1GBIA

Alpha-lytic protease with met 190 replaced by ala and gly 216 replaced by leu complex with methoxysuccinyl-ala-ala-pro-phenylalanine boronic acid
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
198
structure length
198
Chain Sequence
b'ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGLNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbiA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbiA01
1TAWA 3PV4A 1DDJA 3SJIA 1T7CA 3QLPH 3VPKA 1MKXH 2QXJA 2XCFA 2P3TB 3LDXH 1ELFA 4AB8A 2ZHWH 2ZU3A 2JETB 1O2VA 3SJ8A 4AFZA 4YOJA 1A4WH 1AKSA 5L2ZH 4I31A 1PPZA 1AO5A 3M5LA 1GJCB 2WYGA 1HAZB 1ZMNA 3E0PB 4AX9H 4ASHA 1AI8H 5HM2A 1OP0A 1UVUH 5TCAA 2ZC9H 2ZFSA 1MQ6A 3O8BA 1ZSLA 1C2EA 2JH6D 3GY6A 2VU8E 2ANKH 2AGGX 1S0QA 1E0FD 4X1RU 4CRBA 3QZQA 1BJUA 1W7XH 2G51A 2BX4A 1HDTH 4O9VA 2P95A 1C9TA 3TLOA 1H8DH 1FN6A 3TITA 5LPFA 1VITF 1HGTH 5DPAA 3FFGA 3SZNA 1PQ7A 1JMOH 1P0SH 2BD8A 1GBMA 4YT7H 1S0RA 1OPHB 3F9HA 4NSVA 4KTSA 3TU7H 3UWIA 5JBCS 3DUXH 3A85A 1SGEE 2GTBA 3SOSA 1C2FA 3H7OA 4O3UA 2VVUA 1J14A 1E34B 3RXQA 4DIIH 2WINI 3U1JB 1MTSA 3UY9A 4Z6AH 2AS9A 4HI3A 4B74A 3RXDA 2A2XH 4K1SA 2FOHA 1EPTA 2BLOA 5F8ZA 1BOQA 2QCYA 1E35B 4Y7AA 3RXOA 3MTYA 2C8WB 4CR5A 1C5NH 2O8TA 2P8OC 1MTNC 4MNXA 3GY4A 1WUNH 4E05H 3QK1A 3GICB 3PMBB 2FMJA 3GY2A 1TNIA 3HATH 1SBWA 3LJJA 1EASA 2VINA 1GI8B 1VJ9U 2OP9A 2AGEX 2FP7B 1YPHE 4CRDA 2H5DA 1HXFH 3V0XA 3UNRA 1LVBA 1GBTA 1IHTH 2V0BA 1ZTKA 1ZRBA 2ZI2H 1SGQE 2Q6FA 1SGTA 4BAKB 3BF6H 4IBLH 3A8DA 2VVCA 1TABE 2ZU2A 4MDSA 1BMLA 2W7UA 1NROH 4RSPA 1BRBE 3QWCH 5BRRE 1SGFA 1JOUB 2GKVE 1GI9B 1QA7A 3BEFB 2ZF0H 2J2UA 1EZSC 2QV1A 4B73A 5EQSA 1D3QB 4ABFA 4GCHF 3KHVA 1KLJH 1UO6A 1F5RA 2H9TH 4FUHA 3PYHA 2J95A 2EI7A 1FY5A 3A7TA 1O2OA 1ZPZA 3GDVA 3M5OA 1VJAU 3GYMA 4SGBE 1ELCA 3SW2B 1DSUA 1QCPA 4X8SH 5DK1A 2ZCLP 3G01A 4MQAA 3MFJA 2M5TA 1O2IA 1GDNA 1QBVH 4WH6A 1B0FA 1O3KA 2CHAC 3RXTA 1AVXA 5E2PA 1C1RA 1FPHH 1SQTA 2OUAA 4TYDA 2XC4A 2ZEBA 1BUIA 1MZDA 3LGTA 1HAVB 3S7HB 4GUXA 4UFGH 5FCKA 1EQ9A 1P2IA 3O8CA 3CS0A 3KF2A 3LOXA 1MU6B 3SU5A 3VEQB 1L4DA 1TGSZ 3VXEH 1BDAA 1MKWH 2Z9JA 4FUCA 2D2DA 4CRFA 1Z71A 1KLIH 1MU8B 4PROA 4QT8C 4IS5A 1EB2A 1AN1E 3SU1A 1GBCA 2G5NA 5FCRA 2PGQB 1JIMA 4DW2U 2BX3A 2BLQA 5B6OA 1MD7A 3P8NA 1LHCH 2BLVA 1O3DA 2WUCA 3A89A 1WBGB 4B75A 5FPTA 3PM3A 3T2NA 2PTCE 2A0QB 3SV8A 4RN6A 3L3TA 1Y3YA 3GYLB 1Y3UA 1O2SA 1LCYA 3TJUA 3PTNA 1GL0E 2UWOA 5C5OA 2HLCA 2HNTE 3ZV9A 2GVFA 1O3IA 1GHBG 4WMFA 2AGIX 4YO9A 2NU4E 5GCHF 1CQQA 1UVSH 4UFFH 2WUBA 4FUJA 1C5MD 3FANA 2A5IA 1MAXA 1SI5H 4E7NA 3ZZ4A 1BRAA 1W2KH 1AMHA 1FMGA 1SSXA 1A0LA 4XBCA 4CH2B 3I77A 3MI4A 6LPRA 1QHRB 1ZHRA 3RXEA 1C1MA 1ABJH 2BD9A 3ZZ7A 2FOMB 3PLPA 2OC8A 1SVPA 1ZZZA 5T6FA 1ZJKA 2PLXA 2PKSB 1O2WA 3ATKA 5FPYA 3BG4B 1AKSB 4CHAC 1O2TA 1P2NA 5EU8A 3AW0A 2H5CA 1F7ZA 1Z8GA 3A7YA 5A0AE 1N6YA 8ESTE 4NIYA 4VGCB 3SUEA 1CT4E 3S9AA 1HNEE 1V2TT 5F8XA 1MBQA 1BJVA 4K1TA 1EOLA 2TGTA 1SB1H 3SO3A 1GI4A 2WV5A 1FY8E 4NWLA 4OS5A 2VGCB 4WWYA 2ZG0H 4DOQA 1J9CH 1YCPH 4FVDA 1GVKB 4I33A 1YPJH 1AZZA 1GCDA 3OTJE 3UTUH 2G4UA 1NO9H 1HJAB 1OWEA 1OX1A 3S9CA 3URDA 1Z7KA 5E8EH 1PPHE 1TX6A 2V35A 3KGPA 4I8LA 4D7FA 2PW8H 1OSSA 1F5LA 2Y7ZA 1KTTB 1UTPA 4NCYA 2V3OH 1QB6A 5LGOA 1L1GA 3ZVFA 2BXUH 4I7YH 1OP2A 1T8MA 1ZR0A 1P3EA 2ZP0H 1X7AC 3SNEA 1GBIA 3A8CA 4MNVA 4O03A 2B0FA 1FZZA 1UHBA 3P70B 2BHGA 3SUGA 2ZTYA 3H7TA 4X8UH 3KNXA 1AVGH 1C5VA 4YM9A 2VWOA 3RXKA 1GJ7B 1UK4A 3FZZA 3ELAH 1EPTB 1WOFA 1O5AB 4DCDA 1GVZA 1MKXK 4JMYA 2IOTA 4X1SU 1VGCC 4XSKU 3K9XB 3NK8A 5C1XA 1BTYA 2G81E 2V3HH 1AVWA 2EC9H 1O39A 4HFPB 4BTIB 4X2YA 1QBNA 2ZHFH 2FPZA 3UUZA 3SN8A 5EXNA 1C4Y2 2XBYA 1GHYH 3KL6A 2B7DH 2PHBA 4Y8ZA 3BIUH 3ZYEA 1O36A 5C1YA 3HKIB 5HYOA 1NTPA 1BT7A 3D65E 5CMXH 4TPIZ 1EOJA 2BY7X 2Z9GA 3RXAA 2OC0A 1K22H 1RTKA 2SGEE 1DY9A 1O2PA 1MCTA 4X1QU 3V3MA 3BTHE 3SV6A 2LNCA 4TWWA 3MMGA 3BSQA 2WPKS 1ZHMA 1FUJA 3TGIE 1HYLA 3UQVA 1TMUH 1TBRH 1TPAE 3GDUA 4UD9H 1T4VH 1O37A 3F68H 1GJ5H 1TGNA 2XC5A 2BDAA 7ESTE 1K2I1 3L33A 1EP6A 3VB7A 8LPRA 1GI7B 1KXFA 1SGCA 3A7ZA 1UK2A 3HKJB 1G2MA 1FDPA 1FQ3A 1EP5A 3MU4A 1TNKA 3FZDA 1P01A 1YPHC 2Z3EA 2BOKA 4X6OA 9LPRA 1BQYA 3A87A 2ZWLH 2WYJA 3IITA 2G5VA 1ESAA 1L1NA 2CN0H 2AIPA 1A5GH 4ISHH 2WPMS 4MPUA 3NXPA 4Q80A 2ZZUH 4INHA 1NFXA 1QGFA 1OXGA 1TMTH 1NT1A 1C5PA 3GOVB 4DY7B 1BTXA 1QJ7B 4XOJA 4MNYA 1BTHH 3KQDA 1BBRE 1O3PB 4ABBA 5CE1A 1BRCE 5DP4A 1KXEA 2QXGA 1SL3A 2PSXA 2ZIQH 5IDKA 1GI3A 4YLQH 1WTHD 1YLDA 5F03A 3AASA 2P93A 1QNJA 3EGKH 4FUBA 1MTVA 1IHSH 2J4IA 1JWTA 3ZVDA 1DSTA 1GG6C 2VIWA 4O3TA 3SV2H 2BLWA 3LC5A 1DICA 3PLKA 2FX4A 1J15A 1N8OB 1D3TB 3SI3H 1F0TA 1LQEA 1GCTB 3A83A 2XNIA 5ESTE 3FVFB 3LONA 3RM0H 3WY8A 1SGDE 2XBXA 1W3CA 3RXBA 1D6RA 1SC8U 4U2WA 4AFSA 2BDGA 2FEQH 2F9VA 4CR9A 2BDIA 2ULLA 1TFXA 1GMHG 1FY1A 1B7XB 1HAIH 2A2QH 2G55A 3FP8E 1XVMA 3P17H 3RP2A 2ZDLA 4WVPE 3ZVEA 4GVUA 1XVOA 3T62A 1AFEH 3AVZA 1Q3XA 1WSSH 5EXLA 3TH3H 1TNHA 3EYDA 1CVWH 1TGTA 3F1SB 3KQEA 4XBDA 3VGCB 2H2ZA 1AB9B 5K0HA 1O38A 4FUGA 1SGRE 1SPJA 3MH4A 1CE5A 3D23A 1QY6A 3LGWA 1V2NT 3RDZA 4BXSA 3P8OA 2Y80A 1L0ZA 1GBJA 2J38A 2GT7A 2IPHA 1XXDA 1MKWK 2HNTC 1YLCA 3QUMP 3ATWA 1KXBA 4MPWA 5DP7A 5L2YH 4MTBA 1GMCG 4X1PU 1RTLA 5C3NA 2YNAA 3PTBA 1O2NA 1GJ8B 1QIXB 2OQ5A 4MPVA 2GCTB 1QQUA 3STIA 2ZA5A 1O3EA 1TE0A 3BEIB 2QIQA 4KELA 2GD4B 3BTKE 3RXIA 1O31A 1SLXB 2F83A 2GCHG 3U8OH 1F0SA 4Y79A 1O2JA 1ZHPA 4H6TA 1V2MT 1XUJA 1M9UA 3SUFA 2BZ6H 4AZ2B 1NESE 1PYTD 4LZ4B 5A0CA 3A8BA 1NU7B 1GHWH 1ZSJA 2BY5X 1UHBB 2BMGB 4FUFA 4BAOB 1G36A 1IQFA 4ZAEA 2GZ7A 1KLTA 2BY8X 3LH3A 5E2OA 3U1IB 4IC5A 1IQKA 4FXGH 1D3PB 3NKKA 1CGHA 1GHBF 5AFZH 1JBUH 2H9EH 3UIRA 1FY3A 3EA8A 1PQ8A 3ZZAA 2ZKSA 1EX3A 1LPGB 2SNWA 5EODA 3TK9A 1HCGA 3CENA 3FAOA 3RU4E 3BG8A 4NA8A 4FU7A 1C5TA 1AGJA 3LT3A 5F6MA 1RS0A 1CBWB 2FIRH 3T26A 1TPOA 5AHGH 1OWJA 4TY6A 2J92A 1BTZA 3EE0B 3VXFH 2ZDMA 3HPTB 2Y6TA 1ORFA 3MU0A 3NCLA 2ZFFH 3PWCA 2OC1A 3TVJB 1HFDA 2OD3B 3ZZ5A 1GHVH 2HWLB 2ZGJA 2R2WU 1P12E 3HK3B 3QDZB 1AFQC 1UTJA 1YCPK 1ACBE 1O5CB 1O3FA 4WF8A 3BTFE 4K69A 2GGVB 7GCHG 1O30A 3TNSA 4Y10E 5E0GA 4BOHA 2UWLA 1NRNH 4GHTA 4OGXA 3KEEA 3LGUA 1QFKH 4XBBA 1V3XA 1OYTH 1GGDB 3SGAE 3KQBA 1DXWA 1YPGH 1N6XA 1UCYE 1WU1A 3M7QA 3LGYA 1TA6A 1SGNE 3MNXA 1V2UT 1C5SA 1LHEH 4ZKRU 3QX5H 2DUCA 2R0LA 5EQRA 2C8YB 6CHAB 3Q3XA 4X2XA 1TALA 5C67A 4B71A 1W7GH 2BY9X 1O2ZA 1XKAC 2QGRA 1KIGH 3F6UH 4UDWH 1SOZA 2JH0D 4ISIH 3UQOA 1DWBH 4BTUB 2VIQA 1WV7H 2BXTH 2TGAA 1PYTC 5JB9S 3P92A 1SFQB 1V2VT 3U98H 1V6DA 4AB9A 2C90B 5C20A 3DFJA 2FOGA 2FOEA 3RLWH 1OP8A 2A32A 1P2OA 1PPGE 4ABAA 5EXMA 2BQ7B 2A5KA 1TONA 5FXLA 3O8DA 4F49A 5T3HA 2ZGCA 3LIWA 1IQNA 4UFEH 3VB5A 5I46H 1NRRH 4CBNA 3RXFA 2P3UB 1BIOA 5AFYH 1BCUH 3SQHE 4M7GA 3SNCA 4MPXA 1F92A 5FBEA 1ZGVA 2FS8A 1O3GA 1ZTLA 3SGBE 3NZIA 3D49H 1C2DA 1A2CH 3LKWA 3ZZBA 1TBQH 3SBKA 1INCA 2UWPA 4ISNA 2OCVB 3ZVAA 1FIWA 3RXVA 4D9QA 5A8YA 2XXLA 1Y5BT 4ESTE 5HXFA 1ZJDA 2QF0A 3E91A 3RXUA 1FONA 1GI0A 3I78A 1XUHA 3M3TA 1G3BA 2BVSH 3O8RA 1A5HA 1A7SA 4H42U 1WQSA 2AIQA 4BAQB 3JZ1B 1NY22 1SFIA 2A31A 3QGNB 1P2KA 1Z8RA 1ELGA 2B8OH 4K2YA 4ZKSU 1C2IA 3S7KB 2R9PA 2UUJB 3Q76A 1HV7A 1H9LB 2P8OB 1MTNB 1XM1A 4XE4A 1P3CA 1NU9A 1MAYA 3URCA 2RA3A 4ISOA 1C2LA 4BANB 1MQ5A 3MH6A 1HAYB 1Y3VA 2ZFTA 3E3TA 2Y81A 1AE8H 3Q3KA 2VH0A 2BVRH 2QAAA 1S82A 4LXBH 1ZTJA 2ZO3H 2TBSA 1Y59T 3S0NA 1FAKH 1FPCH 2FXRA 2Y5FA 1DOJA 2ZDVH 1ZYOA 4I8GA 1C5XB 2WPHS 1GL1A 3GY5A 4Y8XA 4Y11E 3A7WA 1VCQA 1H4WA 3MNCA 5ESBA 5JBAS 1GMDG 3OSYA 1QA0A 2G4TA 4DG4A 1THSH 3PB1E 4WJG2 1NN6A 1RD3B 1YF4A 2GMTC 5CHAC 1LVYA 2OXSA 1O3LA 2ZDKA 4FUIA 2XBVA 1FNIA 2VWLA 4DVAU 1CO7E 4GAWA 4RKOB 1OOKB 1DWCH 2XBWA 1O3MA 1SGPE 2SGDE 2GDEH 1P02A 4FU8A 4ZUHA 3EA9A 1GBHA 5FX5A 3ATMA 1ELEE 1WYKA 1QRXA 1TIOA 2Q6GA 5HM9A 1P2MA 1E36B 1OKXA 2TGPZ 4CRGA 2CHAB 3GCHC 1DWEH 2Y5GA 2ZCHP 1GMHF 3SUDA 1ZPCA 2Z9LA 1P04A 3U8RH 1K9OE 4ABDA 1K1PA 4ABJA 2FOFA 3C1KA 1NPMA 1NFWA 4H4FA 1UTMA 1MTUA 2GV6A 1CA0C 1LTOA 1C1VH 5GWZA 5LPRA 4ZMAH 1FAXA 3PO1C 3TJOA 2ESTE 4A1XA 4ABEA 4OS2A 4AGJA 3RMMH 2A7JA 2VIDA 3BTEE 5C5NA 1TLDA 5L6NH 2W3IA 4Y0YE 4X8VH 2YNBA 3MO9A 1CHGA 5GDSH 3VB4A 5DP9A 3ATLA 5GIBA 2PV9B 5T6DA 1DLKB 2G8TA 3LU9B 3M35A 1YPKH 1A5IA 1BHXF 3DD2H 4HZHA 1UTKA 1DE7H 4F4OC 1RXPA 1W14U 3UOPA 3RMOH 5A8ZA 3IG6B 1SGYE 1C5RA 3SU2A 1CT0E 2Q6DA 1F0UA 1YC0A 1VITH 2GCHF 1ZMJA 3M37A 1C1PA 5EOKA 2PFEA 1TNLA 4IN1A 3MNSA 4Q2KA 1LQDB 1S84A 1WCZA 4A92A 1PFXC 4X6NA 4K1EA 3STJA 1HLTH 3HGNA 3I29A 1TA2A 2THFB 4CH8B 3SV7A 4D8NA 3A82A 4Y71A 3Q3YA 1TNJA 1KTSB 1ZLRA 3TH4H 1O33A 1YPLH 2W26A 1G37A 2FS9A 3Q77A 3PROA 1LVMA 3RLYH 1EJMA 2G52A 4CHAB 5F8TA 3TJVA 4I8HA 1Z6JH 2FOAA 2GX4A 1ZGIA 1C5OH 1YCPM 1ELDE 1G3DA 2FZZA 4I32A 1UMAH 4UONA 2F91A 1IQIA 3MNBA 5FAHA 3MH7A 1C5ZB 3SNBA 1H9IE 4X6MA 2Y5HA 1GBFA 8KME2 3N7OA 1BZXE 1IAUA 1C5UA 1D4PB 1BB0B 3F9EA 1O0DH 4MG3A 2ZHEH 1GJ4H 2QC2A 2FI3E 1BBRH 3PLBA 4LZ1H 1E37B 1BMAA 2XWAA 2OLGA 1QJ1B 2P59A 4YZUA 2YOLA 1EAIA 2SGAA 3UPEA 1C1OA 2PR3A 2OC7A 1EJNA 2QN5T 7GCHF 2HALA 1K1LA 4R8TB 1MZAA 1Q2WA 1VCPA 2EEKA 1G30B 1UTQA 1T8OA 4MLFB 4JCNA 1TPSA 2P3FH 4K60A 2ALVA 1O2KA 3AAUA 2C8ZB 8GCHG 1BITA 1C1WH 3T5FH 3R3GB 4Y6DA 3AAVA 1FIZA 5IYTA 3KQCA 5DG6A 5FPSA 3GY3A 3AW1A 2FLBH 1DY8A 4JYTA 3TIUA 4H6SB 1GBEA 1J8AA 2F9PA 1LMWB 2BZAA 4X0WU 1EB1H 3VFEA 3H5CB 2ANMH 4DT7B 1VGCB 4HTCH 1G32B 1ZRKA 1W12U 1ANEA 3Q00A 2G00A 3QN7A 9ESTA 3SI4H 2BOHB 2ZFPH 2ZECA 2J94A 2A45B 1U6QA 1RIWC 2AH4X 2IN2A 3SHCH 4DURA 1DITH 2AMQA 1O2YA 4B1TA 1KXDA 3GY8A 4WMEA 1EATA 1O34A 2XC0A 3ZV8A 4CRCA 3BTTE 3EAJA 2BQ6B 1VCWA 3IWMA 3LPRA 4KKDA 1BHXB 1YYY1 2C4FH 4A1VA 1AY6H 2SGPE 2Y82A 4WXVA 5JBTA 2WPLS 4E7RG 2A4OA 4IMZA 1AWHB 1Z1IA 1TX7A 4MVNA 4AN7A 1O2XA 2ZCKP 1NFYA 3TNTA 4BXWA 2QYIA 2ZQ2A 1XXFA 1O5GH 1HAGE 1BRUP 2P16A 2SGFE 1DT2A 3RXCA 1TBZH 1XUKA 1QB9A 2AYWA 5EPNA 2XRCA 1V2LT 2H9HA 3SJ9A 3MYWA 1KXCA 4U32A 3RXPA 2CMYA 1DFPA 4X6PA 4XDEA 2JETC 1PPFE 4AFUA 1YM0A 3ZVCA 1D3DB 3BEUA 1IQEA 4YLUA 2FO9A 5DGJA 1FY4A 1NM6A 3SJOA 2A7HA 3V12A 3ZVBA 5GXPA 3RXGA 2RG3A 2BB4A 1MD8A 4JZFH 2CXVA 1DANH 3E16B 3DFLA 4KTCA 1IQHA 1LDTT 1ETRH 3JZ2B 1Y8TA 1TRMA 5HGGA 5JB8S 5A2MH 1DXPA 2K1QA 1EXFA 1HXEH 5EG4A 4FU9A 4JYUH 2EI6A 2NU0E 4IN2A 1C1SA 4ZHMU 4K5ZA 3MO6A 2F9UA 3T25A 1ESBA 1TMBH 3GCTG 5FHTA 1O5FH 4FUDA 1THRH 1C1TA 1ANBA 1DUEA 3SHAH 5AF9H 4BAMB 1A3EH 4IMQA 1IQJA 1GI5A 1DVAH 1F2SE 3TK6A 3ZZDA 1HJ9A 3M3SA 2P94A 2FYQA 3QTVH 2HOBA 1BMMH 2AERH 1KDQA 4X1NU 1THPB 3BIVH 1G3EA 1SOTA 1EAUA 2D26C 1W11U 4UE7H 3MO3A 5FX6A 2W3KA 2PKAA 4KP0A 3SNAA 1MBMA 1CGJE 1GG6B 2JH5D 2FOCA 4KTUA 2QF3A 2I6SA 1GMDF 1XKBC 1W0ZU 2H6MA 3OX7U 2PWXA 3P8GA 3T29A 1TPPA 2RA0A 6GCHG 2VNTA 3KN2A 3ZZ9A 2GT8A 2F9OA 3M7TA 4D9RA 1YPMH 1UCYH 4ZXYH 3ZVGA 3CS7A 3RXSA 1C5QA 1PPBH 2GDDA 1CA8B 1O3JA 2QXIA 1GDQA 3LC3A 1TRYA 1LO6A 4JZEH 1F5KU 1ABIH 5EW2H 3UREA 1TRNA 4GLYA 3U69H 4AFQA 1QL7A 3ATIA 3BTWE 1IQLA 2BQWB 3SU4A 1XUFA 1XUGA 4X8TH 1OWDA 2LPRA 3SJKA 1LPKB 4J2YB 2HPQH 1Y3XA 1GHAG 1PQ5A 1T8NA 3BV9B 2C93B 4GPGA 2BD5A 4X2VA 4Q7ZA 1QR3E 3MU8A 1BMNH 1L4ZA 7LPRA 1Q31A 2ANWA 3OU0A 1P9UA 3QZRA 1C2HA 3SU0A 1SGIB 4A6LA 1GI6A 2ZTXA 1AUTC 1SLWB 3E0NB 3E8LA 5DP3A 3ZZCA 1OWIA 1J17T 2HRVA 1C2GA 1HBTH 3UFAA 1O2QA 1ELBA 1JRSA 1P09A 5DJ7A 5HMAA 2O8LA 1QQ4A 2BDBA 2XWBI 4AGKA 2BVXH 2OINA 2UUFB 3SGQE 3TGJE 1LKAA 1PPEE 2F9NA 4B76A 4A7IB 1V2QT 3K6ZA 1ANDA 1P05A 1W8BH 4ZHLU 4NIWA 3RXMA 1XMNB 2WV4A 4NWKA 2CF9H 1EUFA 1AD8H 3F9FA 2I6QA 2OBQA 5A8XA 3NWUA 1B0EA 1Z6EA 2PTNA 5FBIA 1EJAA 5JYIA 1C5WB 5GJ4B 1A3BH 1AE5A 4JZIA 1O3BA 2CV3A 3U8TH 1FV9A 1T31A 1GHXH 5GPIB 1UVPA 4ZROA 4JZDH 4TPYA 5A0BA 1KSNA 4U01A 3M5MA 3ZYDA 4GSOA 1SLVB 4MNWA 1OYQA 1VZQH 1OWHA 1UK3A 1O5EH 3MU1A 3PMJA 4IC6A 5BPEA 1ZOMA 1AWFH 3S9BA 2O9QA 2UUKB 3M5NA 2ILNA 1DM4B 3FP7E 3ENSB 2JKHA 4B2BA 1ZMLA 2NU1E 5LH8A 1GJ6A 3SQEE 1BTWA 3P6ZB 2HGTH 2R2MB 1AFQB 1P03A 1SR5C 4K3JA 1ZPBA 3A7XA 5EW1H 5E0JA 2BD3A 2D1JA 2TGDA 4E06H 2NU2E 3EQ0H 1Y3WA 1BBRK 4GHQA 1QTFA 1ID5H 1GI2A 1LPZB 3BTGE 1SQAA 1ELAA 3MOCA 1O5DH 1YPEH 1HUTH 3SORA 4D7GA 1NFUA 1C5LH 3RXHA 1GBDA 2BDYA 2FM2A 3E1XB 4NSYA 3TGKE 4LK4A 2FI4E 1MUEB 2FESH 2PKSC 2DE9A 1EZQA 2BD7A 1P57B 2NU3E 3BG4C 1Z1JA 5A09A 2F3CE 5EGMA 1RRKA 4VGCC 2AEIH 4CREA 4OGYA 2VIVA 3EA7A 2FLRH 4UEHH 1TOCB 2B9LA 5J4SA 4Y0ZE 2ZU1A 4R0IA 3TPIZ 1GHZA 1AZ8A 2Z9IA 8GCHF 1DUAA 1O3AA 1OWKA 3GCOA 1H9HE 3TK5A 2GV7A 1NZQH 3D62A 1QURH 2VGCC 1CHOG 3M61U 1BA8B 1P8VC 1TX8A 2ODYB 1AUJA 3A88A 5C2ZA 4JYVH 1C5YB 4DJZB 3B9FH 1NRQH 2F9BH 1GJDB 1HJAC 2ZGBH 2ZPQA 1DLEA 2HPPH 1T8LA 1GBKA 3L6PA 3RU4D 5J4QA 2FTLE 4UFDH 1GBLA 4K8BA 3V7TA 3KIDU 4Y8YA 2BYAX 2FODA 1WAYB 1O2GH 5DO4H 1PQAA 1Y5UT 2BDHA 1PJPA 1GDUA 3TH2H 3GDSA 1S5SA 3OY6U 1K1MA 1KDQB 2VIOA 2Z3CA 2ZDAH 3A8AA 4ZKOU 3DT0H 1O2RA 4AG2A 1FXYA 1DX5M 5SGAE 1RFNA 2D8WA 2PKAB 3VB3A 3VB6A 1QRWA 1LHGH 1GJ9B 2RDLA 1UTNA 1NRPH 1G9IE 2BD2A 3QGJA 4ISLA 2A4QA 1IQMA 1AHTH 3GISB 1RTFB 1QJ6B 1GBAA 1O2HA 1HIAA 1XUIA 4IW4E 4B2CA 4ZHAA 1O2MA 3RMLH 3GCNA 1B5GH 1EPTC 3M7UA 3E6PH 3UWJH 1LHFH 1A0HB 1HPGA 4D76A 2XW9A 2C8XB 2VB0A 5E0HA 2FTMA 3A7VA 3RC5A 1FLEE 2DE8A 1UTLM 4LOYH 1AIXH 2OBOA 3ZZ3A 1T4UH 1QL9A 3R0FA 1FI8A 1PPCE 3BTDE 2ZFRH 4JK5A 1S6FA 2PUXB 3A80A 2A1DB 1GPZA 4OS1A 1KYNA 2ZGXH 3BTME 2IJOB 1C4V2 1Z8IB 1VITG 1QB1A 4ABHA 2QY0B 1NS3A 5PTPA 2O8MA 2Z94A 3QO6A 1YKTA 3FP6E 4WY3A 1P9SA 2SFAA 4INLA 2XTTB 1UVOA 1MMJN 3MU5A 2TIOA 3RXJA 1DPOA 2KAIA 4AOQA 1HRTH 1S83A 1ESTA 1TNGA 3RC4A 5C1UA 2XCNA 1V2RT 2ZQ1A 4OS4A 1GMCF 3GCTF 2H1UA 3ZZ8A 5K7RA 1YP9A 3F9GA 2ZHQH 6ESTA 1RGQA 3NUMA 2A5AA 1AU8A 4X2WA 1V2KT 4WH8A 4Y7BA 2GMTB 5CHAB 2TPIZ 1DWDH 1CSOE 3A84A 2UUYA 5ABWA 2PUQH 4TWYA 5DKMA 4AYYB 1A46H 1L1JA 1CT2E 1HAHH 4YOGA 1UJ1A 1O3NA 3B23B 1GWAA 2Y7XA 1QL8A 1V2OT 1YGCH 2ANYA 2R0KA 3ODDA 4BTTB 4Z0KA 4O97A 1EAWA 4J1YA 1MCVA 2GZ8A 2VVVA 3T28A 5I25A 4IGDA 2QXHA 2VWNA 1BTPA 1WTGH 2STBE 3PWBA 1C1UH 3RC6A 1TWXB 2BTCE 1ELVA 1C4U2 3T27A 2VWMA 5H4IB 3E90B 1W10U 1WQVH 2PGBB 6GCHF 1GVLA 1SMFE 2GP9B 4YOIA 2J34A 1UCYK 4ABIA 2EI8A 3OY5U 4XFQA 1HJ8A 4DGJA 3NPSA 2Q1JA 3UNQA 1C2JA 5EQQA 1V2ST 3M36A 1TOMH 3GCHB 4NZLA 1TQ0B 3UNSA 3DA9B 3RUOA 2BM2A 3LH1A 1O3CA 4NIVA 3M3VA 2ZHDA 3ODFA 4I8KA 1QRZA 2ZNKH 2ODQA 1LVOA 1T32A 1EKBB 2V6NA 4GCHG 1NC6A 5JBBS 1JXPA 1P11E 4NFEA 4INKA 1CA0B 1MTWA 2Z9KA 1SQOA 1ANCA 4THNH 3RXRA 3PO1B 4CBOA 1QBOA 3MHWU 3HK6B 5DP5A 1ETSH 1GI1A 2ZPRA 1N8OC 1LHDH 1GHAF 2RCEA 2NWNA 2VJ1A 4ZXXH 3QTOH 2FDAA 1GCTC 2TRMA 2R3UA 3EDXB 3HGPA 4JZ1A 1G3CA 1H1BA 3LGVA 2W7SA 2ASUB 1L2EA 3BN9A 4WMDA 1FJSA 1GJAB 2AFQB 3P8FA 5TCCA 2CF8H 1P2JA 1EAXA 2ODPA 1ELTA 1H8IH 2J9NA 1O35A 3K2UA 4FVBA 1O2LA 3OYPA 1JRTA 3UR6A 2A7CA 3RMNH 1J16A 1K1NA 1FN8A 4AG1A 1O3HA 3SV9A 5G4BA 4NA7A 3VGCC 1AB9C 2A4GA 2BY6X 1YBWA 1K1IA 4BAHB 1ARCA 1DS2E 3ITIA 4BNRA 1SHHB 1ARBA 3W95A 4DIHH 1ETTH 1D6WA 3ZZ6A 3SNDA 5TJXA 2Z7FE 1EZXC 2O8WA 1O5BB 5T6GA 3RU4T 1Z8JB 1SHYA 4I8JA 2SGQE 1IQGA 2STAE 1N1LA 4NFFA 4K8YA 2AMPA 2WPJS 4AORA 3ESTA 2GCTC 2XYAA 2GZ9A 1K28D 2W5EA 3RXLA 1HB0B 4NIXA 3A86A 4ABGA 1UTOA 2FI5E 5GCHG 1CU1A 1SGFG 1G2LA 1W13U 1C2MA 4ZKNU 1KY9A 1IOEA 3KCGH 1HAXB 1V2WT 2HNTF 5DP8A 1K21H 1A1RA 3B8JA 3P95A 4YESB 1S6HA 1Y5AT 2FOBA 1GJBB 1BTUA 1A0JA 1TQ7B 3RM2H 2VH6A 3LJOA 1O32A 1P06A 1JIRA 2FX6A 1GBBA 1A61H 1C9PA 2ZTZA 4Q7XA 3C27B 1HAPH 1HIAB 4KGAA 1D9IA 5DP6A 1TGBA 4U30A 2BD4A 2Z6BD 2CJIA 1V2PT 1TB6H 1ZSKA 2C3SA 3LGIA 2PSYA 4A5TS 4AYVB 1SG8B 4FUEA 4HGCA 3MWIU 3DHKH 3UR9A 4B2AA 1XX9A 2FYRA 3S69A 3GY7A 2ZDNA 2O8UA 4TY7A 4WXIA 1AQ7A 1TGCA 2OTVA 4NA9H 2CGAA 1CBWC 2ZGHA 1UVTH 1HAVA 5EPYA 1P2QA 2ZU5A 2ZFQH 5ETXA 1W0YH 1NRSH 4NG9H 2OQUA 1S85A 4NZQA 1CGIE 3K6YA 1K1OA 4OS6A 1SLUB 1TYNA 1P10A 1EZUC 4OS7A 1F0RA 2ALPA 1VR1H 2AMDA 3CP7A 4Q7YA 2ZPSA 2B5TB 1O3OA 4YT6H 1C2KA 4RKJB 1KXAA 3SU3A 1S81A 1V2JT 1RIWB 2A4RA 3PMHB 1K1JA 4CRAA 2HVXA 1E38B 5JPMH 3A81A 3U9AH 1RJXB 3TJNA 1CHOF 2QA9E 5AVDA 2BDCA 4ZH8A 5JDUB 2Z3DA 2KAIB 3SU6A 4YTAA 4A1TA 3PMAB 2ZU4A 1HAOH 1GGDC 4SGAE 2EA3A 4Y76A 1O2UA 3K65B 2SNVA 2VIPA 5L30H 2WPIS 7KMEH 1C1QA 1MH0A 4JK6A 6CHAC 1OS8A 2R3YA 1C1NA 2FWWA 4NGAH 3UOUA 3BTQE 3W94A 1LKBA 3V13A 5LPEA 3MH5A
chains in the Genus database with same CATH superfamily
1TAWA 3PV4A 1DDJA 3SJIA 1T7CA 3QLPH 3VPKA 1MKXH 2QXJA 2XCFA 2P3TB 3LDXH 1ELFA 4AB8A 2ZHWH 2ZU3A 2JETB 1O2VA 3SJ8A 4AFZA 4YOJA 1A4WH 1AKSA 5L2ZH 4I31A 5EJLA 1PPZA 1AO5A 3M5LA 1GJCB 2WYGA 1HAZB 1ZMNA 3E0PB 4AX9H 4F55A 4ASHA 2AHME 1AI8H 5HM2A 1OP0A 1UVUH 5TCAA 2ZC9H 2ZFSA 1MQ6A 3O8BA 1ZSLA 1C2EA 2JH6D 3GY6A 2VU8E 2ANKH 2AGGX 1S0QA 1E0FD 4X1RU 4CRBA 3QZQA 1BJUA 1W7XH 2G51A 2BX4A 1HDTH 4O9VA 2P95A 1C9TA 3TLOA 1H8DH 1FN6A 3TITA 5LPFA 1VITF 1HGTH 5DPAA 3FFGA 3SZNA 1PQ7A 1JMOH 1P0SH 2BD8A 2W6ID 1GBMA 4YT7H 1S0RA 1OPHB 3F9HA 4NSVA 4KTSA 3TU7H 3UWIA 5JBCS 3DUXH 3A85A 1SGEE 2GTBA 3SOSA 2HVYB 1C2FA 3H7OA 4O3UA 2VVUA 1J14A 1E34B 3RXQA 4DIIH 2WINI 3U1JB 1MTSA 3UY9A 4Z6AH 2AS9A 4HI3A 4B74A 3RXDA 2A2XH 4K1SA 2FOHA 1EPTA 2BLOA 5F8ZA 1BOQA 2QCYA 1E35B 4Y7AA 3RXOA 3MTYA 2C8WB 4CR5A 4XD7D 1C5NH 2O8TA 2P8OC 1MTNC 4MNXA 3GY4A 1WUNH 4E05H 3DSOA 3QK1A 3GICB 3PMBB 2FMJA 3GY2A 1TNIA 3HATH 1SBWA 3LJJA 1EASA 2VINA 1GI8B 1VJ9U 2OP9A 2AGEX 2FP7B 1YPHE 4CRDA 2H5DA 1HXFH 3V0XA 3UNRA 1LVBA 1GBTA 1IHTH 2V0BA 1ZTKA 1ZRBA 2ZI2H 4F48B 1SGQE 2Q6FA 1SGTA 4BAKB 3BF6H 4IBLH 3A8DA 2J5UA 2VVCA 1TABE 2ZU2A 4MDSA 1BMLA 2W7UA 1NROH 4RSPA 1BRBE 3QWCH 5BRRE 1SGFA 1JOUB 2GKVE 1GI9B 1QA7A 3BEFB 1E79D 2ZF0H 2J2UA 1EZSC 2QV1A 4B6FA 1E1QD 4B73A 5EQSA 1D3QB 4ABFA 4GCHF 3KHVA 4FETA 1KLJH 1UO6A 1F5RA 2H9TH 4FUHA 3PYHA 4HG6A 2J95A 2EI7A 1FY5A 3A7TA 1O2OA 3PV2A 1ZPZA 3GDVA 3M5OA 1VJAU 3GYMA 4SGBE 1ELCA 3SW2B 1DSUA 1QCPA 4X8SH 5DK1A 4TSFD 3UAIC 2ZCLP 3G01A 2IJD1 4MQAA 3MFJA 2L74A 1UW7A 2M5TA 1O2IA 1GDNA 1QBVH 4WH6A 1B0FA 1O3KA 2CHAC 3RXTA 1AVXA 5E2PA 1C1RA 1FPHH 1SQTA 2OUAA 4TYDA 2XC4A 2ZEBA 1BUIA 1MZDA 3LGTA 1HAVB 3S7HB 4GUXA 4UFGH 5FCKA 1EQ9A 1P2IA 5HKKD 2WSSD 3O8CA 3CS0A 3KF2A 3LOXA 1MU6B 3SU5A 3VEQB 1L4DA 1TGSZ 3VXEH 3F2FA 1BDAA 1MKWH 2Z9JA 4FUCA 2D2DA 4CRFA 1Z71A 1KLIH 1MU8B 4PROA 4QT8C 4IS5A 1EB2A 1AN1E 3SU1A 1GBCA 2G5NA 5FCRA 2PGQB 1JIMA 4AC9A 4DW2U 2BX3A 2L6OA 2BLQA 5B6OA 5C94A 1MD7A 3P8NA 3WW7A 1LHCH 2BLVA 1O3DA 2WUCA 3A89A 1WBGB 4B75A 5FPTA 3PM3A 3T2NA 2PTCE 2A0QB 3SV8A 4RN6A 3L3TA 1Y3YA 3GYLB 1Y3UA 1O2SA 1LCYA 3TJUA 3PTNA 1GL0E 2UWOA 5C5OA 2HLCA 2HNTE 3ZV9A 2GVFA 1O3IA 1WDIA 1GHBG 4WMFA 2AGIX 4YO9A 2NU4E 5GCHF 1CQQA 1UVSH 4UFFH 2WUBA 4FUJA 1C5MD 3F2HA 5CDFE 3FANA 2A5IA 1MAXA 1SI5H 2YMSD 3ZZ4A 4E7NA 1BRAA 1W2KH 1AMHA 1FMGA 1SSXA 1A0LA 4XBCA 4CH2B 3I77A 3MI4A 6LPRA 1QHRB 1ZHRA 3RXEA 1C1MA 1ABJH 2BD9A 3ZZ7A 2FOMB 3PLPA 2V3MA 2OC8A 3AK5A 1SVPA 1ZZZA 5T6FA 1ZJKA 2PLXA 2PKSB 1O2WA 3ATKA 5FPYA 3BG4B 1AKSB 4CHAC 1O2TA 1P2NA 5EU8A 5HIYA 3AW0A 2H5CA 1F7ZA 1Z8GA 3A7YA 5A0AE 1N6YA 8ESTE 4NIYA 4VGCB 3SUEA 1CT4E 3S9AA 1HNEE 3GS9A 1V2TT 5F8XA 1MBQA 1BJVA 4K1TA 1EOLA 2TGTA 1SB1H 3SO3A 1GI4A 2WV5A 1FY8E 4NWLA 4OS5A 3OE7D 2VGCB 4WWYA 2QF4A 2ZG0H 4DOQA 1J9CH 1YCPH 4FVDA 1GVKB 4I33A 4YXWD 1YPJH 1AZZA 1GCDA 3OTJE 3UTUH 1K0HA 2G4UA 1NO9H 1HJAB 1OWEA 1OX1A 3S9CA 3URDA 1Z7KA 5E8EH 3OFND 1PPHE 1TX6A 2V35A 3KGPA 4I8LA 4D7FA 2PW8H 1OSSA 1F5LA 2Y7ZA 1KTTB 1UTPA 4NCYA 2V3OH 1QB6A 5LGOA 4XRNA 1L1GA 3ZVFA 2BXUH 4I7YH 1OP2A 1T8MA 1ZR0A 1P3EA 2ZP0H 1X7AC 3SNEA 1GBIA 3A8CA 4MNVA 4O03A 2B0FA 1FZZA 1UHBA 3P70B 2BHGA 3SUGA 2ZTYA 3H7TA 4X8UH 3KNXA 1AVGH 2KCOA 3KQ5A 1C5VA 4YM9A 2VWOA 3RXKA 1GJ7B 1UK4A 3FZZA 3ELAH 1EPTB 1WOFA 1O5AB 4DCDA 1GVZA 1MKXK 4JMYA 2IOTA 4X1SU 5EJ1A 1VGCC 4XSKU 3K9XB 3NK8A 5C1XA 1BTYA 2G81E 2YMSC 2V3HH 1AVWA 2EC9H 1O39A 4HFPB 4BTIB 4X2YA 1QBNA 2ZHFH 2FPZA 3UUZA 3SN8A 5EXNA 1C4Y2 2XBYA 1GHYH 3KL6A 2B7DH 2PHBA 4Y8ZA 3BIUH 3ZYEA 1O36A 5C1YA 3HKIB 5HYOA 1NTPA 1BT7A 3D65E 5CMXH 4TPIZ 1EOJA 2BY7X 2Z9GA 3RXAA 2OC0A 1K22H 1RTKA 2SGEE 1DY9A 1O2PA 1MCTA 4X1QU 3DCLA 3BTHE 3V3MA 3SV6A 2LNCA 4TWWA 3MMGA 3BSQA 2WPKS 2XNDD 1ZHMA 1FUJA 3TGIE 1HYLA 3UQVA 3VG8A 1TMUH 1TBRH 1TPAE 3GDUA 4UD9H 1T4VH 1O37A 3OAAD 3F68H 1GJ5H 1TGNA 2XC5A 2BDAA 7ESTE 1K2I1 2KCAA 3L33A 3N7EA 1EP6A 3VB7A 8LPRA 1GI7B 1KXFA 1SGCA 3A7ZA 1UK2A 3HKJB 1G2MA 5DN6D 1FDPA 1FQ3A 1EP5A 3MU4A 1TNKA 3FZDA 1P01A 1YPHC 2Z3EA 2BOKA 4X6OA 9LPRA 1BQYA 3A87A 2ZWLH 2WYJA 3IITA 2RDEA 2G5VA 1ESAA 1L1NA 2CN0H 2AIPA 1A5GH 4ISHH 2WPMS 4MPUA 3NXPA 4Q80A 2ZZUH 4INHA 1NFXA 1QGFA 1OXGA 1TMTH 1NT1A 1C5PA 2PP6A 3GOVB 4DY7B 1BTXA 1QJ7B 4OM9A 4XOJA 4MNYA 1BTHH 2LP6A 3KQDA 1BBRE 1O3PB 1NBME 4ABBA 5CE1A 1BRCE 5DP4A 1KXEA 2QXGA 1SL3A 2PSXA 2ZIQH 5IDKA 1GI3A 4YLQH 1WTHD 1YLDA 5F03A 3AASA 2P93A 1QNJA 3EGKH 4FUBA 1MTVA 2KR7A 1IHSH 3FN8A 2J4IA 1JWTA 3ZVDA 1DSTA 1GG6C 2QE7D 2VIWA 2WV9A 4O3TA 3SV2H 2BLWA 3LC5A 1DICA 3PLKA 2FX4A 1J15A 1N8OB 1D3TB 3SI3H 1F0TA 1LQEA 1GCTB 3A83A 2XNIA 5ESTE 3FVFB 3LONA 3RM0H 3WY8A 1SGDE 2XBXA 1W3CA 3RXBA 1D6RA 1SC8U 4U2WA 4AFSA 2BDGA 2FEQH 2F9VA 4CR9A 2BDIA 2ULLA 1TFXA 1GMHG 1FY1A 1B7XB 1HAIH 2A2QH 2G55A 3F0OA 3FP8E 1XVMA 3P17H 3RP2A 2ZDLA 4WVPE 3ZVEA 4GVUA 1XVOA 3T62A 1AFEH 3AVZA 1Q3XA 1WSSH 5EXLA 3TH3H 1TNHA 3EYDA 1CVWH 1TGTA 3F1SB 3KQEA 4XBDA 3VGCB 2H2ZA 1AB9B 5K0HA 1O38A 4FUGA 1SGRE 1SPJA 3MH4A 1CE5A 3D23A 1QY6A 3LGWA 1V2NT 1H8HD 3RDZA 4BXSA 3P8OA 2Y80A 1L0ZA 1GBJA 2J38A 2GT7A 2IPHA 1XXDA 1MKWK 2HNTC 1YLCA 3QUMP 3ATWA 1KXBA 4MPWA 5DP7A 5L2YH 4MTBA 1GMCG 4X1PU 1RTLA 5C3NA 2YNAA 3PTBA 1O2NA 1GJ8B 1QIXB 2OQ5A 4MPVA 2GCTB 1QQUA 3STIA 2ZA5A 1O3EA 1TE0A 3BEIB 2QIQA 4KELA 2GD4B 3BTKE 3RXIA 3N7DA 1O31A 1SLXB 2F83A 2GCHG 4M9FA 3U8OH 1F0SA 4Y79A 1O2JA 1ZHPA 5C0UA 4H6TA 1V2MT 1XUJA 1M9UA 3SUFA 2BZ6H 4AZ2B 1NESE 1PYTD 4LZ4B 5A0CA 3A8BA 1NU7B 1GHWH 1ZSJA 2BY5X 1UHBB 2BMGB 4FUFA 4BAOB 1G36A 5KECA 1IQFA 4ZAEA 2GZ7A 1KLTA 2BY8X 3PRBA 3LH3A 5E2OA 3U1IB 4IC5A 1IQKA 4FXGH 1D3PB 3NKKA 1CGHA 1GHBF 5AFZH 1JBUH 2WZQA 2H9EH 3UIRA 1FY3A 3EA8A 1PQ8A 3ZZAA 1VKYA 2ZKSA 1EX3A 1LPGB 2SNWA 5EODA 3TK9A 1HCGA 3CENA 3FAOA 3RU4E 3BG8A 4NA8A 4FU7A 1C5TA 1AGJA 3LT3A 5F6MA 1RS0A 1CBWB 2FIRH 3T26A 1TPOA 5AHGH 1OWJA 4TY6A 2J92A 1BTZA 3EE0B 3VXFH 2ZDMA 3HPTB 2Y6TA 1ORFA 3MU0A 3NCLA 2ZFFH 3PWCA 2OC1A 3TVJB 1HFDA 2OD3B 3ZZ5A 1GHVH 2HWLB 2ZGJA 4ACBA 2R2WU 1P12E 3HK3B 3QDZB 1AFQC 1UTJA 1YCPK 1ACBE 1O5CB 1O3FA 4WF8A 3BTFE 4K69A 2GGVB 7GCHG 1W0KD 1O30A 3TNSA 4Y10E 5E0GA 4BOHA 2UWLA 1NRNH 4GHTA 4OGXA 3KEEA 3LGUA 4FOUC 1QFKH 4XBBA 1V3XA 1OYTH 1GGDB 2KFWA 3SGAE 3KQBA 1DXWA 1YPGH 1N6XA 1UCYE 3UB0A 1WU1A 3M7QA 3LGYA 1TA6A 1SGNE 3MNXA 1V2UT 5IK2D 1C5SA 1LHEH 4ZKRU 3QX5H 2DUCA 2R0LA 5EQRA 2C8YB 6CHAB 3Q3XA 4X2XA 1TALA 5C67A 4B71A 1W7GH 2BY9X 1O2ZA 1XKAC 2QGRA 1KIGH 3F6UH 4UDWH 1SOZA 2JH0D 4ISIH 3UQOA 1DWBH 2WPDD 2VIQA 4BTUB 1WV7H 2BXTH 2TGAA 1PYTC 5JB9S 3P92A 2K0QA 1SFQB 1V2VT 3U98H 1V6DA 2F43B 4AB9A 2C90B 5C20A 3DFJA 2FOGA 2FOEA 3RLWH 1OP8A 2A32A 1P2OA 2CK3D 1PPGE 4ABAA 5EXMA 2BQ7B 2A5KA 1TONA 5FXLA 3O8DA 4F49A 5T3HA 2ZGCA 3LIWA 1IQNA 4UFEH 3VB5A 5I46H 1NRRH 4CBNA 3RXFA 2P3UB 3SYJA 1BIOA 5AFYH 1BCUH 3SQHE 4M7GA 3SNCA 4MPXA 1F92A 5FBEA 1ZGVA 2FS8A 1O3GA 1ZTLA 3SGBE 3NZIA 3D49H 1C2DA 1A2CH 3LKWA 3ZZBA 1TBQH 3SBKA 1INCA 2UWPA 2J97A 4ISNA 2OCVB 3KYFA 1FIWA 3RXVA 3ZVAA 4D9QA 2XXLA 5A8YA 1Y5BT 4ESTE 5HXFA 1ZJDA 2QF0A 3E91A 3RXUA 1FONA 1GI0A 3I78A 1XUHA 3M3TA 1G3BA 2BVSH 3O8RA 1A5HA 1A7SA 4H42U 1WQSA 1COWD 1YY3A 2AIQA 4BAQB 3JZ1B 1NY22 1SFIA 2A31A 3QGNB 1P2KA 2HLDD 1Z8RA 1ELGA 2B8OH 4K2YA 4ZKSU 1C2IA 3S7KB 2R9PA 2UUJB 3Q76A 1HV7A 1H9LB 2P8OB 1MTNB 1XM1A 4XE4A 1P3CA 1NU9A 1MAYA 3URCA 5GNDA 2RA3A 4ISOA 1C2LA 4BANB 1MQ5A 3MH6A 1HAYB 1Y3VA 2ZFTA 3E3TA 2Y81A 1AE8H 3Q3KA 2VH0A 2BVRH 2QAAA 1S82A 4LXBH 1ZTJA 2ZO3H 2TBSA 1Y59T 3S0NA 2K8IA 1FAKH 1FPCH 2FXRA 2Y5FA 1DOJA 2ZDVH 1ZYOA 4I8GA 1C5XB 2WPHS 1GL1A 3GY5A 4Y8XA 4Y11E 3A7WA 1VCQA 1H4WA 3F2GA 3MNCA 5ESBA 5JBAS 1GMDG 3OSYA 1QA0A 2G4TA 4DG4A 1THSH 3PB1E 4WJG2 1NN6A 1RD3B 1YF4A 2GMTC 5CHAC 1LVYA 2OXSA 1O3LA 2ZDKA 4FUIA 2XBVA 2KM0A 1FNIA 2VWLA 4DVAU 1CO7E 4GAWA 4RKOB 1OOKB 2QF5A 1DWCH 2XBWA 1O3MA 1SGPE 2SGDE 2GDEH 1P02A 4FU8A 4ZUHA 3EA9A 1GBHA 5FX5A 3ATMA 1E1RD 1KMHB 1ELEE 1WYKA 1QRXA 1TIOA 2Q6GA 4Q4LA 5FL7D 5HM9A 1P2MA 1E36B 1OKXA 2TGPZ 2M2AA 4CRGA 2CHAB 3GCHC 1DWEH 2Y5GA 2ZCHP 1GMHF 3SUDA 1ZPCA 2Z9LA 1P04A 3U8RH 1K9OE 4ABDA 1K1PA 4ABJA 2FOFA 3C1KA 1NPMA 1NFWA 4H4FA 1UTMA 1MTUA 2GV6A 1CA0C 1LTOA 1C1VH 5GWZA 5LPRA 4ZMAH 1FAXA 3PO1C 3TJOA 2ESTE 4A1XA 4ABEA 4OS2A 3ZIAD 4AGJA 3RMMH 2A7JA 2VIDA 3BTEE 5C5NA 1TLDA 5L6NH 2W3IA 4Y0YE 4X8VH 2YNBA 3MO9A 1CHGA 4Q63A 5GDSH 3VB4A 5DP9A 3ATLA 5GIBA 2PV9B 5T6DA 1DLKB 2G8TA 3LU9B 3M35A 1YPKH 1A5IA 1BHXF 3DD2H 4HZHA 1UTKA 1DE7H 4F4OC 1RXPA 1W14U 3UOPA 3RMOH 5A8ZA 3IG6B 1SGYE 1C5RA 3SU2A 1CT0E 2Q6DA 1F0UA 1YC0A 1VITH 2GCHF 1ZMJA 3M37A 1C1PA 5EOKA 2PFEA 1TNLA 4IN1A 3MNSA 4Q2KA 1LQDB 1S84A 1WCZA 4A92A 1PFXC 4X6NA 4K1EA 3STJA 1HLTH 3HGNA 3I29A 1TA2A 2THFB 4CH8B 3SV7A 3WWFA 4D8NA 3A82A 4Y71A 3Q3YA 1TNJA 1KTSB 1ZLRA 3TH4H 1O33A 2JIZD 1YPLH 2W26A 1G37A 2FS9A 3Q77A 3PROA 1LVMA 3RLYH 1EJMA 2G52A 4CHAB 5F8TA 3TJVA 4I8HA 1Z6JH 2FOAA 2GX4A 1ZGIA 1C5OH 1YCPM 1ELDE 1G3DA 2FZZA 4I32A 1UMAH 4UONA 2F91A 1IQIA 3MNBA 5FAHA 3MH7A 1C5ZB 3SNBA 1H9IE 4X6MA 2Y5HA 1GBFA 8KME2 3N7OA 1BZXE 1IAUA 1C5UA 1D4PB 1BB0B 3F9EA 1O0DH 4MG3A 2ZHEH 1GJ4H 2QC2A 2FI3E 3H09A 1BBRH 3PLBA 4LZ1H 1E37B 1BMAA 2XWAA 2OLGA 1QJ1B 2P59A 5CHBA 4YZUA 2RFKC 2YOLA 1EAIA 2SGAA 3UPEA 1C1OA 2KZ4A 2PR3A 2OC7A 1EJNA 2QN5T 7GCHF 2HALA 1K1LA 4R8TB 1MZAA 1Q2WA 1VCPA 2EEKA 1G30B 1UTQA 1T8OA 4MLFB 4JCNA 1TPSA 2P3FH 3EE7A 4K60A 2ALVA 1O2KA 3AAUA 2C8ZB 8GCHG 1BITA 1C1WH 3T5FH 2KCYA 3R3GB 4Y6DA 3AAVA 1FIZA 5IYTA 3KQCA 5DG6A 5FPSA 3GY3A 3AW1A 2FLBH 1DY8A 4JYTA 3TIUA 4H6SB 1GBEA 1J8AA 2F9PA 1H8ED 1LMWB 2BZAA 3MQKC 4X0WU 1EB1H 3VFEA 3H5CB 2ANMH 3W1EA 1VGCB 4DT7B 4HTCH 1G32B 1ZRKA 2YMSB 1W12U 4Z1MD 1ANEA 3Q00A 2G00A 3QN7A 9ESTA 3SI4H 2BOHB 2ZFPH 2ZECA 2J94A 2A45B 1U6QA 1RIWC 2AH4X 2IN2A 3SHCH 4DURA 1DITH 2AMQA 4P00A 1O2YA 4B1TA 1KXDA 3GY8A 4WMEA 1EATA 1O34A 2XC0A 3ZV8A 4CRCA 3KYGA 3BTTE 3EAJA 2BQ6B 1VCWA 3IWMA 3LPRA 4KKDA 1BHXB 1YYY1 2C4FH 4A1VA 1AY6H 2SGPE 2Y82A 4WXVA 5JBTA 2WPLS 4E7RG 2A4OA 4IMZA 1AWHB 1Z1IA 1TX7A 1W0JD 4MVNA 4AN7A 1O2XA 2ZCKP 1NFYA 3TNTA 4BXWA 2QYIA 2ZQ2A 1XXFA 1O5GH 1HAGE 1BRUP 2P16A 2SGFE 1DT2A 3RXCA 1TBZH 1XUKA 1QB9A 2AYWA 5EPNA 2XRCA 1V2LT 2H9HA 3SJ9A 3MYWA 1KXCA 4DT4A 4U32A 3RXPA 2CMYA 1DFPA 4X6PA 4XDEA 2JETC 1PPFE 4AFUA 1YM0A 3ZVCA 1D3DB 3BEUA 1IQEA 4YLUA 2FO9A 5DGJA 1FY4A 1NM6A 3SJOA 2A7HA 3V12A 3ZVBA 5GXPA 3RXGA 2RG3A 2BB4A 1MD8A 4JZFH 2CXVA 1DANH 3E16B 3DFLA 4KTCA 1IQHA 1LDTT 1ETRH 3JZ2B 1Y8TA 1TRMA 5HGGA 5JB8S 5A2MH 1DXPA 2K1QA 1EXFA 1HXEH 5EG4A 1SQRA 4FU9A 4JYUH 2EI6A 2NU0E 4IN2A 1C1SA 4ZHMU 5KEDA 4K5ZA 3MO6A 4ACAA 2F9UA 3T25A 1ESBA 1TMBH 3GCTG 2EQNA 1O5FH 5FHTA 4FUDA 1THRH 1C1TA 1ANBA 1DUEA 3SHAH 5AF9H 4BAMB 1A3EH 4IMQA 1IQJA 1GI5A 1DVAH 1F2SE 3TK6A 3ZZDA 1HJ9A 3M3SA 2P94A 2FYQA 2KCPA 3QTVH 2HOBA 2IPQX 1BMMH 2AERH 1KDQA 4X1NU 1THPB 3BIVH 1G3EA 1SOTA 4RI0A 1EAUA 2D26C 1W11U 4UE7H 3MO3A 5FX6A 2W3KA 2PKAA 3F0PA 4KP0A 3SNAA 3DSPA 1MBMA 1CGJE 1GG6B 2JH5D 2FOCA 4KTUA 2QF3A 2I6SA 1GMDF 1XKBC 1W0ZU 2H6MA 3OX7U 2PWXA 3P8GA 3T29A 1TPPA 2RA0A 6GCHG 2VNTA 3KN2A 3ZZ9A 2GT8A 2F9OA 3M7TA 4D9RA 1YPMH 2J98A 1UCYH 4ZXYH 3ZVGA 3CS7A 3RXSA 1C5QA 1PPBH 2GDDA 1CA8B 1O3JA 2QXIA 1GDQA 3LC3A 1TRYA 1LO6A 4JZEH 1F5KU 1ABIH 5EW2H 3UREA 1BMFD 1TRNA 4GLYA 3U69H 4AFQA 1QL7A 3ATIA 3BTWE 1IQLA 2BQWB 3PV5A 3SU4A 1XUFA 1XUGA 4X8TH 1OWDA 2KX4A 2LPRA 3SJKA 1LPKB 4J2YB 2HPQH 1Y3XA 1GHAG 1PQ5A 1T8NA 3BV9B 2C93B 3N99A 2BD5A 4GPGA 4X2VA 4Q7ZA 1QR3E 3MU8A 1BMNH 1L4ZA 7LPRA 1Q31A 2ANWA 3OU0A 1P9UA 3QZRA 1C2HA 3SU0A 1SGIB 4A6LA 1GI6A 2ZTXA 1AUTC 1SLWB 3E0NB 3E8LA 5DP3A 3ZZCA 1OWIA 1NBMD 1J17T 2HRVA 1C2GA 1HBTH 3UFAA 1O2QA 1ELBA 1JRSA 1P09A 5DJ7A 5HMAA 2O8LA 1QQ4A 2BDBA 2XWBI 4AGKA 2BVXH 2OINA 2UUFB 3SGQE 3TGJE 1LKAA 1PPEE 2F9NA 4B76A 4A7IB 1V2QT 3K6ZA 1ANDA 1P05A 1W8BH 4ZHLU 4NIWA 3RXMA 1XMNB 2WV4A 4NWKA 2CF9H 1EUFA 1AD8H 3F9FA 2I6QA 2OBQA 5A8XA 3NWUA 2F4LA 1B0EA 1Z6EA 2PTNA 5FBIA 1EJAA 2V7QD 5JYIA 1C5WB 5GJ4B 1A3BH 1AE5A 4JZIA 1O3BA 2CV3A 3U8TH 1FV9A 1T31A 1GHXH 5GPIB 1UVPA 4ZROA 4JZDH 3FO8D 4TPYA 5A0BA 1KSNA 4U01A 3M5MA 3ZYDA 4GSOA 1SLVB 4MNWA 1OYQA 1VZQH 1OWHA 1UK3A 1O5EH 3MU1A 3PMJA 3FOAA 4IC6A 5BPEA 1ZOMA 1AWFH 3S9BA 2O9QA 2UUKB 3M5NA 2ILNA 1DM4B 3FP7E 3ENSB 2JKHA 4B2BA 1ZMLA 2NU1E 5LH8A 1GJ6A 3SQEE 1BTWA 3P6ZB 2HGTH 2R2MB 1AFQB 1P03A 1SR5C 4K3JA 3CNRA 1ZPBA 3A7XA 5EW1H 5E0JA 2BD3A 2D1JA 2TGDA 4E06H 2NU2E 3EQ0H 1Y3WA 1BBRK 4GHQA 1QTFA 1ID5H 1GI2A 1LPZB 3BTGE 1SQAA 1ELAA 3MOCA 1O5DH 1YPEH 5DSFA 1HUTH 3SORA 4D7GA 1NFUA 1C5LH 3RXHA 1GBDA 2BDYA 3SZEA 2FM2A 3E1XB 4NSYA 3TGKE 4LK4A 2W6JD 4ASUD 2FI4E 1MUEB 2FESH 2PKSC 2DE9A 1EZQA 2BD7A 1P57B 2NU3E 3BG4C 1Z1JA 5A09A 3U28C 2F3CE 5EGMA 1RRKA 4VGCC 2AEIH 4CREA 4OGYA 2VIVA 3EA7A 2FLRH 4UEHH 4I86A 1TOCB 2B9LA 5J4SA 4Y0ZE 2ZU1A 4R0IA 3TPIZ 1GHZA 1AZ8A 2Z9IA 4TT3D 8GCHF 1DUAA 1O3AA 1OWKA 3GCOA 1H9HE 3TK5A 2GV7A 1NZQH 3D62A 1QURH 2VGCC 4ZCNA 1CHOG 3M61U 1YLNA 1BA8B 1P8VC 1TX8A 2ODYB 1AUJA 3A88A 5C2ZA 4JYVH 1C5YB 4DJZB 3B9FH 1NRQH 2F9BH 1GJDB 1HJAC 2ZGBH 3OEED 2ZPQA 1DLEA 1QZ8A 2HPPH 1T8LA 1GBKA 3L6PA 3RU4D 5J4QA 2FTLE 4UFDH 1GBLA 4K8BA 3V7TA 2JJ2D 3KIDU 4Y8YA 2BYAX 2FODA 1WAYB 1O2GH 5DO4H 5C17A 1PQAA 1Y5UT 2BDHA 1PJPA 1GDUA 3TH2H 3GDSA 1S5SA 3OY6U 1K1MA 1KDQB 2VIOA 2Z3CA 2ZDAH 3A8AA 4ZKOU 2VBCA 3DT0H 1O2RA 4AG2A 1FXYA 1DX5M 5SGAE 1RFNA 2D8WA 2PKAB 3VB3A 3VB6A 1QRWA 1LHGH 1GJ9B 2RDLA 1UTNA 1NRPH 1G9IE 2BD2A 3QGJA 4ISLA 2A4QA 1IQMA 1AHTH 3GISB 2JDID 1RTFB 1QJ6B 1GBAA 1O2HA 3NRLA 1HIAA 1XUIA 4IW4E 4B2CA 4ZHAA 1O2MA 3RMLH 3GCNA 1B5GH 1EPTC 3M7UA 3E6PH 3UWJH 1LHFH 1A0HB 1HPGA 2XOKD 5HIZA 4D76A 2XW9A 2C8XB 2VB0A 5E0HA 2FTMA 3A7VA 3DSGA 3RC5A 1FLEE 2J98B 2DE8A 1UTLM 4LOYH 1AIXH 2OBOA 3ZZ3A 1T4UH 1QL9A 3R0FA 1FI8A 1PPCE 3BTDE 2ZFRH 4JK5A 1S6FA 2PUXB 3A80A 2A1DB 1GPZA 4OS1A 1KYNA 2ZGXH 3BTME 2IJOB 1C4V2 1Z8IB 1VITG 1QB1A 4ABHA 2QY0B 1NS3A 5PTPA 2O8MA 2Z94A 3QO6A 1YKTA 3FP6E 4WY3A 1P9SA 2SFAA 4INLA 2XTTB 1UVOA 1MMJN 4B6EA 2WHXA 3MU5A 2TIOA 3RXJA 1DPOA 2KAIA 4AOQA 1HRTH 1S83A 1ESTA 1TNGA 3RC4A 5C1UA 2LELA 2XCNA 1V2RT 2ZQ1A 4OS4A 1GMCF 2EY4C 3GCTF 2H1UA 3ZZ8A 5K7RA 1YP9A 3F9GA 2ZHQH 6ESTA 1RGQA 3NUMA 2A5AA 1AU8A 4X2WA 1V2KT 4WH8A 4Y7BA 2GMTB 5CHAB 2TPIZ 1DWDH 1CSOE 3A84A 3F3BA 2UUYA 5ABWA 2PUQH 4TWYA 5DKMA 4AYYB 1A46H 1L1JA 1CT2E 1HAHH 4YOGA 1UJ1A 1O3NA 3B23B 1GWAA 2Y7XA 1QL8A 1FX0B 1V2OT 1YGCH 2ANYA 2R0KA 3ODDA 4BTTB 4Z0KA 4O97A 1EAWA 4J1YA 1MCVA 2GZ8A 2VVVA 3T28A 5I25A 4IGDA 2QXHA 2VWNA 1BTPA 1WTGH 2STBE 3PWBA 1C1UH 3RC6A 1TWXB 2BTCE 2JJ1D 1ELVA 1C4U2 3T27A 2VWMA 5H4IB 3E90B 1W10U 1WQVH 2PGBB 6GCHF 1GVLA 1SMFE 2GP9B 4YOIA 2J34A 1UCYK 4ABIA 2EI8A 3OY5U 4XFQA 1HJ8A 4DGJA 3NPSA 2Q1JA 4P02A 3UNQA 1C2JA 5EQQA 1V2ST 3M36A 1TOMH 3GCHB 4NZLA 1TQ0B 3UNSA 3DA9B 3RUOA 2BM2A 3LH1A 5EJZA 1O3CA 4NIVA 3M3VA 2ZHDA 3ODFA 4I8KA 1QRZA 2ZNKH 2ODQA 1LVOA 1T32A 1EKBB 2V6NA 4GCHG 1NC6A 5JBBS 1JXPA 1P11E 4NFEA 4INKA 1CA0B 1MTWA 2Z9KA 1SQOA 1ANCA 3FKSD 4THNH 3RXRA 3PO1B 4CBOA 1QBOA 3MHWU 3HK6B 5DP5A 1ETSH 1GI1A 2ZPRA 1N8OC 1LHDH 1GHAF 2RCEA 2NWNA 2VJ1A 4ZXXH 3QTOH 2FDAA 1GCTC 2TRMA 2R3UA 3EDXB 3HGPA 4JZ1A 1G3CA 1OHHD 1H1BA 3LGVA 2W7SA 2ASUB 1L2EA 3BN9A 4WMDA 1FJSA 1GJAB 2AFQB 3P8FA 5TCCA 2CF8H 1P2JA 1EAXA 2ODPA 1ELTA 1H8IH 2J9NA 1O35A 3K2UA 4FVBA 1O2LA 3OYPA 1JRTA 3UR6A 2A7CA 3RMNH 1J16A 1EFRD 1K1NA 1FN8A 2GJGA 4AG1A 1O3HA 3SV9A 5G4BA 4NA7A 3VGCC 1AB9C 2A4GA 2BY6X 1YBWA 1K1IA 4BAHB 1ARCA 1DS2E 3OEHD 3WWBA 3ITIA 4BNRA 1SHHB 1ARBA 3W95A 4DIHH 1ETTH 1D6WA 3ZZ6A 3SNDA 5TJXA 2Z7FE 1EZXC 2O8WA 1O5BB 5T6GA 3RU4T 1Z8JB 1SHYA 1WXRA 4I8JA 2SGQE 1IQGA 2STAE 1N1LA 4NFFA 4K8YA 2AMPA 2WPJS 4AORA 3ESTA 2GCTC 5B6LA 2XYAA 5T1VA 2GZ9A 1K28D 2W5EA 3RXLA 1HB0B 4NIXA 3A86A 4ABGA 1UTOA 2FI5E 5GCHG 1CU1A 1SGFG 1G2LA 1W13U 1C2MA 4ZKNU 4RT1A 1KY9A 1IOEA 3KCGH 1HAXB 1V2WT 2HNTF 5DP8A 1K21H 1A1RA 3B8JA 3P95A 4YESB 1S6HA 1Y5AT 2FOBA 1GJBB 1BTUA 1A0JA 1TQ7B 3RM2H 2VH6A 3LJOA 5C0TA 1O32A 1P06A 1JIRA 2FX6A 1GBBA 1A61H 1C9PA 2ZTZA 4Q7XA 3C27B 5F53A 1HAPH 1HIAB 1MABB 4KGAA 1D9IA 5DP6A 1TGBA 1SKYE 4U30A 2BD4A 2Z6BD 2CJIA 1V2PT 1TB6H 1ZSKA 2C3SA 3LGIA 2PSYA 5EIYA 4A5TS 4AYVB 1SG8B 4FUEA 4HGCA 3MWIU 3DHKH 3UR9A 4B2AA 1XX9A 2FYRA 3S69A 3GY7A 2ZDNA 2O8UA 4TY7A 4WXIA 1AQ7A 1TGCA 2OTVA 4NA9H 2CGAA 1CBWC 2ZGHA 1UVTH 1HAVA 5EPYA 1P2QA 2ZU5A 2ZFQH 5ETXA 1W0YH 1NRSH 4NG9H 2OQUA 1S85A 4NZQA 1CGIE 3K6YA 5KGOA 1K1OA 4OS6A 1SLUB 1TYNA 1P10A 1EZUC 4OS7A 1F0RA 2ALPA 1VR1H 2AMDA 3CP7A 4Q7YA 2ZPSA 2B5TB 1O3OA 4YT6H 1C2KA 4RKJB 1KXAA 3PRDA 3SU3A 1S81A 1V2JT 1RIWB 2A4RA 3PMHB 1K1JA 4CRAA 2HVXA 1E38B 5JPMH 3A81A 3U9AH 1RJXB 3TJNA 1CHOF 2QA9E 5AVDA 2BDCA 4ZH8A 2OK5A 5JDUB 2Z3DA 2KAIB 3SU6A 4YTAA 4A1TA 3PMAB 2ZU4A 1HAOH 4RT0A 1GGDC 4SGAE 2EA3A 4Y76A 1O2UA 3K65B 2SNVA 2VIPA 5L30H 2WPIS 1YWUA 3OTPA 7KMEH 1C1QA 1MH0A 4JK6A 6CHAC 1OS8A 2R3YA 1C1NA 2FWWA 4NGAH 3UOUA 1S6LA 3BTQE 3W94A 1LKBA 3V13A 5LPEA 3MH5A
chains in the Genus database with same CATH topology
1TAWA 3PV4A 1DDJA 3SJIA 1T7CA 3QLPH 3VPKA 1MKXH 2QXJA 2XCFA 2P3TB 3LDXH 1ELFA 4AB8A 2ZHWH 2ZU3A 2JETB 1O2VA 3SJ8A 4AFZA 4YOJA 1A4WH 1AKSA 5L2ZH 4I31A 1PPZA 1AO5A 3M5LA 1GJCB 2WYGA 1HAZB 1ZMNA 3E0PB 4AX9H 4ASHA 1AI8H 5HM2A 1OP0A 1UVUH 5TCAA 2ZC9H 2ZFSA 1MQ6A 3O8BA 1ZSLA 1C2EA 2JH6D 3GY6A 2VU8E 2ANKH 2AGGX 1S0QA 1E0FD 4X1RU 4CRBA 3QZQA 1BJUA 1W7XH 2G51A 2BX4A 1HDTH 4O9VA 2P95A 1C9TA 3TLOA 1H8DH 1FN6A 3TITA 5LPFA 1VITF 1HGTH 5DPAA 3FFGA 3SZNA 1PQ7A 1JMOH 1P0SH 2BD8A 1GBMA 4YT7H 1S0RA 1OPHB 3F9HA 4NSVA 4KTSA 3TU7H 3UWIA 5JBCS 3DUXH 3A85A 1SGEE 2GTBA 3SOSA 1C2FA 3H7OA 4O3UA 2VVUA 1J14A 1E34B 3RXQA 4DIIH 2WINI 3U1JB 1MTSA 3UY9A 4Z6AH 2AS9A 4HI3A 4B74A 3RXDA 2A2XH 4K1SA 2FOHA 1EPTA 2BLOA 5F8ZA 1BOQA 2QCYA 1E35B 4Y7AA 3RXOA 3MTYA 2C8WB 4CR5A 1C5NH 2O8TA 2P8OC 1MTNC 4MNXA 3GY4A 1WUNH 4E05H 3QK1A 3GICB 3PMBB 2FMJA 3GY2A 1TNIA 3HATH 1SBWA 3LJJA 1EASA 2VINA 1GI8B 1VJ9U 2OP9A 2AGEX 2FP7B 1YPHE 4CRDA 2H5DA 1HXFH 3V0XA 3UNRA 1LVBA 1GBTA 1IHTH 2V0BA 1ZTKA 1ZRBA 2ZI2H 1SGQE 2Q6FA 1SGTA 4BAKB 3BF6H 4IBLH 3A8DA 2VVCA 1TABE 2ZU2A 4MDSA 1BMLA 2W7UA 1NROH 4RSPA 1BRBE 3QWCH 5BRRE 1SGFA 1JOUB 2GKVE 1GI9B 1QA7A 3BEFB 2ZF0H 2J2UA 1EZSC 2QV1A 4B73A 5EQSA 1D3QB 4ABFA 4GCHF 3KHVA 1KLJH 1UO6A 1F5RA 2H9TH 4FUHA 3PYHA 2J95A 2EI7A 1FY5A 3A7TA 1O2OA 1ZPZA 3GDVA 3M5OA 1VJAU 3GYMA 4SGBE 1ELCA 3SW2B 1DSUA 1QCPA 4X8SH 5DK1A 2ZCLP 3G01A 4MQAA 3MFJA 2M5TA 1O2IA 1GDNA 1QBVH 4WH6A 1B0FA 1O3KA 2CHAC 3RXTA 1AVXA 5E2PA 1C1RA 1FPHH 1SQTA 2OUAA 4TYDA 2XC4A 2ZEBA 1BUIA 1MZDA 3LGTA 1HAVB 3S7HB 4GUXA 4UFGH 5FCKA 1EQ9A 1P2IA 3O8CA 3CS0A 3KF2A 3LOXA 1MU6B 3SU5A 3VEQB 1L4DA 1TGSZ 3VXEH 1BDAA 1MKWH 2Z9JA 4FUCA 2D2DA 4CRFA 1Z71A 1KLIH 1MU8B 4PROA 4QT8C 4IS5A 1EB2A 1AN1E 3SU1A 1GBCA 2G5NA 5FCRA 2PGQB 1JIMA 4DW2U 2BX3A 2BLQA 5B6OA 1MD7A 3P8NA 1LHCH 2BLVA 1O3DA 2WUCA 3A89A 1WBGB 4B75A 5FPTA 3PM3A 3T2NA 2PTCE 2A0QB 3SV8A 4RN6A 3L3TA 1Y3YA 3GYLB 1Y3UA 1O2SA 1LCYA 3TJUA 3PTNA 1GL0E 2UWOA 5C5OA 2HLCA 2HNTE 3ZV9A 2GVFA 1O3IA 1GHBG 4WMFA 2AGIX 4YO9A 2NU4E 5GCHF 1CQQA 1UVSH 4UFFH 2WUBA 4FUJA 1C5MD 3FANA 2A5IA 1MAXA 1SI5H 4E7NA 3ZZ4A 1BRAA 1W2KH 1AMHA 1FMGA 1SSXA 1A0LA 4XBCA 4CH2B 3I77A 3MI4A 6LPRA 1QHRB 1ZHRA 3RXEA 1C1MA 1ABJH 2BD9A 3ZZ7A 2FOMB 3PLPA 2OC8A 1SVPA 1ZZZA 5T6FA 1ZJKA 2PLXA 2PKSB 1O2WA 3ATKA 5FPYA 3BG4B 1AKSB 4CHAC 1O2TA 1P2NA 5EU8A 3AW0A 2H5CA 1F7ZA 1Z8GA 3A7YA 5A0AE 1N6YA 8ESTE 4NIYA 4VGCB 3SUEA 1CT4E 3S9AA 1HNEE 1V2TT 5F8XA 1MBQA 1BJVA 4K1TA 1EOLA 2TGTA 1SB1H 3SO3A 1GI4A 2WV5A 1FY8E 4NWLA 4OS5A 2VGCB 4WWYA 2ZG0H 4DOQA 1J9CH 1YCPH 4FVDA 1GVKB 4I33A 1YPJH 1AZZA 1GCDA 3OTJE 3UTUH 2G4UA 1NO9H 1HJAB 1OWEA 1OX1A 3S9CA 3URDA 1Z7KA 5E8EH 1PPHE 1TX6A 2V35A 3KGPA 4I8LA 4D7FA 2PW8H 1OSSA 1F5LA 2Y7ZA 1KTTB 1UTPA 4NCYA 2V3OH 1QB6A 5LGOA 1L1GA 3ZVFA 2BXUH 4I7YH 1OP2A 1T8MA 1ZR0A 1P3EA 2ZP0H 1X7AC 3SNEA 1GBIA 3A8CA 4MNVA 4O03A 2B0FA 1FZZA 1UHBA 3P70B 2BHGA 3SUGA 2ZTYA 3H7TA 4X8UH 3KNXA 1AVGH 1C5VA 4YM9A 2VWOA 3RXKA 1GJ7B 1UK4A 3FZZA 3ELAH 1EPTB 1WOFA 1O5AB 4DCDA 1GVZA 1MKXK 4JMYA 2IOTA 4X1SU 1VGCC 4XSKU 3K9XB 3NK8A 5C1XA 1BTYA 2G81E 2V3HH 1AVWA 2EC9H 1O39A 4HFPB 4BTIB 4X2YA 1QBNA 2ZHFH 2FPZA 3UUZA 3SN8A 5EXNA 1C4Y2 2XBYA 1GHYH 3KL6A 2B7DH 2PHBA 4Y8ZA 3BIUH 3ZYEA 1O36A 5C1YA 3HKIB 5HYOA 1NTPA 1BT7A 3D65E 5CMXH 4TPIZ 1EOJA 2BY7X 2Z9GA 3RXAA 2OC0A 1K22H 1RTKA 2SGEE 1DY9A 1O2PA 1MCTA 4X1QU 3V3MA 3BTHE 3SV6A 2LNCA 4TWWA 3MMGA 3BSQA 2WPKS 1ZHMA 1FUJA 3TGIE 1HYLA 3UQVA 1TMUH 1TBRH 1TPAE 3GDUA 4UD9H 1T4VH 1O37A 3F68H 1GJ5H 1TGNA 2XC5A 2BDAA 7ESTE 1K2I1 3L33A 1EP6A 3VB7A 8LPRA 1GI7B 1KXFA 1SGCA 3A7ZA 1UK2A 3HKJB 1G2MA 1FDPA 1FQ3A 1EP5A 3MU4A 1TNKA 3FZDA 1P01A 1YPHC 2Z3EA 2BOKA 4X6OA 9LPRA 1BQYA 3A87A 2ZWLH 2WYJA 3IITA 2G5VA 1ESAA 1L1NA 2CN0H 2AIPA 1A5GH 4ISHH 2WPMS 4MPUA 3NXPA 4Q80A 2ZZUH 4INHA 1NFXA 1QGFA 1OXGA 1TMTH 1NT1A 1C5PA 3GOVB 4DY7B 1BTXA 1QJ7B 4XOJA 4MNYA 1BTHH 3KQDA 1BBRE 1O3PB 4ABBA 5CE1A 1BRCE 5DP4A 1KXEA 2QXGA 1SL3A 2PSXA 2ZIQH 5IDKA 1GI3A 4YLQH 1WTHD 1YLDA 5F03A 3AASA 2P93A 1QNJA 3EGKH 4FUBA 1MTVA 1IHSH 2J4IA 1JWTA 3ZVDA 1DSTA 1GG6C 2VIWA 4O3TA 3SV2H 2BLWA 3LC5A 1DICA 3PLKA 2FX4A 1J15A 1N8OB 1D3TB 3SI3H 1F0TA 1LQEA 1GCTB 3A83A 2XNIA 5ESTE 3FVFB 3LONA 3RM0H 3WY8A 1SGDE 2XBXA 1W3CA 3RXBA 1D6RA 1SC8U 4U2WA 4AFSA 2BDGA 2FEQH 2F9VA 4CR9A 2BDIA 2ULLA 1TFXA 1GMHG 1FY1A 1B7XB 1HAIH 2A2QH 2G55A 3FP8E 1XVMA 3P17H 3RP2A 2ZDLA 4WVPE 3ZVEA 4GVUA 1XVOA 3T62A 1AFEH 3AVZA 1Q3XA 1WSSH 5EXLA 3TH3H 1TNHA 3EYDA 1CVWH 1TGTA 3F1SB 3KQEA 4XBDA 3VGCB 2H2ZA 1AB9B 5K0HA 1O38A 4FUGA 1SGRE 1SPJA 3MH4A 1CE5A 3D23A 1QY6A 3LGWA 1V2NT 3RDZA 4BXSA 3P8OA 2Y80A 1L0ZA 1GBJA 2J38A 2GT7A 2IPHA 1XXDA 1MKWK 2HNTC 1YLCA 3QUMP 3ATWA 1KXBA 4MPWA 5DP7A 5L2YH 4MTBA 1GMCG 4X1PU 1RTLA 5C3NA 2YNAA 3PTBA 1O2NA 1GJ8B 1QIXB 2OQ5A 4MPVA 2GCTB 1QQUA 3STIA 2ZA5A 1O3EA 1TE0A 3BEIB 2QIQA 4KELA 2GD4B 3BTKE 3RXIA 1O31A 1SLXB 2F83A 2GCHG 3U8OH 1F0SA 4Y79A 1O2JA 1ZHPA 4H6TA 1V2MT 1XUJA 1M9UA 3SUFA 2BZ6H 4AZ2B 1NESE 1PYTD 4LZ4B 5A0CA 3A8BA 1NU7B 1GHWH 1ZSJA 2BY5X 1UHBB 2BMGB 4FUFA 4BAOB 1G36A 1IQFA 4ZAEA 2GZ7A 1KLTA 2BY8X 3LH3A 5E2OA 3U1IB 4IC5A 1IQKA 4FXGH 1D3PB 3NKKA 1CGHA 1GHBF 5AFZH 1JBUH 2H9EH 3UIRA 1FY3A 3EA8A 1PQ8A 3ZZAA 2ZKSA 1EX3A 1LPGB 2SNWA 5EODA 3TK9A 1HCGA 3CENA 3FAOA 3RU4E 3BG8A 4NA8A 4FU7A 1C5TA 1AGJA 3LT3A 5F6MA 1RS0A 1CBWB 2FIRH 3T26A 1TPOA 5AHGH 1OWJA 4TY6A 2J92A 1BTZA 3EE0B 3VXFH 2ZDMA 3HPTB 2Y6TA 1ORFA 3MU0A 3NCLA 2ZFFH 3PWCA 2OC1A 3TVJB 1HFDA 2OD3B 3ZZ5A 1GHVH 2HWLB 2ZGJA 2R2WU 1P12E 3HK3B 3QDZB 1AFQC 1UTJA 1YCPK 1ACBE 1O5CB 1O3FA 4WF8A 3BTFE 4K69A 2GGVB 7GCHG 1O30A 3TNSA 4Y10E 5E0GA 4BOHA 2UWLA 1NRNH 4GHTA 4OGXA 3KEEA 3LGUA 1QFKH 4XBBA 1V3XA 1OYTH 1GGDB 3SGAE 3KQBA 1DXWA 1YPGH 1N6XA 1UCYE 1WU1A 3M7QA 3LGYA 1TA6A 1SGNE 3MNXA 1V2UT 1C5SA 1LHEH 4ZKRU 3QX5H 2DUCA 2R0LA 5EQRA 2C8YB 6CHAB 3Q3XA 4X2XA 1TALA 5C67A 4B71A 1W7GH 2BY9X 1O2ZA 1XKAC 2QGRA 1KIGH 3F6UH 4UDWH 1SOZA 2JH0D 4ISIH 3UQOA 1DWBH 4BTUB 2VIQA 1WV7H 2BXTH 2TGAA 1PYTC 5JB9S 3P92A 1SFQB 1V2VT 3U98H 1V6DA 4AB9A 2C90B 5C20A 3DFJA 2FOGA 2FOEA 3RLWH 1OP8A 2A32A 1P2OA 1PPGE 4ABAA 5EXMA 2BQ7B 2A5KA 1TONA 5FXLA 3O8DA 4F49A 5T3HA 2ZGCA 3LIWA 1IQNA 4UFEH 3VB5A 5I46H 1NRRH 4CBNA 3RXFA 2P3UB 1BIOA 5AFYH 1BCUH 3SQHE 4M7GA 3SNCA 4MPXA 1F92A 5FBEA 1ZGVA 2FS8A 1O3GA 1ZTLA 3SGBE 3NZIA 3D49H 1C2DA 1A2CH 3LKWA 3ZZBA 1TBQH 3SBKA 1INCA 2UWPA 4ISNA 2OCVB 3ZVAA 1FIWA 3RXVA 4D9QA 5A8YA 2XXLA 1Y5BT 4ESTE 5HXFA 1ZJDA 2QF0A 3E91A 3RXUA 1FONA 1GI0A 3I78A 1XUHA 3M3TA 1G3BA 2BVSH 3O8RA 1A5HA 1A7SA 4H42U 1WQSA 2AIQA 4BAQB 3JZ1B 1NY22 1SFIA 2A31A 3QGNB 1P2KA 1Z8RA 1ELGA 2B8OH 4K2YA 4ZKSU 1C2IA 3S7KB 2R9PA 2UUJB 3Q76A 1HV7A 1H9LB 2P8OB 1MTNB 1XM1A 4XE4A 1P3CA 1NU9A 1MAYA 3URCA 2RA3A 4ISOA 1C2LA 4BANB 1MQ5A 3MH6A 1HAYB 1Y3VA 2ZFTA 3E3TA 2Y81A 1AE8H 3Q3KA 2VH0A 2BVRH 2QAAA 1S82A 4LXBH 1ZTJA 2ZO3H 2TBSA 1Y59T 3S0NA 1FAKH 1FPCH 2FXRA 2Y5FA 1DOJA 2ZDVH 1ZYOA 4I8GA 1C5XB 2WPHS 1GL1A 3GY5A 4Y8XA 4Y11E 3A7WA 1VCQA 1H4WA 3MNCA 5ESBA 5JBAS 1GMDG 3OSYA 1QA0A 2G4TA 4DG4A 1THSH 3PB1E 4WJG2 1NN6A 1RD3B 1YF4A 2GMTC 5CHAC 1LVYA 2OXSA 1O3LA 2ZDKA 4FUIA 2XBVA 1FNIA 2VWLA 4DVAU 1CO7E 4GAWA 4RKOB 1OOKB 1DWCH 2XBWA 1O3MA 1SGPE 2SGDE 2GDEH 1P02A 4FU8A 4ZUHA 3EA9A 1GBHA 5FX5A 3ATMA 1ELEE 1WYKA 1QRXA 1TIOA 2Q6GA 5HM9A 1P2MA 1E36B 1OKXA 2TGPZ 4CRGA 2CHAB 3GCHC 1DWEH 2Y5GA 2ZCHP 1GMHF 3SUDA 1ZPCA 2Z9LA 1P04A 3U8RH 1K9OE 4ABDA 1K1PA 4ABJA 2FOFA 3C1KA 1NPMA 1NFWA 4H4FA 1UTMA 1MTUA 2GV6A 1CA0C 1LTOA 1C1VH 5GWZA 5LPRA 4ZMAH 1FAXA 3PO1C 3TJOA 2ESTE 4A1XA 4ABEA 4OS2A 4AGJA 3RMMH 2A7JA 2VIDA 3BTEE 5C5NA 1TLDA 5L6NH 2W3IA 4Y0YE 4X8VH 2YNBA 3MO9A 1CHGA 5GDSH 3VB4A 5DP9A 3ATLA 5GIBA 2PV9B 5T6DA 1DLKB 2G8TA 3LU9B 3M35A 1YPKH 1A5IA 1BHXF 3DD2H 4HZHA 1UTKA 1DE7H 4F4OC 1RXPA 1W14U 3UOPA 3RMOH 5A8ZA 3IG6B 1SGYE 1C5RA 3SU2A 1CT0E 2Q6DA 1F0UA 1YC0A 1VITH 2GCHF 1ZMJA 3M37A 1C1PA 5EOKA 2PFEA 1TNLA 4IN1A 3MNSA 4Q2KA 1LQDB 1S84A 1WCZA 4A92A 1PFXC 4X6NA 4K1EA 3STJA