP2A 2ZHQH 1DUAA 4FUJA 1VITF 4GLYA 1V6DA 1GGDB 1P2NA 2H6MA 3BN9A 2BVSH 4I7YH 4BAMB 1HJAB 1O2HA 2XYAA 2O8TA 3V3MA 4E05H 1LHGH 3GY2A 1ZHRA 3OTJE 3RXFA 2ZFSA 2DE8A 2FOFA 2VU8E 1ZR0A 3TNSA 1MKXH 1UK3A 1JIRA 3PLPA 3SV6A 2BB4A 1FAXA 5F03A 1B0FA 2ANKH 2F9BH 1HDTH 1MKWH 1O2SA 2F9NA 3MYWA 3A88A 4Y8XA 1RD3B 4UFFH 2BY9X 2FI4E 4X6NA 1BJUA 1QL9A 1SQTA 1YGCH 1HAIH 4YLQH 1UTQA 5A2MH 1YYY1 2BY8X 1F5RA 1VITG 4JZDH 1BQYA 4NSYA 2BDYA 5F8ZA 5L2ZH 1D9IA 4UE7H 1UVTH 1YP9A 1LMWB 2BY7X 2VIPA 4M7GA 6LPRA 1GHAF 1HAPH 2F9OA 4JYTA 1C5WB 5DP4A 1O2NA 5J4QA 4BXWA 1NN6A 4UFGH 1FY5A 3C27B 4WXIA 3SI3H 1ESBA 5JBCS 1T7CA 3HKIB 1SGRE 3KEEA 5DGJA 5F8TA 3F9HA 2ZC9H 1EAWA 3ZZCA 3BTQE 3SU2A 2PGQB 4X1QU 1NY22 4JZFH 4BAOB 2P94A 3V13A 2V3OH 6ESTA 1MD8A 1C2GA 3MNSA 1GBCA 1MMJN 3KN2A 1L4DA 4NIWA 3U69H 3NWUA 2FEQH 5AHGH 6GCHF 2OBOA 3F6UH 3UR6A 1LKAA 4SGBE 1YPEH 1HV7A 1O3IA 1QBNA 1KXFA 2ODPA 2ZHEH 3BTFE 1O2GH 4WMFA 2AS9A 3SJ8A 8KME2 4IS5A 4GHQA 2OXSA 1JOUB 1P11E 2ZO3H 4OGXA 4A1XA 1UTNA 4NA8A 5JBTA 1O3FA 4D7FA 5HGGA 1MTNB 1QL8A 2ANWA 2H9EH 2ZHFH 1GGDC 2W7SA 1YPLH 3FFGA 1HJAC 5E8EH 3A89A 4U32A 4K1EA 1Z1IA 4BANB 2PTNA 4ZHMU 3U8RH 5GWZA 2XC0A 1HAYB 2UWLA 4SGAE 3SNDA 1B5GH 1GBKA 1QJ1B 2AGIX 3A8DA 4FUIA 1BZXE 1QGFA 3CENA 1KXEA 1GBBA 1UHBB 4U2WA 1UTLM 4A1TA 4ZKSU 2D1JA 1C5ZB 2A7HA 1KTSB 2QXGA 1BMMH 1CT2E 2ZGHA 3LH1A 5E0HA 4YTAA 4O3UA 2GV6A 2FIRH 1ZTLA 3RLWH 4UONA 1UHBA 3F68H 4K1TA 3SNAA 1G37A 4B2AA 3UTUH 2XRCA 1QURH 4B75A 2BVXH 1GL0E 4HTCH 1B7XB 1WYKA 2GTBA 1MUEB 2M5TA 1XMNB 1GJAB 1A5IA 3GY3A 2Z6BD 4ABIA 2A2XH 1GVZA 5EQSA 4YESB 2FYQA 5A8YA 3ZZDA 5FX5A 3UFAA 2VWLA 3QUMP 1HXEH 2FX6A 1DICA 2EI8A 4NIYA 3M7QA 3A87A 3RXKA 5EGMA 1O2VA 2O8MA 4HZHA 4TPYA 1S0RA 4YO9A 1A5HA 1AVXA 3SQHE 1AUTC 1VGCC 3RXHA 1C5YB 5AFYH 3A81A 3C1KA 2OQ5A 3QLPH 1DANH 4BTUB 1H8DH 3GDUA 1C2MA 1GMHF 4OS5A 1AI8H 2SGEE 3AW1A 2BZ6H 3RXRA 5DP3A 3LGUA 1A0JA 3RXLA 5A8XA 4AYYB 2ZPRA 2BM2A 5DG6A 3AAVA 2OC7A 3Q00A 1C5MD 3P8OA 3ZVFA 3SZNA 2RCEA 3ZVCA 3K65B 1C1NA 1MAYA 3Q3XA 1L0ZA 2AMQA 1FUJA 4UEHH 1TPAE 1H1BA 3RU4D 1V2TT 1OXGA 2GVFA 1AWHB 1BIOA 2PV9B 3MH6A 5F8XA 1HYLA 2TGDA 3ZZ8A 3MU4A 1SLXB 2FPZA 3EAJA 2SGPE 2ZP0H 2ZDVH 1C5VA 4DJZB 1NROH 1HLTH 1YPMH 3L33A 3A7VA 4CRCA 1BITA 3B8JA 1TNLA 1TQ0B 1HIAB 1UCYH 1MQ6A 2Y7XA 4INHA 3T27A 1AVWA 3O8DA 2C8YB 3A85A 3GY6A 1KY9A 2VVUA 2P3FH 1Z8JB 3UQOA 5HM2A 2FOMB 1OS8A 4AOQA 4FU8A 1HIAA 1QIXB 2GP9B 8GCHF 1CA0C 4K8YA 3GY8A 1PPBH 1ARCA 1VR1H 2JH0D 5CE1A 4I8LA 3N7OA 1OKXA 4AB8A 3M5OA 3LONA 1NRRH 1PQ8A 1YPHC 1GWAA 3I78A 2BXUH 1GHXH 2GKVE 1ABJH 2J95A 4I8KA 2XCFA 4MPUA 3MH5A 3ZZ3A 2ZFPH 1D3DB 2C8ZB 2VWOA 1C2HA 1KIGH 1V2PT 2OC8A 1IAUA 3QGNB 3GDSA 1QRXA 2PKSB 2G81E 1TRNA 2ZIQH 1A0HB 1C5OH 1DUEA 4X0WU 2CMYA 5TJXA 5FX6A 5EPYA 4FUGA 2FDAA 3RXSA 3GYLB 3SJIA 3RM0H 1AZ8A 2ZCHP 5E0JA 4Q7XA 1EAIA 3FZZA 1CHGA 3STJA 3UR9A 5ABWA 1TNIA 3LGVA 1Z1JA 3PWCA 3E3TA 1DDJA 1K1JA 3HK3B 1LHEH 3DFLA 1DWEH 1ESTA 2ZNKH 2PGBB 1AU8A 3KL6A 2OC0A 4CBOA 5A8ZA 2XBVA 1J14A 2A45B 3OX7U 1INCA 3PM3A 1IQIA 1GI3A 3OY6U 3S0NA 2W7UA 2AMPA 2A7CA 1P06A 5T6GA 1Y3WA 2YNBA 2FLRH 4GCHF 1BMLA 4D8NA 1SGNE 4ABFA 2C90B 4FUEA 4IC5A 1Y3VA 2A31A 2OLGA 2RDLA 3AVZA 2W26A 2SGFE 2Q1JA 1FJSA 4I8HA 1P2IA 5EODA 4B71A 1MQ5A 1DOJA 1MZDA 2A4OA 3SJOA 4ABEA 2A4QA 3M61U 3UOUA 1A7SA 4ABGA 1QA0A 1LO6A 1X7AC 1DSTA 1UO6A 3VB5A 2GGVB 4B1TA 1O5DH 3RXEA 2GX4A 2OP9A 1EXFA 1SL3A 1AFEH 1H9IE 1O5FH 1TGSZ 3TJNA 4DIIH 1BUIA 2OQUA 1BBRK 1O2IA 3LU9B 1AY6H 1BB0B 3PTNA 3STIA 3BG8A 4K69A 1W8BH 2LPRA 3QX5H 5C1YA 4LOYH 3VFEA 2HOBA 1KXDA 1C5LH 2A4RA 1FZZA 5LPRA 3BEIB 3RXGA 2FI3E 1P2OA 2ZDMA 4NSVA 1ZJDA 1GJBB 3WY8A 1ZPCA 1D4PB 2TRMA 1ELGA 2Z9LA 3MNBA 1ELFA 1SGTA 3Q76A 2Y5HA 1P01A 2LNCA 1OP2A 3MH4A 4MVNA 1P2KA 1IQJA 1EB1H 1SOTA 4B2CA 2ZU5A 1NS3A 3A80A 3LKWA 4H6SB 1IQGA 1QFKH 1YKTA 5T3HA 3VEQB 3MO9A 1C9TA 4MNWA 1EJNA 3ZZAA 5C20A 3ATLA 4NWKA 1ZPZA 1XUJA 2PW8H 3SU5A 1Y3YA 3BTEE 5F6MA 5LPEA 4NFFA 2R0LA 1WQVH 2IOTA 3Q3KA 1THRH 2BVRH 2VNTA 1TBRH 4AG2A 4X1SU 3RU4T 4Q7YA 2ZWLH 3MFJA 3NXPA 2Z3CA 5DP8A 1HB0B 2FWWA 3LIWA 1MTVA 5FBIA 2VIOA 1LPKB 1C2IA 3EA7A 1DXPA 1TIOA 2H5CA 1C5XB 2WPJS 3M37A 3UWIA 4XBCA 4MPWA 4O03A 2A0QB 3LGYA 2HALA 4NFEA 1AUJA 1IQKA 1HNEE 1TMBH 2VWMA 3SGQE 1O2QA 2HPPH 1Y8TA 1AIXH 2YOLA 1U6QA 4IN1A 3P8NA 1TX8A 4FUFA 3T28A 4E06H 2Z9JA 1HJ9A 2ZFQH 3SQEE 1BOQA 2ZEBA 4UFEH 1AHTH 1O2MA 1SGFA 2ALVA 3PB1E 4CRAA 4O9VA 1TOCB 1OWJA 1PPHE 1V2QT 4CRBA 4FVDA 1BMAA 2HNTF 5DPAA 2RA0A 3M36A 1L1NA 3RXQA 1ACBE 1O2ZA 2ILNA 4ZKNU 3UNRA 4LK4A 4U01A 3GISB 2OINA 1C2LA 4YT7H 1ZMNA 2I6SA 1L4ZA 1RJXB 3T62A 4BXSA 3ZZ9A 2O9QA 5A0AE 1AFQC 2R9PA 5DJ7A 2GCHG 1O32A 1GI8B 2PSXA 2ZZUH 3KQDA 1QQUA 3MNCA 1GI7B 1Y59T 2Z9GA 1AGJA 2D8WA 1F7ZA 1HCGA 1AE8H 1THSH 1TLDA 1EZQA 2B9LA 2PLXA 2XC4A 2FODA 4INLA 3U8OH 2ZU4A 2WPMS 1T8LA 4ZMAH 5A0BA 1PPZA 3RXUA 1CGIE 1DFPA 4B2BA 2GD4B 1GPZA 1DS2E 5HMAA 3MWIU 1NM6A 3BV9B 1GBHA 3K9XB 2FM2A 1NRPH 4WXVA 1N8OB 1SBWA 1EUFA 1J16A 4BAKB 2STBE 1JIMA 2BY5X 3VB4A 1AVGH 2XBWA 2BLVA 1SMFE 4H6TA 1GBMA 4ABDA 2GCTB 3MTYA 4NZLA 3M35A 5JYIA 2TGPZ 1FY1A 4Z6AH 3T2NA 1XUIA 1ZJKA 3ODFA 1QB1A 3BTDE 1DY8A 3K2UA 5G4BA 3VXFH 1GVKB 9ESTA 4YZUA 2C4FH 3RUOA 3RXPA 3ELAH 1Z6EA 2Z9IA 2FTMA 1MBQA 3PMBB 1OPHB 4MNYA 2BD7A 1XX9A 2V35A 2J34A 1E36B 1RS0A 1RRKA 1D6RA 4UD9H 3D49H 1DITH 1YCPM 2Q6GA 2ZI2H 4WF8A 1V2RT 4WWYA 1ZMJA 2ASUB 1TONA 1WU1A 4LZ1H 2BD8A 5JBBS 1ABIH 2AGGX 4Y76A 1TBQH 2IN2A 4Y79A 2Z7FE 4HGCA 2B5TB 1DWDH 1ZMLA 3MNXA 4KGAA 1KDQB 5CHAB 2GV7A 2PHBA 4O97A 2Y6TA 3SHCH 3DT0H 1EOLA 2H2ZA 1MD7A 2QC2A 4A92A 1BCUH 1S6FA 1LVBA 4AORA 1BMNH 1CGJE 2DE9A 1KDQA 1CGHA 1AKSB 1GDQA 1SGIB 4ESTE 3BF6H 1ETSH 1Y3UA 1UTPA 5GJ4B 4AFUA 1PPFE 1JBUH 1GMDF 2D26C 3PO1C 1QBOA 3SGAE 3ZVDA 4YOJA 2ZU1A 3RMLH 1Q3XA 4MDSA 1TNHA 1ZRBA 3ESTA 2CJIA 3O8CA 2A5AA 3M3SA 2BD2A 1GBTA 1GJCB 1WUNH 3SW2B 1AKSA 3AW0A 1TNGA 2TIOA 1L2EA 2H9HA 2GDEH 2UUKB 1UVOA 3BTME 3GYMA 4E7RG 1V2KT 1N8OC 2QXJA 2A2QH 1T31A 2HNTC 3F9GA 2ZA5A 3HPTB 3MU8A 1IHTH 4KTCA 1C5QA 1K1NA 2AMDA 1EQ9A 1GI6A 4D76A 1QRZA 3QTVH 1DWBH 2R0KA 2UWPA 3SNCA 1GMDG 2QF3A 2ZECA 1HUTH 1NPMA 1ANDA 1O5GH 2J2UA 4CREA 2FOBA 2ZFTA 5C67A 2P3TB 2PUXB 1O3LA 3RXOA 1O37A 1RTKA 3VB6A 2XNIA 1V2MT 1UCYK 2VB0A 2ZTZA 1GBIA 2V0BA 3RLYH 1ETRH 1DX5M 1TABE 2QXHA 4Y8YA 2FTLE 3GCHB 1PPEE 1BTPA 3F9EA 4XBDA 3BG4B 1F0UA 1SG8B 3PMHB 1MZAA 2P3UB 3HGNA 1A4WH 4F4OC 1WSSH 4I33A 3S7KB 3S9BA 1VZQH 1A1RA 1GBFA 4PROA 2AIPA 1YPKH 3SO3A 1OWKA 1GBLA 1ELVA 3GICB 3E8LA 1VCQA 1D6WA 1ZSKA 3QO6A 2QAAA 3KHVA 3QN7A 2QA9E 4YM9A 3HATH 1P12E 3S69A 1F0SA 2XWAA 5FPSA 4UDWH 2QYIA 5CHAC 1YLCA 1C1RA 1YC0A 1P9UA 2F9UA 1Z8RA 3GCNA 1O5CB 4GAWA 1GDNA 3MI4A 2ZDLA