1GBIA

Alpha-lytic protease with met 190 replaced by ala and gly 216 replaced by leu complex with methoxysuccinyl-ala-ala-pro-phenylalanine boronic acid
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGLNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbiA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbiA01
2ZU5A 1V2WT 1Z1IA 3D23A 1UJ1A 3MNCA 2OC8A 3LGTA 3RLYH 3A8CA 4ZUHA 3B8JA 1YYY1 5TJXA 1XMNB 3BV9B 4FUIA 4NZLA 1YPGH 5T6GA 5FAHA 1PYTD 4NA7A 3FFGA 4CHAB 3MU0A 3ZZ8A 4CR9A 3TITA 2ZFRH 2Y5FA 1NT1A 2G4TA 5GPIB 4ZHLU 2FO9A 1EB2A 2QY0B 3M35A 4CBNA 3TH2H 5AF9H 3U98H 1G3DA 1O3EA 4D7FA 5J4QA 2FOMB 1HLTH 2IOTA 2GP9B 4UONA 1RFNA 1T8OA 1S81A 1VITG 1SMFE 1W0YH 4NWKA 3GDVA 1C1UH 4Y8ZA 4DT7B 8GCHG 2C8XB 1AE8H 3FAOA 1TA6A 1BTPA 2FODA 1YPMH 1O32A 1GBTA 1GHVH 1TNIA 8LPRA 2PUQH 1S5SA 2I6QA 3GCHB 5CE1A 1P04A 4NA9H 5DP8A 4GPGA 1QL8A 3RU4D 4KTCA 5FBIA 3LGUA 4ABHA 1HYLA 4DIHH 2PGBB 4M7GA 2Y6TA 1Z8IB 1P02A 2SFAA 1DANH 1H9HE 2A5KA 1W7GH 2HLCA 3SUDA 1GBBA 2CV3A 2NU3E 2P8OC 3A7VA 3I78A 5DK1A 1A0JA 1GVKB 3C27B 2ODYB 1F5KU 1GJ7B 4O9VA 1GI4A 2BOKA 1W11U 1CVWH 4B2AA 8KME2 2B0FA 1ETTH 3ATLA 5J4SA 3LPRA 1C1WH 2OINA 1LHEH 2OQ5A 4FVBA 2O8WA 1AZ8A 2PV9B 1E38B 2ZGJA 1ETSH 1XXDA 2VVVA 4NIXA 2A7CA 1GMCF 2G8TA 1ZPZA 1P2QA 3KEEA 3HK6B 1Y5AT 4K8BA 1S84A 4GVUA 1S6FA 5BPEA 1NN6A 2AEIH 1WBGB 1O2MA 3M3SA 1J14A 3CP7A 5EXLA 2JH0D 4I8GA 3D49H 1OPHB 1QBVH 1O3BA 2O8LA 4BAKB 2B8OH 2FP7B 2UWPA 1A5IA 2GGVB 2ZQ1A 3UR6A 4FU7A 4JZDH 3ZYEA 1C2HA 2ZO3H 5GWZA 3RXUA 4GCHG 3M5OA 1C2MA 3LGVA 3SHAH 2Z9JA 1O2KA 1O3CA 2C8ZB 4E06H 3R0FA 3U69H 1C2KA 5EXNA 3RMOH 3NCLA 1XUHA 1EKBB 1C5LH 1O34A 3G01A 1ABIH 2BDCA 1QIXB 1YPLH 1EQ9A 4CBOA 1B0EA 5A0AE 1ZGIA 3E1XB 3P6ZB 1DWEH 3LJJA 1LQEA 4B2CA 3D65E 4XE4A 1T8MA 1MU8B 1TQ7B 1TONA 1B0FA 2Z9KA 3RXLA 3LKWA 4YLUA 2PFEA 1O2WA 4I31A 3JZ1B 2R3UA 1YCPM 1GDNA 1AI8H 1S85A 1ZHRA 2O8TA 2QCYA 3ZZ6A 4CH8B 1YPKH 1GBJA 2TIOA 4UFDH 2G55A 2BTCE 4Z6AH 1RTFB 3BTGE 1VITH 4YTAA 1C2LA 5DP5A 3UOPA 1O3FA 1SPJA 5DP6A 3IITA 4NSVA 1QNJA 2ZU1A 2NU1E 1XUGA 4MPUA 1K1JA 3MYWA 3TGIE 3SUEA 1HJ8A 3NWUA 4JZEH 1EPTA 3OX7U 3S7HB 3PB1E 2Q6GA 1V3XA 1HAVA 1O5GH 1QURH 1T8LA 2OBOA 2ZF0H 1TABE 3DA9B 2THFB 3RXQA 1O5CB 4E7NA 5AFYH 2AGEX 1DE7H 2VIOA 4X8VH 5DP4A 3K2UA 4F4OC 2Q6FA 2A5IA 3QDZB 1CHOF 2V3HH 1TPPA 1ZGVA 1HUTH 3ZVDA 1SGYE 1P01A 3B9FH 1TIOA 1UHBB 2ZDVH 2GV7A 2H2ZA 4Y76A 2BD9A 1HAIH 1CE5A 1UTLM 2B9LA 2A4QA 2B7DH 1BCUH 2ZNKH 1G30B 1P2MA 5L30H 2GX4A 5PTPA 5DG6A 5BRRE 4XDEA 4YT7H 1PPGE 1GMHF 1FXYA 4X2XA 1SHYA 1ZZZA 4WMFA 3SI3H 3M61U 4IBLH 1BTXA 1GHBF 3SJ9A 2ZFTA 3E0PB 1BRUP 2BD8A 1EJAA 1P57B 2HNTE 2YOLA 3A80A 4LK4A 3S9BA 4ABFA 2ILNA 1V2QT 1SFQB 4UEHH 3TJNA 1TPAE 1FJSA 2BVRH 2J2UA 3T25A 1J16A 1OP2A 4BXSA 1QY6A 4WJG2 3TJVA 1T32A 4MPWA 1EB1H 4FUBA 3RC5A 1D3PB 2ZTZA 1GJ8B 4NIVA 2BQWB 1BRBE 1XKBC 3M3TA 3ZZ3A 1Z7KA 4INHA 4BXWA 1SLUB 1HAPH 1EAWA 4TY6A 1H9LB 2SNWA 1ACBE 5JYIA 4X6NA 2TGAA 1DLEA 1W10U 2C4FH 1GBDA 9LPRA 2WUBA 2FI4E 6ESTA 1O2QA 1WV7H 2FYRA 2H9HA 1MU6B 3E16B 1RXPA 4Y6DA 2GCHF 1TRNA 2ZGHA 1WOFA 3QZRA 4RKJB 1O2RA 2QV1A 3KL6A 4NFEA 1NROH 1D3QB 4ABDA 1GJ6A 3M5LA 2BD4A 4ZKSU 3S9AA 2XC5A 1BHXF 4ISLA 4BTTB 3Q76A 2P3FH 1ZOMA 4I33A 4HTCH 2BLOA 5GJ4B 1KXBA 1WSSH 4NCYA 3BEUA 1ZJKA 1NRSH 3QTVH 4IC6A 5G4BA 1AD8H 4AFQA 1FIZA 6LPRA 1T31A 1C2JA 1O3DA 1LVOA 2RDLA 3EA8A 4NSYA 1ZYOA 1ZSKA 2AIPA 3RP2A 3K6YA 1O3OA 4ABEA 4HFPB 3PMAB 1GBCA 2HPQH 2TGPZ 2OD3B 1PPFE 1GL0E 5C1XA 2F9UA 1GDUA 3PM3A 5SGAE 3BN9A 1GBKA 1TE0A 1C9PA 1O2ZA 4CREA 4K8YA 1PJPA 1CA0B 3A83A 4A7IB 1SGIB 5EGMA 3MH5A 1CT2E 2PLXA 3DT0H 4Y0ZE 1ANEA 3ZVCA 1AFQC 1ZRBA 2YNAA 3SO3A 1GDQA 1P2OA 1Y59T 3QO6A 1BB0B 1D3TB 4X2VA 3RU4E 3SNCA 2JETC 3SZNA 4Y7BA 1GI3A 1TGTA 5C1YA 3PV4A 2UWOA 1BBRE 5E2OA 4CRDA 3BTME 1SGEE 1JWTA 2ZKSA 1SOTA 1QCPA 1FNIA 4Y8YA 1BBRK 3L3TA 4FUFA 1ELFA 4H4FA 4CH2B 1ARCA 3MH6A 3RXPA 3O8CA 3TJUA 1WQSA 2CN0H 2WINI 2Z3CA 1W14U 1SSXA 1GHYH 2ZCLP 3P8FA 1C1OA 1TX6A 1W2KH 1FPCH 2O9QA 4IGDA 4NIWA 1BMNH 2TRMA 1EZXC 4ISOA 4IW4E 1P3CA 4X6MA 1BIOA 3W94A 2OP9A 2GDEH 1XX9A 1XM1A 4KP0A 2ANKH 2DUCA 1HAHH 2W3KA 1EP6A 3S0NA 3A84A 1C2IA 4IMQA 3SNBA 5FCRA 2J92A 3SHCH 2A4GA 1RTKA 3E8LA 1Y3UA 1U6QA 4LXBH 1C2GA 5E2PA 4IMZA 4NFFA 4YOGA 1EAUA 3BIVH 4BAHB 1ESAA 2BD2A 3UR9A 4A1XA 1NRRH 3ZZ5A 2VIPA 1ELCA 1QB6A 1UTPA 3PWCA 3RMLH 4AFUA 1MCVA 4J2YB 2XCFA 1GMHG 1O39A 1W0ZU 1QQ4A 5CHAB 4ZAEA 1XKAC 1ID5H 4Q2KA 4YOJA 3STIA 4DVAU 3NXPA 4Y79A 1E35B 1MD8A 4HI3A 4I7YH 1IQEA 4Z0KA 4FU9A 2BDHA 2EI8A 1H8DH 1HXFH 2UWLA 2C90B 1QB9A 2HWLB 2C93B 3F6UH 5A2MH 1EUFA 1C4Y2 1TX7A 2ODPA 4DIIH 1XUKA 5DP7A 3WY8A 3SU3A 1C4U2 3SJIA 1L4DA 1B7XB 1TGBA 1IQIA 2ZPQA 1C1MA 1VGCC 2FTLE 1CT0E 1T4UH 1S6HA 1MZDA 1SQOA 4X1RU 9ESTA 4Y10E 5AFZH 4DW2U 1GG6B 3UWIA 2GV6A 3A85A 1P05A 1BITA 2ZHEH 1LKAA 3KCGH 3UQVA 1XVMA 4A5TS 2Z6BD 2QIQA 1GI7B 1YM0A 2OLGA 3P17H 4OS7A 1V2PT 1CGJE 1DUAA 5LPFA 4E7RG 1HXEH 4DURA 2OXSA 2OC1A 1IHTH 1MQ6A 1SG8B 2FDAA 2VWOA 1SGTA 3LDXH 1A0LA 7GCHF 1JRSA 2GCHG 4ABJA 2YNBA 1JIMA 1DWDH 4KTUA 2PKAA 1ANDA 1W12U 2A0QB 2XBXA 3A7ZA 1SVPA 3MMGA 2BDYA 5ESTE 1DT2A 1TRYA 2XRCA 3GICB 3U9AH 1EZQA 1FAXA 2C8YB 4MNWA 1HAYB 3PO1B 1FZZA 1TNKA 1P10A 5JB9S 1QTFA 3TU7H 2PW8H 4F49A 1LHDH 1HAXB 5HXFA 3BTQE 3QLPH 3SU4A 3SN8A 1O30A 3VXFH 2BVSH 1GGDB 1XXFA 3VGCC 1V2LT 3UWJH 3U8RH 4BAOB 1FLEE 4U01A 2PTNA 2AH4X 1DWBH 2PKSC 1AQ7A 3RMNH 3LGYA 1C5QA 1O2JA 1UTNA 1SR5C 2SGQE 3BSQA 1G3BA 1O38A 3QTOH 1ANBA 1Y5UT 4WMDA 1FPHH 1OWIA 2QGRA 2A4OA 1QA0A 1QBNA 2XBWA 1ZRKA 5K0HA 1KLJH 4GUXA 2R9PA 1RD3B 3ZZAA 3QK1A 5C2ZA 1FY4A 1V2VT 2H1UA 4KTSA 2STAE 3EAJA 3MNSA 3E90B 1CO7E 1O2SA 1C1RA 1A3BH 2WPJS 2EC9H 3ZYDA 1V2UT 1F0SA 1H8IH 4PROA 3PLPA 3F9GA 1HIAB 1Y3VA 3K9XB 1C1SA 3K6ZA 2OCVB 4ISNA 1FUJA 4D76A 1HFDA 2P59A 2H5DA 1QJ7B 1NRPH 2D1JA 1K1LA 3BTEE 1A5HA 1ANCA 1EPTC 3A86A 5FX6A 3RXDA 1GI1A 1SGQE 1ELAA 4I32A 4JK5A 1DICA 3A8DA 3A88A 2OUAA 1KYNA 1THSH 4ISHH 3ZVFA 3P92A 5E8EH 2ZHFH 1V2TT 1JOUB 5DJ7A 1BQYA 3NPSA 2Y5HA 2ZFPH 3EA9A 1ZHPA 3FANA 3RDZA 1QGFA 1MCTA 2BQ7B 1VZQH 1FY5A 1P2KA 2SGPE 2BOHB 1LVMA 1P06A 4XBCA 3KNXA 2SGDE 1Z8RA 3A8AA 1TNGA 1P03A 3O8BA 2DE8A 2HNTC 3QN7A 4WH8A 1A3EH 1HPGA 1DWCH 2CHAC 1FN8A 1AKSB 2BB4A 1YC0A 3SW2B 3RXMA 1L0ZA 3RXFA 1SQTA 1ZPBA 1F0RA 1LKBA 2ESTE 1QRZA 1NFWA 1NM6A 2FOFA 2Z7FE 2ZDMA 3S7KB 1HAVB 1P2IA 2FOBA 3BTKE 1F0UA 1LPGB 1O5DH 1UTKA 2AGIX 2P3TB 3OU0A 1A7SA 2UUYA 4ZHAA 2P8OB 1SGDE 3P95A 1YPHE 1OWJA 2FMJA 3ZV9A 3AW1A 2AMDA 1SGCA 1ZR0A 3BF6H 5C5NA 4FXGH 1YCPK 4CR5A 1Y3WA 2PTCE 4A92A 3V3MA 1NRNH 4AN7A 5DPAA 1L2EA 2QYIA 3MNXA 3UTUH 4MPVA 2VIQA 3ZZCA 1MMJN 1G3CA 3RXIA 1GCTC 1O33A 1WUNH 1DM4B 4X8SH 4YZUA 3PLBA 3TK6A 1AHTH 1K22H 3ZVEA 3KGPA 4K5ZA 3MFJA 4AYVB 3AAVA 4Y0YE 3SUGA 3ZVGA 4OGYA 3SNDA 2F9OA 2ZGCA 4Y71A 1E0FD 1JRTA 1TPOA 1TLDA 1OOKB 3MU5A 2VGCC 1AMHA 1VCPA 1WTHD 1TMTH 1OKXA 2FESH 1AVGH 3M5NA 1PYTC 1SI5H 1N8OC 2HPPH 2VIDA 4K3JA 4OS5A 3BEFB 2STBE 5HM2A 4IN1A 2BLQA 2VH6A 1O3PB 4BNRA 1F5RA 1FQ3A 2PHBA 2R0KA 2VWMA 3MI4A 4WY3A 1P0SH 2BMGB 3UNSA 6GCHF 1GL1A 1A5GH 1YLDA 3DHKH 1LHFH 3KQEA 4XBBA 1V2RT 2H5CA 5HGGA 2FLBH 1C5TA 2BY6X 1IQHA 4ABGA 1INCA 1YPJH 1MBQA 2BX3A 1MTNC 1C5RA 4OS4A 3ELAH 4O3UA 2GCTC 2Q6DA 1L1GA 1C5NH 1D6WA 4DOQA 2PR3A 4JYTA 3BTFE 5LPEA 1KLIH 2WPMS 1TQ0B 3MO6A 3HATH 1ELBA 1DS2E 2Y7ZA 1C5VA 1W8BH 3Q77A 1AVWA 4DJZB 5C5OA 2A31A 2WV4A 1UCYE 5FPYA 2W7UA 3ODDA 4D8NA 3ITIA 2QXJA 1ELGA 4HZHA 1TMUH 1AZZA 2BDGA 1UCYK 1EATA 2GVFA 4ZROA 4INLA 1C1PA 1NU7B 1F7ZA 5FPSA 2ZHQH 1D3DB 3QWCH 1J8AA 1PFXC 1GHAF 1MZAA 2WYJA 2BXTH 1LCYA 1P11E 3TGJE 1C4V2 1MTSA 5CMXH 1TWXB 1QBOA 1GBLA 2JH6D 4MLFB 2FX6A 1QL9A 5GDSH 1Y3YA 5C20A 3M3VA 3RXTA 1GHZA 3HGPA 1O2HA 1SLXB 1OXGA 2UUFB 2FX4A 4KELA 1BTYA 2BZ6H 7KMEH 1O3NA 3RXRA 1PPHE 1QHRB 3OY5U 2FOCA 3TPIZ 5A09A 1GJ4H 1EASA 3Q3XA 4OS6A 5FHTA 1YF4A 3HKIB 3SJKA 1WU1A 1KSNA 2AFQB 3MTYA 1Z8GA 3EE0B 1O2PA 5EW2H 3SNEA 3AW0A 2H9EH 2ZTYA 3TK9A 3LIWA 3KHVA 3SU5A 4AB8A 2KAIB 3BG4C 4X1NU 1Z8JB 4X1SU 2H6MA 1O2OA 1K2I1 2C3SA 2F83A 1HJAC 2Y81A 1EJNA 5ETXA 3L33A 2CXVA 1VCQA 1GMCG 2XYAA 3DUXH 4QT8C 4CRCA 2XW9A 2ZCHP 3MU1A 1YLCA 2Q1JA 2A2QH 1Y5BT 5ABWA 1O3GA 1ABJH 1GI6A 4WH6A 1TGCA 3H5CB 1T4VH 1IQMA 2VJ1A 1E37B 1IQKA 3M7UA 1TALA 4DY7B 2A4RA 4AGKA 3H7OA 1O5FH 1KDQB 5LGOA 4MQAA 4U30A 4ISIH 3GCTF 1KIGH 4JZ1A 5IYTA 1K1IA 4H6SB 4LOYH 2P16A 2RA3A 2F9VA 4AG2A 2OC7A 1N1LA 1UTQA 2F9PA 4AYYB 1M9UA 1P2NA 3U1IB 4U32A 1SGFG 1FY3A 1W7XH 3IG6B 5B6OA 3SQEE 1VR1H 4BANB 1P9SA 1HCGA 2NU0E 4YLQH 5GIBA 2FS8A 1KXEA 3QGNB 5K7RA 4MNXA 3MOCA 2EA3A 3FP8E 1O31A 5ESBA 1SHHB 1KXDA 3SORA 3SI4H 5A0BA 1DVAH 1FY1A 2XXLA 1FI8A 2EEKA 2Z3DA 2AYWA 1EP5A 1H9IE 2Y7XA 1SGFA 3LOXA 5JDUB 4ZHMU 1D4PB 5AVDA 5GXPA 3SU0A 2FTMA 1GJBB 1UHBA 4X1QU 4Y11E 4GAWA 5EU8A 4LZ1H 1DY8A 1AE5A 6GCHG 4WVPE 1PQAA 1Q31A 2GT7A 1LDTT 2HVXA 3LH1A 4FUEA 3V12A 2CF9H 1BRCE 4MNYA 2G5VA 2FZZA 1ZMNA 5FPTA 3ZVAA 1VCWA 1S83A 4A6LA 2BHGA 2BVXH 2OBQA 4VGCC 2D2DA 2ALVA 1CSOE 5L6NH 2W5EA 3Q00A 1C5WB 3KQBA 5T6DA 1IQGA 5FCKA 5EW1H 3SV6A 2D26C 2Y80A 2VU8E 1TAWA 1QB1A 2ZTXA 4TPYA 1TA2A 1KXAA 4RSPA 3OTJE 1AFQB 3TH3H 1O3HA 3M7QA 3FVFB 1Z6EA 4NZQA 4B75A 1Q3XA 7ESTE 3E91A 1C5SA 4K2YA 2ZFSA 2JETB 4FU8A 2ZDNA 3VEQB 4JZFH 2O8MA 4NWLA 5E0HA 1C1NA 3UNQA 3BEIB 4GHQA 1CHOG 1RIWC 1SGRE 2ZDKA 1QR3E 2XC0A 3SU1A 1K1MA 2LPRA 4ESTE 1EAIA 1GHAG 1K21H 4TWYA 5C3NA 4RKOB 3RXEA 4I8LA 2BDAA 3SV2H 2ZP0H 4YESB 1EXFA 1K1NA 3ZZBA 3OY6U 2ZGXH 3MO9A 4UFGH 3M36A 1ELEE 5C1UA 1LMWB 4SGAE 2QAAA 4Q7XA 1GI5A 3FZZA 2GT8A 1IQNA 1LHCH 1GHBG 3ODFA 2RG3A 2GMTC 2P95A 2RA0A 1FDPA 4U2WA 2DE9A 2F3CE 1A61H 3PWBA 1C5YB 1ELTA 3LU9B 4YOIA 3GISB 1XUFA 2ODQA 1FAKH 2FOAA 3F1SB 3GY6A 1FY8E 1MBMA 2ZC9H 4AG1A 1SBWA 2GKVE 3RXHA 2P93A 1QRXA 3MHWU 2A5AA 2Z9IA 3ATWA 4MVNA 3GYMA 5DKMA 1WQVH 1SLVB 2WPHS 1WCZA 4FUDA 1CA8B 1AB9C 1UVPA 1NPMA 1BBRH 3W95A 3EYDA 1NFYA 1MTUA 5DP9A 3UUZA 3DD2H 1WAYB 4Y7AA 1YPHC 4FUJA 2FI3E 1PPZA 1VJAU 3AASA 4JZIA 1VJ9U 2GMTB 1UMAH 3GDUA 4I8KA 1C9TA 1EAXA 1SFIA 3O8DA 3AVZA 3RXVA 4A1TA 4ABBA 3EGKH 2VIWA 3QGJA 1SB1H 5FX5A 2VWLA 5I25A 1P2JA 3UFAA 2ZI2H 1C2DA 2XCNA 3FP6E 1GI9B 1TOMH 3GYLB 2OQUA 1VGCB 1AUTC 2BXUH 4YM9A 3RU4T 1V2JT 2W3IA 3BTDE 5HMAA 2VNTA 3GCTG 2ZDAH 1H1BA 3KIDU 1HAZB 3LT3A 1DFPA 2K1QA 1CHGA 1TRMA 1FONA 2J34A 1PQ8A 1IAUA 1WTGH 1GBIA 5F6MA 1AN1E 1THPB 3GY3A 4ZXYH 4BAMB 1THRH 3JZ2B 6CHAC 2UUJB 4MG3A 2XTTB 5EQRA 4B1TA 5A8XA 5LPRA 1EOLA 1MTVA 3S9CA 4K60A 5JBBS 4X0WU 1LPZB 1NY22 2D8WA 2SGAA 5T3HA 3ZZ4A 1TNLA 1Z1JA 1EOJA 2B5TB 1BRAA 2CJIA 3E3TA 3PROA 3SQHE 3T2NA 5L2YH 1L4ZA 1ZMLA 3P70B 5DGJA 2ZU3A 4FUHA 4AZ2B 4CHAC 2J9NA 2A1DB 1P12E 3BIUH 3PYHA 1RTLA 3SU6A 1O0DH 2NU4E 3VB5A 2QF0A 1ZTLA 3BTTE 1F5LA 2A7JA 4YT6H 1FMGA 1Y3XA 1OYQA 1UTJA 4NGAH 2VWNA 2R3YA 2BY7X 2F91A 1GI8B 3QUMP 1DY9A 1C5UA 3VGCB 1ZTJA 5EOKA 2TBSA 5F8XA 1FIWA 4OGXA 1L1NA 3GCHC 1YGCH 3EA7A 4X2YA 4X8UH 4GHTA 2VB0A 3EQ0H 1DOJA 5FXLA 1OWHA 1NFXA 3ZZDA 2PKSB 2WV5A 2J38A 2ZU2A 3NKKA 2ZPSA 3LH3A 1P09A 1JXPA 1ZHMA 2WPLS 1OWDA 1LVYA 3A8BA 1P8VC 1G36A 4X8TH 2G81E 1AU8A 4XBDA 3A7XA 3A7WA 3N7OA 2AS9A 2ASUB 2J94A 3SGQE 3T5FH 2HGTH 1O35A 1QRWA 1GJ5H 4I8JA 1YP9A 3GY8A 1UK4A 1TGSZ 1K1OA 3TK5A 1IQFA 3SJOA 1BZXE 4ZMAH 2BD3A 3TNTA 1OSSA 1DUEA 2ZCKP 1MUEB 3A7TA 3VB6A 2ZZUH 1NTPA 2W26A 4ZH8A 4BOHA 2QN5T 3FP7E 1GI2A 2QXIA 5A8ZA 2PWXA 1X7AC 1G2LA 2WUCA 4DG4A 2FLRH 1O3JA 4IC5A 1O2VA 1Y8TA 2SGFE 1HAGE 1EPTB 4Y8XA 1TOCB 4KKDA 4B2BA 3URDA 2FI5E 1C5XB 2AMQA 3RXCA 1WYKA 2Z94A 1TX8A 3RLWH 2BY5X 1ESBA 1V2ST 3KQCA 3U8OH 1NFUA 1RS0A 4WMEA 1SC8U 3VB4A 5FBEA 1GMDF 3P8GA 1O2YA 1AUJA 2V35A 1G9IE 2HALA 1GVLA 1SGNE 5F8TA 1OWEA 1ZJDA 3H7TA 2HOBA 1ARBA 1DSUA 3SGBE 1BMLA 3GY4A 2CHAB 3QZQA 1O2XA 2RCEA 3TVJB 2Z9GA 1HAOH 2G00A 1FN6A 2ZGBH 1HJ9A 2AMPA 4NG9H 1O3LA 1PQ7A 1CQQA 4THNH 3BTWE 2PGQB 1BA8B 3RXAA 4O3TA 2Y5GA 3V13A 7GCHG 2TGTA 1LQDB 4FVDA 3RC4A 2SGEE 2OTVA 1JMOH 5A0CA 4MTBA 1UVUH 1XUIA 2F9NA 4BTIB 5C67A 4D9QA 3IWMA 5HYOA 3T28A 1IQJA 1C2FA 1MD7A 1SGPE 2ULLA 2ZPRA 2I6SA 4TPIZ 1IOEA 1RJXB 1AVXA 3PTBA 3HPTB 3OYPA 4DCDA 3O8RA 2R2MB 1NS3A 1K1PA 2HRVA 1DDJA 1TB6H 1JBUH 1OX1A 1GWAA 2ZFQH 5GCHF 1S82A 2O8UA 4LZ4B 1Z6JH 1PPEE 1N6YA 1O36A 1CGIE 1HIAA 4MDSA 1GCTB 3ENSB 3LGWA 3VB3A 1JIRA 3BG8A 1PPBH 3M37A 1TFXA 2ZQ2A 1DXWA 4Q7YA 1S0RA 1YKTA 1SOZA 1BTUA 4H42U 4AGJA 5IDKA 5L2ZH 1E36B 1AO5A 1J17T 1HB0B 1CBWC 4TYDA 2VGCB 3U1JB 3SBKA 4ABIA 4NIYA 1TGNA 2ZHWH 3MO3A 5EXMA 4AORA 3LC3A 2VINA 1N8OB 2BD5A 2BQ6B 4A1VA 2GD4B 3ATMA 2ZDLA 3TNSA 4Q7ZA 3SV7A 3HK3B 4UD9H 1YCPH 3VPKA 1CGHA 3LGIA 3A7YA 4FUGA 5JBCS 1S0QA 3ZZ7A 4WXVA 1E34B 2ANYA 1AKSA 1F92A 4MNVA 4X2WA 1P3EA 1O37A 3SJ8A 1T8NA 3QX5H 2FPZA 1XUJA 4B71A 3SGAE 1UVOA 3L6PA 1UVTH 4R0IA 1D9IA 1MTNB 1GBMA 1UK2A 1AFEH 2Z9LA 2XWBI 3GY2A 2EI7A 2XBYA 2GCTB 4CRGA 1KTSB 1CBWB 1BMAA 1N6XA 1W3CA 1QJ1B 4I8HA 4WF8A 4UFFH 4ZKOU 3VFEA 1SL3A 4BAQB 4CRAA 1BTHH 1HRTH 4J1YA 2VIVA 1A1RA 1NC6A 1HNEE 1LO6A 1Z71A 1O2LA 1ZTKA 1GHXH 2ZEBA 3RXGA 3PMJA 1LHGH 1DITH 4ZXXH 5E0JA 1F0TA 4INKA 3A87A 3UPEA 4K1TA 4JYVH 4TY7A 1NU9A 2CMYA 1GCDA 1ZMJA 2M5TA 2ZA5A 1G3EA 2G52A 1BTWA 2GZ8A 4UDWH 1BOQA 2ZIQH 3F9EA 3GY5A 3R3GB 1YPEH 4OS2A 1O3AA 1O3MA 1GJ9B 1UO6A 2G5NA 1OS8A 2BZAA 3PTNA 5HM9A 4K1EA 2W7SA 1ETRH 3K65B 1ORFA 3ZZ9A 1KY9A 1XVOA 1CU1A 1HV7A 4WXIA 5EQSA 2H9TH 3SV9A 4ASHA 1TMBH 3Q3YA 3GY7A 3RC6A 1OP0A 1PQ5A 1A46H 2R2WU 3SNAA 4X1PU 3GCOA 2BDIA 4X6OA 3CS0A 4O97A 4D7GA 2QA9E 1NESE 3MU4A 4JMYA 2P94A 2XWAA 3MWIU 4RN6A 1GMDG 2GZ7A 4SGBE 1G2MA 1UCYH 5JPMH 1ELDE 3Q3KA 4GSOA 3ATIA 3ZVBA 1ESTA 3OSYA 2FYQA 2ANWA 3FZDA 2XC4A 5LH8A 1GPZA 1G37A 3I29A 1HGTH 1V2NT 2WPKS 3BG4B 4XOJA 4UE7H 1C1QA 3RUOA 3TH4H 2A7HA 4BTUB 4D9RA 4H6TA 1K9OE 1TNHA 1HJAB 3RXBA 2BX4A 2FOGA 1LPKB 5JBTA 1SQAA 1NO9H 1TNJA 4FUCA 4ZKRU 3EDXB 3TIUA 2A32A 1SLWB 1CA0C 1RGQA 1ZSLA 1IHSH 1V2OT 1J9CH 5A8YA 1MKWK 4OS1A 2ZU4A 1ZPCA 1T7CA 3KF2A 1C2EA 3P8OA 2IN2A 3HKJB 2G51A 5E0GA 1DSTA 1AGJA 3RM2H 1LVBA 1UK3A 3T26A 3BTHE 3T62A 3A89A 4AFZA 3I77A 1EZSC 3URCA 3ZV8A 2A45B 1V2MT 1GBEA 5GCHG 1ZLRA 1J15A 2QXGA 2BY8X 2V0BA 1OYTH 2JKHA 1C1TA 1A2CH 2TGDA 2Z3EA 3A81A 3ESTA 5T6FA 2ALPA 2NWNA 2R0LA 2ZECA 1MAYA 1MKXK 1ELVA 1BT7A 1V6DA 1BMMH 2AERH 3PMHB 1HBTH 4ZKNU 1D6RA 3UQOA 4DGJA 5EG4A 5EQQA 3A82A 1C5OH 1A4WH 4HGCA 1GVZA 2PKAB 3T29A 1DLKB 3AAUA 3UY9A 2GZ9A 5DP3A 1AY6H 1TBZH 1GHWH 4JCNA 5EODA 2FIRH 2GDDA 1OP8A 2Y82A 2CF8H 5F03A 2CGAA 3SV8A 2IJOB 3D62A 1VITF 4Q80A 8GCHF 1GBAA 2NU2E 2VVUA 5EPNA 2EI6A 3RXOA 1QJ6B 3MH7A 1C5ZB 3RM0H 3LJOA 2KAIA 5I46H 1GJAB 2BDBA 2AGGX 2C8WB 1AIXH 1A0HB 1MH0A 3MU8A 3KQDA 3VXEH 3TGKE 2V3OH 1BJVA 1BHXB 7LPRA 1W13U 1GBFA 4AFSA 3M5MA 3U8TH 2BY9X 3PLKA 1QL7A 3RXSA 3SU2A 2ZWLH 3HGNA 1H4WA 2BM2A 4VGCB 3CENA 5CHAC 1QA7A 1KXCA 3C1KA 1AWHB 1MKWH 4AB9A 1EZUC 1KLTA 3SOSA 3PMBB 3SUFA 1CT4E 2F9BH 1B5GH 4E05H 1NZQH 3NK8A 3DFJA 2BD7A 3E6PH 1KDQA 2OC0A 1O5EH 2PUXB 3MNBA 2WYGA 4GLYA 2FEQH 3UOUA 1ZSJA 2VVCA 4IN2A 4ABAA 3RXJA 1TBRH 4UFEH 4AX9H 1GG6C 2WPIS 3UNRA 1F2SE 2AIQA 4K1SA 2FXRA 1O2IA 2FOHA 1RIWB 2ZG0H 1RRKA 3VB7A 1O5BB 1GBHA 2BYAX 2XBVA 1DPOA 1MKXH 1O2NA 1MAXA 2FWWA 1O3KA 3RMMH 1OWKA 5TCCA 3LC5A 1TYNA 5AHGH 3UIRA 2V6NA 3F68H 1BDAA 8ESTE 1FV9A 5JBAS 4KGAA 1IQLA 3M7TA 4JK6A 2QF3A 1PPCE 2XNIA 1C1VH 2QXHA 3DFLA 1UTOA 3MH4A 2ZHDA 3NZIA 1C5PA 4XSKU 1G32B 1K28D 5H4IB 2ANMH 4GCHF 4JYUH 1C5MD 3CS7A 1LTOA 2J95A 1BJUA 1KXFA 4TWWA 3PO1C 1GI0A 1V2KT 3E0NB 3KN2A 1YBWA 1GJCB 2GTBA 3NUMA 1HDTH 4X6PA 1GJDB 1GGDC 2JH5D 4XFQA 1KTTB 1NRQH 4R8TB 1AB9B 1QQUA 5TCAA 2LNCA 5F8ZA 1O2UA 2PSYA 3GDSA 4B76A 1EJMA 4WWYA 3F9FA 2FM2A 2IPHA 2VH0A 3GOVB 2UUKB 3UREA 3T27A 4NA8A 1O5AB 1AWFH 4IS5A 3RXKA 1DXPA 3ATKA 4CRFA 1O2TA 5DO4H 3P8NA 2P3UB 1BUIA 5JB8S 3V7TA 3F9HA 3GCNA 4MPXA 2G4UA 1TBQH 1L1JA 2A2XH 4YO9A 3V0XA 1QFKH 2J4IA 3S69A 1MTWA 1Q2WA 1TPSA 1O3IA 2BLVA 3TLOA 1O2GH 2SNVA 1UTMA 4O03A 1P9UA 4B73A 3TJOA 2PSXA 2FOEA 1UVSH 2BLWA 4B74A 2ZFFH 4AOQA 2FS9A 4CRBA 2QC2A 6CHAB 3LONA 1EX3A 1MQ5A 3STJA 2TPIZ 3B23B 5EPYA 2HNTF 4K69A 1BTZA 1DX5M
chains in the Genus database with same CATH superfamily
2ZU5A 1V2WT 1Z1IA 3D23A 1UJ1A 3MNCA 2OC8A 3LGTA 3RLYH 3A8CA 4ZUHA 3B8JA 1YYY1 5TJXA 1XMNB 3BV9B 4FUIA 4NZLA 1YPGH 3F0OA 5T6GA 5FAHA 1PYTD 4NA7A 3FFGA 4CHAB 3MU0A 3ZZ8A 4CR9A 5C0UA 3TITA 2ZFRH 2Y5FA 1NT1A 2G4TA 5GPIB 4ZHLU 2FO9A 1EB2A 2QY0B 3M35A 4CBNA 3TH2H 5AF9H 3U98H 1G3DA 1O3EA 4D7FA 5J4QA 2FOMB 1HLTH 2IOTA 2GP9B 4UONA 1RFNA 1T8OA 1S81A 1VITG 1SMFE 1W0YH 4NWKA 3GDVA 1C1UH 4Y8ZA 4DT7B 8GCHG 2C8XB 1AE8H 3FAOA 1TA6A 1BTPA 2FODA 1YPMH 1O32A 1GBTA 1GHVH 1TNIA 8LPRA 2PUQH 1S5SA 2I6QA 3GCHB 5CE1A 1P04A 4NA9H 3F0PA 4GPGA 1QL8A 5DP8A 3RU4D 4KTCA 1WXRA 5FBIA 3LGUA 4ABHA 1HYLA 1FX0B 4DIHH 2PGBB 4M7GA 2Y6TA 1Z8IB 1P02A 2SFAA 1DANH 4Q63A 1H9HE 2A5KA 1W7GH 2HLCA 3SUDA 1GBBA 2CV3A 2NU3E 2P8OC 3A7VA 3I78A 5DK1A 1A0JA 1GVKB 3C27B 2ODYB 1F5KU 4P00A 1GJ7B 4O9VA 1GI4A 2BOKA 1W11U 1CVWH 4B2AA 8KME2 2B0FA 1ETTH 3ATLA 5J4SA 3LPRA 1C1WH 2OINA 1LHEH 2OQ5A 4FVBA 2O8WA 1AZ8A 2PV9B 1E38B 2ZGJA 1ETSH 1XXDA 2F4LA 3W1EA 2VVVA 4NIXA 2A7CA 1GMCF 2G8TA 1ZPZA 4Z1MD 1COWD 2W6ID 1P2QA 3KEEA 3HK6B 1Y5AT 4K8BA 1S84A 4GVUA 1S6FA 5BPEA 1NN6A 5EJZA 1BMFD 2AEIH 1WBGB 1O2MA 3M3SA 1J14A 3CP7A 3UB0A 5EXLA 2JH0D 4I8GA 3D49H 1OPHB 1QBVH 1O3BA 2O8LA 4BAKB 2B8OH 2FP7B 2UWPA 1A5IA 2GGVB 2ZQ1A 3UR6A 4FU7A 4JZDH 3ZYEA 1C2HA 2ZO3H 4ACAA 5GWZA 3FN8A 3RXUA 4GCHG 3M5OA 1C2MA 3LGVA 3SHAH 2Z9JA 3OAAD 3FOAA 1O2KA 1O3CA 2C8ZB 4E06H 3R0FA 3U69H 4XRNA 1C2KA 3ZIAD 5EXNA 3EE7A 3RMOH 3NCLA 1XUHA 1EKBB 1C5LH 1O34A 3G01A 1ABIH 2BDCA 1QIXB 1YPLH 1EQ9A 4CBOA 1B0EA 5A0AE 1ZGIA 3E1XB 3P6ZB 1DWEH 3LJJA 2KX4A 1LQEA 4B2CA 3D65E 4XE4A 1T8MA 1MU8B 1TQ7B 1TONA 1B0FA 2Z9KA 3RXLA 3LKWA 5CDFE 4YLUA 2PFEA 2HVYB 1O2WA 4I31A 3JZ1B 2R3UA 2IJD1 1YCPM 1GDNA 1AI8H 1S85A 1ZHRA 2O8TA 2QCYA 3ZZ6A 4CH8B 1YPKH 1GBJA 2TIOA 4UFDH 2G55A 2BTCE 4Z6AH 1RTFB 3BTGE 1VITH 4YTAA 1C2LA 5DP5A 3UOPA 1O3FA 1SPJA 5DP6A 3IITA 4NSVA 1QNJA 2ZU1A 2NU1E 1XUGA 4MPUA 1K1JA 3MYWA 3TGIE 3SUEA 1HJ8A 3NWUA 4JZEH 1EPTA 2QE7D 3OX7U 3S7HB 3PB1E 2Q6GA 1V3XA 1HAVA 1O5GH 1QURH 1T8LA 2OBOA 2ZF0H 1TABE 3DA9B 2THFB 3RXQA 1O5CB 4E7NA 5AFYH 2AGEX 1DE7H 2VIOA 4X8VH 5DP4A 3K2UA 4F4OC 2Q6FA 2A5IA 3QDZB 1CHOF 2V3HH 1TPPA 1ZGVA 1HUTH 3ZVDA 1SGYE 1P01A 3B9FH 1TIOA 1UHBB 2ZDVH 2GV7A 2H2ZA 4Y76A 2BD9A 1HAIH 1CE5A 1UTLM 2B9LA 2A4QA 2B7DH 1BCUH 2ZNKH 1G30B 1P2MA 5L30H 2GX4A 5PTPA 5DG6A 5BRRE 4XDEA 4YT7H 1PPGE 1GMHF 1FXYA 4X2XA 1SHYA 1ZZZA 4WMFA 3SI3H 3M61U 4IBLH 1BTXA 1GHBF 3SJ9A 2ZFTA 3E0PB 1BRUP 2BD8A 1EJAA 1P57B 2HNTE 2YOLA 3A80A 4LK4A 3S9BA 4ABFA 2ILNA 1V2QT 4P02A 1SFQB 2KR7A 4UEHH 3TJNA 1TPAE 4XD7D 1FJSA 2BVRH 2J2UA 3T25A 1J16A 1OP2A 4BXSA 1QY6A 4WJG2 3TJVA 1T32A 4MPWA 1EB1H 4FUBA 3RC5A 1D3PB 2ZTZA 1GJ8B 4NIVA 2BQWB 4FETA 1BRBE 3KQ5A 1XKBC 2EY4C 3M3TA 3ZZ3A 1Z7KA 4INHA 4BXWA 2RDEA 1SLUB 1HAPH 1EAWA 4TY6A 1H9LB 2SNWA 4RT0A 1ACBE 5JYIA 4X6NA 2TGAA 1DLEA 1W10U 2C4FH 1GBDA 3FKSD 9LPRA 4OM9A 2WUBA 2FI4E 6ESTA 1O2QA 1WV7H 2FYRA 2H9HA 1MU6B 3E16B 1RXPA 4Y6DA 4AC9A 2GCHF 1TRNA 2ZGHA 1WOFA 3QZRA 4RKJB 1O2RA 2QV1A 3KL6A 4NFEA 1NROH 2L6OA 1D3QB 4ABDA 1GJ6A 3M5LA 2BD4A 4ZKSU 3S9AA 2XC5A 1BHXF 4ISLA 4BTTB 3Q76A 2P3FH 1ZOMA 2V7QD 4I33A 4HTCH 2BLOA 5GJ4B 1KXBA 1WSSH 4NCYA 3BEUA 1ZJKA 1NRSH 3QTVH 4IC6A 5G4BA 1AD8H 4AFQA 1FIZA 6LPRA 1T31A 1C2JA 1O3DA 1LVOA 2RDLA 3EA8A 4NSYA 1ZYOA 1ZSKA 2AIPA 3RP2A 3K6YA 1O3OA 4ABEA 4HFPB 3F2GA 1GBCA 3PMAB 2HPQH 3DCLA 2TGPZ 2OD3B 1PPFE 1GL0E 5C1XA 2F9UA 1GDUA 3PM3A 5SGAE 3BN9A 1GBKA 1TE0A 1C9PA 1O2ZA 4CREA 4K8YA 1PJPA 1CA0B 5KECA 3A83A 4A7IB 1SGIB 5EGMA 3MH5A 2QF4A 1CT2E 2PLXA 3DT0H 4Y0ZE 1ANEA 3ZVCA 1AFQC 1ZRBA 2YNAA 3SO3A 1GDQA 3AK5A 1P2OA 1Y59T 3QO6A 1BB0B 1D3TB 4X2VA 3RU4E 3SNCA 2WV9A 2JETC 3SZNA 4Y7BA 1GI3A 1TGTA 5C1YA 3PV4A 2UWOA 1BBRE 5E2OA 4CRDA 3BTME 1SGEE 1JWTA 2ZKSA 1SOTA 1QCPA 1FNIA 2YMSD 4Y8YA 1BBRK 3L3TA 4FUFA 1ELFA 4H4FA 4CH2B 1ARCA 3MH6A 3RXPA 3O8CA 3TJUA 2CK3D 1WQSA 2CN0H 2WINI 2Z3CA 1W14U 1SSXA 1GHYH 2ZCLP 3P8FA 1C1OA 1TX6A 1W2KH 1FPCH 2O9QA 4IGDA 4NIWA 1BMNH 2TRMA 1EZXC 4ISOA 4IW4E 1P3CA 4X6MA 1BIOA 3W94A 2OP9A 2GDEH 1XX9A 1XM1A 4KP0A 2ANKH 2DUCA 1HAHH 2W3KA 1EP6A 3S0NA 3A84A 1C2IA 4IMQA 3SNBA 5FCRA 2J92A 3SHCH 2A4GA 1RTKA 3E8LA 1Y3UA 1U6QA 4LXBH 1C2GA 5E2PA 5F53A 4IMZA 4NFFA 4YOGA 1EAUA 3BIVH 4BAHB 1ESAA 2BD2A 3UR9A 4A1XA 1NRRH 3ZZ5A 2VIPA 1ELCA 1QB6A 1UTPA 3PWCA 3OE7D 3RMLH 4AFUA 1MCVA 4J2YB 2XCFA 1GMHG 1O39A 1W0ZU 1QQ4A 5CHAB 4ZAEA 1XKAC 1ID5H 3WW7A 4Q2KA 4YOJA 3STIA 4DVAU 3NXPA 4Y79A 1E35B 1MD8A 4HI3A 4I7YH 1IQEA 4Z0KA 4FU9A 2BDHA 2EI8A 1H8DH 1HXFH 2UWLA 2C90B 1QB9A 2HWLB 2C93B 3F6UH 5A2MH 1EUFA 1C4Y2 1TX7A 2ODPA 4DIIH 1XUKA 2WHXA 5DP7A 3WY8A 3SU3A 1C4U2 3OEED 1L4DA 1B7XB 1TGBA 1IQIA 2ZPQA 3SJIA 1C1MA 1VGCC 2FTLE 1CT0E 1T4UH 1S6HA 1MZDA 1SQOA 4X1RU 9ESTA 4Y10E 5AFZH 4DW2U 1GG6B 3UWIA 2GV6A 3A85A 1P05A 1BITA 2ZHEH 1LKAA 3KCGH 3UQVA 1XVMA 4A5TS 2Z6BD 2QIQA 1GI7B 1YM0A 1K0HA 2OLGA 3P17H 4OS7A 1V2PT 1CGJE 1DUAA 5LPFA 4E7RG 1HXEH 4DURA 2OXSA 2OC1A 1IHTH 1MQ6A 1SG8B 2FDAA 2VWOA 1SGTA 3LDXH 1A0LA 7GCHF 1JRSA 2GCHG 4ABJA 2KCPA 2YNBA 1JIMA 4DT4A 1DWDH 4KTUA 2PKAA 1ANDA 1W12U 2A0QB 2XBXA 3A7ZA 1SVPA 3MMGA 2BDYA 5ESTE 1DT2A 1TRYA 2XRCA 3GICB 3U9AH 1EZQA 1FAXA 4B6EA 2JJ1D 2AHME 2C8YB 4MNWA 1HAYB 3PO1B 1FZZA 1TNKA 1P10A 5JB9S 1H8HD 4M9FA 1QTFA 3TU7H 2PW8H 4F49A 1LHDH 1HAXB 5HXFA 3BTQE 3QLPH 3SU4A 3SN8A 1O30A 3VXFH 2BVSH 1GGDB 1XXFA 3VGCC 1V2LT 3UWJH 3U8RH 5HKKD 4BAOB 1FLEE 4U01A 2PTNA 2AH4X 1DWBH 2PKSC 1AQ7A 3RMNH 4F55A 3LGYA 1C5QA 1O2JA 1UTNA 1SR5C 2YMSB 2SGQE 3BSQA 1G3BA 1O38A 3QTOH 1ANBA 1Y5UT 4WMDA 1FPHH 1OWIA 2QGRA 2A4OA 1QA0A 1QBNA 2XBWA 1ZRKA 5K0HA 1KLJH 4GUXA 2R9PA 1RD3B 3ZZAA 3QK1A 5C2ZA 1FY4A 1V2VT 2H1UA 4KTSA 2STAE 3EAJA 3MNSA 2LP6A 1CO7E 3E90B 1O2SA 1C1RA 2KZ4A 3PV2A 1A3BH 2WPJS 2EC9H 3ZYDA 1V2UT 1F0SA 1H8IH 4PROA 3PLPA 3F9GA 2KCAA 1HIAB 1Y3VA 3K9XB 1C1SA 3K6ZA 2OCVB 4ISNA 1FUJA 4D76A 1HFDA 2H5DA 2P59A 1QJ7B 1NRPH 2D1JA 5FL7D 1K1LA 3BTEE 2KFWA 1A5HA 1ANCA 1EPTC 3A86A 5FX6A 3RXDA 1GI1A 1SGQE 1ELAA 4I32A 4JK5A 1DICA 3A8DA 3A88A 2OUAA 1KYNA 1THSH 4ISHH 3ZVFA 3P92A 5E8EH 2ZHFH 3F2HA 1V2TT 1JOUB 5DJ7A 1BQYA 3NPSA 2Y5HA 2ZFPH 3EA9A 1ZHPA 3FANA 3RDZA 1QGFA 1MCTA 2BQ7B 1VZQH 1FY5A 1P2KA 2SGPE 5B6LA 2BOHB 1LVMA 1P06A 4XBCA 3KNXA 2SGDE 1NBMD 1Z8RA 2XNDD 3A8AA 1TNGA 1P03A 3O8BA 2DE8A 2HNTC 3QN7A 1OHHD 4WH8A 1A3EH 1HPGA 1DWCH 2CHAC 1FN8A 1AKSB 2BB4A 1YC0A 3SW2B 3RXMA 1L0ZA 3RXFA 1SQTA 1ZPBA 1F0RA 1LKBA 2ESTE 1QRZA 1NFWA 1NM6A 2FOFA 2Z7FE 2ZDMA 3S7KB 1HAVB 1P2IA 2FOBA 3BTKE 1F0UA 1LPGB 1O5DH 1UTKA 2AGIX 2P3TB 3OU0A 1A7SA 2UUYA 3OEHD 4ZHAA 4RT1A 2P8OB 1SGDE 3SZEA 3P95A 1YPHE 4RI0A 1OWJA 2FMJA 3ZV9A 3AW1A 2AMDA 3CNRA 1SGCA 1ZR0A 3BF6H 5C5NA 4FXGH 2K8IA 1YCPK 4CR5A 1Y3WA 2PTCE 4A92A 3V3MA 1NRNH 4AN7A 5DPAA 1L2EA 2QYIA 3MNXA 3UTUH 4MPVA 2VIQA 3ZZCA 1MMJN 2J97A 4I86A 1G3CA 3RXIA 1GCTC 1O33A 1WUNH 1DM4B 4X8SH 4YZUA 3PLBA 3TK6A 1AHTH 1K22H 3ZVEA 3KGPA 4K5ZA 3MFJA 4AYVB 3AAVA 4Y0YE 3SUGA 3ZVGA 4OGYA 3SNDA 2F9OA 2ZGCA 4Y71A 1E0FD 1JRTA 1TPOA 1TLDA 1OOKB 3MU5A 1YY3A 2VGCC 1AMHA 1VCPA 1WTHD 1TMTH 1OKXA 2FESH 1AVGH 3M5NA 1PYTC 1SI5H 1N8OC 2HPPH 2VIDA 4K3JA 4OS5A 3BEFB 2STBE 3KYFA 5HM2A 4IN1A 2BLQA 2VH6A 1O3PB 4BNRA 1F5RA 1FQ3A 2PHBA 2R0KA 2VWMA 3MI4A 4WY3A 1P0SH 2BMGB 3UNSA 6GCHF 1GL1A 1A5GH 1YLDA 3DHKH 2JIZD 1LHFH 3KQEA 4XBBA 1V2RT 2H5CA 5HGGA 2PP6A 2FLBH 2EQNA 1C5TA 2BY6X 1IQHA 4ABGA 1INCA 1YPJH 1MBQA 2BX3A 1MTNC 1C5RA 4OS4A 3ELAH 4O3UA 2GCTC 2Q6DA 1L1GA 1C5NH 1D6WA 4DOQA 2PR3A 4JYTA 3BTFE 5LPEA 1KLIH 2WPMS 1TQ0B 3MO6A 3HATH 1ELBA 5EJ1A 1DS2E 2Y7ZA 1C5VA 1W8BH 3Q77A 1AVWA 4DJZB 5C5OA 2A31A 2WV4A 1UCYE 5FPYA 2W7UA 5CHBA 3ODDA 4D8NA 3ITIA 2QXJA 1ELGA 4HZHA 1TMUH 1AZZA 2BDGA 1UCYK 1EATA 2GVFA 4ZROA 4INLA 1C1PA 1NU7B 1F7ZA 5FPSA 2ZHQH 1D3DB 3QWCH 1J8AA 5IK2D 1PFXC 1GHAF 1MZAA 2WYJA 2BXTH 1LCYA 1P11E 3TGJE 1C4V2 3NRLA 1MTSA 5CMXH 1TWXB 1QBOA 3DSPA 1GBLA 2JH6D 4MLFB 2FX6A 1QL9A 5GDSH 1Y3YA 5C20A 5T1VA 3M3VA 1E1QD 3RXTA 1GHZA 3HGPA 3N7EA 1O2HA 1SLXB 1OXGA 2UUFB 2FX4A 4KELA 1BTYA 2BZ6H 7KMEH 1O3NA 1YWUA 3RXRA 1PPHE 1QHRB 3OY5U 2FOCA 3TPIZ 5A09A 1GJ4H 1EASA 3Q3XA 4OS6A 5FHTA 1YF4A 3F2FA 3HKIB 3SJKA 1WU1A 1KSNA 2AFQB 3MTYA 1Z8GA 3EE0B 1O2PA 2IPQX 5EW2H 3SNEA 3AW0A 2H9EH 2ZTYA 3TK9A 4HG6A 3LIWA 3KHVA 3SU5A 4AB8A 2KAIB 3BG4C 4X1NU 2WZQA 1Z8JB 4X1SU 2H6MA 2F83A 1O2OA 1K2I1 2C3SA 1WDIA 1HJAC 2Y81A 1EJNA 5ETXA 3L33A 2CXVA 1VCQA 1GMCG 2XYAA 3DUXH 4QT8C 4CRCA 2XW9A 2ZCHP 3MU1A 1YLCA 2Q1JA 2A2QH 1Y5BT 4YXWD 5ABWA 1O3GA 1ABJH 1GI6A 4WH6A 1TGCA 3H5CB 1T4VH 1IQMA 2VJ1A 1E37B 1IQKA 3M7UA 1TALA 4DY7B 2A4RA 4AGKA 3H7OA 1O5FH 1KDQB 5LGOA 4MQAA 4U30A 4ISIH 3GCTF 1KIGH 4JZ1A 5IYTA 1K1IA 4H6SB 4LOYH 2P16A 2RA3A 2F9VA 4AG2A 2OC7A 1N1LA 1UTQA 2F9PA 4AYYB 1M9UA 1P2NA 3U1IB 4U32A 1SGFG 1FY3A 1W7XH 3IG6B 5B6OA 3SQEE 1VR1H 4BANB 1P9SA 1HCGA 1QZ8A 2NU0E 4YLQH 5GIBA 2FS8A 1KXEA 3QGNB 5K7RA 4MNXA 3MOCA 2EA3A 3FP8E 1O31A 5ESBA 1SHHB 1KXDA 3SORA 3SI4H 5A0BA 1DVAH 1FY1A 2XXLA 1FI8A 2EEKA 2Z3DA 2AYWA 1EP5A 1H9IE 2LELA 2Y7XA 1SGFA 3LOXA 5JDUB 4ZHMU 1D4PB 5AVDA 5GXPA 3SU0A 2FTMA 1GJBB 1UHBA 4X1QU 4Y11E 4GAWA 5EU8A 4LZ1H 1DY8A 1AE5A 6GCHG 4WVPE 1PQAA 1Q31A 2GT7A 1LDTT 2HVXA 3LH1A 4FUEA 3V12A 2CF9H 1BRCE 4MNYA 2G5VA 2OK5A 2FZZA 1ZMNA 5FPTA 3ZVAA 1VCWA 1S83A 4A6LA 2BHGA 2BVXH 2OBQA 4VGCC 2D2DA 2ALVA 1CSOE 5L6NH 2W5EA 3DSOA 1NBME 1C5WB 3KQBA 3F3BA 3Q00A 5T6DA 1IQGA 5FCKA 5EW1H 3SV6A 2D26C 2Y80A 2VU8E 1TAWA 1QB1A 5C0TA 2ZTXA 4TPYA 1TA2A 1KXAA 4RSPA 3OTJE 3WWFA 1AFQB 3TH3H 1O3HA 2W6JD 3M7QA 3FVFB 1W0JD 1Z6EA 4NZQA 4B75A 1Q3XA 7ESTE 3E91A 1C5SA 3GS9A 4K2YA 2ZFSA 2JETB 4FU8A 2ZDNA 3VEQB 4JZFH 3N99A 2O8MA 4NWLA 5E0HA 1C1NA 3UNQA 3BEIB 4GHQA 1CHOG 1RIWC 1SGRE 2ZDKA 5HIYA 1QR3E 2XC0A 3SU1A 1K1MA 2LPRA 4ESTE 1EAIA 1GHAG 1K21H 4TWYA 5C3NA 4RKOB 3RXEA 4I8LA 3UAIC 2BDAA 3SV2H 2ZP0H 4YESB 1EXFA 1K1NA 3ZZBA 3OY6U 2ZGXH 3MO9A 4UFGH 3M36A 1H8ED 1ELEE 5C1UA 1LMWB 2WSSD 4SGAE 2QAAA 4Q7XA 1GI5A 3FZZA 2GT8A 1IQNA 1LHCH 1GHBG 3ODFA 2RG3A 2GMTC 2P95A 2RA0A 3PRDA 1FDPA 4Q4LA 2DE9A 2F3CE 4U2WA 1A61H 3PWBA 1C5YB 1ELTA 3LU9B 4YOIA 3GISB 1XUFA 3SYJA 2ODQA 1FAKH 2FOAA 3F1SB 3GY6A 1FY8E 1MBMA 2ZC9H 4AG1A 5DSFA 4B6FA 1SBWA 2GKVE 3MQKC 3RXHA 2P93A 1QRXA 3MHWU 2A5AA 2J98A 2Z9IA 3ATWA 1S6LA 4MVNA 3GYMA 5DKMA 1WQVH 1SLVB 2WPHS 1WCZA 4FUDA 1CA8B 1AB9C 1UVPA 1NPMA 1BBRH 3W95A 3EYDA 1NFYA 1MTUA 5DP9A 3UUZA 3DD2H 1WAYB 4Y7AA 1YPHC 4FUJA 2FI3E 1PPZA 1VJAU 3AASA 4JZIA 1VJ9U 3U28C 2GMTB 1UMAH 3GDUA 4ASUD 4I8KA 1C9TA 1EAXA 1SFIA 3O8DA 3AVZA 3RXVA 4A1TA 4ABBA 3EGKH 2VIWA 3QGJA 1SB1H 5FX5A 4ZCNA 2VWLA 5I25A 1P2JA 3UFAA 2ZI2H 1C2DA 2XCNA 3FP6E 1GI9B 1TOMH 3GYLB 2OQUA 1VGCB 1AUTC 2BXUH 4YM9A 3RU4T 1V2JT 2GJGA 2W3IA 3BTDE 2VNTA 5HMAA 3GCTG 2ZDAH 1H1BA 2HLDD 1HAZB 3KIDU 3LT3A 1DFPA 2K1QA 1CHGA 1TRMA 1FONA 2J34A 1PQ8A 1IAUA 1WTGH 1GBIA 5F6MA 1AN1E 1THPB 3GY3A 4ZXYH 4BAMB 1THRH 3JZ2B 6CHAC 2UUJB 4MG3A 2XTTB 5EQRA 4B1TA 5A8XA 5LPRA 1EOLA 1MTVA 3S9CA 4K60A 5JBBS 4X0WU 1LPZB 1E1RD 1NY22 2D8WA 2SGAA 3FO8D 1TNLA 5T3HA 3ZZ4A 1Z1JA 1EOJA 2B5TB 5EJLA 1BRAA 2CJIA 3E3TA 3PROA 3SQHE 3T2NA 5L2YH 1L4ZA 1ZMLA 3P70B 1EFRD 5DGJA 2ZU3A 4FUHA 4AZ2B 4CHAC 2J9NA 2A1DB 1P12E 3BIUH 3PYHA 1RTLA 3SU6A 2KCYA 1O0DH 2NU4E 3VB5A 5C94A 2QF0A 1ZTLA 3BTTE 1F5LA 2KCOA 2A7JA 4YT6H 1FMGA 1Y3XA 1OYQA 1UTJA 4NGAH 2VWNA 2R3YA 2BY7X 2F91A 1GI8B 3QUMP 1DY9A 1C5UA 3VGCB 1ZTJA 5EOKA 2TBSA 5F8XA 1FIWA 4OGXA 1L1NA 3GCHC 1YGCH 3EA7A 4X2YA 4X8UH 4GHTA 2VB0A 3EQ0H 1DOJA 5FXLA 1OWHA 1NFXA 3PV5A 3ZZDA 2PKSB 2WV5A 2J38A 2ZU2A 3NKKA 2ZPSA 3LH3A 1P09A 1JXPA 1ZHMA 2WPLS 1OWDA 1LVYA 1VKYA 3A8BA 1P8VC 1G36A 4X8TH 2G81E 1AU8A 4XBDA 3A7XA 3A7WA 3N7OA 2AS9A 2ASUB 2J94A 3SGQE 3T5FH 2HGTH 1O35A 1QRWA 1GJ5H 4I8JA 1YP9A 3GY8A 1UK4A 1TGSZ 1K1OA 3TK5A 1IQFA 3SJOA 1BZXE 4ZMAH 2BD3A 3TNTA 1OSSA 1DUEA 2ZCKP 1MUEB 3A7TA 3VB6A 2ZZUH 1NTPA 2W26A 5HIZA 4ZH8A 4BOHA 2QN5T 3FP7E 1GI2A 2QXIA 1MABB 5A8ZA 2PWXA 1X7AC 1G2LA 2WUCA 4DG4A 2FLRH 1O3JA 4IC5A 1O2VA 1Y8TA 2SGFE 1HAGE 1EPTB 4Y8XA 1TOCB 4KKDA 4B2BA 3URDA 2FI5E 1C5XB 2AMQA 3RXCA 1WYKA 2Z94A 3KYGA 1TX8A 3RLWH 2BY5X 1ESBA 1V2ST 3KQCA 3U8OH 5EIYA 1NFUA 1RS0A 4WMEA 1SC8U 3VB4A 5FBEA 1GMDF 3P8GA 1O2YA 1AUJA 2V35A 1G9IE 2HALA 1GVLA 1SGNE 5F8TA 1OWEA 1ZJDA 3H7TA 2HOBA 1ARBA 1DSUA 3SGBE 1BMLA 3GY4A 2CHAB 3QZQA 1O2XA 2RCEA 3TVJB 2Z9GA 1HAOH 2G00A 2VBCA 1FN6A 2ZGBH 1HJ9A 2AMPA 4NG9H 1O3LA 1PQ7A 1CQQA 4THNH 3BTWE 2PGQB 1BA8B 3RXAA 2J5UA 4O3TA 2Y5GA 3V13A 7GCHG 2TGTA 1LQDB 4FVDA 3RC4A 2SGEE 2OTVA 1JMOH 5A0CA 4MTBA 1UVUH 1XUIA 2F9NA 4BTIB 5C67A 4D9QA 3IWMA 5HYOA 3T28A 1IQJA 1C2FA 1MD7A 1SGPE 2ULLA 2ZPRA 2I6SA 4TPIZ 1IOEA 1RJXB 1AVXA 3PTBA 3HPTB 3OYPA 4DCDA 3O8RA 2R2MB 1NS3A 1K1PA 2HRVA 1DDJA 3OFND 1TB6H 1JBUH 1OX1A 1GWAA 2ZFQH 5GCHF 1S82A 5C17A 2O8UA 4LZ4B 1Z6JH 1PPEE 1N6YA 1O36A 1CGIE 1HIAA 4MDSA 1GCTB 3ENSB 3LGWA 3VB3A 1JIRA 3BG8A 1PPBH 3M37A 1TFXA 2ZQ2A 1DXWA 4Q7YA 1S0RA 1YKTA 1SOZA 1BTUA 4H42U 4AGJA 5IDKA 5L2ZH 1E36B 1AO5A 1J17T 1HB0B 1CBWC 4TYDA 2VGCB 3U1JB 3SBKA 4ABIA 4NIYA 1TGNA 2ZHWH 3MO3A 5EXMA 4AORA 3LC3A 2VINA 1N8OB 2BD5A 2BQ6B 4A1VA 2GD4B 3ATMA 2ZDLA 3TNSA 4Q7ZA 3SV7A 3HK3B 4UD9H 1YCPH 3VPKA 1CGHA 3LGIA 3A7YA 4FUGA 5JBCS 1S0QA 3ZZ7A 4WXVA 4ACBA 1E34B 2ANYA 1AKSA 1F92A 4MNVA 4X2WA 1P3EA 1O37A 3SJ8A 1T8NA 3QX5H 2FPZA 1XUJA 4B71A 3SGAE 1UVOA 3L6PA 1UVTH 4R0IA 1D9IA 1MTNB 1GBMA 1UK2A 1AFEH 2Z9LA 2XWBI 3GY2A 2EI7A 2XBYA 2RFKC 2GCTB 4CRGA 1KTSB 1CBWB 1BMAA 1KMHB 1N6XA 1W3CA 1QJ1B 4I8HA 4WF8A 4UFFH 4ZKOU 3VFEA 1UW7A 1SL3A 4BAQB 4CRAA 1BTHH 1HRTH 4J1YA 1SKYE 2VIVA 1A1RA 1NC6A 1HNEE 1LO6A 1Z71A 1O2LA 1ZTKA 1E79D 1GHXH 2ZEBA 3RXGA 3PMJA 1LHGH 1DITH 4ZXXH 5E0JA 1F0TA 4INKA 3A87A 3UPEA 4K1TA 4JYVH 4TY7A 1NU9A 2CMYA 1GCDA 1ZMJA 2M5TA 2ZA5A 1G3EA 2G52A 1BTWA 2GZ8A 4UDWH 1BOQA 2ZIQH 3F9EA 3GY5A 3R3GB 1YPEH 4OS2A 1O3AA 1O3MA 1GJ9B 1UO6A 2G5NA 1OS8A 2BZAA 3PTNA 5HM9A 4K1EA 2W7SA 1ETRH 3K65B 1ORFA 3ZZ9A 2KM0A 1KY9A 1XVOA 1W0KD 1CU1A 1HV7A 4WXIA 5EQSA 2H9TH 3SV9A 4ASHA 1TMBH 3Q3YA 3GY7A 3RC6A 1OP0A 1PQ5A 1A46H 2R2WU 3SNAA 4X1PU 2WPDD 3GCOA 2BDIA 4X6OA 3CS0A 4O97A 4D7GA 2QA9E 1NESE 3MU4A 4JMYA 2P94A 2XWAA 3MWIU 4RN6A 1GMDG 2GZ7A 4SGBE 1G2MA 1UCYH 5JPMH 1ELDE 3Q3KA 4GSOA 3ATIA 3ZVBA 1ESTA 3OSYA 5KEDA 2FYQA 2ANWA 3FZDA 2XC4A 5LH8A 3PRBA 1GPZA 1G37A 3I29A 1HGTH 1V2NT 3N7DA 2WPKS 3BG4B 4XOJA 4UE7H 1C1QA 3RUOA 3OTPA 2A7HA 4TSFD 3TH4H 4BTUB 4D9RA 4H6TA 1K9OE 1TNHA 1HJAB 3RXBA 2BX4A 2FOGA 1LPKB 5JBTA 1SQAA 1NO9H 1TNJA 4FUCA 4ZKRU 3EDXB 3TIUA 2A32A 1SLWB 1CA0C 1RGQA 1ZSLA 1IHSH 1V2OT 1J9CH 5A8YA 1MKWK 4OS1A 2ZU4A 1ZPCA 1T7CA 3KF2A 1C2EA 3P8OA 2IN2A 3HKJB 2G51A 5E0GA 1DSTA 1AGJA 3RM2H 1LVBA 1UK3A 3T26A 2J98B 3BTHE 3T62A 3A89A 4AFZA 3I77A 1EZSC 3URCA 3ZV8A 2A45B 1V2MT 1GBEA 5GCHG 1ZLRA 1J15A 2QXGA 2BY8X 2V0BA 1OYTH 2JKHA 1C1TA 1A2CH 2TGDA 2Z3EA 3A81A 3ESTA 5T6FA 2ALPA 2M2AA 2NWNA 2R0LA 2ZECA 1MAYA 1MKXK 1ELVA 1BT7A 1V6DA 1BMMH 2AERH 3PMHB 1HBTH 4ZKNU 1D6RA 3UQOA 4DGJA 5EG4A 5EQQA 3A82A 1C5OH 1A4WH 4HGCA 1GVZA 2PKAB 3T29A 1DLKB 3AAUA 3UY9A 2L74A 2GZ9A 5DP3A 1AY6H 1TBZH 1GHWH 4JCNA 5EODA 2FIRH 2GDDA 1OP8A 2Y82A 2CF8H 5F03A 2CGAA 3SV8A 2IJOB 3D62A 1VITF 4Q80A 8GCHF 1GBAA 2NU2E 2VVUA 5EPNA 2EI6A 3RXOA 1QJ6B 3MH7A 1C5ZB 3RM0H 3LJOA 2KAIA 5I46H 1GJAB 2BDBA 2AGGX 2QF5A 2C8WB 1AIXH 1A0HB 1MH0A 3MU8A 3KQDA 3VXEH 3TGKE 2V3OH 1BJVA 1BHXB 7LPRA 1W13U 1GBFA 4AFSA 3M5MA 3U8TH 2BY9X 3PLKA 1QL7A 3RXSA 3SU2A 2ZWLH 3HGNA 1H4WA 2BM2A 4VGCB 3CENA 3DSGA 5CHAC 1QA7A 1KXCA 3C1KA 1AWHB 1MKWH 4AB9A 1EZUC 1KLTA 3SOSA 3PMBB 2JDID 3SUFA 1CT4E 2F9BH 1B5GH 3WWBA 4E05H 1NZQH 3NK8A 3DFJA 2BD7A 3E6PH 1KDQA 2OC0A 1O5EH 2PUXB 3MNBA 2WYGA 4GLYA 2FEQH 3UOUA 1ZSJA 2VVCA 4IN2A 1YLNA 4ABAA 3RXJA 3VG8A 1TBRH 4UFEH 4AX9H 1GG6C 2WPIS 3UNRA 1F2SE 2AIQA 4K1SA 2FXRA 1O2IA 2FOHA 1RIWB 2ZG0H 1RRKA 3VB7A 1O5BB 1GBHA 2BYAX 2XBVA 1DPOA 1MKXH 1O2NA 1MAXA 2FWWA 1O3KA 3RMMH 1OWKA 5TCCA 2V3MA 3LC5A 1TYNA 4FOUC 5AHGH 2V6NA 3F68H 3UIRA 1BDAA 8ESTE 1FV9A 5JBAS 4KGAA 1IQLA 3M7TA 4JK6A 2QF3A 1PPCE 2XNIA 1C1VH 2JJ2D 2QXHA 3DFLA 1UTOA 3MH4A 2ZHDA 3NZIA 1C5PA 4XSKU 1G32B 1K28D 5H4IB 2ANMH 4GCHF 4JYUH 1C5MD 3CS7A 1LTOA 2J95A 2XOKD 1BJUA 1KXFA 4TWWA 3PO1C 1GI0A 1V2KT 3E0NB 3KN2A 1YBWA 1GJCB 2GTBA 3NUMA 1HDTH 4X6PA 1GJDB 1GGDC 5GNDA 2JH5D 4XFQA 1KTTB 1NRQH 4R8TB 4TT3D 1SQRA 1AB9B 1QQUA 4F48B 5TCAA 2LNCA 5F8ZA 1O2UA 2PSYA 3GDSA 4B76A 1EJMA 4WWYA 3F9FA 2FM2A 2IPHA 2VH0A 3GOVB 2UUKB 3UREA 3T27A 5DN6D 2YMSC 1O5AB 4NA8A 1AWFH 4IS5A 3RXKA 1DXPA 3ATKA 4CRFA 1O2TA 5DO4H 2F43B 3P8NA 2P3UB 1BUIA 5JB8S 3V7TA 2K0QA 3F9HA 3GCNA 4MPXA 2G4UA 1TBQH 1L1JA 2A2XH 4YO9A 3V0XA 1QFKH 2J4IA 3S69A 1MTWA 1Q2WA 1TPSA 5KGOA 1O3IA 2BLVA 3TLOA 1O2GH 2SNVA 1UTMA 3H09A 4O03A 1P9UA 4B73A 3TJOA 2PSXA 2FOEA 1UVSH 2BLWA 4B74A 2ZFFH 4AOQA 2FS9A 4CRBA 2QC2A 6CHAB 3LONA 1EX3A 1MQ5A 3STJA 2TPIZ 3B23B 5EPYA 2HNTF 4K69A 1BTZA 1DX5M
chains in the Genus database with same CATH topology
2ZU5A 1V2WT 1Z1IA 3D23A 1UJ1A 3MNCA 2OC8A 3LGTA 3RLYH 3A8CA 4ZUHA 3B8JA 1YYY1 5TJXA 1XMNB 3BV9B 4FUIA 4NZLA 1YPGH 5T6GA 5FAHA 1PYTD 4NA7A 3FFGA 4CHAB 3MU0A 3ZZ8A 4CR9A 3TITA 2ZFRH 2Y5FA 1NT1A 2G4TA 5GPIB 4ZHLU 2FO9A 1EB2A 2QY0B 3M35A 4CBNA 3TH2H 5AF9H 3U98H 1G3DA 1O3EA 4D7FA 5J4QA 2FOMB 1HLTH 2IOTA 2GP9B 4UONA 1RFNA 1T8OA 1S81A 1VITG 1SMFE 1W0YH 4NWKA 3GDVA 1C1UH 4Y8ZA 4DT7B 8GCHG 2C8XB 1AE8H 3FAOA 1TA6A 1BTPA 2FODA 1YPMH 1O32A 1GBTA 1GHVH 1TNIA 8LPRA 2PUQH 1S5SA 2I6QA 3GCHB 5CE1A 1P04A 4NA9H 5DP8A 4GPGA 1QL8A 3RU4D 4KTCA 5FBIA 3LGUA 4ABHA 1HYLA 4DIHH 2PGBB 4M7GA 2Y6TA 1Z8IB 1P02A 2SFAA 1DANH 1H9HE 2A5KA 1W7GH 2HLCA 3SUDA 1GBBA 2CV3A 2NU3E 2P8OC 3A7VA 3I78A 5DK1A 1A0JA 1GVKB 3C27B 2ODYB 1F5KU 1GJ7B 4O9VA 1GI4A 2BOKA 1W11U 1CVWH 4B2AA 8KME2 2B0FA 1ETTH 3ATLA 5J4SA 3LPRA 1C1WH 2OINA 1LHEH 2OQ5A 4FVBA 2O8WA 1AZ8A 2PV9B 1E38B 2ZGJA 1ETSH 1XXDA 2VVVA 4NIXA 2A7CA 1GMCF 2G8TA 1ZPZA 1P2QA 3KEEA 3HK6B 1Y5AT 4K8BA 1S84A 4GVUA 1S6FA 5BPEA 1NN6A 2AEIH 1WBGB 1O2MA 3M3SA 1J14A 3CP7A 5EXLA 2JH0D 4I8GA 3D49H 1OPHB 1QBVH 1O3BA 2O8LA 4BAKB 2B8OH 2FP7B 2UWPA 1A5IA 2GGVB 2ZQ1A 3UR6A 4FU7A 4JZDH 3ZYEA 1C2HA 2ZO3H 5GWZA 3RXUA 4GCHG 3M5OA 1C2MA 3LGVA 3SHAH 2Z9JA 1O2KA 1O3CA 2C8ZB 4E06H 3R0FA 3U69H 1C2KA 5EXNA 3RMOH 3NCLA 1XUHA 1EKBB 1C5LH 1O34A 3G01A 1ABIH 2BDCA 1QIXB 1YPLH 1EQ9A 4CBOA 1B0EA 5A0AE 1ZGIA 3E1XB 3P6ZB 1DWEH 3LJJA 1LQEA 4B2CA 3D65E 4XE4A 1T8MA 1MU8B 1TQ7B 1TONA 1B0FA 2Z9KA 3RXLA 3LKWA 4YLUA 2PFEA 1O2WA 4I31A 3JZ1B 2R3UA 1YCPM 1GDNA 1AI8H 1S85A 1ZHRA 2O8TA 2QCYA 3ZZ6A 4CH8B 1YPKH 1GBJA 2TIOA 4UFDH 2G55A 2BTCE 4Z6AH 1RTFB 3BTGE 1VITH 4YTAA 1C2LA 5DP5A 3UOPA 1O3FA 1SPJA 5DP6A 3IITA 4NSVA 1QNJA 2ZU1A 2NU1E 1XUGA 4MPUA 1K1JA 3MYWA 3TGIE 3SUEA 1HJ8A 3NWUA 4JZEH 1EPTA 3OX7U 3S7HB 3PB1E 2Q6GA 1V3XA 1HAVA 1O5GH 1QURH 1T8LA 2OBOA 2ZF0H 1TABE 3DA9B 2THFB 3RXQA 1O5CB 4E7NA 5AFYH 2AGEX 1DE7H 2VIOA 4X8VH 5DP4A 3K2UA 4F4OC 2Q6FA 2A5IA 3QDZB 1CHOF 2V3HH 1TPPA 1ZGVA 1HUTH 3ZVDA 1SGYE 1P01A 3B9FH 1TIOA 1UHBB 2ZDVH 2GV7A 2H2ZA 4Y76A 2BD9A 1HAIH 1CE5A 1UTLM 2B9LA 2A4QA 2B7DH 1BCUH 2ZNKH 1G30B 1P2MA 5L30H 2GX4A 5PTPA 5DG6A 5BRRE 4XDEA 4YT7H 1PPGE 1GMHF 1FXYA 4X2XA 1SHYA 1ZZZA 4WMFA 3SI3H 3M61U 4IBLH 1BTXA 1GHBF 3SJ9A 2ZFTA 3E0PB 1BRUP 2BD8A 1EJAA 1P57B 2HNTE 2YOLA 3A80A 4LK4A 3S9BA 4ABFA 2ILNA 1V2QT 1SFQB 4UEHH 3TJNA 1TPAE 1FJSA 2BVRH 2J2UA 3T25A 1J16A 1OP2A 4BXSA 1QY6A 4WJG2 3TJVA 1T32A 4MPWA 1EB1H 4FUBA 3RC5A 1D3PB 2ZTZA 1GJ8B 4NIVA 2BQWB 1BRBE 1XKBC 3M3TA 3ZZ3A 1Z7KA 4INHA 4BXWA 1SLUB 1HAPH 1EAWA 4TY6A 1H9LB 2SNWA 1ACBE 5JYIA 4X6NA 2TGAA 1DLEA 1W10U 2C4FH 1GBDA 9LPRA 2WUBA 2FI4E 6ESTA 1O2QA 1WV7H 2FYRA 2H9HA 1MU6B 3E16B 1RXPA 4Y6DA 2GCHF 1TRNA 2ZGHA 1WOFA 3QZRA 4RKJB 1O2RA 2QV1A 3KL6A 4NFEA 1NROH 1D3QB 4ABDA 1GJ6A 3M5LA 2BD4A 4ZKSU 3S9AA 2XC5A 1BHXF 4ISLA 4BTTB 3Q76A 2P3FH 1ZOMA 4I33A 4HTCH 2BLOA 5GJ4B 1KXBA 1WSSH 4NCYA 3BEUA 1ZJKA 1NRSH 3QTVH 4IC6A 5G4BA 1AD8H 4AFQA 1FIZA 6LPRA 1T31A 1C2JA 1O3DA 1LVOA 2RDLA 3EA8A 4NSYA 1ZYOA 1ZSKA 2AIPA 3RP2A 3K6YA 1O3OA 4ABEA 4HFPB 3PMAB 1GBCA 2HPQH 2TGPZ 2OD3B 1PPFE 1GL0E 5C1XA 2F9UA 1GDUA 3PM3A 5SGAE 3BN9A 1GBKA 1TE0A 1C9PA 1O2ZA 4CREA 4K8YA 1PJPA 1CA0B 3A83A 4A7IB 1SGIB 5EGMA 3MH5A 1CT2E 2PLXA 3DT0H 4Y0ZE 1ANEA 3ZVCA 1AFQC 1ZRBA 2YNAA 3SO3A 1GDQA 1P2OA 1Y59T 3QO6A 1BB0B 1D3TB 4X2VA 3RU4E 3SNCA 2JETC 3SZNA 4Y7BA 1GI3A 1TGTA 5C1YA 3PV4A 2UWOA 1BBRE 5E2OA 4CRDA 3BTME 1SGEE 1JWTA 2ZKSA 1SOTA 1QCPA 1FNIA 4Y8YA 1BBRK 3L3TA 4FUFA 1ELFA 4H4FA 4CH2B 1ARCA 3MH6A 3RXPA 3O8CA 3TJUA 1WQSA 2CN0H 2WINI 2Z3CA 1W14U 1SSXA 1GHYH 2ZCLP 3P8FA 1C1OA 1TX6A 1W2KH 1FPCH 2O9QA 4IGDA 4NIWA 1BMNH 2TRMA 1EZXC 4ISOA 4IW4E 1P3CA 4X6MA 1BIOA 3W94A 2OP9A 2GDEH 1XX9A 1XM1A 4KP0A 2ANKH 2DUCA 1HAHH 2W3KA 1EP6A 3S0NA 3A84A 1C2IA 4IMQA 3SNBA 5FCRA 2J92A 3SHCH 2A4GA 1RTKA 3E8LA 1Y3UA 1U6QA 4LXBH 1C2GA 5E2PA 4IMZA 4NFFA 4YOGA 1EAUA 3BIVH 4BAHB 1ESAA 2BD2A 3UR9A 4A1XA 1NRRH 3ZZ5A 2VIPA 1ELCA 1QB6A 1UTPA 3PWCA 3RMLH 4AFUA 1MCVA 4J2YB 2XCFA 1GMHG 1O39A 1W0ZU 1QQ4A 5CHAB 4ZAEA 1XKAC 1ID5H 4Q2KA 4YOJA 3STIA 4DVAU 3NXPA 4Y79A 1E35B 1MD8A 4HI3A 4I7YH 1IQEA 4Z0KA 4FU9A 2BDHA 2EI8A 1H8DH 1HXFH 2UWLA 2C90B 1QB9A 2HWLB 2C93B 3F6UH 5A2MH 1EUFA 1C4Y2 1TX7A 2ODPA 4DIIH 1XUKA 5DP7A 3WY8A 3SU3A 1C4U2 3SJIA 1L4DA 1B7XB 1TGBA 1IQIA 2ZPQA 1C1MA 1VGCC 2FTLE 1CT0E 1T4UH 1S6HA 1MZDA 1SQOA 4X1RU 9ESTA 4Y10E 5AFZH 4DW2U 1GG6B 3UWIA 2GV6A 3A85A 1P05A 1BITA 2ZHEH 1LKAA 3KCGH 3UQVA 1XVMA 4A5TS 2Z6BD 2QIQA 1GI7B 1YM0A 2OLGA 3P17H 4OS7A 1V2PT 1CGJE 1DUAA 5LPFA 4E7RG 1HXEH 4DURA 2OXSA 2OC1A 1IHTH 1MQ6A 1SG8B 2FDAA 2VWOA 1SGTA 3LDXH 1A0LA 7GCHF 1JRSA 2GCHG 4ABJA 2YNBA 1JIMA 1DWDH 4KTUA 2PKAA 1ANDA 1W12U 2A0QB 2XBXA 3A7ZA 1SVPA 3MMGA 2BDYA 5ESTE 1DT2A 1TRYA 2XRCA 3GICB 3U9AH 1EZQA 1FAXA 2C8YB 4MNWA 1HAYB 3PO1B 1FZZA 1TNKA 1P10A 5JB9S 1QTFA 3TU7H 2PW8H 4F49A 1LHDH 1HAXB 5HXFA 3BTQE 3QLPH 3SU4A 3SN8A 1O30A 3VXFH 2BVSH 1GGDB 1XXFA 3VGCC 1V2LT 3UWJH 3U8RH 4BAOB 1FLEE 4U01A 2PTNA 2AH4X 1DWBH 2PKSC 1AQ7A 3RMNH 3LGYA 1C5QA 1O2JA 1UTNA 1SR5C 2SGQE 3BSQA 1G3BA 1O38A 3QTOH 1ANBA 1Y5UT 4WMDA 1FPHH 1OWIA 2QGRA 2A4OA 1QA0A 1QBNA 2XBWA 1ZRKA 5K0HA 1KLJH 4GUXA 2R9PA 1RD3B 3ZZAA 3QK1A 5C2ZA 1FY4A 1V2VT 2H1UA 4KTSA 2STAE 3EAJA 3MNSA 3E90B 1CO7E 1O2SA 1C1RA 1A3BH 2WPJS 2EC9H 3ZYDA 1V2UT 1F0SA 1H8IH 4PROA 3PLPA 3F9GA 1HIAB 1Y3VA 3K9XB 1C1SA 3K6ZA 2OCVB 4ISNA 1FUJA 4D76A 1HFDA 2P59A 2H5DA 1QJ7B 1NRPH 2D1JA 1K1LA 3BTEE 1A5HA 1ANCA 1EPTC 3A86A 5FX6A 3RXDA 1GI1A 1SGQE 1ELAA 4I32A 4JK5A 1DICA 3A8DA 3A88A 2OUAA 1KYNA 1THSH 4ISHH 3ZVFA 3P92A 5E8EH 2ZHFH 1V2TT 1JOUB 5DJ7A 1BQYA 3NPSA 2Y5HA 2ZFPH 3EA9A 1ZHPA 3FANA 3RDZA 1QGFA 1MCTA 2BQ7B 1VZQH 1FY5A 1P2KA 2SGPE 2BOHB 1LVMA 1P06A 4XBCA 3KNXA 2SGDE 1Z8RA 3A8AA 1TNGA 1P03A 3O8BA 2DE8A 2HNTC 3QN7A 4WH8A 1A3EH 1HPGA 1DWCH 2CHAC 1FN8A 1AKSB 2BB4A 1YC0A 3SW2B 3RXMA 1L0ZA 3RXFA 1SQTA 1ZPBA 1F0RA 1LKBA 2ESTE 1QRZA 1NFWA 1NM6A 2FOFA 2Z7FE 2ZDMA 3S7KB 1HAVB 1P2IA 2FOBA 3BTKE 1F0UA 1LPGB 1O5DH 1UTKA 2AGIX 2P3TB 3OU0A 1A7SA 2UUYA 4ZHAA 2P8OB 1SGDE 3P95A 1YPHE 1OWJA 2FMJA 3ZV9A 3AW1A 2AMDA 1SGCA 1ZR0A 3BF6H 5C5NA 4FXGH 1YCPK 4CR5A 1Y3WA 2PTCE 4A92A 3V3MA 1NRNH 4AN7A 5DPAA 1L2EA 2QYIA 3MNXA 3UTUH 4MPVA 2VIQA 3ZZCA 1MMJN 1G3CA 3RXIA 1GCTC 1O33A 1WUNH 1DM4B 4X8SH 4YZUA 3PLBA 3TK6A 1AHTH 1K22H 3ZVEA 3KGPA 4K5ZA 3MFJA 4AYVB 3AAVA 4Y0YE 3SUGA 3ZVGA 4OGYA 3SNDA 2F9OA 2ZGCA 4Y71A 1E0FD 1JRTA 1TPOA 1TLDA 1OOKB 3MU5A 2VGCC 1AMHA 1VCPA 1WTHD 1TMTH 1OKXA 2FESH 1AVGH 3M5NA 1PYTC 1SI5H 1N8OC 2HPPH 2VIDA 4K3JA 4OS5A 3BEFB 2STBE 5HM2A 4IN1A 2BLQA 2VH6A 1O3PB 4BNRA 1F5RA 1FQ3A 2PHBA 2R0KA 2VWMA 3MI4A 4WY3A 1P0SH 2BMGB 3UNSA 6GCHF 1GL1A 1A5GH 1YLDA 3DHKH 1LHFH 3KQEA 4XBBA 1V2RT 2H5CA 5HGGA 2FLBH 1C5TA 2BY6X 1IQHA 4ABGA 1INCA 1YPJH 1MBQA 2BX3A 1MTNC 1C5RA 4OS4A 3ELAH 4O3UA 2GCTC 2Q6DA 1L1GA 1C5NH 1D6WA 4DOQA 2PR3A 4JYTA 3BTFE 5LPEA 1KLIH 2WPMS 1TQ0B 3MO6A 3HATH 1ELBA 1DS2E 2Y7ZA 1C5VA 1W8BH 3Q77A 1AVWA 4DJZB 5C5OA 2A31A 2WV4A 1UCYE 5FPYA 2W7UA 3ODDA 4D8NA 3ITIA 2QXJA 1ELGA 4HZHA 1TMUH 1AZZA 2BDGA 1UCYK 1EATA 2GVFA 4ZROA 4INLA 1C1PA 1NU7B 1F7ZA 5FPSA 2ZHQH 1D3DB 3QWCH 1J8AA 1PFXC 1GHAF 1MZAA 2WYJA 2BXTH 1LCYA 1P11E 3TGJE 1C4V2 1MTSA 5CMXH 1TWXB 1QBOA 1GBLA 2JH6D 4MLFB 2FX6A 1QL9A 5GDSH 1Y3YA 5C20A 3M3VA 3RXTA 1GHZA 3HGPA 1O2HA 1SLXB 1OXGA 2UUFB 2FX4A 4KELA 1BTYA 2BZ6H 7KMEH 1O3NA 3RXRA 1PPHE 1QHRB 3OY5U 2FOCA 3TPIZ 5A09A 1GJ4H 1EASA 3Q3XA 4OS6A 5FHTA 1YF4A 3HKIB 3SJKA 1WU1A 1KSNA 2AFQB 3MTYA 1Z8GA 3EE0B 1O2PA 5EW2H 3SNEA 3AW0A 2H9EH 2ZTYA 3TK9A 3LIWA 3KHVA 3SU5A 4AB8A 2KAIB 3BG4C 4X1NU 1Z8JB 4X1SU 2H6MA 1O2OA 1K2I1 2C3SA 2F83A 1HJAC 2Y81A 1EJNA 5ETXA 3L33A 2CXVA 1VCQA 1GMCG 2XYAA 3DUXH 4QT8C 4CRCA 2XW9A 2ZCHP 3MU1A 1YLCA 2Q1JA 2A2QH 1Y5BT 5ABWA 1O3GA 1ABJH 1GI6A 4WH6A 1TGCA 3H5CB 1T4VH 1IQMA 2VJ1A 1E37B 1IQKA 3M7UA 1TALA 4DY7B 2A4RA 4AGKA 3H7OA 1O5FH 1KDQB 5LGOA 4MQAA 4U30A 4ISIH 3GCTF 1KIGH 4JZ1A 5IYTA 1K1IA 4H6SB