1GBCA

Alpha-lytic protease with met 190 replaced by ala and gly 216 replaced by ala complex with methoxysuccinyl-ala-ala-pro-leucine boronic acid
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGANVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ALPHA-LYTIC PROTEASE
total genus 52
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbcA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbcA01
3TGKE 5CHAB 1EZQA 3E8LA 2RDLA 3TVJB 1EZXC 5HYOA 2XBYA 3PWCA 4FVBA 1AB9B 1GBBA 2ZI2H 2ZDLA 1HIAB 3V12A 3ZVGA 4X6OA 2A31A 1TX8A 1O2WA 4NSYA 1BT7A 3RXQA 1GMHF 3CP7A 1W13U 1NRNH 1GHAF 1MD7A 3U9AH 1C5XB 4TWYA 2BLOA 4NCYA 3T25A 3ZYEA 3PMAB 1GBKA 1W0YH 2ZDAH 4Z6AH 2QIQA 5F8TA 2ZEBA 4NGAH 1IQEA 1MZDA 2A2QH 4RKOB 5ESBA 3A7VA 1NC6A 1ZLRA 4J2YB 1IAUA 4I8HA 1HJ9A 3UOPA 1HAPH 4NG9H 4D8NA 1ANEA 2OLGA 5EG4A 1RGQA 5GXPA 5HXFA 1UTOA 1Z7KA 5FCRA 2DE9A 5AFYH 2FP7B 2F83A 3Q3KA 5GDSH 1Z8IB 2W3KA 1GL1A 1DX5M 2J38A 3LGWA 1FY5A 5L2ZH 1V2JT 5GJ4B 1N6YA 1C5MD 2WINI 1ANCA 3BTWE 2VB0A 3SU0A 1FY8E 1YPMH 3SI3H 4MPVA 2QXIA 2ZNKH 5A0BA 1XXFA 1A2CH 1SGFG 3P8GA 2AIQA 1XX9A 2B7DH 3Q3XA 1GJ8B 3PLKA 3PTBA 1C5VA 4Y0YE 2OP9A 1UTQA 2AGIX 3RUOA 1LCYA 5E0HA 1AIXH 3A8BA 5DP5A 4Q80A 2ZIQH 4A5TS 2HLCA 4MPUA 3MH4A 1ZHRA 1B0FA 3PLBA 3SJKA 1MKWH 3GCHC 5FX6A 3VB7A 3SJOA 1T8LA 2PKSC 1GBTA 1BTHH 1AD8H 1YYY1 3OSYA 1TRNA 2FOFA 2BD7A 2XNIA 1AMHA 1ABIH 2F9OA 2G8TA 1IQHA 3MH5A 3MNSA 1NRRH 1UJ1A 3GYMA 3LOXA 4BAOB 3HK6B 1V2WT 5E0GA 4LK4A 2HNTC 3L6PA 4O3UA 1GBFA 2W26A 1SGFA 1UCYH 1Y3UA 4ZH8A 4JZ1A 2CMYA 4ESTE 3ESTA 1C5LH 1TABE 1Y5AT 1GPZA 2EC9H 1MTSA 1V2KT 3BTKE 1PYTD 4RN6A 4D7FA 3TLOA 3TH2H 1N8OB 4BAMB 1O3GA 2ZCKP 3RU4D 1JIRA 2UWOA 3V13A 4Y76A 1SQAA 1GHBF 1F0RA 3FFGA 1MCTA 1O5AB 1TNJA 2Z7FE 3K6YA 3BTFE 4GPGA 3UR6A 2C8YB 4JZIA 1HLTH 3LJOA 3O8DA 1B7XB 1SHHB 5EQQA 4MTBA 1MAYA 2BDGA 2TBSA 2GGVB 3B8JA 3S9BA 3TJUA 3P8FA 1XUFA 3A82A 6GCHF 2ZFQH 2BY7X 3GDSA 3GY5A 4BAKB 3RXVA 2HPQH 4VGCB 1CHOF 2R3UA 5LPRA 1PPZA 1O3DA 1FN8A 1L4DA 4JZFH 2OC7A 1Z6EA 5AFZH 1Y3WA 3UNRA 2BDIA 4IMZA 5LGOA 1XM1A 3LT3A 3S9CA 1C1NA 1ZMJA 2GP9B 2VH6A 3TJOA 1EPTA 1KXCA 1DSUA 5EPNA 4B2BA 1UK4A 3LU9B 2ZF0H 4AFSA 2ZGJA 2H9EH 3KQCA 3QZQA 2ANMH 4IN1A 3A80A 1XUHA 1ZR0A 2GTBA 3F1SB 3PTNA 1K1LA 1V2LT 5C67A 2OQ5A 4DOQA 1OP0A 2BDCA 1LVOA 3MO6A 4VGCC 1CT2E 2D1JA 3LDXH 2V3OH 3M5NA 1Y8TA 2IPHA 5J4QA 2O8TA 4H6SB 3LGYA 5LH8A 1BTPA 3OX7U 2NU0E 1AN1E 1SMFE 1A0JA 1EAIA 1HAGE 4MNXA 2ZO3H 1ZSLA 1P2KA 2BOHB 1V2TT 1HJAC 4MPWA 2ZWLH 3EDXB 1GHWH 2CXVA 1EQ9A 1GCTC 1YBWA 3TGJE 5EXNA 1AKSB 1Y3YA 2HWLB 3M3SA 4IW4E 2C90B 4DJZB 2BQWB 1GHBG 5H4IB 4H4FA 3LGIA 2P94A 4K1TA 1HAHH 2IN2A 1RTFB 2WPIS 1D3PB 2GV7A 2UUKB 4INHA 1HUTH 2C8XB 1SI5H 2ZU2A 3RLYH 2D26C 4BTUB 2UWLA 1C2DA 1WSSH 3QWCH 3Q00A 4MQAA 5I46H 1WQVH 2TRMA 1CE5A 3VGCB 2P16A 1G37A 5JB8S 3V7TA 4YESB 3SV8A 2AH4X 1TQ7B 1PQ5A 1TOMH 1ETTH 1ZJDA 3PYHA 3RXIA 1T8OA 1X7AC 1VITG 1OP2A 2QXGA 4YT6H 4AB8A 1ZPZA 2QGRA 3C27B 2FOBA 1YF4A 1GI5A 4MNYA 3BTEE 3LJJA 1TRMA 5JPMH 3MMGA 4X1PU 2QXHA 1FIWA 2OC0A 1GHZA 4YT7H 2VWOA 1JOUB 1CO7E 3QTVH 4X2WA 2A0QB 4FXGH 1O39A 4YTAA 1O3JA 3F9GA 1O34A 1CQQA 1ZPBA 2OXSA 3O8CA 5EPYA 1V2PT 1H8DH 3D62A 1C5QA 1PPHE 3HATH 3ZZ6A 3RU4T 1NROH 2BOKA 1AFQC 5C2ZA 4PROA 1EUFA 2XBVA 1JMOH 1W10U 3RXSA 1Y59T 4X1RU 3UQVA 3UNQA 1YCPM 1XUIA 1FIZA 1FPCH 2VIOA 3EA7A 1GHVH 2W3IA 4CR9A 3CS7A 1GJ6A 1S81A 1E35B 1WQSA 3M7UA 5B6OA 1C5UA 1GG6B 5EGMA 3DFLA 1EOLA 2XTTB 3UPEA 1GGDC 4AZ2B 2JETC 4X2VA 1A3EH 2AERH 2ZCHP 5GIBA 1FY4A 3OTJE 3SZNA 3RXBA 1UTLM 3DHKH 3M35A 3P95A 1GI3A 1KLTA 3FANA 1G3CA 1ZTJA 3O8BA 1BJUA 4SGBE 1YP9A 2B5TB 1ESAA 1U6QA 4WMEA 1DWEH 4ABFA 1AE8H 5GWZA 1QRZA 3MYWA 2FS9A 4ISOA 1SR5C 1GWAA 1MQ5A 4A7IB 1C9PA 2UWPA 3VXFH 4Y71A 3LC5A 3N7OA 4X8UH 1TRYA 1SGNE 1GGDB 1FV9A 1GHYH 3SV2H 2UUJB 1C1QA 1VGCB 5HMAA 2G55A 3H5CB 1YCPH 3RXHA 2GDDA 1QB6A 2OD3B 2G81E 2SNVA 1SFIA 2HNTF 1W11U 1HAIH 1LQEA 5C5OA 1UO6A 3BTHE 1F5KU 1O3HA 3M5MA 1PPEE 1O3PB 1V3XA 1BTUA 2BLVA 4JYTA 4FVDA 3W94A 2BDYA 4K5ZA 3ZZ7A 1P57B 1FN6A 2ZHFH 3QO6A 1ELFA 5CE1A 4ZHLU 2F9VA 3URCA 2FI4E 5EOKA 3TIUA 2QY0B 2BVRH 5JDUB 2EI6A 1GBIA 2ODQA 3BTQE 2ZU5A 4CBNA 3LGUA 1BB0B 5E2OA 2FESH 2PUQH 1C5OH 2VIQA 3PWBA 4F4OC 2YNAA 3SGAE 1BHXF 2ZFFH 1FI8A 2ALVA 4Q7ZA 4JYVH 2STAE 2A4QA 4Y10E 3LGVA 4JK5A 2ZA5A 2QN5T 1GCTB 3A81A 4Y8ZA 1P9UA 1HCGA 5ETXA 4BTTB 3FZZA 3PV4A 1NU7B 1GI1A 1JXPA 2OINA 5F6MA 5HM9A 2BZ6H 2Y5GA 1SGPE 4M7GA 1KXAA 4NA9H 1O3CA 1IHSH 3B23B 1YGCH 1HBTH 2Z3CA 4H42U 2CF9H 3D23A 3LGTA 2ZDMA 3SU4A 1BITA 1EP6A 2QAAA 3GCHB 5CMXH 3ATMA 3EYDA 1DDJA 5DO4H 3KQDA 1A5GH 2PSXA 1ZRBA 1H9HE 3KHVA 5AF9H 1FONA 3LKWA 1SGQE 2ANWA 3MNCA 1AVXA 1W12U 5CHAC 3MNBA 2WPMS 4I7YH 1PQ7A 1H9IE 1P01A 3QUMP 1GI6A 2BD3A 2VH0A 3KQEA 1MKXH 2BHGA 3QGJA 1SC8U 2P3TB 5DG6A 2F9UA 5DP3A 1OWEA 3TK5A 1QRXA 1S85A 1P0SH 1V2ST 2ZGHA 1W2KH 3PB1E 4A1TA 2Z3DA 4UE7H 2EEKA 2HOBA 2J4IA 2UUFB 4KP0A 1N8OC 1QB9A 3A85A 3PO1C 1G9IE 1TNHA 1HGTH 1GMDF 2W5EA 1AVWA 4CREA 2ZU3A 4ZKSU 1G3EA 1KDQB 3ZZ8A 3K2UA 1C4V2 2I6SA 1ID5H 2J95A 4BXWA 2IOTA 1CU1A 1V6DA 2XC5A 4Y7BA 1O2VA 3ZZDA 2PSYA 2CJIA 2B8OH 2B9LA 2ZZUH 2AGEX 4HI3A 1BMNH 4TPYA 3SU5A 3VB4A 1C5YB 1DANH 3STIA 2BY5X 2H1UA 1SGCA 1TA2A 1O36A 4B71A 3A8AA 1SGTA 1CA8B 1NT1A 2ZP0H 3P17H 4AFZA 8KME2 1HAYB 3U69H 2BD2A 5A8ZA 2ZFRH 4XBCA 1ZHMA 1XUGA 1FAXA 2J9NA 1TGSZ 1C5WB 2GZ8A 1O37A 1FQ3A 1S82A 4RSPA 1C5TA 3BEIB 4DT7B 1A1RA 3ENSB 1NS3A 1OWIA 2ZPRA 8GCHG 1HXFH 1V2VT 4X1QU 4ZXYH 2PKAA 4DGJA 1EPTB 3KIDU 4XBBA 2A32A 4U01A 1EAUA 3DD2H 4HTCH 1G30B 3S9AA 1Y3VA 1HNEE 2G00A 2FI3E 1ELGA 1TBQH 1S0QA 5LPEA 1AWFH 2H6MA 2CV3A 3RXLA 2FM2A 2Q6GA 1N1LA 3EA8A 1ELCA 1HAZB 1NESE 1P04A 1QCPA 1TQ0B 4WH6A 4AN7A 4IBLH 2VJ1A 3ZVEA 4KKDA 6ESTA 3OY5U 3S7KB 2WUBA 1TLDA 2Y82A 3EA9A 2ASUB 4GAWA 3MH7A 4GCHG 1INCA 4FUHA 3Q77A 1NFUA 2BM2A 5HGGA 1S84A 5FX5A 2ZFTA 3TITA 3SV9A 3EAJA 1SBWA 3R3GB 1IHTH 3SUEA 5FBEA 4HZHA 1ANBA 2C8ZB 2SGQE 1TMBH 1C2MA 4Q7YA 2QF3A 4IMQA 3SW2B 1H1BA 1Z1IA 3SUGA 3M3TA 2F9BH 3RLWH 2ZGCA 1V2RT 1AQ7A 3SV6A 3L3TA 4BXSA 4NIWA 1QBOA 1T32A 2IJOB 1GBCA 3SU6A 2VVUA 3TJVA 1T31A 2F91A 1KLJH 1GHXH 4AX9H 4NZQA 1TNLA 2F3CE 3VGCC 4FUBA 1WV7H 3K65B 2THFB 7GCHG 1K1IA 1K1OA 3MU0A 5F03A 3SHCH 1TGCA 1FNIA 1NFXA 2PWXA 4BANB 1O2ZA 4DVAU 4FU8A 2P8OC 3M3VA 4ASHA 1P3EA 5GPIB 3AVZA 2JETB 4JZDH 4LOYH 4XBDA 1EATA 2H2ZA 2GCTB 1THPB 5GCHG 4WXIA 1O3MA 1F0SA 1BTXA 4AFUA 1BOQA 3LH1A 1OWHA 2XBWA 2O8LA 4WXVA 1IQIA 2F9NA 3U8RH 1QL7A 1EXFA 1T7CA 1C1PA 3SUDA 3UREA 4A1VA 1KYNA 4OS2A 3ZVBA 1NM6A 1DWCH 4CR5A 2F9PA 1P03A 4NIVA 1LVBA 3RXFA 4BTIB 4K1SA 2BD4A 4ISIH 1GL0E 1Z8GA 4WMFA 1SOTA 2ODYB 4DIHH 1P2MA 1YKTA 1A7SA 4ZROA 4ABHA 3BSQA 1FLEE 3BTME 3W95A 4GUXA 1P10A 3MU5A 4I8KA 4IC5A 3ZV8A 2R3YA 1OWJA 2GKVE 2ZFSA 2WYJA 3SBKA 1XMNB 1K1MA 1SLVB 3U1IB 3FZDA 1MTNB 1SGDE 2BLWA 1FY3A 1HYLA 4CH8B 1ANDA 1T8MA 2FLRH 1JBUH 1H8IH 1CA0C 3SI4H 2PLXA 2BDAA 2SGEE 4BAQB 4I8LA 1IQFA 1O2PA 1P09A 3KGPA 2WYGA 1AGJA 5DP6A 2FX4A 4ZXXH 1LMWB 2XBXA 4WJG2 1ZRKA 4FUFA 3A87A 5HM2A 2G52A 3SJ8A 1P8VC 1GJ7B 1K1JA 3E3TA 1DOJA 1WBGB 1NZQH 2V0BA 1S6FA 4R0IA 1P12E 5EODA 1FUJA 3TK9A 1RIWC 3SU2A 2BZAA 2DE8A 4B74A 2H5DA 4E06H 2H9HA 1GDNA 2QYIA 3NPSA 1TGBA 1VGCC 2HVXA 3OU0A 4A92A 2FOCA 3F68H 1TB6H 2FIRH 1UTMA 2TIOA 1O2QA 1A61H 4AG2A 3P8OA 3LC3A 3SQHE 3VB3A 5JB9S 1NFYA 1O2NA 4XSKU 1UVOA 5L2YH 2W7SA 4Y79A 2CF8H 3H7OA 3Q76A 2WPKS 2WV5A 1ZPCA 1S6HA 1DUEA 2WV4A 1O3AA 2J2UA 4U30A 1LPKB 1Z8RA 2PGQB 1JRSA 2TGDA 1TMTH 1O2XA 7KMEH 1LTOA 1XKAC 1ELBA 1TBZH 3A84A 3TK6A 3NK8A 4BAHB 3TNSA 3BF6H 5DP9A 1ELAA 3MI4A 1RIWB 4A6LA 2QC2A 4X6NA 5JBBS 1YPHC 4WMDA 1OYTH 2BVSH 2BLQA 2QA9E 2VWMA 1TALA 2Y7XA 2BQ7B 4TWWA 4UD9H 1FPHH 4K1EA 3U1JB 2ZPQA 1MU6B 5AHGH 1TE0A 3PMJA 7ESTE 1SG8B 1AU8A 3GISB 1KSNA 2Y5FA 1P2OA 1GVLA 3K9XB 3ZZAA 4CHAB 4AGKA 1C5RA 1NO9H 4CRFA 3WY8A 4X0WU 1O3EA 1GJ4H 4X1SU 1UVUH 1ZGVA 4K2YA 2OCVB 2GCHF 1HRTH 1TPOA 1KDQA 1ZMNA 1C1RA 3GYLB 5EQSA 4ZMAH 1IQLA 2ANKH 3IWMA 1O2YA 4K8YA 3TNTA 1NTPA 4ISLA 1UTJA 1BRBE 1QY6A 1EAWA 2P3UB 1KY9A 1XXDA 1CBWB 2NU4E 3CENA 1C1VH 4OS4A 4JMYA 1TNGA 2R0LA 3GOVB 4ABGA 1Z8JB 2A7CA 1THSH 4CRDA 1O2MA 1PPGE 3TU7H 2Y7ZA 1AVGH 2ZKSA 5EW1H 4DIIH 3QGNB 1O2RA 1VJ9U 2BD9A 1HAOH 5A09A 1SQOA 4YOGA 3MU4A 2ZGXH 1O38A 1K21H 1O5CB 3VFEA 2FOAA 1O5FH 4X2XA 1GBMA 2FTMA 2OUAA 3RDZA 1QBNA 1UMAH 3GY7A 4U2WA 2NU1E 1GMHG 1GHAG 1PYTC 4I33A 1TGTA 1V2NT 3SV7A 1EASA 3M7QA 1ABJH 3RXGA 1J16A 3A7TA 4MNVA 3D65E 4IGDA 3SQEE 1PFXC 1DSTA 1ZHPA 1BMAA 4DURA 1HAVB 1UTPA 3F9HA 1QIXB 1O2KA 3LH3A 3A7WA 3G01A 3NWUA 1O3LA 4JCNA 5FPTA 4F49A 1E37B 2GVFA 2FODA 1GI0A 1L4ZA 1CGIE 1GVZA 4I8JA 1EP5A 1V2OT 1UVTH 4BOHA 3RP2A 2DUCA 4X8VH 2Z94A 2HPPH 1TBRH 1SLWB 1TA6A 3CS0A 1GBEA 1GJAB 1NN6A 3TPIZ 3A88A 1C1TA 3BEUA 1MMJN 3M7TA 2PKSB 1YPKH 2G4TA 1A5HA 4O97A 1RJXB 2A4RA 2ZHEH 1AUTC 1C1SA 4UFDH 1M9UA 4ISHH 2YOLA 4YOJA 2BVXH 4YOIA 2QF0A 3GY8A 2WPHS 1EJMA 2BMGB 1IQMA 1C4Y2 1ELEE 2A2XH 4ZUHA 4D76A 2G5VA 1RD3B 2Y5HA 3O8RA 4AGJA 3SORA 4IC6A 1HV7A 3ELAH 4ISNA 3BEFB 1C1MA 3KF2A 2B0FA 5G4BA 1P11E 2GMTC 1G36A 2AEIH 3QZRA 1B5GH 2R0KA 2SGFE 5K7RA 2ZGBH 1KIGH 1P9SA 2FXRA 4O03A 4YLQH 5DKMA 5JBCS 2PKAB 2FEQH 3KQBA 1CGHA 5C1XA 2OC1A 2HRVA 2FX6A 4AYVB 2BQ6B 3A7ZA 1SL3A 1C2JA 1BMMH 3SOSA 1TFXA 1L1GA 2V3HH 1ZYOA 4YM9A 1L2EA 3LIWA 1CHOG 1AKSA 4UEHH 3A8DA 3LONA 8GCHF 1W3CA 1G3BA 3ATWA 1J15A 2OBQA 1KTTB 2LPRA 1SB1H 2GCTC 4CRBA 3AASA 1C5ZB 2R2WU 1MTVA 1SGYE 3RMOH 1DS2E 1SHYA 3UTUH 1HFDA 3MNXA 2OC8A 4CRAA 3PO1B 2CN0H 1KTSB 1Q3XA 2ZDVH 3T5FH 1P06A 1NU9A 1XVOA 1FAKH 1ZJKA 2SGAA 1QB1A 2VIPA 2PR3A 4X6MA 4FUEA 1SOZA 5EU8A 2GZ9A 1AHTH 1HPGA 1FY1A 2G5NA 1BRUP 1P2QA 4Y7AA 1SVPA 5T3HA 3VB6A 2P93A 2C93B 4I8GA 2Y6TA 2P59A 2ZDNA 3M37A 4KTUA 2O8UA 1FZZA 1K22H 1BHXB 3SN8A 1THRH 2ILNA 1EB2A 3RXOA 5L30H 2QV1A 1DY8A 4IN2A 2VINA 1Z71A 2NU2E 5DP4A 3MWIU 1ESBA 3TH4H 1NRQH 1C9TA 1S5SA 3RXCA 3FP7E 3EGKH 1MKWK 1Q2WA 2FZZA 5LPFA 1DM4B 5DP7A 1W7GH 3T29A 5IDKA 1EPTC 1MU8B 1QQUA 1YLDA 4E7RG 2FO9A 3M5LA 3RXDA 1CHGA 1AI8H 3U8OH 4UFEH 4K60A 3SU3A 3Q3YA 1EJAA 2Z9GA 3ZZBA 4FUJA 4WY3A 1GI4A 3K6ZA 1HIAA 4GVUA 3PROA 5T6DA 3AW1A 3UOUA 2JH0D 3C1KA 3KCGH 2A5AA 4I31A 2AGGX 2AMDA 3I29A 1FXYA 2EI8A 1CT0E 3QDZB 3NUMA 1VITH 2BD5A 1HJ8A 3IG6B 5C1YA 4B1TA 3ZYDA 1V2UT 1O33A 4CRCA 1TYNA 2G51A 1C2EA 3BIUH 3HPTB 7LPRA 1GBJA 3UIRA 5L6NH 4B2AA 1D6RA 5C1UA 1GJBB 1Z1JA 2ULLA 4X6PA 3URDA 4XFQA 2UUYA 1QURH 1LHCH 1ELTA 1UVPA 4JYUH 1DE7H 1W0ZU 4K3JA 5BRRE 4THNH 1K9OE 4BNRA 3RM0H 3H7TA 3UNSA 2PHBA 2BD8A 2OBOA 4X8TH 2FI5E 5A0CA 5FXLA 2H9TH 8ESTE 1EZSC 1P02A 2PGBB 4FU9A 3P70B 3E6PH 1KXBA 1E36B 1FJSA 1DXWA 3S7HB 3BG4B 3FVFB 3AW0A 2Z9LA 1WAYB 4GCHF 1TONA 1CBWC 1O3KA 1OX1A 4NZLA 1MQ6A 2P3FH 4FUIA 2ZPSA 2ZTXA 1SLUB 4FUGA 4MDSA 2ZQ1A 1BTZA 3ATLA 3NKKA 3GY6A 2ANYA 2GCHG 4AYYB 4CH2B 1S0RA 5E2PA 1TX7A 1KXEA 4OGYA 1QQ4A 4FUDA 2FOMB 4NIYA 1ELDE 2Q1JA 3RMMH 2ZU4A 3KEEA 4AFQA 1O2TA 1MAXA 3OY6U 1UCYE 4H6TA 3RXTA 1BTWA 1QBVH 1O0DH 3GCTG 2BX3A 1UTNA 2QXJA 4CHAC 3QK1A 4DW2U 2AMPA 1TPAE 4YZUA 1OXGA 1GVKB 1EOJA 3TGIE 1SFQB 3UR9A 7GCHF 1A5IA 2ZG0H 2OQUA 3PLPA 1HAVA 3SO3A 2VIDA 1J17T 3FP6E 2VWLA 4MNWA 1RTLA 1BRCE 1GMCF 2HALA 3E1XB 3GY3A 3RC6A 1LO6A 1FDPA 3DUXH 3MFJA 4DY7B 6LPRA 2FDAA 1AE5A 1D9IA 1TAWA 1ZSKA 1DPOA 2VNTA 2XC0A 1HAXB 2HNTE 5JBAS 2A4GA 1RRKA 2FLBH 3SHAH 9LPRA 3KN2A 1BRAA 1DVAH 2J92A 2PFEA 1CT4E 1GJDB 2XWAA 3VB5A 2Z3EA 1TGNA 1GMCG 1LVMA 4RKJB 1QTFA 3E16B 2A1DB 5C3NA 1TNIA 4XE4A 3MO9A 3T28A 1J8AA 3P8NA 5E8EH 4XDEA 2ZC9H 2JH6D 4KELA 2WPLS 2ODPA 4CRGA 5T6GA 1O3FA 2BDHA 2ZECA 1MBMA 3ZVAA 1P2NA 1UK2A 3ATIA 3HK3B 1GI9B 1AZZA 1GDUA 4WH8A 2KAIA 1QL9A 3V3MA 2J94A 3U98H 2CGAA 1T4UH 3M5OA 3ODDA 1OOKB 1LDTT 1J9CH 2PW8H 4NWLA 1T8NA 1IOEA 4OS7A 3SNDA 2Y80A 2D8WA 1QL8A 3RXRA 4X8SH 3AAUA 2FTLE 4LXBH 2RA0A 1GBLA 2J34A 1DLKB 2FYQA 2ALPA 1L0ZA 1MTWA 5DJ7A 1ZTLA 1C4U2 1YM0A 4HGCA 3D49H 2H5CA 3OYPA 2TGTA 2ZDKA 1AFQB 3ZVDA 3SGBE 1VCWA 1O2UA 3GCTF 3T2NA 5BPEA 3DA9B 1HB0B 4KTCA 1NPMA 3F9FA 2NWNA 2K1QA 3RXPA 1D3QB 1ETRH 1QRWA 1QJ6B 4Y11E 1L1JA 1QA7A 2GD4B 5JBTA 1ZSJA 3GCNA 4LZ1H 2GZ7A 3VEQB 2GT7A 1SSXA 5K0HA 3JZ2B 5EXMA 2P8OB 3MHWU 1NY22 4LZ4B 2Q6FA 1AB9C 1BBRH 2V35A 2TGAA 2ZQ2A 3MH6A 1G32B 4O3TA 4FU7A 4ZKOU 3RU4E 1O3IA 1F5RA 2YNBA 6CHAB 5I25A 1LHGH 3DFJA 5FPSA 5DGJA 1EKBB 1W7XH 2XC4A 3UWJH 1LHDH 2GT8A 1D4PB 2VGCB 1VCQA 1GI7B 3R0FA 2BY6X 1O32A 1BQYA 5A8XA 3SNEA 2A7JA 5FPYA 1ZZZA 5PTPA 1O5GH 4Q7XA 1QJ7B 1TPSA 3GDUA 1F2SE 3ZZ3A 1DLEA 2XRCA 1O2OA 5SGAE 1K1PA 1OSSA 4O9VA 2FS8A 2R2MB 3QX5H 4NFFA 2M5TA 1P05A 4JZEH 5DPAA 2XW9A 3JZ1B 2XWBI 1VCPA 3SUFA 4INLA 3M61U 3EE0B 3EQ0H 3RXEA 1A46H 3SJ9A 4D9RA 4DG4A 3GY4A 1EZUC 1Y5UT 3TH3H 3NXPA 5T6FA 3ZZ5A 4K8BA 5A0AE 1IQNA 1VR1H 1QHRB 1IQKA 3MO3A 2CHAC 1RXPA 1UTKA 2PV9B 4NSVA 3HKIB 3U8TH 1MH0A 2C3SA 1UHBB 1MBQA 5TCCA 4UFFH 1YPLH 1YPGH 1ZTKA 4TYDA 3RMNH 2BY8X 2A45B 1PQAA 4JK6A 2W7UA 3RXMA 4NA8A 1OKXA 3S0NA 3E0NB 1C2GA 3QN7A 1K28D 4AB9A 4WWYA 1OWKA 1TX6A 3BTGE 3HKJB 3RC4A 1KLIH 1MZAA 1BJVA 3GCOA 4HFPB 1EAXA 1BDAA 1TOCB 3RXKA 3T26A 3L33A 1LVYA 3UFAA 2ZFPH 1C1WH 5C5NA 2GMTB 9ESTA 2GX4A 2ZU1A 1O2GH 1LKAA 3V0XA 4CBOA 1O31A 1ESTA 2TPIZ 3ODFA 3RXJA 1W14U 1GBDA 5EXLA 2C8WB 1DWDH 2Z6BD 1BUIA 1XUJA 1EJNA 4K69A 3MOCA 1JWTA 3BG8A 3ZZ9A 3UUZA 2VGCC 2BXTH 2SGDE 2XCNA 5ESTE 1OPHB 3F9EA 1ZGIA 1SLXB 5DP8A 1XVMA 3RXAA 1ORFA 1YPJH 1NFWA 3ZZCA 1WUNH 1O5BB 1PPBH 2RG3A 2Z9KA 4OS6A 4YO9A 4MLFB 1A4WH 4B76A 4GHQA 3A83A 4ZKRU 1XUKA 1MUEB 1TPPA 4R8TB 2BYAX 1VZQH 3E0PB 3MTYA 2AMQA 3E91A 1G2LA 2FYRA 1K2I1 4XOJA 4TY7A 1C2IA 1F0TA 2HGTH 5ABWA 4ZAEA 1IQJA 2O8WA 1MD8A 3VXEH 1DICA 1A3BH 1ELVA 2OTVA 3ATKA 3MU8A 3PM3A 1SGRE 1O5DH 1BTYA 3DT0H 1WCZA 1GMDG 1QNJA 1RS0A 2SGPE 1QFKH 1F92A 2EI7A 1O2JA 1SQTA 1AO5A 1YPHE 1OYQA 1HDTH 1G3DA 2STBE 1TNKA 1GDQA 1UVSH 4GLYA 1ETSH 1KXFA 3SNAA 1RFNA 2AFQB 3P6ZB 3F6UH 3A86A 1C5PA 3ZVFA 3I78A 1O3NA 1O3OA 2D2DA 1DITH 1V2QT 3A7YA 1O35A 1GBAA 2AS9A 2RA3A 2ESTE 2FOHA 1Y3XA 1GCDA 1MTNC 2JKHA 1SGEE 1TMUH 1WTHD 1HXEH 1BBRE 5C20A 5FAHA 1IQGA 1C2HA 8LPRA 1SGIB 6GCHG 1CGJE 1DFPA 5IYTA 4DCDA 4ZHAA 1H4WA 1K1NA 1TWXB 4AG1A 3S69A 2GDEH 4Y6DA 4NWKA 1BBRK 4GHTA 5FCKA 1QA0A 5J4SA 1EX3A 1CSOE 1E0FD 1GJ5H 2Z9IA 2LNCA 4MVNA 1LKBA 4UDWH 4OGXA 3STJA 2Y81A 4AOQA 1BCUH 1Z6JH 3SGQE 4SGAE 1ZOMA 4Y8YA 5FBIA 4WVPE 1LPGB 1QR3E 1WTGH 1GBHA 4U32A 5FHTA 3ZV9A 2EA3A 5F8ZA 4INKA 1AY6H 3T27A 1E34B 1VITF 2CHAB 4AORA 2A5KA 4TY6A 5TCAA 3ZVCA 1V2MT 1N6XA 3M36A 1GI8B 4ABDA 1FMGA 4NFEA 1PJPA 4YLUA 1GJ9B 1A0LA 2AIPA 1P2JA 1G2MA 2P95A 4J1YA 1DT2A 3BIVH 4B2CA 5JYIA 1SPJA 1D6WA 2PTNA 1MCVA 2AYWA 2FPZA 1GJCB 3E90B 1C1OA 3NZIA 4TPIZ 1P3CA 1BIOA 4Z0KA 3ZZ4A 4E7NA 2C4FH 2KAIB 2ZCLP 1CVWH 3BV9B 3NCLA 4IS5A 5EW2H 1D3DB 3A89A 3BG4C 3RMLH 1GG6C 2FWWA 3ITIA 1DXPA 1OP8A 2VVCA 3P92A 3MU1A 3SNBA 1UCYK 5AVDA 2BX4A 2O9QA 3FP8E 1O2HA 3HGPA 1O30A 3RC5A 1MKXK 2A7HA 1LPZB 1HJAB 1ZMLA 2BY9X 1YLCA 1XKBC 1C1UH 2TGPZ 1O2SA 3SU1A 2R9PA 2BB4A 3T62A 5GCHF 2QCYA 1P2IA 3IITA 5A2MH 1D3TB 1A0HB 1OS8A 1RTKA 4NA7A 4D9QA 2XXLA 3AAVA 1GI2A 1OWDA 2ZHQH 2BXUH 1LHFH 1L1NA 1AUJA 3LPRA 1JRTA 2VIWA 4QT8C 4KTSA 4Q2KA 1ARCA 2VVVA 4ABAA 2G4UA 4MPXA 4OS1A 4ZHMU 1F5LA 3KL6A 4OS5A 1C2LA 1AWHB 2I6QA 4X1NU 1CA0B 3BN9A 1NRSH 2WPJS 1DWBH 4B73A 3TJNA 6CHAC 1O5EH 2A4OA 3B9FH 2SNWA 2BDBA 4A1XA 1C2KA 1EB1H 3HGNA 4UONA 1BMLA 3A7XA 1VJAU 2VIVA 3PMBB 1WOFA 3SJIA 2FMJA 3I77A 1DUAA 1O2LA 1J14A 1WYKA 3FAOA 3BTDE 1AZ8A 2GV6A 2FOGA 1H9LB 4Y8XA 1T4VH 1ACBE 2Q6DA 1NRPH 2V6NA 2Z9JA 2ZTYA 3A8CA 1E38B 4E05H 4ABEA 2PUXB 2XCFA 1WU1A 2NU3E 5DK1A 1S83A 2O8MA 2RCEA 4X2YA 1PQ8A 3QLPH 1F0UA 1UK3A 1PPCE 4B75A 1YC0A 3BTTE 5A8YA 2ZTZA 2A5IA 1LQDB 4ABBA 1AFEH 4Y0ZE 4KGAA 3SNCA 1YCPK 2XYAA 4ABJA 5EQRA 1C5NH 3GICB 2ZHWH 4ZKNU 3PMHB 1BZXE 1B0EA 2SFAA 3RM2H 4GSOA 1LHEH 1W8BH 3KNXA 5E0JA 2VU8E 1QGFA 1JIMA 2JH5D 1DY9A 4UFGH 4NIXA 1Q31A 3VPKA 4WF8A 1O3BA 3UWIA 3RXUA 3GDVA 1TIOA 1Y5BT 4ABIA 1C5SA 1MTUA 1O2IA 4FUCA 5F8XA 1F7ZA 3QTOH 1C2FA 1YPEH 3UY9A 1QJ1B 1BA8B 2WUCA 2ZHDA 4MG3A 2FOEA 1PPFE 5TJXA 2BTCE 1UHBA 2VWNA 1ARBA 3GY2A 1KXDA 3UQOA 4D7GA 2PTCE 4I32A
chains in the Genus database with same CATH superfamily
4TSFD 3TGKE 5CHAB 1EZQA 3E8LA 2RDLA 3TVJB 1EZXC 4XD7D 5HYOA 2XBYA 3PWCA 4FVBA 1AB9B 1GBBA 2ZI2H 3F0PA 2ZDLA 1HIAB 3V12A 3ZVGA 4X6OA 2A31A 4ACAA 1TX8A 1O2WA 4NSYA 1BT7A 3RXQA 1GMHF 3CP7A 1W13U 1NRNH 1GHAF 3OEHD 1MD7A 3U9AH 1C5XB 4TWYA 2BLOA 4NCYA 3T25A 2J98B 3ZYEA 3PMAB 1GBKA 1W0YH 2ZDAH 4Z6AH 2QIQA 5F8TA 2ZEBA 4NGAH 1IQEA 1MZDA 2A2QH 4RKOB 5ESBA 3A7VA 1NC6A 1ZLRA 4J2YB 1IAUA 4I8HA 1HJ9A 3UOPA 1HAPH 4NG9H 4D8NA 1ANEA 2OLGA 5EG4A 1RGQA 4TT3D 5GXPA 5HXFA 1UTOA 1Z7KA 5FCRA 2DE9A 5AFYH 2FP7B 2F83A 3Q3KA 5GDSH 1Z8IB 2W3KA 1GL1A 1DX5M 2J38A 1MABB 3LGWA 1FY5A 5L2ZH 1V2JT 5GJ4B 1N6YA 1C5MD 2WINI 1ANCA 3BTWE 2VB0A 3SU0A 1FY8E 1YPMH 3SI3H 4MPVA 2QXIA 2ZNKH 5A0BA 1XXFA 1A2CH 1SGFG 3P8GA 2AIQA 1XX9A 2B7DH 3Q3XA 1GJ8B 3PLKA 3PV5A 3PTBA 1C5VA 4Y0YE 2OP9A 1UTQA 2AGIX 3RUOA 1LCYA 5E0HA 1AIXH 2IPQX 3A8BA 5DP5A 4Q80A 2ZIQH 4A5TS 2HLCA 4MPUA 3MH4A 1ZHRA 1B0FA 3PLBA 3SJKA 1MKWH 3GCHC 5FX6A 3VB7A 3SJOA 1T8LA 2PKSC 1GBTA 1BTHH 1AD8H 1YYY1 3OSYA 4RT0A 1TRNA 2FOFA 2BD7A 2XNIA 1AMHA 1ABIH 2F9OA 2G8TA 1IQHA 3MH5A 3MNSA 1NRRH 1UJ1A 3GYMA 3LOXA 4BAOB 3HK6B 1V2WT 5E0GA 1E1RD 4LK4A 2HNTC 3SYJA 2LELA 3L6PA 4O3UA 1GBFA 2W26A 1SGFA 1UCYH 1Y3UA 4ZH8A 4JZ1A 2CMYA 4ESTE 3ESTA 1C5LH 1TABE 1Y5AT 1GPZA 2EC9H 1MTSA 1V2KT 3BTKE 1PYTD 4RN6A 4D7FA 3TLOA 2M2AA 3TH2H 1N8OB 4BAMB 1O3GA 2ZCKP 3RU4D 1JIRA 2UWOA 3V13A 4Y76A 1SQAA 1GHBF 1F0RA 3FFGA 2JDID 1MCTA 1O5AB 1TNJA 2Z7FE 3K6YA 3BTFE 4GPGA 3UR6A 5IK2D 2C8YB 4JZIA 1HLTH 3LJOA 3O8DA 1B7XB 2HLDD 1SHHB 5EQQA 4MTBA 1MAYA 2BDGA 2TBSA 2GGVB 3B8JA 3S9BA 3TJUA 3P8FA 1XUFA 3A82A 6GCHF 2KFWA 2ZFQH 2BY7X 3GDSA 3GY5A 4BAKB 3RXVA 2HPQH 4VGCB 1CHOF 2R3UA 5LPRA 1PPZA 3DSOA 1O3DA 1FN8A 1L4DA 4JZFH 2OC7A 1Z6EA 5AFZH 1Y3WA 3UNRA 2BDIA 4IMZA 5LGOA 1XM1A 3LT3A 3S9CA 1C1NA 1ZMJA 2GP9B 2VH6A 3TJOA 1EPTA 1KXCA 1DSUA 5EPNA 4B2BA 1UK4A 3LU9B 5C94A 2ZF0H 4AFSA 2ZGJA 2H9EH 3KQCA 3QZQA 2ANMH 4IN1A 3A80A 1XUHA 1ZR0A 2GTBA 3F1SB 3PTNA 1K1LA 1V2LT 5C67A 4P00A 2OQ5A 4DOQA 1OP0A 2BDCA 5EIYA 1LVOA 3MO6A 4VGCC 1CT2E 2D1JA 3LDXH 2V3OH 3M5NA 1Y8TA 2IPHA 5J4QA 2O8TA 4H6SB 3LGYA 5LH8A 1BTPA 3OX7U 2NU0E 1AN1E 1SMFE 1A0JA 1EAIA 1HAGE 4MNXA 2ZO3H 1ZSLA 1P2KA 2BOHB 1V2TT 1HJAC 4MPWA 2ZWLH 3EDXB 1GHWH 3F2GA 2CXVA 1EQ9A 1GCTC 1YBWA 3TGJE 5EXNA 1AKSB 1Y3YA 2HWLB 3M3SA 4IW4E 2C90B 4DJZB 2BQWB 1GHBG 5H4IB 4H4FA 3ZIAD 3LGIA 2P94A 4K1TA 1HAHH 2IN2A 1RTFB 2WPIS 1D3PB 2GV7A 2UUKB 4FOUC 4INHA 1HUTH 2C8XB 1SI5H 2ZU2A 3RLYH 2D26C 3WW7A 4BTUB 2UWLA 1C2DA 1WSSH 3QWCH 3Q00A 4MQAA 5I46H 1WQVH 2TRMA 1CE5A 3VGCB 2P16A 1G37A 5JB8S 3V7TA 4YESB 3SV8A 2AH4X 1TQ7B 1PQ5A 1TOMH 1YWUA 1ETTH 1ZJDA 3PYHA 3RXIA 1T8OA 1X7AC 1VITG 1OP2A 2QXGA 4YT6H 4AB8A 1ZPZA 2QGRA 3C27B 2FOBA 1YF4A 1GI5A 4MNYA 3BTEE 3LJJA 1TRMA 5JPMH 5EJZA 3MMGA 4X1PU 2QXHA 1FIWA 2OC0A 1GHZA 2KCYA 4YT7H 1JOUB 1CO7E 2VWOA 3QTVH 4X2WA 2A0QB 4FXGH 1O39A 4YTAA 1O3JA 3F9GA 1O34A 1CQQA 1ZPBA 2OXSA 3O8CA 3UAIC 5EPYA 1UW7A 1V2PT 1H8DH 3D62A 1C5QA 1PPHE 3HATH 3ZZ6A 3RU4T 1NROH 2BOKA 1AFQC 5C2ZA 4P02A 4PROA 1EUFA 2XBVA 1JMOH 1W10U 3RXSA 1Y59T 4X1RU 3UQVA 3UNQA 1YCPM 3DSPA 1XUIA 1FIZA 1FPCH 2VIOA 3EA7A 1GHVH 2W3IA 4CR9A 3CS7A 1GJ6A 1S81A 1E35B 1WQSA 3OE7D 3M7UA 5B6OA 4F55A 1C5UA 1GG6B 5EGMA 3DFLA 1EOLA 2XTTB 3UPEA 1GGDC 4AZ2B 2JETC 4X2VA 1A3EH 2AERH 1OHHD 2ZCHP 5GIBA 1FY4A 3OTJE 3SZNA 3RXBA 1UTLM 3DHKH 3M35A 3P95A 1GI3A 1KLTA 3FANA 1G3CA 1ZTJA 3O8BA 3NRLA 1BJUA 4SGBE 1YP9A 2KCOA 2B5TB 1ESAA 1U6QA 4WMEA 1DWEH 4ABFA 1AE8H 5GWZA 1QRZA 3MYWA 2FS9A 4ISOA 1SR5C 1GWAA 1MQ5A 4A7IB 1C9PA 2UWPA 3VXFH 4Y71A 3LC5A 3N7OA 4X8UH 1TRYA 1SGNE 1GGDB 1FV9A 1GHYH 3SV2H 2UUJB 1C1QA 1VGCB 5HMAA 2G55A 3H5CB 1YCPH 3RXHA 2GDDA 1QB6A 2OD3B 2G81E 2SNVA 1SFIA 2HNTF 1W11U 5B6LA 1HAIH 1LQEA 5C5OA 5KGOA 1UO6A 3BTHE 1F5KU 1O3HA 3M5MA 1PPEE 1O3PB 1V3XA 1BTUA 2BLVA 4JYTA 4FVDA 3W94A 2BDYA 4K5ZA 3ZZ7A 1P57B 1FN6A 2ZHFH 4RI0A 3QO6A 1ELFA 5CE1A 4ZHLU 2F9VA 3URCA 2FI4E 5EOKA 3TIUA 2QE7D 2QY0B 2BVRH 4XRNA 5JDUB 3DSGA 2EI6A 1GBIA 2ODQA 3BTQE 2ZU5A 4CBNA 3LGUA 1BB0B 5E2OA 2FESH 2PUQH 1C5OH 2VIQA 3PWBA 4F4OC 2YNAA 3SGAE 1BHXF 4DT4A 2ZFFH 1FI8A 2ALVA 4Q7ZA 4JYVH 2STAE 2A4QA 4Y10E 3LGVA 4JK5A 2ZA5A 2QN5T 1GCTB 3A81A 4Y8ZA 1P9UA 1HCGA 5ETXA 4BTTB 3FZZA 3PV4A 1NU7B 1GI1A 1JXPA 2OINA 5F6MA 5HM9A 2BZ6H 2Y5GA 1SGPE 4M7GA 1KXAA 4NA9H 1O3CA 1IHSH 3B23B 1YGCH 1HBTH 2Z3CA 4H42U 2CF9H 3D23A 3LGTA 2ZDMA 3SU4A 1BITA 1EP6A 2EY4C 2QAAA 3AK5A 3GCHB 5CMXH 3ATMA 3EYDA 1DDJA 5DO4H 3KQDA 1A5GH 2PSXA 1ZRBA 1H9HE 3KHVA 5AF9H 1FONA 3LKWA 1SGQE 2ANWA 3MNCA 1AVXA 1W12U 5CHAC 3MNBA 2WPMS 4I7YH 1PQ7A 1H9IE 1P01A 2JIZD 3QUMP 1GI6A 2BD3A 2VH0A 3KQEA 1MKXH 2BHGA 3QGJA 1SC8U 2P3TB 5DG6A 2F9UA 5DP3A 1OWEA 3TK5A 1QRXA 1S85A 1P0SH 1V2ST 2ZGHA 1W2KH 3F2FA 3PB1E 4A1TA 2Z3DA 4UE7H 2EEKA 2HOBA 2J4IA 2UUFB 4KP0A 5F53A 1N8OC 1QB9A 3A85A 3PO1C 1G9IE 1TNHA 1HGTH 1GMDF 2VBCA 2W5EA 1AVWA 4CREA 2ZU3A 4ZKSU 1G3EA 1KDQB 5T1VA 3K2UA 3ZZ8A 3N7DA 1C4V2 2I6SA 1ID5H 2J95A 4BXWA 2IOTA 1CU1A 1V6DA 2XC5A 4Y7BA 1O2VA 3ZZDA 2PSYA 2CJIA 2B8OH 2B9LA 2ZZUH 2AGEX 4HI3A 1BMNH 4TPYA 3SU5A 3VB4A 1C5YB 1DANH 3STIA 2BY5X 2H1UA 1SGCA 1TA2A 1O36A 4B71A 3A8AA 1SGTA 1CA8B 1NT1A 2ZP0H 3P17H 4AFZA 8KME2 3F2HA 3N7EA 1HAYB 3U69H 2BD2A 5A8ZA 2ZFRH 4XBCA 2KX4A 1ZHMA 2V7QD 1XUGA 1FAXA 2J9NA 1TGSZ 1C5WB 2GZ8A 1O37A 1FQ3A 1S82A 4RSPA 1C5TA 3BEIB 4DT7B 1A1RA 3ENSB 1NS3A 1OWIA 5KEDA 2ZPRA 8GCHG 1HXFH 1V2VT 4X1QU 4ZXYH 2PKAA 4DGJA 2KM0A 1EPTB 3KIDU 4XBBA 2A32A 4U01A 1EAUA 3DD2H 4HTCH 1G30B 3S9AA 1Y3VA 1HNEE 2G00A 2FI3E 1ELGA 1TBQH 1S0QA 5LPEA 1AWFH 2H6MA 2CV3A 3RXLA 2FM2A 3PV2A 2Q6GA 1N1LA 3EA8A 1ELCA 1HAZB 1NESE 1P04A 1QCPA 1TQ0B 4WH6A 4AN7A 4IBLH 2VJ1A 3ZVEA 4KKDA 6ESTA 3OY5U 2J97A 3S7KB 2WUBA 1TLDA 2Y82A 3EA9A 2ASUB 4GAWA 3MH7A 4GCHG 1INCA 4FUHA 3Q77A 1NFUA 2BM2A 5HGGA 1S84A 5FX5A 2ZFTA 3TITA 3SV9A 3FKSD 3EAJA 1SBWA 3R3GB 1IHTH 3SUEA 5FBEA 4HZHA 1ANBA 2C8ZB 2SGQE 1TMBH 1C2MA 4Q7YA 2QF3A 4IMQA 3SW2B 1H1BA 1Z1IA 3SUGA 1YY3A 3M3TA 2F9BH 3RLWH 2ZGCA 3OFND 1V2RT 1AQ7A 3SV6A 3L3TA 4BXSA 4NIWA 1QBOA 1T32A 2IJOB 1GBCA 3SU6A 2VVUA 3TJVA 1T31A 2F91A 1KLJH 1GHXH 4AX9H 1KMHB 4NZQA 1TNLA 2F3CE 3VGCC 4FUBA 1WV7H 3K65B 2THFB 7GCHG 1K1IA 1K1OA 3MU0A 5F03A 3SHCH 1TGCA 1FNIA 1NFXA 2PWXA 4BANB 1O2ZA 4DVAU 4FU8A 2P8OC 3M3VA 4ASHA 1P3EA 5GPIB 3AVZA 2JETB 4JZDH 3PRBA 4LOYH 4XBDA 1EATA 2H2ZA 2GCTB 1THPB 5GCHG 4WXIA 1O3MA 1F0SA 1BTXA 4AFUA 1BOQA 3LH1A 1OWHA 2XBWA 2O8LA 4WXVA 1IQIA 2F9NA 3U8RH 1QL7A 4B6EA 1EXFA 1T7CA 1C1PA 3SUDA 3UREA 4A1VA 1KYNA 4OS2A 3ZVBA 1NM6A 1DWCH 4CR5A 2F9PA 1P03A 4NIVA 1LVBA 3RXFA 4BTIB 4K1SA 2BD4A 4ISIH 1GL0E 1Z8GA 4WMFA 1SOTA 2ODYB 4DIHH 1P2MA 1YKTA 1A7SA 4ZROA 4ABHA 3BSQA 1FLEE 3BTME 3KYFA 2K0QA 3W95A 4GUXA 1P10A 3MU5A 4I8KA 4IC5A 3ZV8A 2R3YA 1OWJA 2GKVE 3OTPA 2ZFSA 2WYJA 3SBKA 1XMNB 1K1MA 1SLVB 3U1IB 3FZDA 1MTNB 1SGDE 2BLWA 1FY3A 1HYLA 4CH8B 2KZ4A 1ANDA 2FLRH 1T8MA 1JBUH 3W1EA 1H8IH 1CA0C 3SI4H 2PLXA 2BDAA 2SGEE 4BAQB 4I8LA 1IQFA 1O2PA 1P09A 2RDEA 3KGPA 2WYGA 1AGJA 5DP6A 2FX4A 4ZXXH 1LMWB 2XBXA 4WJG2 1ZRKA 4FUFA 3A87A 4ACBA 5HM2A 2G52A 3SJ8A 1P8VC 1WXRA 1GJ7B 1K1JA 3E3TA 1DOJA 1WBGB 1NZQH 2V0BA 1S6FA 4R0IA 1P12E 5EODA 1FUJA 4Z1MD 3TK9A 1RIWC 3SU2A 2BZAA 2DE8A 4B74A 2H5DA 4E06H 2H9HA 1GDNA 2QYIA 3NPSA 1TGBA 1VGCC 2HVXA 3OU0A 4A92A 2FOCA 3F68H 1TB6H 2FIRH 1UTMA 2TIOA 1O2QA 1A61H 4AG2A 3P8OA 3LC3A 3SQHE 3VB3A 5JB9S 1NFYA 1O2NA 4XSKU 1UVOA 5L2YH 4RT1A 2W7SA 4Y79A 2CF8H 3H7OA 3Q76A 2WPKS 2WV5A 1ZPCA 1S6HA 1DUEA 2WV4A 1O3AA 2J2UA 4U30A 1LPKB 1Z8RA 2PGQB 1JRSA 2TGDA 1TMTH 1O2XA 7KMEH 1LTOA 1XKAC 1ELBA 1TBZH 3A84A 3TK6A 3NK8A 4BAHB 3TNSA 3BF6H 5DP9A 1ELAA 3MI4A 1RIWB 4A6LA 2QC2A 4X6NA 5JBBS 1YPHC 2IJD1 4WMDA 1OYTH 2BVSH 2BLQA 1YLNA 2AHME 2QA9E 2VWMA 1TALA 2Y7XA 2BQ7B 4TWWA 4UD9H 1FPHH 4K1EA 3U1JB 2ZPQA 1MU6B 5AHGH 1TE0A 3PMJA 7ESTE 1SG8B 1AU8A 3VG8A 3GISB 1KSNA 1P2OA 2Y5FA 1GVLA 3K9XB 3ZZAA 4CHAB 4AGKA 1C5RA 1NO9H 4CRFA 3WY8A 4X0WU 1O3EA 1GJ4H 4X1SU 1UVUH 1ZGVA 4K2YA 2OCVB 2YMSC 2GCHF 1HRTH 1TPOA 1KDQA 1ZMNA 1C1RA 3GYLB 5EQSA 4ZMAH 1IQLA 2ANKH 3IWMA 1O2YA 4K8YA 3TNTA 1NTPA 4ISLA 1UTJA 1BRBE 3H09A 1QY6A 1EAWA 2P3UB 1KY9A 1XXDA 1CBWB 2NU4E 3CENA 1C1VH 4OS4A 4JMYA 1TNGA 2R0LA 3GOVB 4ABGA 3KYGA 1Z8JB 2A7CA 1THSH 4CRDA 1O2MA 1PPGE 3TU7H 2Y7ZA 1AVGH 2ZKSA 5EW1H 4DIIH 3QGNB 1O2RA 1VJ9U 2BD9A 1HAOH 5A09A 1SQOA 4YOGA 3MU4A 2ZGXH 1O38A 1K21H 1O5CB 3VFEA 2FOAA 1O5FH 4X2XA 1GBMA 2FTMA 2OUAA 3RDZA 1QBNA 1UMAH 3GY7A 4U2WA 2NU1E 1GMHG 1GHAG 1PYTC 4I33A 1TGTA 1V2NT 3SV7A 1EASA 3M7QA 1ABJH 3RXGA 1J16A 3A7TA 4MNVA 3MQKC 3D65E 3F3BA 4IGDA 4YXWD 3SQEE 1PFXC 1DSTA 1ZHPA 1BMAA 4DURA 1HAVB 1UTPA 3F9HA 1QIXB 1O2KA 3LH3A 3A7WA 3G01A 3NWUA 3N99A 1O3LA 4JCNA 5FPTA 4F49A 1E37B 2GVFA 2FODA 1GI0A 1L4ZA 1CGIE 1GVZA 4I8JA 1EP5A 1V2OT 1UVTH 4BOHA 3RP2A 2DUCA 4X8VH 2Z94A 2HPPH 1TBRH 1SLWB 1TA6A 3CS0A 1GBEA 1GJAB 1NN6A 3TPIZ 3A88A 1C1TA 3BEUA 1MMJN 3M7TA 2PKSB 1YPKH 2G4TA 1A5HA 4O97A 1RJXB 2A4RA 2ZHEH 1AUTC 1C1SA 4UFDH 1M9UA 4ISHH 2YOLA 4YOJA 2BVXH 4YOIA 2QF0A 3GY8A 2WPHS 1EJMA 2BMGB 1IQMA 1C4Y2 5HIYA 1ELEE 2A2XH 4ZUHA 4D76A 2G5VA 3UB0A 1RD3B 2Y5HA 3O8RA 4AGJA 3SORA 4IC6A 1HV7A 3ELAH 4ISNA 3BEFB 1C1MA 3KF2A 2KCPA 2B0FA 5G4BA 1P11E 2GMTC 1G36A 2AEIH 3QZRA 1B5GH 2R0KA 2SGFE 5K7RA 2ZGBH 1KIGH 1P9SA 2FXRA 4O03A 4YLQH 5DKMA 5JBCS 2PKAB 2FEQH 1W0KD 3KQBA 1CGHA 5C1XA 2OC1A 2HRVA 2FX6A 2WSSD 4AYVB 2W6ID 2BQ6B 3A7ZA 1SL3A 1C2JA 1BMMH 3SOSA 1TFXA 1L1GA 2V3HH 1ZYOA 4YM9A 1L2EA 3LIWA 1CHOG 1AKSA 4UEHH 3A8DA 3LONA 8GCHF 1W3CA 1K0HA 1G3BA 3ATWA 1J15A 2OBQA 1KTTB 2WV9A 2LPRA 1SB1H 2GCTC 4CRBA 3AASA 1C5ZB 2R2WU 1MTVA 1SGYE 3RMOH 1DS2E 1SHYA 4ASUD 3UTUH 1NBME 1HFDA 3MNXA 2OC8A 4CRAA 3PO1B 2CN0H 1KTSB 1Q3XA 2ZDVH 3T5FH 1P06A 1NU9A 1XVOA 1FAKH 1ZJKA 2SGAA 1QB1A 2VIPA 2PR3A 4X6MA 4FUEA 1SOZA 5EU8A 2GZ9A 4FETA 1AHTH 1HPGA 1FY1A 2G5NA 1BRUP 1P2QA 4Y7AA 1SVPA 5T3HA 3VB6A 2P93A 2C93B 4I8GA 2Y6TA 2P59A 2ZDNA 3M37A 4KTUA 2O8UA 1FZZA 1K22H 1BHXB 3SN8A 1THRH 2ILNA 1EB2A 3RXOA 5L30H 2QV1A 1DY8A 1NBMD 4IN2A 2VINA 1Z71A 2NU2E 5EJ1A 5DP4A 3MWIU 1ESBA 3TH4H 4M9FA 1NRQH 1C9TA 1S5SA 3RXCA 3FP7E 3EGKH 1MKWK 1Q2WA 2FZZA 5CDFE 5LPFA 1DM4B 3KQ5A 1W7GH 5DP7A 3T29A 5IDKA 1EPTC 1MU8B 1QQUA 1YLDA 4E7RG 2FO9A 3M5LA 3RXDA 1CHGA 1AI8H 3U8OH 4UFEH 4K60A 1E79D 3SU3A 3Q3YA 1EJAA 2Z9GA 3ZZBA 4FUJA 4WY3A 1GI4A 3K6ZA 1W0JD 1HIAA 4GVUA 3PROA 5T6DA 3AW1A 3UOUA 2JH0D 3C1KA 3KCGH 2A5AA 4I31A 2AGGX 4ZCNA 2AMDA 3I29A 1FXYA 2EI8A 2OK5A 1CT0E 3QDZB 3NUMA 1VITH 2BD5A 1HJ8A 3IG6B 1QZ8A 5FL7D 5C1YA 4B1TA 3ZYDA 1V2UT 1O33A 4CRCA 1TYNA 2G51A 1C2EA 3BIUH 3HPTB 7LPRA 1GBJA 3U28C 3UIRA 5L6NH 4B2AA 1D6RA 5C1UA 1GJBB 3FN8A 1Z1JA 2QF4A 2ULLA 4X6PA 3URDA 4XFQA 2UUYA 3SZEA 1QURH 1LHCH 1ELTA 1UVPA 4JYUH 1DE7H 1W0ZU 4K3JA 5BRRE 4THNH 1K9OE 4BNRA 3RM0H 3H7TA 5GNDA 3UNSA 2PHBA 2BD8A 2OBOA 4X8TH 2FI5E 5A0CA 3OAAD 5FXLA 2H9TH 2WHXA 1EZSC 8ESTE 1P02A 2PGBB 4FU9A 3P70B 3E6PH 1KXBA 5CHBA 1E36B 2KCAA 1FJSA 2JJ1D 1DXWA 3S7HB 3BG4B 3FVFB 3AW0A 2Z9LA 1WAYB 4GCHF 1TONA 1CBWC 1O3KA 1OX1A 4NZLA 1MQ6A 2P3FH 4FUIA 2ZPSA 2ZTXA 1SLUB 4FUGA 4MDSA 2ZQ1A 1BTZA 3ATLA 3NKKA 3GY6A 2ANYA 2GCHG 4AYYB 4CH2B 1S0RA 5E2PA 1TX7A 1KXEA 4OGYA 1QQ4A 4FUDA 2FOMB 4NIYA 1ELDE 2Q1JA 3RMMH 2ZU4A 3KEEA 4AFQA 1O2TA 1MAXA 3OY6U 1UCYE 4H6TA 3RXTA 1BTWA 1QBVH 1O0DH 3GCTG 2BX3A 1UTNA 2QXJA 4CHAC 3QK1A 4DW2U 2AMPA 1TPAE 4YZUA 1OXGA 1GVKB 1EOJA 3TGIE 1SFQB 3UR9A 7GCHF 1A5IA 2YMSD 2ZG0H 2OQUA 2YMSB 3PLPA 3F0OA 1HAVA 3SO3A 2VIDA 1J17T 3FP6E 2VWLA 4MNWA 1RTLA 1BRCE 2GJGA 2L74A 1GMCF 2HALA 3E1XB 3GY3A 3RC6A 1SKYE 4B6FA 1LO6A 1FDPA 3DUXH 3MFJA 4DY7B 6LPRA 2FDAA 1AE5A 1D9IA 1TAWA 1ZSKA 1DPOA 2VNTA 2XC0A 1HAXB 2HNTE 3FO8D 5JBAS 2A4GA 1RRKA 2FLBH 3SHAH 9LPRA 3KN2A 1BRAA 1DVAH 2J92A 2JJ2D 2PFEA 4HG6A 1CT4E 1GJDB 2XWAA 3VB5A 2Z3EA 1TGNA 1GMCG 1LVMA 4RKJB 1QTFA 3E16B 2A1DB 5C3NA 1TNIA 4XE4A 3MO9A 3T28A 1J8AA 3P8NA 5E8EH 5KECA 4XDEA 2ZC9H 2JH6D 4KELA 2WPLS 2ODPA 4CRGA 5T6GA 1O3FA 2BDHA 5C0UA 2ZECA 1MBMA 3ZVAA 1P2NA 1UK2A 3ATIA 3HK3B 1GI9B 1AZZA 1GDUA 4WH8A 2KAIA 1QL9A 3V3MA 2J94A 3U98H 2CGAA 2PP6A 1T4UH 5C0TA 3M5OA 3ODDA 1OOKB 1LDTT 1J9CH 2PW8H 4NWLA 1T8NA 1IOEA 4OS7A 3SNDA 2Y80A 2D8WA 1QL8A 3RXRA 4X8SH 3AAUA 5DN6D 2FTLE 4LXBH 2RA0A 1GBLA 2J34A 1DLKB 2FYQA 2ALPA 1L0ZA 1MTWA 5DJ7A 1ZTLA 1C4U2 1YM0A 4HGCA 3D49H 2H5CA 3OYPA 3GS9A 2QF5A 2TGTA 2ZDKA 1AFQB 3ZVDA 3SGBE 5HKKD 1VCWA 1O2UA 3GCTF 3T2NA 2RFKC 5BPEA 3DA9B 1HB0B 4KTCA 1NPMA 3F9FA 2NWNA 2K1QA 3RXPA 1D3QB 1ETRH 1QRWA 2KR7A 1E1QD 1QJ6B 4Y11E 1L1JA 1QA7A 2GD4B 5JBTA 1ZSJA 3GCNA 4LZ1H 2GZ7A 3VEQB 2GT7A 1SSXA 5K0HA 3JZ2B 5EXMA 2P8OB 3MHWU 1NY22 4LZ4B 2Q6FA 1AB9C 1BBRH 2V35A 2TGAA 2ZQ2A 3MH6A 1G32B 4O3TA 4FU7A 4ZKOU 3RU4E 1O3IA 1F5RA 2YNBA 6CHAB 5I25A 1LHGH 3DFJA 5FPSA 5DGJA 1EKBB 1W7XH 2XC4A 3UWJH 1LHDH 2GT8A 1D4PB 2VGCB 1VCQA 1GI7B 1S6LA 3R0FA 2BY6X 1O32A 1BQYA 5A8XA 1EFRD 3SNEA 2A7JA 5FPYA 1ZZZA 5PTPA 1O5GH 4Q7XA 1QJ7B 1TPSA 3GDUA 1F2SE 3ZZ3A 1DLEA 2XRCA 1O2OA 5SGAE 1K1PA 2W6JD 2L6OA 1OSSA 4O9VA 2FS8A 2R2MB 3QX5H 4NFFA 2M5TA 1P05A 2WZQA 4JZEH 5DPAA 4AC9A 2XW9A 3JZ1B 1H8HD 2XWBI 1VCPA 3SUFA 4INLA 3M61U 3EE0B 5HIZA 3EQ0H 3RXEA 1A46H 3SJ9A 4D9RA 4DG4A 3WWFA 3GY4A 1EZUC 1Y5UT 2V3MA 3TH3H 1BMFD 3NXPA 5T6FA 3ZZ5A 4K8BA 5A0AE 1IQNA 1VR1H 1QHRB 1IQKA 3MO3A 2CHAC 1RXPA 1UTKA 3OEED 2PV9B 4NSVA 3HKIB 3U8TH 1MH0A 2C3SA 1UHBB 1MBQA 5TCCA 4UFFH 1YPLH 1YPGH 1ZTKA 4TYDA 3RMNH 2BY8X 2A45B 1PQAA 4JK6A 2W7UA 3EE7A 3RXMA 4NA8A 1OKXA 3S0NA 3E0NB 1C2GA 3QN7A 1K28D 4AB9A 2F4LA 4WWYA 1OWKA 1TX6A 3BTGE 3HKJB 3RC4A 1KLIH 1MZAA 1BJVA 3GCOA 4HFPB 1EAXA 1BDAA 1TOCB 4Q4LA 3RXKA 3T26A 3L33A 1LVYA 3UFAA 2ZFPH 1C1WH 5C5NA 2GMTB 2XOKD 9ESTA 2GX4A 2ZU1A 1O2GH 1LKAA 3V0XA 4CBOA 1O31A 1ESTA 2TPIZ 2F43B 3ODFA 3RXJA 1W14U 1GBDA 5EXLA 2C8WB 1DWDH 2Z6BD 1BUIA 1XUJA 1EJNA 4K69A 3MOCA 1JWTA 3BG8A 3ZZ9A 3UUZA 2VGCC 2BXTH 2SGDE 2XCNA 5ESTE 1OPHB 3F9EA 1ZGIA 1SLXB 5DP8A 1XVMA 3RXAA 1ORFA 1YPJH 1NFWA 3ZZCA 1WUNH 1O5BB 1PPBH 2RG3A 2Z9KA 4OS6A 4YO9A 4MLFB 1A4WH 4B76A 4GHQA 3A83A 4ZKRU 1XUKA 1MUEB 1TPPA 4R8TB 2BYAX 1VZQH 3E0PB 3MTYA 2AMQA 3E91A 1G2LA 2FYRA 1K2I1 4XOJA 4TY7A 1C2IA 1F0TA 2HGTH 5ABWA 4ZAEA 1IQJA 2O8WA 1MD8A 3VXEH 1DICA 1A3BH 1ELVA 2OTVA 3ATKA 3MU8A 3PM3A 1SGRE 1O5DH 1BTYA 3DT0H 1WCZA 1GMDG 1QNJA 1RS0A 2J98A 1QFKH 2SGPE 1F92A 1VKYA 2EI7A 1O2JA 1SQTA 1AO5A 1YPHE 1OYQA 1SQRA 1HDTH 1G3DA 2STBE 1TNKA 1GDQA 1UVSH 4GLYA 1ETSH 1KXFA 3SNAA 1RFNA 2AFQB 3P6ZB 3F6UH 3A86A 1C5PA 3ZVFA 3I78A 1O3NA 1O3OA 2D2DA 1DITH 1V2QT 3A7YA 1O35A 1GBAA 2AS9A 2RA3A 2ESTE 2FOHA 1Y3XA 1GCDA 1MTNC 2JKHA 1SGEE 3CNRA 1TMUH 1WTHD 1HXEH 1BBRE 5C20A 5FAHA 1IQGA 1C2HA 8LPRA 1SGIB 6GCHG 1CGJE 1DFPA 3WWBA 5IYTA 4DCDA 4ZHAA 1H4WA 1K1NA 1TWXB 1WDIA 4AG1A 4F48B 3S69A 2GDEH 4Y6DA 4NWKA 1BBRK 4GHTA 5FCKA 1QA0A 5J4SA 1EX3A 1CSOE 1E0FD 1GJ5H 2Z9IA 2LNCA 4MVNA 1LKBA 4UDWH 4OGXA 3STJA 2Y81A 4AOQA 1BCUH 1Z6JH 3SGQE 4SGAE 1ZOMA 4Y8YA 5FBIA 4WVPE 2EQNA 1LPGB 1QR3E 1WTGH 1GBHA 4U32A 1COWD 3PRDA 5FHTA 3ZV9A 2EA3A 5F8ZA 4INKA 1AY6H 3T27A 1E34B 1VITF 2CHAB 4AORA 2A5KA 4TY6A 5TCAA 3ZVCA 1V2MT 1N6XA 3M36A 1GI8B 4ABDA 1FMGA 4NFEA 1PJPA 4YLUA 1GJ9B 1A0LA 2AIPA 1P2JA 1G2MA 2P95A 4J1YA 1DT2A 3BIVH 4B2CA 5JYIA 1SPJA 1D6WA 2PTNA 1MCVA 2AYWA 2FPZA 1GJCB 2CK3D 3E90B 1C1OA 3NZIA 4TPIZ 1P3CA 1BIOA 4Z0KA 3ZZ4A 4E7NA 2C4FH 2KAIB 2ZCLP 1CVWH 3BV9B 3NCLA 4IS5A 5EW2H 1D3DB 3A89A 3BG4C 3RMLH 5C17A 1GG6C 2FWWA 3ITIA 4OM9A 1DXPA 1OP8A 2VVCA 3P92A 3MU1A 3SNBA 1UCYK 5AVDA 2BX4A 2O9QA 3FP8E 1O2HA 3HGPA 1O30A 2XNDD 3RC5A 1MKXK 2A7HA 1LPZB 1HJAB 1ZMLA 2BY9X 1YLCA 1XKBC 1C1UH 2TGPZ 1O2SA 3SU1A 2R9PA 2BB4A 2WPDD 3T62A 5GCHF 2QCYA 1P2IA 3IITA 5A2MH 1D3TB 1A0HB 1OS8A 1RTKA 4NA7A 4D9QA 2XXLA 3AAVA 1GI2A 1FX0B 1OWDA 4Q63A 2ZHQH 2BXUH 1LHFH 1L1NA 1AUJA 3LPRA 5EJLA 1JRTA 2VIWA 3DCLA 4QT8C 4KTSA 4Q2KA 1ARCA 2VVVA 4ABAA 2G4UA 4MPXA 4OS1A 4ZHMU 1F5LA 3KL6A 4OS5A 1C2LA 1AWHB 2HVYB 2I6QA 4X1NU 1CA0B 3BN9A 1NRSH 2WPJS 1DWBH 4B73A 3FOAA 3TJNA 6CHAC 1O5EH 2A4OA 3B9FH 5DSFA 2SNWA 2BDBA 4A1XA 1C2KA 1EB1H 3HGNA 4UONA 1BMLA 3A7XA 1VJAU 2VIVA 3PMBB 1WOFA 3SJIA 2FMJA 3I77A 1DUAA 1O2LA 1J14A 1WYKA 3FAOA 3BTDE 1AZ8A 2GV6A 2FOGA 1H9LB 4Y8XA 1T4VH 1ACBE 2Q6DA 1NRPH 2V6NA 2Z9JA 2ZTYA 3A8CA 1E38B 4E05H 4ABEA 2PUXB 2XCFA 1WU1A 2NU3E 5DK1A 1S83A 2O8MA 2RCEA 4X2YA 1PQ8A 3QLPH 1F0UA 1UK3A 1PPCE 4B75A 1YC0A 3BTTE 5A8YA 2ZTZA 2A5IA 1LQDB 4ABBA 2K8IA 1AFEH 4Y0ZE 4KGAA 3SNCA 1H8ED 1YCPK 2XYAA 4ABJA 5EQRA 1C5NH 2LP6A 3GICB 2ZHWH 4ZKNU 3PMHB 1BZXE 1B0EA 2SFAA 3RM2H 4GSOA 1LHEH 1W8BH 3KNXA 5E0JA 2VU8E 1QGFA 1JIMA 2JH5D 1DY9A 4UFGH 4NIXA 1Q31A 3VPKA 4WF8A 1O3BA 4I86A 3UWIA 3RXUA 3GDVA 1TIOA 1Y5BT 4ABIA 1C5SA 1MTUA 1O2IA 4FUCA 5F8XA 1F7ZA 3QTOH 1C2FA 1YPEH 3UY9A 1QJ1B 1BA8B 2WUCA 2ZHDA 4MG3A 2FOEA 1PPFE 5TJXA 2BTCE 1UHBA 2VWNA 1ARBA 3GY2A 1KXDA 3UQOA 4D7GA 2PTCE 2J5UA 4I32A
chains in the Genus database with same CATH topology
3TGKE 5CHAB 1EZQA 3E8LA 2RDLA 3TVJB 1EZXC 5HYOA 2XBYA 3PWCA 4FVBA 1AB9B 1GBBA 2ZI2H 2ZDLA 1HIAB 3V12A 3ZVGA 4X6OA 2A31A 1TX8A 1O2WA 4NSYA 1BT7A 3RXQA 1GMHF 3CP7A 1W13U 1NRNH 1GHAF 1MD7A 3U9AH 1C5XB 4TWYA 2BLOA 4NCYA 3T25A 3ZYEA 3PMAB 1GBKA 1W0YH 2ZDAH 4Z6AH 2QIQA 5F8TA 2ZEBA 4NGAH 1IQEA 1MZDA 2A2QH 4RKOB 5ESBA 3A7VA 1NC6A 1ZLRA 4J2YB 1IAUA 4I8HA 1HJ9A 3UOPA 1HAPH 4NG9H 4D8NA 1ANEA 2OLGA 5EG4A 1RGQA 5GXPA 5HXFA 1UTOA 1Z7KA 5FCRA 2DE9A 5AFYH 2FP7B 2F83A 3Q3KA 5GDSH 1Z8IB 2W3KA 1GL1A 1DX5M 2J38A 3LGWA 1FY5A 5L2ZH 1V2JT 5GJ4B 1N6YA 1C5MD 2WINI 1ANCA 3BTWE 2VB0A 3SU0A 1FY8E 1YPMH 3SI3H 4MPVA 2QXIA 2ZNKH 5A0BA 1XXFA 1A2CH 1SGFG 3P8GA 2AIQA 1XX9A 2B7DH 3Q3XA 1GJ8B 3PLKA 3PTBA 1C5VA 4Y0YE 2OP9A 1UTQA 2AGIX 3RUOA 1LCYA 5E0HA 1AIXH 3A8BA 5DP5A 4Q80A 2ZIQH 4A5TS 2HLCA 4MPUA 3MH4A 1ZHRA 1B0FA 3PLBA 3SJKA 1MKWH 3GCHC 5FX6A 3VB7A 3SJOA 1T8LA 2PKSC 1GBTA 1BTHH 1AD8H 1YYY1 3OSYA 1TRNA 2FOFA 2BD7A 2XNIA 1AMHA 1ABIH 2F9OA 2G8TA 1IQHA 3MH5A 3MNSA 1NRRH 1UJ1A 3GYMA 3LOXA 4BAOB 3HK6B 1V2WT 5E0GA 4LK4A 2HNTC 3L6PA 4O3UA 1GBFA 2W26A 1SGFA 1UCYH 1Y3UA 4ZH8A 4JZ1A 2CMYA 4ESTE 3ESTA 1C5LH 1TABE 1Y5AT 1GPZA 2EC9H 1MTSA 1V2KT 3BTKE 1PYTD 4RN6A 4D7FA 3TLOA 3TH2H 1N8OB 4BAMB 1O3GA 2ZCKP 3RU4D 1JIRA 2UWOA 3V13A 4Y76A 1SQAA 1GHBF 1F0RA 3FFGA 1MCTA 1O5AB 1TNJA 2Z7FE 3K6YA 3BTFE 4GPGA 3UR6A 2C8YB 4JZIA 1HLTH 3LJOA 3O8DA 1B7XB 1SHHB 5EQQA 4MTBA 1MAYA 2BDGA 2TBSA 2GGVB 3B8JA 3S9BA 3TJUA 3P8FA 1XUFA 3A82A 6GCHF 2ZFQH 2BY7X 3GDSA 3GY5A 4BAKB 3RXVA 2HPQH 4VGCB 1CHOF 2R3UA 5LPRA 1PPZA 1O3DA 1FN8A 1L4DA 4JZFH 2OC7A 1Z6EA 5AFZH 1Y3WA 3UNRA 2BDIA 4IMZA 5LGOA 1XM1A 3LT3A 3S9CA 1C1NA 1ZMJA 2GP9B 2VH6A 3TJOA 1EPTA 1KXCA 1DSUA 5EPNA 4B2BA 1UK4A 3LU9B 2ZF0H 4AFSA 2ZGJA 2H9EH 3KQCA 3QZQA 2ANMH 4IN1A 3A80A 1XUHA 1ZR0A 2GTBA 3F1SB 3PTNA 1K1LA 1V2LT 5C67A 2OQ5A 4DOQA 1OP0A 2BDCA 1LVOA 3MO6A 4VGCC 1CT2E 2D1JA 3LDXH 2V3OH 3M5NA 1Y8TA 2IPHA 5J4QA 2O8TA 4H6SB 3LGYA 5LH8A 1BTPA 3OX7U 2NU0E 1AN1E 1SMFE 1A0JA 1EAIA 1HAGE 4MNXA 2ZO3H 1ZSLA 1P2KA 2BOHB 1V2TT 1HJAC 4MPWA 2ZWLH 3EDXB 1GHWH 2CXVA 1EQ9A 1GCTC 1YBWA 3TGJE 5EXNA 1AKSB 1Y3YA 2HWLB 3M3SA 4IW4E 2C90B 4DJZB 2BQWB 1GHBG 5H4IB 4H4FA 3LGIA 2P94A 4K1TA 1HAHH 2IN2A 1RTFB 2WPIS 1D3PB 2GV7A 2UUKB 4INHA 1HUTH 2C8XB 1SI5H 2ZU2A 3RLYH 2D26C 4BTUB 2UWLA 1C2DA 1WSSH 3QWCH 3Q00A 4MQAA 5I46H 1WQVH 2TRMA 1CE5A 3VGCB 2P16A 1G37A 5JB8S 3V7TA 4YESB 3SV8A 2AH4X 1TQ7B 1PQ5A 1TOMH 1ETTH 1ZJDA 3PYHA 3RXIA 1T8OA 1X7AC 1VITG 1OP2A 2QXGA 4YT6H 4AB8A 1ZPZA 2QGRA 3C27B 2FOBA 1YF4A 1GI5A 4MNYA 3BTEE 3LJJA 1TRMA 5JPMH 3MMGA 4X1PU 2QXHA 1FIWA 2OC0A 1GHZA 4YT7H 2VWOA 1JOUB 1CO7E 3QTVH 4X2WA 2A0QB 4FXGH 1O39A 4YTAA 1O3JA 3F9GA 1O34A 1CQQA 1ZPBA 2OXSA 3O8CA 5EPYA 1V2PT 1H8DH 3D62A 1C5QA 1PPHE 3HATH 3ZZ6A 3RU4T 1NROH 2BOKA 1AFQC 5C2ZA 4PROA 1EUFA 2XBVA 1JMOH 1W10U 3RXSA 1Y59T 4X1RU 3UQVA 3UNQA 1YCPM 1XUIA 1FIZA 1FPCH 2VIOA 3EA7A 1GHVH 2W3IA 4CR9A 3CS7A 1GJ6A 1S81A 1E35B 1WQSA 3M7UA 5B6OA 1C5UA 1GG6B 5EGMA 3DFLA 1EOLA 2XTTB 3UPEA 1GGDC 4AZ2B 2JETC 4X2VA 1A3EH 2AERH 2ZCHP 5GIBA 1FY4A 3OTJE 3SZNA 3RXBA 1UTLM 3DHKH 3M35A 3P95A 1GI3A 1KLTA 3FANA 1G3CA 1ZTJA 3O8BA 1BJUA 4SGBE 1YP9A 2B5TB 1ESAA 1U6QA 4WMEA 1DWEH 4ABFA 1AE8H 5GWZA 1QRZA 3MYWA 2FS9A 4ISOA 1SR5C 1GWAA 1MQ5A 4A7IB 1C9PA 2UWPA 3VXFH 4Y71A 3LC5A 3N7OA 4X8UH 1TRYA 1SGNE 1GGDB 1FV9A 1GHYH 3SV2H 2UUJB 1C1QA 1VGCB 5HMAA 2G55A 3H5CB 1YCPH 3RXHA 2GDDA 1QB6A 2OD3B 2G81E 2SNVA 1SFIA 2HNTF 1W11U 1HAIH 1LQEA 5C5OA 1UO6A 3BTHE 1F5KU 1O3HA 3M5MA 1PPEE 1O3PB 1V3XA 1BTUA 2BLVA 4JYTA 4FVDA 3W94A 2BDYA 4K5ZA 3ZZ7A 1P57B 1FN6A 2ZHFH 3QO6A 1ELFA 5CE1A 4ZHLU 2F9VA 3URCA 2FI4E 5EOKA 3TIUA 2QY0B 2BVRH 5JDUB 2EI6A 1GBIA 2ODQA 3BTQE 2ZU5A 4CBNA 3LGUA 1BB0B 5E2OA 2FESH 2PUQH 1C5OH 2VIQA 3PWBA 4F4OC 2YNAA 3SGAE 1BHXF 2ZFFH 1FI8A 2ALVA 4Q7ZA 4JYVH 2STAE 2A4QA 4Y10E 3LGVA 4JK5A 2ZA5A 2QN5T 1GCTB 3A81A 4Y8ZA 1P9UA 1HCGA 5ETXA 4BTTB 3FZZA 3PV4A 1NU7B 1GI1A 1JXPA 2OINA 5F6MA 5HM9A 2BZ6H 2Y5GA 1SGPE 4M7GA 1KXAA 4NA9H 1O3CA 1IHSH 3B23B 1YGCH 1HBTH 2Z3CA 4H42U 2CF9H 3D23A 3LGTA 2ZDMA 3SU4A 1BITA 1EP6A 2QAAA 3GCHB 5CMXH 3ATMA 3EYDA 1DDJA 5DO4H 3KQDA 1A5GH 2PSXA 1ZRBA 1H9HE 3KHVA 5AF9H 1FONA 3LKWA 1SGQE 2ANWA 3MNCA 1AVXA 1W12U 5CHAC 3MNBA 2WPMS 4I7YH 1PQ7A 1H9IE 1P01A 3QUMP 1GI6A 2BD3A 2VH0A 3KQEA 1MKXH 2BHGA 3QGJA 1SC8U 2P3TB 5DG6A 2F9UA 5DP3A 1OWEA 3TK5A 1QRXA 1S85A 1P0SH 1V2ST 2ZGHA 1W2KH 3PB1E 4A1TA 2Z3DA 4UE7H 2EEKA 2HOBA 2J4IA 2UUFB 4KP0A 1N8OC 1QB9A 3A85A 3PO1C 1G9IE 1TNHA 1HGTH 1GMDF 2W5EA 1AVWA 4CREA 2ZU3A 4ZKSU 1G3EA 1KDQB 3ZZ8A 3K2UA 1C4V2 2I6SA 1ID5H 2J95A 4BXWA 2IOTA 1CU1A 1V6DA 2XC5A 4Y7BA 1O2VA 3ZZDA 2PSYA 2CJIA 2B8OH 2B9LA 2ZZUH 2AGEX 4HI3A 1BMNH 4TPYA 3SU5A 3VB4A 1C5YB 1DANH 3STIA 2BY5X 2H1UA 1SGCA 1TA2A 1O36A 4B71A 3A8AA 1SGTA 1CA8B 1NT1A 2ZP0H 3P17H 4AFZA 8KME2 1HAYB 3U69H 2BD2A 5A8ZA 2ZFRH 4XBCA 1ZHMA 1XUGA 1FAXA 2J9NA 1TGSZ 1C5WB 2GZ8A 1O37A 1FQ3A 1S82A 4RSPA 1C5TA 3BEIB 4DT7B 1A1RA 3ENSB 1NS3A 1OWIA 2ZPRA 8GCHG 1HXFH 1V2VT 4X1QU 4ZXYH 2PKAA 4DGJA 1EPTB 3KIDU 4XBBA 2A32A 4U01A 1EAUA 3DD2H 4HTCH 1G30B 3S9AA 1Y3VA 1HNEE 2G00A 2FI3E 1ELGA 1TBQH 1S0QA 5LPEA 1AWFH 2H6MA 2CV3A 3RXLA 2FM2A 2Q6GA 1N1LA 3EA8A 1ELCA 1HAZB 1NESE 1P04A 1QCPA 1TQ0B 4WH6A 4AN7A 4IBLH 2VJ1A 3ZVEA 4KKDA 6ESTA 3OY5U 3S7KB 2WUBA 1TLDA 2Y82A 3EA9A 2ASUB 4GAWA 3MH7A 4GCHG 1INCA 4FUHA 3Q77A 1NFUA 2BM2A 5HGGA 1S84A 5FX5A 2ZFTA 3TITA 3SV9A 3EAJA 1SBWA 3R3GB 1IHTH 3SUEA 5FBEA 4HZHA 1ANBA 2C8ZB 2SGQE 1TMBH 1C2MA 4Q7YA 2QF3A 4IMQA 3SW2B 1H1BA 1Z1IA 3SUGA 3M3TA 2F9BH 3RLWH 2ZGCA 1V2RT 1AQ7A 3SV6A 3L3TA 4BXSA 4NIWA 1QBOA 1T32A 2IJOB 1GBCA 3SU6A 2VVUA 3TJVA 1T31A 2F91A 1KLJH 1GHXH 4AX9H 4NZQA 1TNLA 2F3CE 3VGCC 4FUBA 1WV7H 3K65B 2THFB 7GCHG 1K1IA 1K1OA 3MU0A 5F03A 3SHCH 1TGCA 1FNIA 1NFXA 2PWXA 4BANB 1O2ZA 4DVAU 4FU8A 2P8OC 3M3VA 4ASHA 1P3EA 5GPIB 3AVZA 2JETB 4JZDH 4LOYH 4XBDA 1EATA 2H2ZA 2GCTB 1THPB 5GCHG 4WXIA 1O3MA 1F0SA 1BTXA 4AFUA 1BOQA 3LH1A 1OWHA 2XBWA 2O8LA 4WXVA 1IQIA 2F9NA 3U8RH 1QL7A 1EXFA 1T7CA 1C1PA 3SUDA 3UREA 4A1VA 1KYNA 4OS2A 3ZVBA 1NM6A 1DWCH 4CR5A 2F9PA 1P03A 4NIVA 1LVBA 3RXFA 4BTIB 4K1SA 2BD4A 4ISIH 1GL0E 1Z8GA 4WMFA 1SOTA 2ODYB 4DIHH 1P2MA 1YKTA 1A7SA 4ZROA 4ABHA 3BSQA 1FLEE 3BTME 3W95A 4GUXA 1P10A 3MU5A 4I8KA 4IC5A 3ZV8A 2R3YA 1OWJA 2GKVE 2ZFSA 2WYJA 3SBKA 1XMNB 1K1MA 1SLVB 3U1IB 3FZDA 1MTNB 1SGDE 2BLWA 1FY3A 1HYLA 4CH8B 1ANDA 1T8MA 2FLRH 1JBUH 1H8IH 1CA0C 3SI4H 2PLXA 2BDAA 2SGEE 4BAQB 4I8LA 1IQFA 1O2PA 1P09A 3KGPA 2WYGA 1AGJA 5DP6A 2FX4A 4ZXXH 1LMWB 2XBXA 4WJG2 1ZRKA 4FUFA 3A87A 5HM2A 2G52A 3SJ8A 1P8VC 1GJ7B 1K1JA 3E3TA 1DOJA 1WBGB 1NZQH 2V0BA 1S6FA 4R0IA 1P12E 5EODA 1FUJA 3TK9A 1RIWC 3SU2A 2BZAA 2DE8A 4B74A 2H5DA 4E06H 2H9HA 1GDNA 2QYIA 3NPSA 1TGBA 1VGCC 2HVXA 3OU0A 4A92A 2FOCA 3F68H 1TB6H 2FIRH 1UTMA 2TIOA 1O2QA 1A61H 4AG2A 3P8OA 3LC3A 3SQHE 3VB3A 5JB9S 1NFYA 1O2NA 4XSKU 1UVOA 5L2YH 2W7SA 4Y79A 2CF8H 3H7OA 3Q76A 2WPKS 2WV5A 1ZPCA 1S6HA 1DUEA 2WV4A 1O3AA 2J2UA 4U30A 1LPKB 1Z8RA 2PGQB 1JRSA 2TGDA 1TMTH 1O2XA 7KMEH 1LTOA 1XKAC 1ELBA 1TBZH 3A84A 3TK6A 3NK8A 4BAHB 3TNSA 3BF6H 5DP9A 1ELAA 3MI4A 1RIWB 4A6LA 2QC2A 4X6NA 5JBBS 1YPHC 4WMDA 1OYTH 2BVSH 2BLQA 2QA9E 2VWMA 1TALA 2Y7XA 2BQ7B 4TWWA 4UD9H 1FPHH 4K1EA 3U1JB 2ZPQA 1MU6B 5AHGH 1TE0A 3PMJA 7ESTE 1SG8B 1AU8A 3GISB 1KSNA 2Y5FA 1P2OA 1GVLA 3K9XB 3ZZAA 4CHAB 4AGKA 1C5RA 1NO9H 4CRFA 3WY8A 4X0WU 1O3EA 1GJ4H 4X1SU 1UVUH 1ZGVA 4K2YA 2OCVB 2GCHF 1HRTH 1TPOA 1KDQA 1ZMNA 1C1RA 3GYLB 5EQSA 4ZMAH 1IQLA 2ANKH 3IWMA 1O2YA 4K8YA 3TNTA 1NTPA 4ISLA 1UTJA 1BRBE 1QY6A 1EAWA 2P3UB 1KY9A 1XXDA 1CBWB 2NU4E 3CENA 1C1VH 4OS4A 4JMYA 1TNGA 2R0LA 3GOVB 4ABGA 1Z8JB 2A7CA 1THSH 4CRDA 1O2MA 1PPGE 3TU7H 2Y7ZA 1AVGH 2ZKSA 5EW1H 4DIIH 3QGNB 1O2RA 1VJ9U 2BD9A 1HAOH 5A09A 1SQOA 4YOGA 3MU4A 2ZGXH 1O38A 1K21H 1O5CB 3VFEA 2FOAA 1O5FH 4X2XA 1GBMA 2FTMA 2OUAA 3RDZA 1QBNA 1UMAH 3GY7A 4U2WA 2NU1E 1GMHG 1GHAG 1PYTC 4I33A 1TGTA 1V2NT 3SV7A 1EASA 3M7QA 1ABJH 3RXGA