1GBIA

Alpha-lytic protease with met 190 replaced by ala and gly 216 replaced by leu complex with methoxysuccinyl-ala-ala-pro-phenylalanine boronic acid
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGLNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ALPHA-LYTIC PROTEASE
total genus 51
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbiA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbiA01
1AI8H 1P04A 1TAWA 3HK6B 1C4U2 2QC2A 5FCRA 4MTBA 1SGRE 3RXOA 2WV5A 2EEKA 1O5EH 1P3EA 1JIMA 3BTTE 1O3KA 4ZAEA 3RXIA 1C1WH 3BTME 4ZKRU 1P09A 4LZ1H 3M5NA 3MU0A 3UY9A 1ESTA 1KTSB 1AUJA 5C1XA 1RJXB 1TOCB 2FIRH 3KIDU 2CGAA 5TCCA 5AFZH 3TGIE 3E16B 3GY5A 2Z3DA 1FY5A 1BHXB 1HAOH 1ZGVA 3HKJB 1XM1A 1YPKH 1DPOA 3MH6A 1VCPA 1SPJA 4X2VA 4CRFA 3MH4A 1TOMH 1GMDF 1ELEE 3BF6H 3MHWU 5DK1A 3A87A 1FXYA 1BJUA 3BG4C 2CF9H 1MAYA 2WPKS 2RDLA 1OPHB 2VVUA 5FPTA 4ISLA 1Y5UT 1W7GH 5E0GA 1TNJA 1SGQE 1BTHH 1OP2A 3SU3A 1Z7KA 2BM2A 4X1RU 4FUJA 2AGGX 3MNCA 2DE8A 1V2VT 2G4TA 4MNYA 1YC0A 4FUEA 1BA8B 1TFXA 3LKWA 1QBNA 1HUTH 1RRKA 3KHVA 3ZZ3A 2FOBA 3SN8A 5JPMH 5JBBS 3E8LA 4OGXA 3Q76A 1GI6A 2ZTZA 4J2YB 3VB7A 1UJ1A 3Q3XA 1AUTC 3ODDA 4MQAA 1GHBF 1MBQA 2ZWLH 3M3SA 1CA0B 1TYNA 1XKAC 1RFNA 1A1RA 4E06H 1KXFA 1XMNB 3NUMA 2V3HH 4LK4A 4AG1A 4FU7A 3B8JA 4I8LA 1MQ5A 2B7DH 2BY8X 1LQDB 1B0EA 2WYJA 4NG9H 5DPAA 5FX6A 2ZKSA 3RXGA 1C5UA 2Y82A 5FPYA 1A3EH 1AWHB 1ZJDA 1WTHD 3HPTB 5HMAA 1KYNA 2O8MA 3EDXB 1G32B 2SGQE 4HI3A 3U1IB 5B6OA 5C5OA 2SGFE 3U9AH 1G37A 1O2NA 1S6FA 1IQFA 1M9UA 2A31A 1EPTA 2QF3A 4INKA 2SGAA 3O8CA 3F9GA 3IG6B 4WF8A 1O3CA 2FOFA 1HAZB 2ZNKH 1ZR0A 5DJ7A 2QA9E 1UHBB 4AGJA 4K3JA 4BTIB 3M5OA 1ZTJA 5BRRE 1KXDA 1ZTKA 1PPHE 1QJ6B 4JZEH 1C1MA 2SGDE 1XUHA 1EB2A 1TIOA 1GBFA 2GT8A 3A7VA 1P2IA 4AFSA 1THPB 2F9BH 1TA6A 1A5IA 2J2UA 4WXIA 1S83A 5PTPA 1SOZA 1MD7A 4AG2A 3MH7A 4TY6A 1O3DA 1CGIE 1O2IA 4Z0KA 4FU8A 4D7GA 1G3CA 2PUXB 1DSUA 1TGCA 3G01A 3NZIA 4I33A 3KNXA 1ZTLA 1W0YH 3E1XB 6ESTA 2HNTC 2CHAC 4VGCC 5F8XA 5LPFA 3T5FH 4CHAB 5DP4A 2Q1JA 1MU6B 2C93B 1G3EA 1IHSH 3FP8E 3EAJA 5IYTA 1QBVH 3NK8A 1XVOA 1GBIA 2OUAA 3VB4A 1GHZA 1BT7A 4D8NA 4F49A 4MDSA 1BMNH 1DUEA 3DT0H 3OX7U 4B2BA 4B74A 2Z9LA 1NTPA 2WYGA 4CBNA 4DW2U 4WWYA 1LVYA 2AIQA 3SW2B 3MWIU 1AY6H 4Q2KA 2VIQA 1J9CH 3RMMH 1HDTH 2R0LA 2AYWA 3MFJA 2ALPA 2G81E 2VH6A 3QX5H 1YGCH 1LVOA 1RS0A 3EA8A 2ZZUH 1FDPA 2ALVA 1C1SA 4B71A 2H1UA 2O8UA 2A7HA 3KGPA 1V3XA 2PGQB 1Y3UA 2B8OH 3M61U 2CXVA 4D9QA 4ZKSU 1ELFA 1BBRH 1P01A 2ZP0H 5FHTA 2ZFRH 1F0SA 3PYHA 2BD2A 3UWIA 5LPEA 2EI7A 4NFFA 3RC4A 3GOVB 3E0NB 2B5TB 1GBLA 2AH4X 1L0ZA 1NC6A 1V6DA 4DCDA 2ANMH 1MMJN 1NPMA 2QF0A 1GI7B 9ESTA 2B9LA 2FODA 2AMPA 2VIPA 2XCNA 4AB8A 1V2MT 2AGEX 1NRQH 1C5NH 2OQ5A 2IJOB 3VB3A 1MBMA 1O2UA 2GMTB 1YBWA 1QTFA 4X1PU 3BG4B 2BY5X 2QIQA 3KEEA 1Y5BT 5EG4A 3V12A 2Z3CA 1D3DB 2P95A 3TJVA 1A0HB 3TLOA 4E05H 8KME2 1P05A 3RM0H 4THNH 1L4DA 4GSOA 1MQ6A 3TJUA 3ZZAA 1GL0E 4AX9H 2BTCE 2FO9A 2AERH 3A81A 3K6YA 1S84A 2PSXA 2GTBA 3SUGA 4I7YH 1T8LA 1PYTD 2OQUA 1PPCE 1N6XA 3H7TA 2PR3A 2ZG0H 2RCEA 1KTTB 1HXFH 1WQVH 4H6TA 4YOGA 1GHVH 4O97A 4Y8YA 3GY2A 1LO6A 2O8LA 1SQAA 4GCHG 2XW9A 3A7XA 2TPIZ 3RC6A 2OINA 2TGDA 3BSQA 2C4FH 1LHDH 1FPHH 4IW4E 3TJNA 4YTAA 2KAIB 1SMFE 2NU3E 1PPEE 4Q7ZA 1QB1A 1EASA 4NCYA 3D65E 1KDQA 4FUGA 5LGOA 2C8XB 4ABHA 3S7HB 1ZZZA 5DP9A 3STJA 5JYIA 4IBLH 2ZHDA 1EZXC 1GGDC 1OOKB 4K69A 4Y8ZA 3M7UA 2P16A 3SHAH 3VEQB 1XKBC 2BD3A 5T6FA 2BHGA 2GZ7A 2H9TH 1ZOMA 3W95A 3LOXA 4BAOB 1IQKA 2SGEE 3MNSA 1SGCA 1K28D 2GV6A 4Z6AH 1CE5A 2FI4E 5JB8S 2WPJS 2BDHA 3SGBE 1W2KH 3K2UA 1ACBE 1C1PA 1HNEE 1NN6A 4OS1A 2QV1A 3SUFA 4O9VA 1IQIA 2FEQH 1EX3A 1BBRE 1O2SA 1C1QA 2V35A 1ZMLA 1DX5M 2G00A 3GYLB 5A0AE 1OKXA 1W13U 3AW1A 5FAHA 2XWBI 1GJ5H 1N8OC 4X8UH 1C4Y2 4ABJA 4ZHLU 5TJXA 1TX8A 1QY6A 4Y7BA 1TE0A 2WPIS 4Y10E 2BXUH 2AFQB 3LT3A 3SV8A 1DM4B 2WPHS 2J38A 2OP9A 1ZSKA 1H8IH 3GYMA 1C2GA 1SFQB 2BD7A 1SGDE 1DWDH 1IQMA 4I8HA 1AKSB 2PTNA 2FLRH 2G8TA 3UUZA 1SOTA 4Q7YA 2ZFPH 2ZDAH 4R0IA 3CS7A 3KL6A 1Z71A 2F9VA 1C5QA 1SBWA 4H42U 1BOQA 1BRCE 3UR9A 1IQNA 2VU8E 2W5EA 3PWCA 1YPJH 1YM0A 2ODQA 1H9IE 5F6MA 1BB0B 3LGWA 2FP7B 4MNWA 4ABAA 3TPIZ 3K9XB 2BB4A 4B1TA 1P11E 1LMWB 1O2WA 4YESB 1EP5A 1GBDA 3BTWE 2JH5D 3T28A 4CHAC 1YCPM 2WUCA 1HAHH 1SHYA 2EC9H 1ABJH 1FAXA 1QA7A 5C5NA 3TGJE 2R2MB 4GHTA 3F1SB 1TPPA 3E91A 4SGBE 4ZKNU 4WY3A 3RP2A 4WXVA 2FDAA 3SUDA 3TIUA 1ZHPA 3VPKA 4X1QU 2CMYA 2G51A 1O3HA 1WBGB 2FXRA 2GV7A 4I8JA 4ISOA 1P2KA 5F8ZA 2C3SA 4A1TA 3TK5A 2FOCA 2VH0A 1DS2E 5EOKA 1MZAA 1FJSA 1O3AA 4B2CA 2J94A 1UK2A 4B2AA 3SOSA 3GY6A 1F5LA 1O36A 1SGIB 1UMAH 3PM3A 4ZROA 3OTJE 8GCHG 2Q6DA 2GDDA 3GY7A 3A89A 1QBOA 1P2NA 4LZ4B 3MU5A 3MTYA 3PTBA 1NY22 2XC4A 1GI5A 3GCOA 2R2WU 2F91A 5DP5A 1J17T 4UFDH 1IQEA 3UNQA 4BTUB 1J14A 1VCWA 2G5VA 2H6MA 3SJ9A 4JK6A 3CP7A 1A2CH 4DT7B 1XUFA 2ULLA 1GJBB 2OC1A 6LPRA 2TGAA 3PB1E 1OYTH 3D49H 1HFDA 1BRAA 2FOHA 4MNXA 2STBE 2A7JA 1O30A 1TABE 3EYDA 1L1JA 1TMUH 3MYWA 1VJAU 3M35A 1IQHA 2P8OB 3BN9A 1TX7A 2OCVB 4JZ1A 3SU1A 2ASUB 7ESTE 1OWDA 1TPSA 1MTVA 3S9CA 1P2OA 2F9PA 1GBJA 1O2HA 4ZUHA 3LJOA 3QTOH 3LH3A 1Q3XA 1W14U 1V2TT 2LPRA 2EI6A 2RA0A 2ZA5A 3ZYDA 1ZSJA 1P2JA 3GISB 1O5DH 2QXIA 1C5MD 2BDAA 1NFWA 2W3KA 1F0TA 4XBDA 2RA3A 3RMOH 3EA9A 1HAGE 1C5XB 2OLGA 1TQ7B 2XBWA 3I78A 3V13A 1GWAA 5EXNA 2VWOA 1G3DA 3ZYEA 5A2MH 1TGSZ 2D8WA 1SLWB 1OYQA 1AQ7A 3FFGA 3ZZ9A 3TU7H 3AW0A 2A4QA 2A5KA 1GG6B 2CJIA 2Y7ZA 3P8OA 1DWCH 5G4BA 1QL8A 1CT0E 2I6SA 4Y6DA 3FZZA 5HM9A 5E8EH 1Y5AT 5FBIA 6CHAC 3SI4H 3C27B 4HGCA 3UOUA 3ZZ7A 2UUJB 1GHYH 2PFEA 3NPSA 2PKAB 1AO5A 1NT1A 4YOIA 3V0XA 1ANCA 1OWKA 4XBCA 3QDZB 1AFQC 3GY4A 1O2YA 4ASHA 4DIIH 3A88A 1PFXC 4RN6A 1U6QA 1C5RA 3UQVA 2OTVA 2QXJA 4ABGA 5HYOA 1G30B 3LGIA 2LNCA 1AB9B 1RTKA 1XUKA 4ABIA 2QXGA 3MOCA 2QYIA 4GHQA 3S9BA 4JYUH 2H5CA 1O5GH 5GIBA 1CU1A 1YPHC 5C20A 4U01A 1WU1A 1FY8E 1GVKB 2PLXA 1IQGA 1DICA 1NRNH 4ISNA 3VXFH 2SNVA 4KP0A 4CR5A 5DKMA 1GVZA 1Z8RA 3GCHB 4NA8A 3VB5A 2I6QA 1K1LA 1H1BA 3ZV8A 3P70B 3NWUA 2Z9KA 4JZIA 4OS5A 2XNIA 2Y81A 3JZ1B 3TK9A 1MCTA 3IWMA 1SHHB 3S0NA 2OC8A 3MU4A 3VGCC 1YP9A 1QNJA 1MU8B 4KELA 1AB9C 1W8BH 3FAOA 3QUMP 2GP9B 2GMTC 1GMHF 2BY7X 2YNAA 4XSKU 4CREA 1B7XB 4ABDA 2H5DA 3RXFA 3L3TA 4M7GA 2ZI2H 1BTXA 1SB1H 3UQOA 3QGNB 1NFXA 4Q7XA 5EW2H 1H9HE 3RXEA 5C3NA 2NU4E 1BQYA 3HATH 1EAUA 4D7FA 1QHRB 3M3VA 4WMFA 2NU1E 2Y7XA 1GHAF 2O8TA 1X7AC 1UTNA 1KY9A 1EJAA 4X6NA 1XUGA 3BG8A 4KGAA 4FUBA 1EAXA 2UWPA 1VZQH 2ANKH 3RXDA 4INLA 1FUJA 1QJ1B 1UTQA 3UPEA 1MD8A 3TH2H 4I31A 1LHGH 1OS8A 1DOJA 1PYTC 3SV2H 4DGJA 1A4WH 2W3IA 1HIAB 3P17H 2CF8H 4JK5A 1BRBE 3QZRA 1NM6A 1K1MA 3SU4A 4ABFA 5GXPA 1EZUC 3SBKA 4NWKA 2YOLA 1GDQA 1D9IA 1P10A 2HNTE 3OY5U 1ELVA 1EJMA 3ZV9A 1FN6A 4TWYA 1GJDB 2VWNA 3MNBA 5JB9S 1O5BB 1FZZA 2R0KA 1O5AB 5A8ZA 3B23B 2QGRA 2UWLA 3BTGE 3PMJA 2FM2A 1GBEA 1AHTH 2VWMA 1WQSA 2ILNA 2UWOA 1O5FH 1C5VA 2B0FA 5FX5A 1KDQB 2HRVA 2VIVA 2F3CE 1HRTH 2IPHA 1C1RA 1QB9A 1GI3A 2R3UA 3UWJH 4MPVA 1MKWH 3MU8A 1TLDA 1SGFA 1C2IA 3SU5A 2ZDNA 2WUBA 1FAKH 2NWNA 3ENSB 5SGAE 3FZDA 3TH3H 1FLEE 1EUFA 1P0SH 1C1OA 1HGTH 1UTKA 1GHWH 5DP6A 2ZCLP 1B0FA 1TGTA 2BDIA 1C1UH 5FPSA 1A3BH 4U30A 4BXWA 2FI5E 3H7OA 2ZFFH 2PSYA 1EQ9A 2CHAB 4VGCB 1UVSH 4TPYA 4XFQA 3GCNA 1MAXA 4JMYA 4U32A 4O3TA 2YNBA 4X8SH 3ZVCA 2ZHEH 1NZQH 4Y7AA 3SQHE 4ZXXH 1CO7E 2VB0A 1O2OA 1F5RA 2XYAA 2QCYA 2GGVB 4BANB 2GZ8A 3R0FA 1DE7H 2BQ6B 1O2XA 3LIWA 3LPRA 2WV4A 1G3BA 3OY6U 1HAVA 1E0FD 4NSYA 4DJZB 7LPRA 1ZRKA 3RDZA 2ODPA 1E34B 1YPEH 1AVWA 4KTSA 4KTCA 1YPMH 1P3CA 2ZF0H 1W0ZU 1BITA 3STIA 1DDJA 3LGVA 4DVAU 3SNEA 5JBCS 1UK4A 4FUDA 5ESTE 1AMHA 1O2GH 2H9HA 3ZZ5A 3P8FA 3QK1A 3GY3A 1OP8A 1NRSH 5EU8A 3U8TH 2A5IA 4B73A 3PROA 3FANA 3TVJB 1ETRH 5GPIB 3U8RH 2GVFA 4BOHA 1ID5H 4R8TB 4ESTE 1MKXH 1S0QA 1TBQH 3A85A 5EPYA 2O8WA 1O3BA 1UTJA 1D6RA 4X8VH 3GICB 2ZGCA 2F83A 2ZHQH 1GI0A 1T4VH 2AIPA 3ZVEA 1YKTA 1ZMNA 4DURA 1OSSA 5CMXH 1EAIA 3LGYA 1WOFA 2IN2A 3RLYH 1O2MA 1TPOA 1QIXB 1NRRH 2PKSC 4JZDH 1L1GA 3BTDE 3E0PB 1TNHA 4AORA 1EAWA 1P2QA 3T26A 1B5GH 1O2ZA 1UCYK 1TRNA 1EKBB 2D26C 1TGNA 2ZCKP 1UK3A 2AGIX 2J34A 1GJAB 3EA7A 1ETTH 2PHBA 5HM2A 1N6YA 1ORFA 3SGAE 3SJIA 1GJ8B 1GVLA 7GCHG 4UFFH 4UFEH 4OS2A 1BCUH 1S81A 5EXLA 3SHCH 3B9FH 1YPHE 2C8YB 2GZ9A 3DFJA 1DY9A 3LDXH 3FVFB 1GI2A 1Z1JA 3E3TA 2SFAA 1FI8A 2OBQA 2FS9A 4TYDA 4ZHMU 1S0RA 3HGPA 4RKOB 2NU0E 2ZC9H 1QR3E 4NZQA 3RXQA 1PQAA 3RXTA 2BLWA 2D2DA 1ZYOA 5HGGA 1C5LH 1INCA 2G5NA 3KN2A 1GHAG 2ZO3H 1HBTH 3HK3B 1FONA 3P6ZB 1PJPA 2GCTB 3DUXH 2Q6GA 1TMBH 4MLFB 4AFZA 3KCGH 1O2VA 2BVXH 3I77A 4RKJB 2Z3EA 4CRAA 5EPNA 1ZJKA 1V2WT 1S85A 1O33A 1Z8IB 2XXLA 3A82A 3RXCA 2A2XH 4WMEA 3SU0A 2FYQA 3VGCB 3OYPA 2XC5A 3SNDA 4CH8B 1LCYA 4UE7H 2GD4B 1P02A 2BZAA 4YT6H 5E2PA 3RXHA 1QRWA 1G2MA 1T4UH 2BX3A 1N1LA 4ZXYH 3SQEE 1A46H 1TX6A 1O2KA 2P59A 1AWFH 1C5ZB 3L6PA 5LPRA 2H9EH 2ZFTA 1BJVA 4K5ZA 2JH6D 2BD5A 1HCGA 1HIAA 2UUKB 3U69H 1IQLA 4LOYH 6GCHF 1E38B 4GVUA 1Q2WA 4BXSA 1GDUA 3SJOA 1DXPA 2BDGA 2PGBB 2ANWA 1C2LA 4NIVA 1O32A 2FMJA 1SVPA 3A84A 1SL3A 1GJ7B 3UNSA 2V6NA 9LPRA 5EGMA 5DP8A 1AFEH 1QL7A 1GDNA 5AVDA 5E0HA 4B75A 5DP3A 1YYY1 1LHEH 1BDAA 4CRDA 4HTCH 1ZPBA 1G2LA 1HAVB 5GJ4B 1BUIA 1GCDA 3QWCH 1N8OB 3QTVH 1XUIA 3VXEH 2BLOA 1DXWA 3V7TA 4FUIA 4GAWA 3ZZ4A 2A4OA 1V2ST 1PPGE 1TALA 4HFPB 3MMGA 3A7WA 3F9HA 3QGJA 5K7RA 4Y0YE 1O0DH 1ELGA 1GJ4H 1C9TA 4IN2A 1FY4A 2AS9A 1LHCH 1HJ9A 2FOMB 5GCHF 3ZVDA 2AEIH 1AIXH 4KKDA 1H4WA 4YLQH 3MNXA 1GG6C 3NCLA 1AU8A 2VVVA 4RSPA 1O35A 4AN7A 1ZGIA 2ZU3A 2R3YA 3PTNA 1VCQA 1G36A 1GBHA 1JRTA 1V2QT 1ELDE 3SJKA 1EPTB 5GCHG 1Y3XA 3ITIA 3P8NA 2A0QB 4IGDA 3A80A 1MTUA 1FQ3A 2K1QA 3LJJA 2ZGHA 4BAHB 1SGEE 1V2JT 2Q6FA 1K9OE 3L33A 1EB1H 2BZ6H 3MO9A 8LPRA 1GBAA 5J4SA 4UEHH 1SC8U 1KIGH 1AGJA 2ZU1A 1BTYA 4ISHH 1V2UT 1Y8TA 4NIWA 2BQWB 1GBBA 2PV9B 3SJ8A 2HPPH 3SGQE 1HYLA 1NRPH 1W3CA 2BMGB 4X2YA 1GBCA 1Y3VA 3LU9B 1VGCC 2A4RA 1VJ9U 4CRCA 1TGBA 2W26A 2Y80A 1C2FA 1DLKB 4K8BA 3ATMA 5EXMA 1K1NA 2V0BA 1D4PB 3ZZ6A 1SGFG 1C1NA 1NU7B 1HAIH 2BLQA 1C5OH 2XBVA 2BY9X 1Z8GA 1MTNB 1H8DH 1S6HA 1UVPA 3T2NA 5CHAC 2BOKA 4TPIZ 2FTMA 3SV9A 2ZU5A 2FTLE 2FZZA 3GCHC 4X2XA 3S69A 2GDEH 4WH8A 1KLIH 2HOBA 2VGCB 3RXKA 2ZDMA 3RXVA 1C5WB 1FY3A 1QGFA 5DGJA 1GI4A 2BLVA 1F0RA 1W7XH 5H4IB 1CA0C 4D76A 1WAYB 3F68H 5TCAA 4X2WA 3RU4D 1O2PA 1O3GA 1UCYE 1QQ4A 1LHFH 5EW1H 1OX1A 1HAYB 2FPZA 2VNTA 4X6MA 3TNSA 1PQ7A 3A7YA 1HAPH 2PTCE 5A09A 2J4IA 3KQCA 2WINI 3BEIB 5AHGH 3QZQA 1UTLM 2FOGA 1HB0B 4YZUA 3LGTA 1MTWA 4HZHA 2VVCA 1J16A 1ZHMA 3D62A 3NXPA 1ELAA 1SQTA 1UVOA 1F92A 3E90B 3M5LA 3QLPH 4UONA 5T6DA 3M3TA 4XE4A 1KXCA 3AAUA 2BDBA 1SFIA 2OBOA 2FYRA 2KAIA 3SUEA 1NO9H 5ABWA 4MNVA 1WSSH 3A7TA 3PMBB 3MO6A 3IITA 1XXFA 1Q31A 4BAKB 1TNKA 3ZZBA 1EOLA 5E2OA 1DWEH 5EQRA 3TH4H 1TA2A 3RXBA 5L2YH 5EODA 1BMLA 1NROH 1QFKH 3RMNH 1NFYA 5ESBA 5C1UA 1C9PA 1C1TA 3O8DA 1BTUA 4O03A 1LTOA 1JBUH 1A0LA 3A7ZA 2ZGXH 2TIOA 2AMQA 1IAUA 1OWHA 2FWWA 2G4UA 4X0WU 3ATKA 4DY7B 5BPEA 2ZDKA 1NU9A 2TRMA 2M5TA 1GGDB 4E7RG 2ZDLA 4XDEA 4I32A 4H4FA 5C2ZA 1O3LA 1WYKA 1T32A 1K22H 1F7ZA 1FY1A 4LXBH 3UOPA 4NWLA 1C2HA 4DG4A 2A2QH 1FPCH 1EOJA 2HGTH 2JH0D 2HNTF 4WVPE 2IOTA 3EGKH 3ESTA 2OD3B 1TNGA 1IQJA 3FP6E 3O8BA 3U1JB 3Q77A 2JETC 4Y11E 4PROA 1QRZA 5F8TA 1PPZA 1GI1A 1AKSA 2ZPQA 4BNRA 3SNAA 2BD4A 1WTGH 3LC3A 1FMGA 1CGJE 1DSTA 2ANYA 4FU9A 1L1NA 1GJ9B 2DUCA 2HLCA 3PLBA 4OGYA 1LKAA 3T25A 4FUHA 3SV6A 4CH2B 2HALA 4ZKOU 4IN1A 5A0BA 5L2ZH 1QJ7B 1O2JA 2FX4A 2ZDVH 2CN0H 3RXPA 2BVRH 4AYYB 2VIOA 1P06A 2VINA 2WPMS 5I46H 2P3TB 1L2EA 1SG8B 5T6GA 4X1SU 1DFPA 1SQOA 1CQQA 2BQ7B 4U2WA 5DG6A 4ZHAA 1ANEA 1UVTH 3V3MA 4IC5A 4NA7A 3BIVH 3RU4E 1A5HA 1OWEA 1ZMJA 1O3FA 4TWWA 1RIWB 3A8DA 3A86A 4OS7A 3F9EA 2FX6A 2H2ZA 3BTHE 5JDUB 1GL1A 1MTSA 4FVDA 3RXUA 1SGYE 3QO6A 5A8YA 4ABEA 1NS3A 2P3UB 3WY8A 1DY8A 4UD9H 2ZFSA 2A32A 2ZFQH 1DANH 4ZMAH 4X8TH 1O3OA 3ATLA 3ODFA 1Y3WA 2F9NA 1O2LA 2BYAX 2Y5GA 2GKVE 3UNRA 2ZHFH 3PO1C 3BTKE 1P9SA 3M7QA 4XOJA 1O3MA 1TQ0B 3RXRA 3I29A 1RTLA 1D3TB 2BX4A 1QB6A 1RGQA 1SR5C 4GPGA 4K1SA 1C1VH 2ZGJA 1O31A 3OU0A 1D3QB 3ZVFA 4Y8XA 1C4V2 2ZTYA 3E6PH 4FUCA 2PWXA 3ATWA 4E7NA 1BZXE 3UFAA 3SNBA 4DOQA 1ZSLA 2RG3A 3RUOA 4I8KA 1BTPA 1TMTH 1QURH 2HVXA 2C8ZB 4A6LA 1TNIA 3BEFB 2PUQH 4OS4A 1ESBA 1MTNC 1TRMA 1O2RA 2VWLA 1V2NT 1UVUH 4O3UA 4WH6A 1JWTA 1T8MA 1UTMA 4YO9A 3RXLA 5L30H 3BIUH 4INHA 1P9UA 4AB9A 3M7TA 2FS8A 1YLCA 1EZQA 1IHTH 1E37B 4IC6A 1T31A 2ZPSA 1PQ8A 1HV7A 2VIDA 4CRGA 1UO6A 1H9LB 1JXPA 1HJAC 1C2KA 1S5SA 1C5TA 2A7CA 1P2MA 4CBOA 8ESTE 5FCKA 3OSYA 4BTTB 1BBRK 1C5SA 3LGUA 2ZU2A 3SNCA 7GCHF 1MZDA 3P92A 3R3GB 5J4QA 1AE8H 4K8YA 2A1DB 1E36B 1K1IA 2ZQ2A 1T8OA 1ZRBA 1BIOA 1MH0A 1FNIA 4NFEA 2AMDA 1JIRA 1ELBA 1GMHG 3GY8A 8GCHF 3RC5A 3AVZA 1THSH 3RU4T 1GHBG 4MPWA 5T3HA 2GCHG 1AE5A 4QT8C 1YPGH 3EE0B 4MG3A 4OS6A 2ZEBA 2Y5FA 5FBEA 1HJ8A 4ISIH 1BMAA 4A5TS 4WJG2 4BAQB 5K0HA 3BTQE 1LPKB 3QN7A 1AVXA 1P12E 5A8XA 1VITG 3M37A 1C5PA 1P57B 5EQQA 3RMLH 1K1OA 1JMOH 5E0JA 4A7IB 2G52A 1LPZB 4CRBA 2BY6X 1W12U 2ZU4A 5AFYH 3SV7A 1IOEA 3TNTA 1UHBA 2Z9IA 2Z6BD 1Z8JB 4K1TA 1O5CB 3DFLA 2QAAA 1F0UA 1VR1H 4MPXA 3LC5A 4X6OA 1DWBH 3UR6A 1BTZA 1SLXB 3PLKA 3RXAA 1LQEA 2JETB 1WUNH 2P94A 5F03A 4GLYA 1A61H 5HXFA 1YPLH 1G9IE 3A8CA 4AGKA 4FUFA 1O3JA 1AFQB 3BEUA 1FN8A 1Z6JH 2ZECA 2BDYA 5ETXA 1CBWC 2A4GA 1MCVA 1GMCG 4AYVB 1RXPA 5DP7A 1LVBA 4Y79A 2ESTE 1ESAA 1EXFA 3T29A 5DO4H 1GMCF 3EQ0H 1F2SE 2W7UA 2CV3A 1ZPCA 1T7CA 5JBAS 4X1NU 2TBSA 1QA0A 6GCHG 4DIHH 3F6UH 2QY0B 5L6NH 3M5MA 2TGTA 1AZZA 2P3FH 3N7OA 1V2PT 3MH5A 2PW8H 3NKKA 3P95A 3MO3A 3K6ZA 3PWBA 4SGAE 1BRUP 3RLWH 2G55A 3K65B 1UTPA 2ZQ1A 1QQUA 1DLEA 3RXMA 4I8GA 1O3IA 3FP7E 2OXSA 6CHAB 3PV4A 1TPAE 2W7SA 1LVMA 1P8VC 2ZIQH 2Z94A 1ZPZA 3SZNA 2BDCA 2FLBH 1GHXH 1SLUB 5LH8A 1CT4E 1LKBA 4IS5A 2FI3E 1GCTB 1YCPK 3LONA 4K2YA 1FIWA 1TBZH 1SGPE 4J1YA 1OP0A 4YT7H 2FESH 1NFUA 2J92A 3ZVBA 1DT2A 1PPFE 1GI9B 1KXAA 3KQBA 1MKWK 3LH1A 3UTUH 3GDVA 2J95A 3SO3A 1KXEA 2F9UA 2ZHWH 3TITA 1D6WA 2XCFA 2ZCHP 4NA9H 5C1YA 3SI3H 1THRH 1O34A 3M36A 1HLTH 4YM9A 1AVGH 2VJ1A 1SGNE 2Z9GA 4MVNA 3ZZCA 4B76A 1NESE 1AD8H 1T8NA 1O2TA 3PLPA 1C2EA 2SGPE 3PO1B 3MI4A 4KTUA 1P03A 2Z7FE 4CR9A 1AN1E 2STAE 4YOJA 1QCPA 3GCTF 1JOUB 3PMAB 1ANDA 1FV9A 3P8GA 1AZ8A 1HPGA 1XX9A 3HGNA 2PKAA 3UREA 5GWZA 1O37A 1KLTA 1TONA 3TJOA 2XBXA 1L4ZA 3CS0A 1SGTA 2BXTH 1O2QA 1DITH 4IMZA 3MU1A 2R9PA 3VB6A 1BHXF 1XUJA 4BAMB 5AF9H 3S7KB 3GDSA 5A0CA 1EPTC 1C2DA 1CHGA 4JZFH 2A5AA 1RD3B 1WV7H 5C67A 2TGPZ 4F4OC 2QXHA 1E35B 2Y5HA 2EA3A 2ZTXA 3BTFE 1YLDA 2GCHF 1V2OT 4A1VA 2SNWA 1TNLA 2XC0A 1YCPH 4YLUA 2F9OA 3SU6A 1K2I1 1TWXB 2GX4A 1GMDG 1K21H 4JYTA 5I25A 3U8OH 1BMMH 1W10U 3ZZDA 5IDKA 1RIWC 1A5GH 1YF4A 2GCTC 1EP6A 2EI8A 4XBBA 1A7SA 2XTTB 1XVMA 2HWLB 1ZLRA 1HXEH 3CENA 2BVSH 1JRSA 1ELTA 2QN5T 3BV9B 4AFQA 1PQ5A 3C1KA 2VIWA 1V2LT 3Q3KA 2C90B 4NZLA 3RXJA 1ARCA 2FOAA 3KQDA 3T27A 1Y59T 1C2JA 1O3EA 1MKXK 1KLJH 5CHAB 2P8OC 1O3PB 1ARBA 3UIRA 1CBWB 1A0JA 4H6SB 1WCZA 4K1EA 1ELCA 1O39A 3W94A 2UUFB 3ZVAA 1CHOF 1SLVB 2XBYA 4K60A 2P93A 1EZSC 4Y0ZE 2A45B 3HKIB 1EATA 1LPGB 3A8BA 1VITF 2VGCC 1DUAA 3BTEE 4X6PA 3O8RA 3Q00A 2BD9A 1UCYH 1CGHA 2GT7A 3URCA 1FIZA 3RM2H 2Y6TA 4ABBA 1OWJA 3T62A 1D3PB 1VITH 2XWAA 1ETSH 1OWIA 1GCTC 2OC7A 2Z9JA 3SORA 4AZ2B 3JZ2B 1SI5H 4JCNA 4NIXA 1S82A 2V3OH 1XXDA 1GBMA 3DHKH 4JYVH 1Y3YA 4ZH8A 1K1JA 1W11U 4GUXA 1QL9A 3S9AA 2OC0A 4WMDA 1RTFB 2HPQH 4GCHF 1VGCB 1Z6EA 1GI8B 3PMHB 4MPUA 1GJCB 5EQSA 2D1JA 3ZVGA 3GDUA 1EJNA 1GBTA 5GDSH 1K1PA 1ANBA 5JBTA 1J15A 5FXLA 3VFEA 1HAXB 4NIYA 4AFUA 3ZZ8A 4A1XA 1TBRH 1CA8B 1Z1IA 2JKHA 3AAVA 1ABIH 3TGKE 3ATIA 1UTOA 3A83A 2XRCA 1SSXA 2C8WB 3DA9B 3TK6A 4AOQA 3H5CB 1CT2E 4UDWH 4IMQA 1O38A 1O3NA 2BOHB 3AASA 4D9RA 3RXSA 1C2MA 1CHOG 3A8AA 2UUYA 3KQEA 3U98H 2ODYB 3Q3YA 4TY7A 4NGAH 1BTWA 2DE9A 3D23A 1HJAB 2NU2E 1TRYA 1V2RT 4Y71A 2ZPRA 1MUEB 2PKSB 2WPLS 7KMEH 1C5YB 5CE1A 3SU2A 3ELAH 2BD8A 2ZGBH 3F9FA 4Y76A 1PPBH 4UFGH 2O9QA 1GBKA 1GPZA 1LDTT 3KF2A 1TB6H 4FVBA 4A92A 1CVWH 1QRXA 1ZHRA 3GCTG 1CSOE 2THFB 1OXGA 4FXGH 1F5KU 1KXBA 1J8AA 3DD2H 1V2KT 4Q80A 1GJ6A 2FOEA 4NSVA 2J9NA 3URDA 1KSNA 1DVAH
chains in the Genus database with same CATH superfamily
1AI8H 1P04A 1TAWA 3HK6B 1C4U2 2QC2A 5FCRA 3KYFA 2K0QA 4MTBA 1SGRE 3RXOA 5EJLA 2WV5A 2EEKA 1O5EH 1P3EA 1JIMA 3BTTE 1O3KA 4ZAEA 3RXIA 1C1WH 3BTME 4ZKRU 1P09A 3UAIC 3M5NA 3MU0A 4LZ1H 3UY9A 1ESTA 4ACAA 1KTSB 1AUJA 5C1XA 1RJXB 1TOCB 2FIRH 3KIDU 2CGAA 5TCCA 5AFZH 3TGIE 3E16B 3GY5A 2Z3DA 1FY5A 1BHXB 1HAOH 1ZGVA 3HKJB 3FO8D 1XM1A 1YPKH 2V7QD 1DPOA 3MH6A 1VCPA 3OAAD 1SPJA 4X2VA 4CRFA 3MH4A 1TOMH 1GMDF 5CDFE 1ELEE 3BF6H 3MHWU 5DK1A 3A87A 5EIYA 1FXYA 1BJUA 3BG4C 2CF9H 1MAYA 2WPKS 2RDLA 3DSPA 1OPHB 2VVUA 5FPTA 4ISLA 1Y5UT 1W7GH 5E0GA 3F2FA 1TNJA 1SGQE 1BTHH 1OP2A 3SU3A 1Z7KA 2BM2A 4X1RU 4FUJA 2AGGX 3MNCA 2DE8A 2LP6A 1V2VT 2G4TA 4MNYA 1YC0A 4FUEA 1BA8B 1TFXA 3LKWA 1QBNA 1HUTH 1RRKA 2RDEA 3KHVA 3ZZ3A 2FOBA 3SN8A 5JPMH 5JBBS 3E8LA 4OGXA 3Q76A 1GI6A 2ZTZA 4J2YB 3VB7A 1UJ1A 3PV2A 1AUTC 3ODDA 3Q3XA 1GHBF 1MBQA 4MQAA 3AK5A 2ZWLH 3M3SA 1CA0B 1TYNA 1XKAC 4FETA 1RFNA 1A1RA 4E06H 1KXFA 1W0JD 1XMNB 3NUMA 2V3HH 4LK4A 4AG1A 4FU7A 3B8JA 4I8LA 1MQ5A 2B7DH 2BY8X 3OTPA 1LQDB 1B0EA 2WYJA 4NG9H 5DPAA 5FX6A 2ZKSA 3RXGA 1C5UA 2Y82A 5FPYA 1A3EH 1AWHB 1ZJDA 1WTHD 3HPTB 5HMAA 1KYNA 2O8MA 3EDXB 1G32B 2SGQE 4HI3A 3U1IB 5B6OA 5C5OA 2SGFE 3U9AH 1G37A 1O2NA 1S6FA 1IQFA 1M9UA 2A31A 1EPTA 2QF3A 4INKA 2SGAA 3O8CA 3F9GA 3IG6B 4WF8A 1O3CA 2FOFA 1HAZB 2ZNKH 5C17A 1ZR0A 5DJ7A 2QA9E 1UHBB 4AGJA 4K3JA 5EJ1A 4BTIB 3M5OA 1ZTJA 5BRRE 1KXDA 1ZTKA 1PPHE 1NBMD 1QJ6B 4JZEH 1C1MA 2SGDE 1XUHA 1EB2A 1TIOA 1GBFA 2GT8A 3A7VA 4F48B 1P2IA 4AFSA 1THPB 2F9BH 1TA6A 1A5IA 2J2UA 4WXIA 1S83A 5PTPA 1SOZA 1MD7A 4AG2A 3MH7A 4TY6A 1O3DA 1CGIE 1O2IA 4Z0KA 4FU8A 4D7GA 1G3CA 2PUXB 1DSUA 1E1QD 1TGCA 3G01A 3NZIA 4I33A 3KNXA 1ZTLA 1W0YH 3E1XB 6ESTA 2HNTC 2CHAC 4VGCC 5F8XA 5LPFA 3T5FH 4CHAB 5DP4A 2Q1JA 1MU6B 2C93B 1G3EA 1IHSH 4RI0A 3FP8E 3EAJA 5IYTA 1QBVH 3NK8A 1XVOA 5HIYA 1GBIA 2OUAA 3VB4A 1GHZA 1BT7A 4D8NA 4F49A 3WWBA 4MDSA 1BMNH 1DUEA 3DT0H 3OX7U 4B2BA 4B74A 2Z9LA 1NTPA 2WYGA 4CBNA 4DW2U 4WWYA 1LVYA 2AIQA 3SW2B 3MWIU 3MQKC 1AY6H 4Q2KA 2VIQA 1J9CH 1YLNA 3RMMH 1HDTH 2R0LA 2AYWA 3MFJA 2HVYB 2ALPA 2G81E 2VH6A 3QX5H 1YGCH 1LVOA 1RS0A 3EA8A 2ZZUH 1FDPA 2ALVA 1C1SA 4B71A 2H1UA 2O8UA 2A7HA 3KGPA 1V3XA 2PGQB 4XD7D 1Y3UA 2B8OH 3M61U 2CXVA 4D9QA 4ZKSU 1ELFA 1BBRH 1P01A 2ZP0H 5FHTA 2ZFRH 1F0SA 3PYHA 2BD2A 3UWIA 5LPEA 2F4LA 2EI7A 4NFFA 3RC4A 3U28C 3GOVB 3E0NB 2B5TB 1GBLA 2AH4X 3PRBA 2IJD1 1L0ZA 1NC6A 1V6DA 4DCDA 2ANMH 1MMJN 1NPMA 2QF0A 1GI7B 2QF4A 9ESTA 2B9LA 2FODA 2AMPA 2VIPA 2XCNA 4AB8A 1V2MT 2AGEX 1NRQH 4I86A 1C5NH 2OQ5A 2IJOB 3VB3A 1MBMA 1O2UA 2GMTB 1YBWA 4B6FA 1QTFA 4X1PU 3BG4B 2BY5X 2QIQA 3KEEA 1Y5BT 5EG4A 3V12A 2Z3CA 1D3DB 2P95A 3TJVA 1A0HB 3TLOA 4E05H 8KME2 1P05A 3RM0H 4THNH 1L4DA 4GSOA 5KECA 1MQ6A 3TJUA 3ZZAA 1GL0E 4AX9H 2BTCE 2FO9A 2AERH 3A81A 3K6YA 1S84A 2PSXA 2GTBA 2HLDD 3SUGA 3OEED 4I7YH 1T8LA 1PYTD 2OQUA 1PPCE 1N6XA 3H7TA 2PR3A 2ZG0H 2RCEA 1KTTB 1HXFH 1WQVH 4H6TA 4YOGA 5EJZA 1GHVH 4O97A 4Y8YA 3GY2A 1LO6A 2O8LA 1SQAA 4GCHG 2XW9A 3A7XA 2TPIZ 3RC6A 2OINA 2TGDA 3BSQA 3EE7A 2C4FH 1LHDH 1FPHH 4IW4E 3TJNA 4YTAA 2KAIB 3SYJA 2WHXA 1SMFE 2NU3E 1PPEE 4Q7ZA 1QB1A 1EASA 4NCYA 3D65E 1KDQA 4FUGA 5LGOA 2C8XB 4ABHA 3S7HB 1ZZZA 5DP9A 3STJA 5JYIA 4IBLH 2ZHDA 1EZXC 1GGDC 1OOKB 4K69A 4Y8ZA 3M7UA 2P16A 3SHAH 3VEQB 1XKBC 2BD3A 5T6FA 2L6OA 2BHGA 1QZ8A 2GZ7A 2H9TH 1ZOMA 1EFRD 3W95A 3LOXA 4BAOB 1IQKA 2SGEE 3MNSA 1SGCA 1K28D 3N7EA 2GV6A 4Z6AH 1CE5A 2FI4E 5JB8S 2WPJS 2BDHA 3SGBE 1W2KH 3K2UA 1ACBE 1C1PA 1HNEE 1NN6A 4OS1A 2QV1A 3SUFA 4O9VA 1IQIA 2FEQH 4F55A 1EX3A 1BBRE 4YXWD 1O2SA 1C1QA 2V35A 1ZMLA 1DX5M 2G00A 3GYLB 5A0AE 5T1VA 1OKXA 1W13U 3AW1A 5FAHA 2XWBI 1GJ5H 1N8OC 4X8UH 1C4Y2 4ABJA 4ZHLU 5TJXA 1TX8A 1QY6A 4Y7BA 1TE0A 2WPIS 4Y10E 5CHBA 2BXUH 2AFQB 3GS9A 3LT3A 3SV8A 1DM4B 2WPHS 2J38A 2OP9A 1ZSKA 1H8IH 3GYMA 1C2GA 1SFQB 2BD7A 1SGDE 1DWDH 1IQMA 3KYGA 4I8HA 1AKSB 2PTNA 2FLRH 2G8TA 3F3BA 5C0TA 3UUZA 1SOTA 4Q7YA 1W0KD 2ZFPH 2ZDAH 4TSFD 4R0IA 3CS7A 3KL6A 1Z71A 2F9VA 1C5QA 1SBWA 4H42U 1BOQA 1BRCE 4M9FA 3UR9A 1IQNA 2VU8E 4P00A 2W5EA 3PWCA 1YPJH 1YM0A 2ODQA 1H9IE 1NBME 5F6MA 1BB0B 3LGWA 2FP7B 4MNWA 4ABAA 3TPIZ 3K9XB 2BB4A 4B1TA 1P11E 1LMWB 1O2WA 4YESB 1EP5A 1GBDA 3BTWE 2JH5D 3T28A 4CHAC 1YCPM 2WUCA 1HAHH 1SHYA 2EC9H 1ABJH 1FAXA 1QA7A 5C5NA 3TGJE 2R2MB 4GHTA 3F1SB 1TPPA 3E91A 4SGBE 4ZKNU 4WY3A 3RP2A 4WXVA 2FDAA 3SUDA 3TIUA 1ZHPA 3VPKA 4X1QU 2CMYA 2G51A 1O3HA 1WBGB 2FXRA 2GV7A 4I8JA 4ISOA 1P2KA 5F8ZA 2C3SA 4A1TA 3TK5A 2FOCA 2VH0A 1DS2E 5EOKA 1MZAA 1FJSA 1O3AA 4B2CA 2J94A 1UK2A 4B2AA 3SOSA 2YMSC 3GY6A 1F5LA 1O36A 1SGIB 1UMAH 3PM3A 4ZROA 3OTJE 8GCHG 2Q6DA 2GDDA 3OEHD 2KCPA 1WDIA 1QBOA 2KR7A 3A89A 3GY7A 1P2NA 4LZ4B 3MU5A 3MTYA 3PTBA 1NY22 2XC4A 1GI5A 3GCOA 2R2WU 2F91A 5DP5A 1J17T 4UFDH 1IQEA 3UNQA 4BTUB 1J14A 1VCWA 2G5VA 2H6MA 3SJ9A 4JK6A 3CP7A 1A2CH 4FOUC 4DT7B 1XUFA 2ULLA 1GJBB 2OC1A 6LPRA 2TGAA 3PB1E 1OYTH 3D49H 1HFDA 1BRAA 2J97A 2FOHA 4MNXA 2STBE 3DSGA 2A7JA 1O30A 1TABE 3EYDA 1L1JA 1TMUH 3MYWA 1VJAU 3M35A 1IQHA 2P8OB 3BN9A 2WPDD 1TX7A 2OCVB 4JZ1A 3SU1A 2ASUB 7ESTE 2AHME 1OWDA 1TPSA 1MTVA 3S9CA 1P2OA 2F9PA 1GBJA 1O2HA 4ZUHA 3LJOA 3QTOH 3LH3A 1Q3XA 1W14U 1V2TT 2LPRA 2EI6A 2RA0A 2ZA5A 3ZYDA 1ZSJA 1P2JA 3GISB 1O5DH 2QXIA 1C5MD 2BDAA 1NFWA 2W3KA 1F0TA 4XBDA 2RA3A 3RMOH 3EA9A 1HAGE 1C5XB 2OLGA 1TQ7B 2XBWA 1BMFD 3I78A 3V13A 1GWAA 5EXNA 2VWOA 1G3DA 3ZYEA 5A2MH 1TGSZ 2D8WA 1SLWB 2KCAA 1E79D 1OYQA 2J5UA 1AQ7A 3FFGA 3ZZ9A 3TU7H 3AW0A 2A4QA 2A5KA 1GG6B 2CJIA 2Y7ZA 3P8OA 1DWCH 5G4BA 1QL8A 1CT0E 2I6SA 4Y6DA 3FZZA 5HM9A 2CK3D 5E8EH 1Y5AT 5FBIA 6CHAC 3SI4H 3C27B 4HGCA 3UOUA 3ZZ7A 2UUJB 1GHYH 2PFEA 3NPSA 2JDID 2PKAB 1AO5A 1NT1A 4YOIA 3V0XA 1ANCA 1OWKA 4XBCA 3QDZB 1AFQC 3GY4A 1O2YA 4ASHA 1H8HD 4DIIH 5GNDA 3A88A 1PFXC 4RN6A 1U6QA 1C5RA 3UQVA 2OTVA 2QXJA 4ABGA 5HYOA 1G30B 3LGIA 2LNCA 1AB9B 1RTKA 1XUKA 4ABIA 2QXGA 3MOCA 2QYIA 4GHQA 3S9BA 4JYUH 2H5CA 1O5GH 5GIBA 1CU1A 1YPHC 5C20A 4U01A 1WU1A 1FY8E 1GVKB 2PLXA 1IQGA 1DICA 1NRNH 4ISNA 3VXFH 2SNVA 4KP0A 4CR5A 5DKMA 1GVZA 1Z8RA 3GCHB 4NA8A 3VB5A 2I6QA 1K1LA 1H1BA 3ZV8A 3P70B 3NWUA 4Q63A 2Z9KA 4JZIA 4OS5A 2XNIA 2Y81A 3JZ1B 3TK9A 1MCTA 3IWMA 1SHHB 3S0NA 2OC8A 3VG8A 3MU4A 3VGCC 1YP9A 1QNJA 1MU8B 4KELA 1AB9C 1W8BH 3FAOA 3QUMP 2GP9B 2GMTC 1GMHF 2BY7X 2YNAA 4XSKU 4CREA 5B6LA 1B7XB 2JIZD 2H5DA 4ABDA 3RXFA 3L3TA 4M7GA 2ZI2H 1BTXA 1SB1H 3UQOA 3QGNB 5DSFA 1NFXA 4Q7XA 5EW2H 1H9HE 3RXEA 5C3NA 2NU4E 1BQYA 3HATH 5F53A 1EAUA 4D7FA 1QHRB 3M3VA 4WMFA 2NU1E 2Y7XA 1GHAF 2O8TA 1X7AC 1UTNA 1KY9A 1EJAA 4X6NA 1XUGA 3BG8A 4KGAA 4FUBA 1EAXA 2UWPA 1VZQH 2ANKH 3RXDA 5HKKD 4INLA 1FUJA 1QJ1B 1UTQA 3UPEA 1MD8A 3TH2H 4I31A 1LHGH 1OS8A 1DOJA 1PYTC 3SV2H 4DGJA 1A4WH 2W3IA 1HIAB 3P17H 2CF8H 4JK5A 1BRBE 3QZRA 1NM6A 1K1MA 3SU4A 4ABFA 5GXPA 2KM0A 1EZUC 3SBKA 4NWKA 2YOLA 1GDQA 1D9IA 2J98B 1P10A 2HNTE 3OY5U 3WWFA 1ELVA 1EJMA 3ZV9A 1FN6A 4TWYA 1GJDB 2VWNA 3MNBA 5JB9S 1O5BB 1VKYA 1FZZA 2R0KA 4ASUD 1O5AB 5A8ZA 3B23B 2QGRA 2UWLA 3BTGE 3PMJA 5DN6D 2FM2A 1GBEA 1AHTH 2VWMA 1WQSA 2ILNA 2W6ID 2UWOA 1O5FH 1C5VA 2M2AA 2B0FA 5FX5A 1KDQB 2HRVA 2VIVA 2F3CE 1HRTH 2IPHA 1C1RA 1QB9A 1GI3A 2R3UA 4DT4A 3UWJH 4MPVA 1MKWH 3MU8A 1TLDA 1SGFA 1C2IA 3SU5A 2ZDNA 2WUBA 1FAKH 2NWNA 3ENSB 5SGAE 3FZDA 3TH3H 1FLEE 1EUFA 1P0SH 1C1OA 2XNDD 1HGTH 1UTKA 1GHWH 5DP6A 2ZCLP 1B0FA 1TGTA 2BDIA 1C1UH 5FPSA 1A3BH 4U30A 4BXWA 2FI5E 3H7OA 2ZFFH 2PSYA 1EQ9A 2CHAB 4VGCB 1UVSH 4TPYA 4XFQA 3GCNA 1MAXA 4JMYA 4U32A 4O3TA 2YNBA 4X8SH 3ZVCA 2ZHEH 1NZQH 4Y7AA 3SQHE 4ZXXH 1CO7E 2VB0A 1O2OA 1F5RA 2XYAA 2QCYA 2GGVB 2KZ4A 4BANB 2GZ8A 3R0FA 1DE7H 2BQ6B 1O2XA 4Z1MD 3LIWA 3LPRA 2WV4A 1G3BA 3OY6U 1HAVA 1E0FD 4NSYA 4DJZB 7LPRA 1ZRKA 3RDZA 2ODPA 1E34B 1YPEH 1AVWA 4KTSA 4KTCA 1YPMH 1P3CA 2ZF0H 1W0ZU 1BITA 3STIA 1DDJA 2OK5A 3LGVA 4DVAU 3SNEA 5JBCS 1UK4A 2JJ2D 4FUDA 5ESTE 1AMHA 1O2GH 2H9HA 3ZZ5A 3P8FA 3QK1A 3GY3A 1OP8A 1NRSH 5EU8A 3U8TH 2A5IA 4B73A 3PROA 3FANA 3TVJB 1ETRH 5GPIB 3U8RH 2GVFA 4BOHA 1ID5H 4R8TB 4ESTE 1MKXH 1S0QA 1TBQH 3A85A 2WSSD 5EPYA 2O8WA 1O3BA 3N99A 1UTJA 1D6RA 4X8VH 3GICB 2ZGCA 2F83A 2ZHQH 1GI0A 1T4VH 2AIPA 3ZVEA 1YKTA 1ZMNA 4DURA 1OSSA 5CMXH 1EAIA 3W1EA 3LGYA 1WOFA 2IN2A 3RLYH 1O2MA 1TPOA 1QIXB 1NRRH 2PKSC 4JZDH 1L1GA 3BTDE 3E0PB 1TNHA 3F0OA 4AORA 1EAWA 1P2QA 3T26A 1B5GH 1O2ZA 1UCYK 1TRNA 1EKBB 2D26C 1TGNA 2ZCKP 1UK3A 2AGIX 2J34A 1GJAB 3EA7A 1ETTH 2PHBA 2J98A 1N6YA 1ORFA 3F2GA 5HM2A 1GJ8B 1GVLA 3SGAE 7GCHG 4UFFH 4UFEH 4OS2A 1BCUH 1S81A 5EXLA 3SHCH 3B9FH 1YPHE 2C8YB 2GZ9A 3DFJA 1DY9A 3LDXH 3FVFB 1GI2A 1Z1JA 3E3TA 2SFAA 1FI8A 2OBQA 2FS9A 4TYDA 4ZHMU 2WV9A 1S0RA 3HGPA 4RKOB 3UB0A 2NU0E 2ZC9H 1QR3E 4NZQA 3RXQA 1PQAA 3RXTA 2BLWA 2D2DA 1ZYOA 4TT3D 5HGGA 1C5LH 1INCA 2G5NA 3KN2A 1GHAG 2ZO3H 1HBTH 3HK3B 1FONA 3P6ZB 1PJPA 2GCTB 3DUXH 2Q6GA 1TMBH 4MLFB 4AFZA 3KCGH 1O2VA 2BVXH 3I77A 4RKJB 2Z3EA 4CRAA 5EPNA 1ZJKA 5FL7D 1V2WT 1S85A 1O33A 1Z8IB 3PRDA 2XXLA 3A82A 3RXCA 2A2XH 4WMEA 3SU0A 2FYQA 3VGCB 3OYPA 2XC5A 3SNDA 4CH8B 1LCYA 4UE7H 2GD4B 1P02A 2BZAA 4OM9A 4YT6H 5E2PA 3RXHA 1QRWA 1G2MA 1T4UH 2BX3A 1N1LA 4ZXYH 3SQEE 1A46H 5C0UA 1TX6A 1O2KA 2P59A 1AWFH 1C5ZB 3ZIAD 3L6PA 5LPRA 3CNRA 2H9EH 2ZFTA 1BJVA 4K5ZA 2JH6D 2BD5A 1HCGA 1HIAA 2UUKB 3U69H 1IQLA 4LOYH 6GCHF 1E38B 4GVUA 1Q2WA 4BXSA 1GDUA 3SJOA 1DXPA 2BDGA 2PGBB 2ANWA 1C2LA 4NIVA 1O32A 2FMJA 1SVPA 3A84A 1SL3A 1GJ7B 3UNSA 2V6NA 9LPRA 5EGMA 5DP8A 1AFEH 1QL7A 1GDNA 5AVDA 5E0HA 4B75A 5DP3A 1YYY1 1LHEH 1BDAA 4CRDA 4HTCH 1ZPBA 5C94A 1G2LA 1HAVB 5GJ4B 1BUIA 1GCDA 3QWCH 1N8OB 3QTVH 1XUIA 4RT0A 3VXEH 2BLOA 1DXWA 3V7TA 4FUIA 4GAWA 3ZZ4A 2YMSB 2A4OA 1V2ST 1PPGE 1TALA 4HFPB 3MMGA 2VBCA 1UW7A 3A7WA 3F9HA 1WXRA 3QGJA 5K7RA 4Y0YE 1O0DH 3OE7D 1ELGA 1GJ4H 1C9TA 4IN2A 1FY4A 2AS9A 1LHCH 1HJ9A 2FOMB 5GCHF 3ZVDA 2AEIH 1AIXH 3KQ5A 4KKDA 1H4WA 4YLQH 3MNXA 1GG6C 3NCLA 1AU8A 2VVVA 4RSPA 1O35A 4AN7A 1ZGIA 2ZU3A 2R3YA 3PTNA 1VCQA 1G36A 1GBHA 1JRTA 1V2QT 1ELDE 3SJKA 1EPTB 5GCHG 1FX0B 1Y3XA 3ITIA 3P8NA 2V3MA 2A0QB 4IGDA 3A80A 1MTUA 1FQ3A 2K1QA 3LJJA 2ZGHA 4BAHB 1SGEE 1V2JT 2Q6FA 1K9OE 3L33A 1EB1H 2BZ6H 3MO9A 8LPRA 1GBAA 5J4SA 4UEHH 1SC8U 1KIGH 1OHHD 1AGJA 2ZU1A 1BTYA 4ISHH 1V2UT 1Y8TA 4NIWA 2BQWB 1GBBA 2PV9B 3SJ8A 2HPPH 3SGQE 1HYLA 1NRPH 1W3CA 2BMGB 4X2YA 1GBCA 1Y3VA 3LU9B 3NRLA 1VGCC 2A4RA 1VJ9U 1KMHB 4CRCA 3OFND 1TGBA 2W26A 2Y80A 1C2FA 1DLKB 4K8BA 3ATMA 5EXMA 1K1NA 2V0BA 1D4PB 3ZZ6A 1SGFG 1C1NA 1NU7B 1HAIH 2BLQA 1C5OH 2XBVA 2BY9X 1Z8GA 1MTNB 2W6JD 1H8DH 1S6HA 1UVPA 3T2NA 5CHAC 2BOKA 4TPIZ 2FTMA 3SV9A 2ZU5A 2FTLE 2FZZA 3GCHC 4X2XA 3S69A 2GDEH 4WH8A 1KLIH 2HOBA 2VGCB 3RXKA 5HIZA 2ZDMA 3RXVA 1C5WB 1FY3A 1QGFA 5DGJA 1GI4A 2BLVA 1F0RA 1W7XH 5H4IB 1CA0C 4D76A 1WAYB 3F68H 5TCAA 4X2WA 3RU4D 1O2PA 1O3GA 1UCYE 1QQ4A 1LHFH 1H8ED 5EW1H 1OX1A 1HAYB 2FPZA 2VNTA 4X6MA 3TNSA 1PQ7A 3A7YA 5KGOA 2JJ1D 1HAPH 2PTCE 5A09A 2J4IA 3KQCA 2WINI 3BEIB 5AHGH 3QZQA 1UTLM 2FOGA 1HB0B 1YWUA 4YZUA 1COWD 3LGTA 1MTWA 4HZHA 2VVCA 1J16A 1ZHMA 3D62A 3DSOA 3NXPA 1ELAA 1SQTA 1UVOA 1F92A 3E90B 3M5LA 3QLPH 4UONA 5T6DA 3M3TA 4XE4A 1KXCA 3AAUA 2BDBA 1SFIA 2OBOA 2FYRA 2KAIA 3SUEA 1NO9H 5ABWA 4MNVA 1WSSH 3A7TA 3PMBB 2L74A 3MO6A 3IITA 1XXFA 2WZQA 1Q31A 4BAKB 1TNKA 3ZZBA 1EOLA 5E2OA 1DWEH 5EQRA 3TH4H 1TA2A 3RXBA 5L2YH 5EODA 1BMLA 1NROH 1QFKH 3RMNH 1NFYA 5ESBA 5C1UA 1C9PA 1C1TA 3O8DA 1BTUA 4O03A 1LTOA 1JBUH 1A0LA 3A7ZA 2ZGXH 2TIOA 2F43B 2AMQA 1IAUA 1OWHA 2FWWA 2G4UA 4X0WU 3ATKA 4DY7B 5BPEA 2ZDKA 1NU9A 2TRMA 2M5TA 1GGDB 4E7RG 2ZDLA 4XDEA 4I32A 4H4FA 4HG6A 5C2ZA 1O3LA 1WYKA 1T32A 1K22H 1F7ZA 1FY1A 4LXBH 3UOPA 4NWLA 1C2HA 4DG4A 2A2QH 1FPCH 1EOJA 2HGTH 2JH0D 3FKSD 2HNTF 4WVPE 2IOTA 3EGKH 3ESTA 2OD3B 2XOKD 1TNGA 1IQJA 3FP6E 3O8BA 3U1JB 3Q77A 2JETC 4Y11E 4PROA 1QRZA 5F8TA 1PPZA 1GI1A 1AKSA 2ZPQA 4BNRA 3SNAA 2BD4A 1WTGH 3LC3A 1FMGA 1CGJE 1DSTA 2ANYA 4FU9A 1L1NA 1GJ9B 2DUCA 2HLCA 3PLBA 4OGYA 1LKAA 3T25A 4FUHA 3SV6A 4CH2B 2HALA 4ZKOU 4IN1A 5A0BA 5L2ZH 1QJ7B 1O2JA 2FX4A 2ZDVH 2CN0H 3RXPA 2BVRH 4AYYB 2VIOA 1P06A 2VINA 2WPMS 5I46H 2P3TB 1L2EA 1SG8B 5T6GA 4X1SU 1DFPA 1SQOA 1CQQA 2BQ7B 4U2WA 5DG6A 4ZHAA 1ANEA 1UVTH 3V3MA 4IC5A 4NA7A 3BIVH 3F0PA 1A5HA 3RU4E 1OWEA 1ZMJA 1O3FA 4TWWA 1RIWB 3A8DA 3A86A 4OS7A 3F9EA 3FOAA 2FX6A 2H2ZA 3BTHE 5JDUB 1GL1A 1MTSA 4FVDA 3RXUA 1SGYE 3QO6A 4XRNA 5A8YA 4ABEA 1NS3A 2P3UB 3WY8A 2KX4A 1DY8A 4UD9H 2QF5A 2GJGA 1E1RD 2ZFSA 2A32A 2ZFQH 1DANH 4ZMAH 4X8TH 1O3OA 3ATLA 3ODFA 1Y3WA 2F9NA 1O2LA 2BYAX 2Y5GA 2GKVE 3UNRA 2ZHFH 3PO1C 3BTKE 1P9SA 3M7QA 4XOJA 1O3MA 1TQ0B 3RXRA 3I29A 1RTLA 1D3TB 2BX4A 1QB6A 1RGQA 1SR5C 4GPGA 4K1SA 1C1VH 2ZGJA 1O31A 3OU0A 1D3QB 3ZVFA 4Y8XA 1C4V2 2ZTYA 3E6PH 4FUCA 2YMSD 2PWXA 3ATWA 4E7NA 1BZXE 3UFAA 3SNBA 4DOQA 1ZSLA 2RG3A 3RUOA 4I8KA 1BTPA 1TMTH 1QURH 2HVXA 2C8ZB 4A6LA 1TNIA 3BEFB 2PUQH 4OS4A 1ESBA 1MTNC 1TRMA 1O2RA 2VWLA 1V2NT 1UVUH 4O3UA 4WH6A 1JWTA 1T8MA 1UTMA 4YO9A 3RXLA 5L30H 3BIUH 4INHA 1P9UA 4AB9A 3M7TA 2FS8A 1YLCA 1EZQA 1IHTH 1E37B 4IC6A 3PV5A 1T31A 2ZPSA 1PQ8A 1HV7A 2VIDA 4CRGA 1UO6A 1H9LB 1JXPA 1HJAC 1C2KA 1S5SA 1C5TA 2A7CA 1P2MA 4CBOA 8ESTE 5FCKA 3OSYA 4BTTB 1BBRK 1C5SA 3LGUA 2ZU2A 3SNCA 7GCHF 1MZDA 2PP6A 3P92A 3R3GB 5J4QA 1AE8H 1MABB 4K8YA 2A1DB 1E36B 1K1IA 2ZQ2A 1T8OA 1ZRBA 1BIOA 1MH0A 1FNIA 4NFEA 2AMDA 1JIRA 1ELBA 1GMHG 3GY8A 8GCHF 3RC5A 3AVZA 1THSH 3RU4T 1GHBG 4MPWA 5T3HA 2GCHG 1AE5A 4QT8C 1YPGH 3EE0B 4MG3A 4OS6A 2ZEBA 2Y5FA 5FBEA 1HJ8A 4ISIH 1BMAA 4A5TS 4WJG2 4BAQB 5K0HA 3BTQE 5IK2D 1LPKB 3QN7A 1AVXA 1P12E 5A8XA 1VITG 3M37A 1C5PA 1P57B 5EQQA 1K0HA 3RMLH 3N7DA 1K1OA 1JMOH 5E0JA 4A7IB 2G52A 1LPZB 2KCYA 4CRBA 2BY6X 1W12U 2ZU4A 5AFYH 3SV7A 1IOEA 3TNTA 1UHBA 2Z9IA 2Z6BD 1Z8JB 4K1TA 1O5CB 3DFLA 2QAAA 1F0UA 1VR1H 4MPXA 3LC5A 4X6OA 1DWBH 3UR6A 1BTZA 1SLXB 2KCOA 3PLKA 3RXAA 1LQEA 2JETB 1WUNH 2P94A 5F03A 4GLYA 1A61H 5HXFA 1YPLH 1G9IE 3A8CA 4AGKA 4FUFA 1O3JA 1AFQB 3BEUA 1FN8A 1Z6JH 2ZECA 2BDYA 5ETXA 1CBWC 2A4GA 1MCVA 4AC9A 3DCLA 1GMCG 4AYVB 1RXPA 5DP7A 1LVBA 4Y79A 2ESTE 1ESAA 1EXFA 3T29A 5DO4H 1GMCF 3EQ0H 2K8IA 1F2SE 2W7UA 2CV3A 1ZPCA 1T7CA 5JBAS 4X1NU 2TBSA 1QA0A 6GCHG 4DIHH 3F6UH 2QY0B 5L6NH 3M5MA 2TGTA 1AZZA 2P3FH 3N7OA 1V2PT 3MH5A 2PW8H 3NKKA 3P95A 3MO3A 3K6ZA 3PWBA 4SGAE 1BRUP 1YY3A 3RLWH 2G55A 3K65B 3F2HA 1UTPA 2ZQ1A 1QQUA 1DLEA 3RXMA 4I8GA 1O3IA 3FP7E 2OXSA 2QE7D 6CHAB 5KEDA 4ACBA 3PV4A 1TPAE 2W7SA 1LVMA 1P8VC 2ZIQH 2Z94A 1ZPZA 3SZNA 2BDCA 2FLBH 1GHXH 1SLUB 5LH8A 1CT4E 1LKBA 4IS5A 2FI3E 1GCTB 1YCPK 3LONA 4K2YA 1FIWA 1TBZH 1SGPE 4J1YA 1OP0A 4YT7H 2FESH 1NFUA 2J92A 3ZVBA 1DT2A 1PPFE 1GI9B 1KXAA 3KQBA 1MKWK 3LH1A 3UTUH 3GDVA 2J95A 3SO3A 1KXEA 2F9UA 2ZHWH 3TITA 1D6WA 2XCFA 2ZCHP 4NA9H 5C1YA 3SI3H 1THRH 1O34A 3M36A 1HLTH 4YM9A 1AVGH 2VJ1A 1SGNE 2Z9GA 4MVNA 3ZZCA 4B76A 1NESE 1AD8H 1T8NA 1O2TA 3H09A 3PLPA 1C2EA 2SGPE 3PO1B 3MI4A 4KTUA 1P03A 2Z7FE 4CR9A 1AN1E 2STAE 2EQNA 4YOJA 1QCPA 3GCTF 1JOUB 3PMAB 1ANDA 1FV9A 3WW7A 3P8GA 1AZ8A 1HPGA 1XX9A 4RT1A 3HGNA 2PKAA 3UREA 5GWZA 1O37A 1KLTA 1TONA 3TJOA 1L4ZA 2XBXA 3CS0A 1SGTA 2BXTH 1O2QA 2EY4C 1DITH 4IMZA 3MU1A 2R9PA 4P02A 3VB6A 1BHXF 1XUJA 4BAMB 5AF9H 3S7KB 3GDSA 5A0CA 1EPTC 1C2DA 1CHGA 4JZFH 2A5AA 1RD3B 1WV7H 5C67A 2TGPZ 4F4OC 2QXHA 1E35B 2Y5HA 2EA3A 2ZTXA 3BTFE 1YLDA 4B6EA 2GCHF 1V2OT 4A1VA 2SNWA 1TNLA 2XC0A 1YCPH 4YLUA 2F9OA 3SU6A 1K2I1 1TWXB 2GX4A 1GMDG 1K21H 4JYTA 5I25A 3U8OH 1BMMH 1W10U 3ZZDA 5IDKA 1RIWC 1A5GH 1YF4A 2GCTC 1EP6A 2EI8A 4XBBA 1A7SA 2XTTB 1XVMA 2HWLB 3FN8A 1ZLRA 1HXEH 3CENA 2BVSH 1JRSA 1ELTA 2QN5T 3BV9B 4AFQA 1PQ5A 3C1KA 2VIWA 1V2LT 3Q3KA 2C90B 4NZLA 3RXJA 1ARCA 2FOAA 3KQDA 3T27A 1Y59T 1C2JA 1O3EA 1MKXK 1KLJH 5CHAB 2P8OC 1O3PB 1ARBA 3UIRA 2RFKC 1CBWB 1A0JA 4H6SB 1WCZA 4K1EA 1ELCA 1O39A 3W94A 2UUFB 1S6LA 3ZVAA 1CHOF 1SLVB 2XBYA 4K60A 2P93A 1EZSC 4Y0ZE 2A45B 3HKIB 1EATA 1LPGB 3A8BA 1VITF 2VGCC 1DUAA 3BTEE 4X6PA 3O8RA 3Q00A 2BD9A 1UCYH 1CGHA 2GT7A 3URCA 1FIZA 3RM2H 2Y6TA 4ABBA 1OWJA 3T62A 1D3PB 1VITH 2XWAA 1ETSH 1OWIA 1GCTC 2OC7A 2Z9JA 3SORA 3SZEA 4AZ2B 3JZ2B 1SI5H 4JCNA 4NIXA 1S82A 2V3OH 1XXDA 1GBMA 3DHKH 4JYVH 1Y3YA 4ZH8A 2IPQX 1K1JA 1W11U 4GUXA 1QL9A 3S9AA 2OC0A 4WMDA 1RTFB 2HPQH 4GCHF 1VGCB 1Z6EA 1GI8B 3PMHB 4MPUA 1GJCB 5EQSA 2D1JA 3ZVGA 3GDUA 1EJNA 1GBTA 5GDSH 1K1PA 1ANBA 5JBTA 1J15A 5FXLA 3VFEA 1HAXB 4NIYA 4AFUA 3ZZ8A 4A1XA 1TBRH 2KFWA 1CA8B 1Z1IA 2JKHA 3AAVA 1ABIH 3TGKE 3ATIA 1UTOA 3A83A 2XRCA 1SSXA 2C8WB 3DA9B 3TK6A 4AOQA 3H5CB 1CT2E 4UDWH 4IMQA 1O38A 1O3NA 2BOHB 3AASA 4D9RA 3RXSA 1C2MA 1CHOG 3A8AA 2UUYA 1SKYE 3KQEA 3U98H 2ODYB 3Q3YA 4TY7A 4NGAH 1BTWA 2DE9A 3D23A 1HJAB 2NU2E 1TRYA 1V2RT 4Y71A 2ZPRA 1MUEB 2PKSB 2WPLS 7KMEH 1C5YB 5CE1A 1SQRA 3SU2A 3ELAH 2BD8A 2ZGBH 4Q4LA 3F9FA 4Y76A 4ZCNA 1PPBH 4UFGH 2O9QA 1GBKA 3SJIA 1GPZA 1LDTT 3KF2A 1TB6H 4FVBA 2LELA 4A92A 1CVWH 1QRXA 1ZHRA 3GCTG 1CSOE 2THFB 1OXGA 4FXGH 1F5KU 1KXBA 1J8AA 3DD2H 1V2KT 4Q80A 1GJ6A 2FOEA 4NSVA 2J9NA 3URDA 1KSNA 1DVAH
chains in the Genus database with same CATH topology
1AI8H 1P04A 1TAWA 3HK6B 1C4U2 2QC2A 5FCRA 4MTBA 1SGRE 3RXOA 2WV5A 2EEKA 1O5EH 1P3EA 1JIMA 3BTTE 1O3KA 4ZAEA 3RXIA 1C1WH 3BTME 4ZKRU 1P09A 4LZ1H 3M5NA 3MU0A 3UY9A 1ESTA 1KTSB 1AUJA 5C1XA 1RJXB 1TOCB 2FIRH 3KIDU 2CGAA 5TCCA 5AFZH 3TGIE 3E16B 3GY5A 2Z3DA 1FY5A 1BHXB 1HAOH 1ZGVA 3HKJB 1XM1A 1YPKH 1DPOA 3MH6A 1VCPA 1SPJA 4X2VA 4CRFA 3MH4A 1TOMH 1GMDF 1ELEE 3BF6H 3MHWU 5DK1A 3A87A 1FXYA 1BJUA 3BG4C 2CF9H 1MAYA 2WPKS 2RDLA 1OPHB 2VVUA 5FPTA 4ISLA 1Y5UT 1W7GH 5E0GA 1TNJA 1SGQE 1BTHH 1OP2A 3SU3A 1Z7KA 2BM2A 4X1RU 4FUJA 2AGGX 3MNCA 2DE8A 1V2VT 2G4TA 4MNYA 1YC0A 4FUEA 1BA8B 1TFXA 3LKWA 1QBNA 1HUTH 1RRKA 3KHVA 3ZZ3A 2FOBA 3SN8A 5JPMH 5JBBS 3E8LA 4OGXA 3Q76A 1GI6A 2ZTZA 4J2YB 3VB7A 1UJ1A 3Q3XA 1AUTC 3ODDA 4MQAA 1GHBF 1MBQA 2ZWLH 3M3SA 1CA0B 1TYNA 1XKAC 1RFNA 1A1RA 4E06H 1KXFA 1XMNB 3NUMA 2V3HH 4LK4A 4AG1A 4FU7A 3B8JA 4I8LA 1MQ5A 2B7DH 2BY8X 1LQDB 1B0EA 2WYJA 4NG9H 5DPAA 5FX6A 2ZKSA 3RXGA 1C5UA 2Y82A 5FPYA 1A3EH 1AWHB 1ZJDA 1WTHD 3HPTB 5HMAA 1KYNA 2O8MA 3EDXB 1G32B 2SGQE 4HI3A 3U1IB 5B6OA 5C5OA 2SGFE 3U9AH 1G37A 1O2NA 1S6FA 1IQFA 1M9UA 2A31A 1EPTA 2QF3A 4INKA 2SGAA 3O8CA 3F9GA 3IG6B 4WF8A 1O3CA 2FOFA 1HAZB 2ZNKH 1ZR0A 5DJ7A 2QA9E 1UHBB 4AGJA 4K3JA 4BTIB 3M5OA 1ZTJA 5BRRE 1KXDA 1ZTKA 1PPHE 1QJ6B 4JZEH 1C1MA 2SGDE 1XUHA 1EB2A 1TIOA 1GBFA 2GT8A 3A7VA 1P2IA 4AFSA 1THPB 2F9BH 1TA6A 1A5IA 2J2UA 4WXIA 1S83A 5PTPA 1SOZA 1MD7A 4AG2A 3MH7A 4TY6A 1O3DA 1CGIE 1O2IA 4Z0KA 4FU8A 4D7GA 1G3CA 2PUXB 1DSUA 1TGCA 3G01A 3NZIA 4I33A 3KNXA 1ZTLA 1W0YH 3E1XB 6ESTA 2HNTC 2CHAC 4VGCC 5F8XA 5LPFA 3T5FH 4CHAB 5DP4A 2Q1JA 1MU6B 2C93B 1G3EA 1IHSH 3FP8E 3EAJA 5IYTA 1QBVH 3NK8A 1XVOA 1GBIA 2OUAA 3VB4A 1GHZA 1BT7A 4D8NA 4F49A 4MDSA 1BMNH 1DUEA 3DT0H 3OX7U 4B2BA 4B74A 2Z9LA 1NTPA 2WYGA 4CBNA 4DW2U 4WWYA 1LVYA 2AIQA 3SW2B 3MWIU 1AY6H 4Q2KA 2VIQA 1J9CH 3RMMH 1HDTH 2R0LA 2AYWA 3MFJA 2ALPA 2G81E 2VH6A 3QX5H 1YGCH 1LVOA 1RS0A 3EA8A 2ZZUH 1FDPA 2ALVA 1C1SA 4B71A 2H1UA 2O8UA 2A7HA 3KGPA 1V3XA 2PGQB 1Y3UA 2B8OH 3M61U 2CXVA 4D9QA 4ZKSU 1ELFA 1BBRH 1P01A 2ZP0H 5FHTA 2ZFRH 1F0SA 3PYHA 2BD2A 3UWIA 5LPEA 2EI7A 4NFFA 3RC4A 3GOVB 3E0NB 2B5TB 1GBLA 2AH4X 1L0ZA 1NC6A 1V6DA 4DCDA 2ANMH 1MMJN 1NPMA 2QF0A 1GI7B 9ESTA 2B9LA 2FODA 2AMPA 2VIPA 2XCNA 4AB8A 1V2MT 2AGEX 1NRQH 1C5NH 2OQ5A 2IJOB 3VB3A 1MBMA 1O2UA 2GMTB 1YBWA 1QTFA 4X1PU 3BG4B 2BY5X 2QIQA 3KEEA 1Y5BT 5EG4A 3V12A 2Z3CA 1D3DB 2P95A 3TJVA 1A0HB 3TLOA 4E05H 8KME2 1P05A 3RM0H 4THNH 1L4DA 4GSOA 1MQ6A 3TJUA 3ZZAA 1GL0E 4AX9H 2BTCE 2FO9A 2AERH 3A81A 3K6YA 1S84A 2PSXA 2GTBA 3SUGA 4I7YH 1T8LA 1PYTD 2OQUA 1PPCE 1N6XA 3H7TA 2PR3A 2ZG0H 2RCEA 1KTTB 1HXFH 1WQVH 4H6TA 4YOGA 1GHVH 4O97A 4Y8YA 3GY2A 1LO6A 2O8LA 1SQAA 4GCHG 2XW9A 3A7XA 2TPIZ 3RC6A 2OINA 2TGDA 3BSQA 2C4FH 1LHDH 1FPHH 4IW4E 3TJNA 4YTAA 2KAIB 1SMFE 2NU3E 1PPEE 4Q7ZA 1QB1A 1EASA 4NCYA 3D65E 1KDQA 4FUGA 5LGOA 2C8XB 4ABHA 3S7HB 1ZZZA 5DP9A 3STJA 5JYIA 4IBLH 2ZHDA 1EZXC 1GGDC 1OOKB 4K69A 4Y8ZA 3M7UA 2P16A 3SHAH 3VEQB 1XKBC 2BD3A 5T6FA 2BHGA 2GZ7A 2H9TH 1ZOMA 3W95A 3LOXA 4BAOB 1IQKA 2SGEE 3MNSA 1SGCA 1K28D 2GV6A 4Z6AH 1CE5A 2FI4E 5JB8S 2WPJS 2BDHA 3SGBE 1W2KH 3K2UA 1ACBE 1C1PA 1HNEE 1NN6A 4OS1A 2QV1A 3SUFA 4O9VA 1IQIA 2FEQH 1EX3A 1BBRE 1O2SA 1C1QA 2V35A 1ZMLA 1DX5M 2G00A 3GYLB 5A0AE 1OKXA 1W13U 3AW1A 5FAHA 2XWBI 1GJ5H 1N8OC 4X8UH 1C4Y2 4ABJA 4ZHLU 5TJXA 1TX8A 1QY6A 4Y7BA 1TE0A 2WPIS 4Y10E 2BXUH 2AFQB 3LT3A 3SV8A 1DM4B 2WPHS 2J38A 2OP9A 1ZSKA 1H8IH 3GYMA 1C2GA 1SFQB 2BD7A 1SGDE 1DWDH 1IQMA 4I8HA 1AKSB 2PTNA 2FLRH 2G8TA 3UUZA 1SOTA 4Q7YA 2ZFPH 2ZDAH 4R0IA 3CS7A 3KL6A 1Z71A 2F9VA 1C5QA 1SBWA 4H42U 1BOQA 1BRCE 3UR9A 1IQNA 2VU8E 2W5EA 3PWCA 1YPJH 1YM0A 2ODQA 1H9IE 5F6MA 1BB0B 3LGWA 2FP7B 4MNWA 4ABAA 3TPIZ 3K9XB 2BB4A 4B1TA 1P11E 1LMWB 1O2WA 4YESB 1EP5A 1GBDA 3BTWE 2JH5D 3T28A 4CHAC 1YCPM 2WUCA 1HAHH 1SHYA 2EC9H 1ABJH 1FAXA 1QA7A 5C5NA 3TGJE 2R2MB 4GHTA 3F1SB 1TPPA 3E91A 4SGBE 4ZKNU 4WY3A 3RP2A 4WXVA 2FDAA 3SUDA 3TIUA 1ZHPA 3VPKA 4X1QU 2CMYA 2G51A 1O3HA 1WBGB 2FXRA 2GV7A 4I8JA 4ISOA 1P2KA 5F8ZA 2C3SA 4A1TA 3TK5A 2FOCA 2VH0A 1DS2E 5EOKA 1MZAA 1FJSA 1O3AA 4B2CA 2J94A 1UK2A 4B2AA 3SOSA 3GY6A 1F5LA 1O36A 1SGIB 1UMAH 3PM3A 4ZROA 3OTJE 8GCHG 2Q6DA 2GDDA 3GY7A 3A89A 1QBOA 1P2NA 4LZ4B 3MU5A 3MTYA 3PTBA 1NY22 2XC4A 1GI5A 3GCOA 2R2WU 2F91A 5DP5A 1J17T 4UFDH 1IQEA 3UNQA 4BTUB 1J14A 1VCWA 2G5VA 2H6MA 3SJ9A 4JK6A 3CP7A 1A2CH 4DT7B 1XUFA 2ULLA 1GJBB 2OC1A 6LPRA 2TGAA 3PB1E 1OYTH 3D49H 1HFDA 1BRAA 2FOHA 4MNXA 2STBE 2A7JA 1O30A 1TABE 3EYDA 1L1JA 1TMUH 3MYWA 1VJAU 3M35A 1IQHA 2P8OB 3BN9A 1TX7A 2OCVB 4JZ1A 3SU1A 2ASUB 7ESTE 1OWDA 1TPSA 1MTVA 3S9CA 1P2OA 2F9PA 1GBJA 1O2HA 4ZUHA 3LJOA 3QTOH 3LH3A 1Q3XA 1W14U 1V2TT 2LPRA 2EI6A 2RA0A 2ZA5A 3ZYDA 1ZSJA 1P2JA 3GISB 1O5DH 2QXIA 1C5MD 2BDAA 1NFWA 2W3KA 1F0TA 4XBDA 2RA3A 3RMOH 3EA9A 1HAGE 1C5XB 2OLGA 1TQ7B 2XBWA 3I78A 3V13A 1GWAA 5EXNA 2VWOA 1G3DA 3ZYEA 5A2MH 1TGSZ 2D8WA 1SLWB 1OYQA 1AQ7A 3FFGA 3ZZ9A 3TU7H 3AW0A 2A4QA 2A5KA 1GG6B 2CJIA 2Y7ZA 3P8OA 1DWCH 5G4BA 1QL8A 1CT0E 2I6SA 4Y6DA 3FZZA 5HM9A 5E8EH 1Y5AT 5FBIA 6CHAC 3SI4H 3C27B 4HGCA 3UOUA 3ZZ7A 2UUJB 1GHYH 2PFEA 3NPSA 2PKAB 1AO5A 1NT1A 4YOIA 3V0XA 1ANCA 1OWKA 4XBCA 3QDZB 1AFQC 3GY4A 1O2YA 4ASHA 4DIIH 3A88A 1PFXC 4RN6A 1U6QA 1C5RA 3UQVA 2OTVA 2QXJA 4ABGA 5HYOA 1G30B 3LGIA 2LNCA 1AB9B 1RTKA 1XUKA 4ABIA 2QXGA 3MOCA 2QYIA 4GHQA 3S9BA 4JYUH 2H5CA 1O5GH 5GIBA 1CU1A 1YPHC 5C20A 4U01A 1WU1A 1FY8E 1GVKB 2PLXA 1IQGA 1DICA 1NRNH 4ISNA 3VXFH 2SNVA 4KP0A 4CR5A 5DKMA 1GVZA 1Z8RA 3GCHB 4NA8A 3VB5A 2I6QA 1K1LA 1H1BA 3ZV8A 3P70B 3NWUA 2Z9KA 4JZIA 4OS5A 2XNIA 2Y81A 3JZ1B 3TK9A 1MCTA 3IWMA 1SHHB 3S0NA 2OC8A 3MU4A 3VGCC 1YP9A 1QNJA 1MU8B 4KELA 1AB9C 1W8BH 3FAOA 3QUMP 2GP9B 2GMTC 1GMHF 2BY7X 2YNAA 4XSKU 4CREA 1B7XB 4ABDA 2H5DA 3RXFA 3L3TA 4M7GA 2ZI2H 1BTXA 1SB1H 3UQOA 3QGNB 1NFXA 4Q7XA 5EW2H 1H9HE 3RXEA 5C3NA 2NU4E 1BQYA 3HATH 1EAUA 4D7FA 1QHRB 3M3VA 4WMFA 2NU1E 2Y7XA 1GHAF 2O8TA 1X7AC 1UTNA 1KY9A 1EJAA 4X6NA 1XUGA 3BG8A 4KGAA 4FUBA 1EAXA 2UWPA 1VZQH 2ANKH 3RXDA 4INLA 1FUJA 1QJ1B 1UTQA 3UPEA 1MD8A 3TH2H 4I31A 1LHGH 1OS8A 1DOJA 1PYTC 3SV2H 4DGJA 1A4WH 2W3IA 1HIAB 3P17H 2CF8H 4JK5A 1BRBE 3QZRA 1NM6A 1K1MA 3SU4A 4ABFA 5GXPA 1EZUC 3SBKA 4NWKA 2YOLA 1GDQA 1D9IA 1P10A 2HNTE 3OY5U 1ELVA 1EJMA 3ZV9A 1FN6A 4TWYA 1GJDB 2VWNA 3MNBA 5JB9S 1O5BB 1FZZA 2R0KA 1O5AB 5A8ZA 3B23B 2QGRA 2UWLA 3BTGE 3PMJA 2FM2A 1GBEA 1AHTH 2VWMA 1WQSA 2ILNA 2UWOA 1O5FH 1C5VA 2B0FA 5FX5A 1KDQB 2HRVA 2VIVA 2F3CE 1HRTH 2IPHA 1C1RA 1QB9A 1GI3A 2R3UA 3UWJH 4MPVA 1MKWH 3MU8A 1TLDA 1SGFA 1C2IA 3SU5A 2ZDNA 2WUBA 1FAKH 2NWNA 3ENSB 5SGAE 3FZDA 3TH3H 1FLEE 1EUFA 1P0SH 1C1OA 1HGTH 1UTKA 1GHWH 5DP6A 2ZCLP 1B0FA 1TGTA 2BDIA 1C1UH 5FPSA 1A3BH 4U30A 4BXWA 2FI5E 3H7OA 2ZFFH 2PSYA 1EQ9A 2CHAB 4VGCB 1UVSH 4TPYA 4XFQA 3GCNA 1MAXA 4JMYA 4U32A 4O3TA 2YNBA 4X8SH 3ZVCA 2ZHEH 1NZQH 4Y7AA 3SQHE 4ZXXH 1CO7E 2VB0A 1O2OA 1F5RA 2XYAA 2QCYA 2GGVB 4BANB 2GZ8A 3R0FA 1DE7H 2BQ6B 1O2XA 3LIWA 3LPRA 2WV4A 1G3BA 3OY6U 1HAVA 1E0FD 4NSYA 4DJZB 7LPRA 1ZRKA 3RDZA 2ODPA 1E34B 1YPEH 1AVWA 4KTSA 4KTCA 1YPMH 1P3CA 2ZF0H 1W0ZU 1BITA 3STIA 1DDJA 3LGVA 4DVAU 3SNEA 5JBCS 1UK4A 4FUDA 5ESTE 1AMHA 1O2GH 2H9HA 3ZZ5A 3P8FA 3QK1A 3GY3A 1OP8A 1NRSH 5EU8A 3U8TH 2A5IA 4B73A 3PROA 3FANA 3TVJB 1ETRH 5GPIB 3U8RH 2GVFA 4BOHA 1ID5H 4R8TB 4ESTE 1MKXH 1S0QA 1TBQH 3A85A 5EPYA 2O8WA 1O3BA 1UTJA 1D6RA 4X8VH 3GICB 2ZGCA 2F83A 2ZHQH 1GI0A 1T4VH 2AIPA 3ZVEA 1YKTA 1ZMNA 4DURA 1OSSA 5CMXH 1EAIA 3LGYA 1WOFA 2IN2A 3RLYH 1O2MA 1TPOA 1QIXB 1NRRH 2PKSC 4JZDH 1L1GA 3BTDE 3E0PB 1TNHA 4AORA 1EAWA 1P2QA 3T26A 1B5GH 1O2ZA 1UCYK 1TRNA 1EKBB 2D26C 1TGNA 2ZCKP 1UK3A 2AGIX 2J34A 1GJAB 3EA7A 1ETTH 2PHBA 5HM2A 1N6YA 1ORFA 3SGAE 3SJIA 1GJ8B 1GVLA 7GCHG 4UFFH 4UFEH 4OS2A 1BCUH 1S81A 5EXLA 3SHCH 3B9FH 1YPHE 2C8YB 2GZ9A 3DFJA 1DY9A 3LDXH 3FVFB 1GI2A 1Z1JA 3E3TA 2SFAA 1FI8A 2OBQA 2FS9A 4TYDA 4ZHMU 1S0RA 3HGPA 4RKOB 2NU0E 2ZC9H 1QR3E 4NZQA 3RXQA 1PQAA 3RXTA 2BLWA 2D2DA 1ZYOA 5HGGA 1C5LH 1INCA