1GBJA

Alpha-lytic protease with met 190 replaced by ala
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
198
structure length
198
Chain Sequence
b'ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
molecule tags Hydrolase (serine proteinase)
source organism Lysobacter enzymogenes
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
total genus 51
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbjA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbjA01
1GCDA 3PWBA 2FIRH 4I32A 2XBWA 2ZU5A 3RXQA 2DE8A 1HJ9A 1YP9A 4LZ4B 5LPFA 3ZVCA 2P94A 1EPTC 2P93A 5DP5A 2G4TA 2BX3A 5FXLA 2ZHQH 1HAPH 1S0RA 2FM2A 3VB5A 4K2YA 3A8AA 5AFZH 4CRFA 2J95A 1FLEE 2HALA 3MI4A 3RU4D 1C2GA 2ODQA 2AH4X 1SQTA 3RXKA 2ZHFH 2ZDKA 2R0LA 1TX8A 1P8VC 1AB9C 1SGPE 2WPMS 1ZJDA 4BTIB 1YPLH 2BVXH 5C67A 3A80A 4DIIH 3SGQE 1LCYA 1L1GA 1A0HB 3SI4H 3GCTF 1QB6A 1HXFH 2ANWA 2BLQA 3SV9A 2STAE 1O2HA 5ESTE 1GG6C 1F0RA 2GV7A 3QZQA 1DUEA 1WOFA 2FTLE 1O5DH 5LPEA 4BXSA 1O2ZA 3VB6A 1MKWK 3E90B 4NIWA 1HAVB 1CHOG 1YGCH 3MU8A 1ZPCA 1O31A 1AUJA 7LPRA 5C1UA 2NU1E 5E2OA 3UIRA 1BTWA 3SBKA 1BB0B 1ZRKA 1J15A 1TRMA 3SOSA 1WU1A 2QN5T 4UFDH 3RC4A 2ZI2H 2ODPA 1O3BA 3SUGA 5DKMA 1OWEA 1H8DH 1Z1IA 1KDQA 1OX1A 2G5VA 4FUIA 1O37A 1H9HE 3E1XB 1GHWH 1E35B 1L1NA 5AVDA 2EI7A 1RIWC 3P8FA 3L3TA 1GBJA 3MFJA 1AZ8A 1LPGB 1MTNB 1WTHD 1KTTB 4B2CA 3T25A 1F5KU 4LXBH 1ZSLA 3FP7E 1EQ9A 3MO6A 1ANCA 2Y5HA 3VPKA 1FPHH 2BX4A 1GBIA 4TWYA 6CHAB 1JMOH 2HNTF 2BM2A 1HAZB 5LGOA 1SI5H 1C2IA 1XVMA 5A0CA 1UTQA 4MNVA 1TPAE 2FLBH 2ZCKP 4AB9A 4TWWA 4X6NA 3RXPA 3RLWH 1Y3YA 1C1VH 1C9TA 3B23B 1SL3A 2VU8E 4WY3A 3AAVA 4BANB 2FOFA 1HCGA 3RXLA 4E7NA 2R3UA 3GY5A 1UVOA 4JYTA 3KL6A 1OSSA 2ZCLP 4TPYA 1C5UA 3VXEH 1QA0A 2OC0A 1SC8U 1DSTA 2Z6BD 5C1XA 3IG6B 5E0GA 1MTNC 2Z9LA 2ZDAH 4YO9A 4J2YB 1AVWA 1MAYA 3MNXA 6LPRA 3U8TH 1TGNA 3SNAA 4FUDA 1AWFH 1JOUB 4ISHH 1EXFA 1BRCE 3GYMA 1AMHA 2IPHA 1CQQA 3SJKA 1K22H 2FOEA 1GBKA 3O8BA 1Z1JA 1GJ5H 5TCAA 5A8ZA 1EAIA 3PLPA 3RM0H 4D76A 1C4Y2 2J9NA 3TJNA 5GDSH 3QWCH 3T2NA 4DVAU 2PKAA 3QX5H 1XUJA 2UUYA 2B5TB 1SPJA 3HATH 2BXUH 4BAHB 1QNJA 1KYNA 3SV8A 2AS9A 1GJ9B 4H6TA 1A0JA 4UONA 4B2AA 1AQ7A 2PLXA 1NS3A 3GDSA 1HB0B 1EB2A 2BB4A 3KGPA 3L33A 2ZA5A 3RXFA 1GCTB 1V6DA 2A2QH 1O3PB 3SNDA 2XCFA 1BMLA 2ZU2A 3ENSB 3NXPA 4FUGA 5DP4A 1ZGVA 2Y5GA 1YLCA 4FUJA 1W12U 3RU4E 1GI5A 1QJ1B 1S84A 2XYAA 3ODDA 1Z8JB 1XXDA 2A7JA 3AVZA 1DANH 1BTHH 1EUFA 1O35A 4JMYA 2FEQH 1NY22 3NK8A 2D26C 1H8IH 3PMBB 1O2LA 3LH3A 3Q76A 1ELDE 1A0LA 4A6LA 5H4IB 2W7SA 2FXRA 1T8LA 1O34A 1O30A 3LKWA 3BTEE 1SBWA 1O2IA 4O3TA 4JZDH 3SU5A 5A0AE 1C1WH 1JWTA 3A81A 1A5IA 4FUCA 1SR5C 1GI0A 8KME2 2A1DB 1GJDB 1UVSH 2PFEA 3V12A 1YM0A 4OGYA 2PW8H 2ZGXH 4IS5A 3LJJA 3ZVAA 2OCVB 3GY8A 2FO9A 1HDTH 1EJNA 4AX9H 1FV9A 2FP7B 4ABBA 2VIWA 2XCNA 2OD3B 4GCHF 1VGCB 1DLKB 2Q6DA 2D1JA 3ZVBA 1BTXA 1XKAC 2ALPA 1TX7A 3R0FA 4NCYA 3BTDE 2XW9A 1D6RA 2PKSB 1O2VA 1ACBE 3RXIA 1HNEE 2ULLA 3FFGA 1TGCA 1LMWB 2P8OC 3ZV9A 5EXMA 5JB9S 1KXDA 4Y0ZE 1SVPA 4U32A 4QT8C 1GI8B 3ZZ3A 3LJOA 1DY9A 3KF2A 2Z3EA 3LPRA 3SU4A 1HAVA 1Q3XA 1V2ST 3BV9B 1P09A 1HXEH 3LGYA 3MH7A 5DP8A 1QB1A 5CMXH 3D62A 1IHSH 3P8GA 7KMEH 4I8LA 1BTPA 1LQEA 4FXGH 1F0TA 1FUJA 5CHAC 1OP8A 3PMHB 1FONA 1EPTA 3EDXB 1TPOA 1LHGH 3ZZDA 1V2QT 1IQIA 1Z6JH 2ZKSA 4JZ1A 1G3CA 3VGCB 2HPQH 1TGBA 1Y5UT 2A4OA 4Q7XA 5DJ7A 3M7QA 1P9UA 5L2ZH 2ZDMA 4CRBA 1HIAB 2OC1A 5EXLA 5GWZA 2Y5FA 1C2KA 3SU1A 1KLTA 1TRNA 3P8OA 2J92A 1CT4E 1OWHA 2BDBA 1TONA 4O9VA 1A61H 1C5YB 3P92A 4ZUHA 3IITA 4AOQA 1NRNH 3OY6U 1C1QA 3RXDA 5K0HA 4WMFA 3A89A 1CE5A 3LGWA 1HAGE 1SGDE 3LGVA 5FX6A 1YCPM 3BSQA 3KCGH 5EODA 2A45B 5GPIB 4HGCA 1YPHE 5A09A 4ABEA 4THNH 1IOEA 4I8KA 4X8SH 2TGDA 2GDEH 4OS6A 2TBSA 1UK2A 1QL8A 1YPKH 4R0IA 1VCPA 4Y8XA 1ELCA 3TVJB 1C9PA 3S9AA 3GISB 1TOCB 1Q2WA 4TY6A 1TA6A 3FP6E 4H4FA 1AWHB 3GDUA 3SUFA 3RMMH 4ISNA 1MZDA 1GDQA 1EP6A 2F9BH 1JIRA 1GI4A 3PO1B 2P3FH 4ZXXH 4K8YA 1HPGA 2WV4A 1GMHG 2HNTE 4FU7A 2AEIH 3RXCA 1ZJKA 1QCPA 1N1LA 2BD2A 2H9TH 3GCHB 4R8TB 1QIXB 1D3TB 1D6WA 5FCRA 1PQ8A 1ABJH 1MH0A 1A4WH 2VGCC 1C5WB 1O3EA 5E2PA 1A5HA 3BEUA 4YOJA 5LH8A 1NROH 3M5LA 1ETRH 3ATLA 3UTUH 1TOMH 3A7YA 1K1PA 1BRBE 2J4IA 1YBWA 2I6QA 4ISIH 4Y6DA 1UTLM 3UR9A 1PQ7A 1N8OB 2EI8A 1IQHA 1TRYA 4FVBA 5DP9A 1LKAA 4D9RA 4A7IB 1DLEA 3EA9A 1SGYE 1O2OA 1X7AC 3FP8E 3TITA 4WH8A 1CSOE 1GVZA 1XX9A 5EXNA 1BDAA 1RJXB 2JETC 2AIPA 1S6HA 1TMTH 1RXPA 1C5QA 2CHAC 3KQCA 3Q77A 1V2LT 3TH2H 1C2MA 3A87A 1O2NA 2BOKA 2STBE 5GJ4B 2VIDA 4DCDA 1IQKA 3SNBA 2F83A 4ZHMU 4AYYB 2BD8A 3R3GB 1A1RA 3P6ZB 1UO6A 4AYVB 4I33A 2BHGA 1BHXB 4ZKRU 2CJIA 1ZLRA 4ZKNU 2UUKB 1OKXA 4NWLA 5HYOA 4JZIA 2GZ9A 4UFFH 3W95A 1Z8GA 1CT2E 2ODYB 5EQRA 1JIMA 3QO6A 3VEQB 3GCNA 4KKDA 5EQSA 3BTWE 2EEKA 2GP9B 1P05A 1T8MA 3ZZ5A 5JBTA 1FN6A 1C5ZB 1GJCB 5HM2A 2FS8A 8LPRA 1G2LA 1XVOA 3ATKA 1MKXK 1SGRE 1UTNA 2CMYA 2ZHWH 1CGJE 2ZPQA 3RMNH 2H2ZA 2PUQH 3TH3H 1EB1H 2R2WU 5GCHF 5F6MA 2GCTC 2KAIA 3TGKE 1O3NA 2OQ5A 2GTBA 2A5IA 2XWBI 2FZZA 2YNBA 1O3FA 3KNXA 2ZFSA 2RA3A 4IN1A 1GVKB 1IQEA 1O2SA 2QXIA 4UFGH 2G51A 1GMCG 4H6SB 1XUFA 5EOKA 3SQHE 1D3DB 3ATMA 1WBGB 1E37B 2BVRH 2XWAA 1OWIA 1AE8H 2FESH 2JH0D 1MCTA 1MQ6A 1BUIA 1SOTA 3MH5A 1H1BA 4TY7A 1OWJA 4KTSA 4ZMAH 1B0EA 3RMLH 3L6PA 1ESTA 4Y8YA 3GICB 5DO4H 1DWEH 4MPXA 4CRDA 2OBQA 1SG8B 4HFPB 4B75A 4IW4E 1T4VH 4ZKSU 1YCPK 3SJ9A 1SGQE 3P95A 1V2PT 1ELGA 1O2MA 1W14U 2ZCHP 3BG4B 4WVPE 3SU0A 4E05H 2B8OH 1K1MA 1O3OA 3QDZB 1HJAC 4K69A 4NZLA 1DVAH 2VH6A 1SFIA 5FPYA 3TIUA 1O5FH 1GBHA 1NTPA 2V3OH 2GZ7A 2GVFA 2Z9GA 4JZEH 1SMFE 1YYY1 1L4DA 1GL0E 1PJPA 1B7XB 1GJ6A 1HUTH 3A7WA 1ZOMA 3GCHC 1DITH 1F2SE 4K8BA 2FI5E 2G52A 2G4UA 1YPJH 4WMEA 4MQAA 1HAIH 4ZKOU 1GDNA 3MU5A 5AFYH 2ZP0H 1BBRK 4JYVH 1EATA 1GMDF 3F9HA 4VGCC 2BD5A 3QGJA 1P2MA 7GCHG 4XSKU 4DY7B 1BJVA 8GCHF 1PYTC 3C27B 2AERH 1LVOA 1BMNH 1NPMA 1UK3A 1DWCH 2BY8X 1QFKH 1K9OE 2IJOB 2XTTB 1GHVH 3LU9B 1P10A 1SGNE 2PV9B 1SLWB 1UMAH 4Q7YA 2RA0A 1TFXA 1O2RA 2WUCA 3NCLA 1TGSZ 4U30A 1MZAA 4YTAA 3M37A 3EQ0H 3A84A 5GCHG 3F9GA 2I6SA 2A5AA 3U1IB 3F6UH 5BRRE 1BZXE 1DS2E 1SGIB 1A5GH 3MO3A 1J8AA 1NFWA 3A7VA 3BEIB 4WJG2 3M7TA 1SLUB 1PYTD 2GV6A 1K1IA 4IBLH 1W10U 1O3CA 2A31A 1S0QA 1E36B 2FI4E 2RG3A 4AFUA 1MU8B 3A7TA 2A4QA 1RS0A 1SQOA 1O3MA 1TX6A 1AZZA 2ZHDA 1C5TA 3FANA 5ABWA 2ANYA 1WV7H 3VB3A 6GCHF 1L1JA 3GY4A 5EG4A 5DP6A 2FODA 5T6GA 3UUZA 1PQ5A 1TABE 1K28D 1Y8TA 2GT8A 2OC7A 1ZHMA 4YLUA 1AD8H 2V6NA 5C5OA 1C4U2 2F3CE 2J34A 1W8BH 1C1PA 3MYWA 4Y0YE 1O3KA 4KGAA 1LHEH 1ZTKA 1XUKA 4BOHA 4MNYA 2DE9A 2FOMB 4NWKA 1DT2A 1YLDA 3N7OA 1ZTLA 1QJ7B 5A8XA 1RGQA 3TK9A 5FBEA 2C8XB 1ID5H 4ZHAA 1LVYA 2HGTH 3BTHE 1FZZA 4LOYH 1AUTC 1V2TT 3S9CA 1YPMH 1BITA 3TNTA 1QURH 4RKJB 3RXRA 3QN7A 3DFLA 3RP2A 4GPGA 5B6OA 2KAIB 1SGEE 2FDAA 4K3JA 5JPMH 3SORA 1GBEA 1AU8A 1GI3A 2QIQA 1O2UA 1ANBA 1OYTH 3GCOA 2FPZA 1ZMLA 2W7UA 2YNAA 3ZZ6A 3TU7H 5L2YH 2K1QA 1UTOA 1J16A 1BBRE 1H9LB 3MMGA 4X8VH 1XXFA 3Q3YA 1SGTA 2QYIA 3S7HB 2FYRA 2BVSH 5GXPA 5HXFA 3RM2H 1HLTH 2GT7A 3PV4A 3A82A 3SJ8A 1LPZB 2H5DA 4X1NU 3STIA 4BAKB 1KXEA 2BQ6B 2H9HA 4GVUA 1LPKB 2AGIX 2V3HH 1GHAF 2UUFB 2BY9X 2GMTB 2XC5A 5DP7A 3TGJE 1P2QA 1AN1E 4KTCA 5L30H 4WXVA 2OINA 4CBNA 5TJXA 5JBBS 4AFQA 4NGAH 4NIVA 3M3TA 2W5EA 2ZF0H 5E0HA 1DOJA 5EPYA 3WY8A 3NUMA 1ARBA 1C1MA 4BAQB 2SGPE 2ZNKH 1WYKA 3HKIB 1EAXA 4BTUB 1THRH 2BY7X 2ZC9H 2Y80A 3LOXA 2OQUA 1S6FA 2P3TB 1NU7B 4O97A 3RC5A 2NU3E 4OS2A 4MPUA 1HGTH 1SGFG 3M61U 1DPOA 4CHAC 1Y5AT 2HNTC 3P70B 3F9FA 2F9OA 3ATWA 3KEEA 3E91A 2CHAB 1F92A 1GMDG 4WMDA 3RU4T 3AW0A 1V2VT 1SHHB 1T4UH 2BY6X 4D9QA 1NESE 1EZQA 2WYGA 1O2TA 2H5CA 2BDYA 2ZTYA 1MTVA 3I77A 2NU0E 4X0WU 2WINI 2ZHEH 3CS7A 1FNIA 2QXGA 4ABGA 2GMTC 2AGGX 4X2WA 3VFEA 3QLPH 1P57B 1VZQH 4Q80A 7GCHF 1EAUA 4FUFA 4KTUA 5FX5A 1KIGH 3AW1A 2ZDNA 3NKKA 4B76A 1YF4A 2C8ZB 2W26A 1THPB 2ZFQH 3RXOA 2B9LA 5EW2H 3ZVDA 3RXGA 1AO5A 1D3QB 1YCPH 4XE4A 1FI8A 2RDLA 4CRAA 1TQ7B 2AMQA 3K6YA 1RFNA 2IOTA 2O8WA 2Y82A 3OTJE 4CH2B 5C3NA 1TAWA 2G81E 1KSNA 5HM9A 3OSYA 5L6NH 1O38A 4CREA 1FQ3A 1DDJA 1CHOF 1ORFA 5TCCA 3A83A 1IQMA 3A86A 1HRTH 2LPRA 2BDGA 1C1OA 4I31A 1LO6A 5FHTA 4ISOA 1ZMJA 1CVWH 1EZXC 3SV2H 2LNCA 1GJAB 3M3SA 1NRSH 3KQBA 3BTTE 5FBIA 1IAUA 3TNSA 2ZGHA 1CA0C 1HAHH 4B74A 3VB7A 2JH6D 4UDWH 4Y76A 4MDSA 1O5AB 3K9XB 4NFFA 3RLYH 3ZVGA 1ELVA 2BY5X 3SHCH 2Y6TA 1C2FA 1BTYA 2ZPSA 2JETB 1O2GH 4KP0A 4Y8ZA 4X1QU 1MU6B 2XBVA 3EA8A 2AMDA 2F9PA 1HIAA 1NT1A 2UWOA 1FDPA 4X1SU 3EE0B 5LPRA 2VIOA 2ZU3A 5IYTA 4WWYA 2V35A 3UR6A 1GMCF 3LC3A 3SN8A 1O5CB 4FVDA 4MG3A 4DIHH 1XKBC 1O3IA 1BTUA 3LC5A 1UVPA 4J1YA 1E0FD 4CBOA 1V2NT 1TNJA 3ZZ8A 1INCA 2GD4B 5JB8S 2VWMA 2A0QB 2GCHF 2HRVA 1EPTB 3RXMA 1JRTA 1K21H 3A8CA 3MWIU 1LQDB 4ESTE 5F8XA 1V2OT 3T27A 4BXWA 1EZUC 4NIYA 1DXWA 4YT6H 1UVTH 1GG6B 5E8EH 4U01A 3EGKH 4FU8A 2F91A 5A0BA 1EASA 4DJZB 2PSYA 3PM3A 2HWLB 3RXAA 3SUEA 2A7CA 4X1RU 2P8OB 4ABHA 5CHAB 6CHAC 4NZQA 2BD9A 2ZFTA 2QY0B 2A4GA 2VH0A 1RD3B 4AGJA 1EOLA 4WH6A 2CF8H 1GBLA 1ZGIA 2PSXA 3T26A 1PPFE 1W0YH 2C3SA 1SGFA 1NFUA 3EA7A 3GY2A 1MBMA 1K1OA 5EU8A 2FOHA 4OS5A 1KLJH 1W7GH 1B0FA 2XBYA 2HVXA 4IGDA 4GAWA 4YZUA 1P03A 1AFQC 2Y7ZA 1C5PA 1GGDB 3VB4A 1GDUA 2P59A 2QC2A 4NA9H 1NU9A 1W11U 1B5GH 5EGMA 3H7OA 1EP5A 4AORA 5FAHA 2JKHA 4MVNA 2PKSC 3FAOA 2BMGB 2J2UA 1ESAA 5C1YA 4INKA 2PGQB 4MPVA 2F9UA 1EOJA 3T28A 4AFSA 4PROA 1FAKH 1T8NA 1TNKA 3HGNA 1C5RA 4FU9A 3MHWU 3A7XA 3P8NA 2B7DH 2VNTA 2BYAX 1P02A 3HKJB 1HAXB 3SJIA 1GHZA 1DWDH 3PLKA 1TLDA 1V2MT 3V0XA 1G32B 3S69A 3GCTG 4GLYA 5EQQA 1QTFA 2ZEBA 1KDQB 2R0KA 1V3XA 2VJ1A 2FYQA 2SNWA 3CS0A 4ABFA 3RDZA 1GBTA 2F9VA 2A2XH 3CENA 1CBWB 4YT7H 3LGIA 1QRXA 4ZXYH 1GBFA 4Q7ZA 3E0NB 1ELAA 1ZTJA 1OXGA 2FI3E 2OUAA 1VCQA 3ZZCA 2XNIA 1AI8H 3B8JA 3NWUA 2PR3A 1NN6A 1W13U 2BDAA 3QTVH 3URDA 1TA2A 1A3EH 1O32A 1TPSA 3IWMA 5JYIA 4E7RG 4RN6A 1TB6H 1D4PB 1PPCE 2GZ8A 1VR1H 2SGFE 5DP3A 2Q6FA 4IMQA 1BRUP 3ESTA 6GCHG 1DWBH 1TNLA 2PKAB 1IQFA 1DSUA 5A2MH 1A46H 1DE7H 1HFDA 3SV7A 4NIXA 5DPAA 3ZZAA 3K65B 3V3MA 4ABJA 1KLIH 3UOPA 1D9IA 1MUEB 4X2XA 3OU0A 2IN2A 1P2KA 1DUAA 4K60A 2BXTH 1O5EH 3DUXH 3T5FH 4GHQA 1P12E 3QTOH 4LK4A 1G37A 1C5NH 1GBBA 4AG2A 2W3KA 1ZMNA 3KIDU 4NSYA 4TPIZ 1P9SA 2Y7XA 2SGQE 5T3HA 3EAJA 3SUDA 1AHTH 4A1XA 4AFZA 1IQNA 1ELEE 1RTLA 2FLRH 1Y3XA 3B9FH 1QHRB 1FY4A 3U8RH 3SI3H 2A7HA 1LTOA 1NFYA 4MTBA 2ZFPH 3TGIE 2RCEA 2XC0A 3PMAB 1DM4B 1GI9B 1F0SA 1CGIE 3I29A 3VGCC 4CR5A 3HPTB 2XBXA 5IDKA 1RTKA 2ZZUH 1O3HA 1F7ZA 1KXBA 4X8UH 3D65E 1S82A 3RXEA 1O0DH 4NSVA 8GCHG 4DURA 1GBAA 4YM9A 3V13A 1QBOA 4ISLA 3MTYA 1QRWA 5F8TA 7ESTE 4VGCB 1Y5BT 2BDCA 1YPGH 1ETTH 3T62A 4K1TA 1TMBH 3LONA 1C5VA 2C4FH 1O3DA 2VVVA 1S5SA 3RXTA 3U8OH 2EI6A 2FX6A 2J94A 2BDIA 5DK1A 4BNRA 2JH5D 4CR9A 1MD7A 2PTCE 1QGFA 2XRCA 4D7GA 1LDTT 1QQUA 2H1UA 2ZGBH 3PROA 2EA3A 4O3UA 3E3TA 3RXUA 2ZDLA 1BMMH 1NM6A 2NU4E 4ASHA 2BDHA 1EJMA 2ZPRA 2AIQA 1DX5M 1O3AA 1PPGE 3HK3B 4UD9H 2OTVA 1ETSH 1FIZA 1LHFH 1PFXC 4K1EA 4JZFH 2FWWA 4FUHA 2C8WB 2Z9JA 4BTTB 3FVFB 3D49H 4B73A 3OX7U 1Z8IB 4MNXA 4CH8B 3O8CA 5AF9H 1GMHF 1MKXH 4I8GA 3QUMP 4HTCH 2P16A 1GHBF 2TGPZ 1CHGA 2FX4A 3LIWA 3G01A 2AMPA 2XC4A 6ESTA 1C5SA 1Z6EA 1QRZA 1ANDA 2VIPA 1ELTA 2O8MA 3ITIA 1SB1H 3JZ2B 1KY9A 4WXIA 2ZG0H 2F9NA 3UFAA 3DD2H 1AB9B 4BAMB 3SU6A 4A92A 3BTKE 3E16B 3SGAE 3E8LA 1DFPA 3BF6H 3I78A 3ODFA 4X2YA 4I7YH 1P3CA 1WSSH 1AFEH 1OP0A 1AY6H 2OXSA 1CA8B 1TGTA 1K2I1 1HV7A 1WTGH 1FMGA 3E0PB 4DOQA 1GHYH 3F9EA 5K7RA 2PTNA 3HK6B 3ZYDA 3S0NA 1G3DA 1CBWC 1PPBH 1ZZZA 1C2DA 4K1SA 1YC0A 2ZQ1A 1YPHC 2H9EH 4Y7AA 5C20A 3GY3A 4AB8A 3UPEA 3BTGE 3MNSA 1P06A 4DG4A 4Y7BA 5G4BA 1AIXH 3V7TA 2YOLA 2QF0A 1UTJA 2WYJA 3DA9B 1MTSA 2WPHS 1O2KA 1LVBA 1OYQA 5JDUB 3ZYEA 3URCA 1J9CH 4GSOA 3TLOA 3PMJA 2FOBA 4MPWA 2C8YB 1MAXA 3M5OA 1K1LA 1T7CA 2TRMA 1GI7B 1P11E 1NC6A 2ANMH 5DG6A 4Q2KA 2GKVE 1UTPA 3SU3A 2QAAA 1J14A 1AFQB 1GI1A 4AZ2B 1ESBA 1UCYH 3RXBA 3BTFE 3K2UA 1E34B 3MOCA 1O3JA 4JYUH 1IQJA 2VIQA 3M35A 4IC5A 4ZAEA 4JK5A 4B2BA 1V2JT 2QXJA 1V2WT 2BQ7B 1A2CH 2G55A 1MMJN 2FMJA 3UOUA 2AYWA 4OS4A 2HLCA 1O5GH 2SFAA 3ZZ9A 3OY5U 2ZU1A 3LDXH 1BT7A 4SGAE 2BLOA 3RXJA 1P2JA 2BTCE 2ZIQH 1PPEE 1O2YA 1BIOA 1J17T 1V2UT 1UVUH 1TWXB 1VITH 3TK6A 2NU2E 4XBCA 4OS1A 1N8OC 4NG9H 1VGCC 1L4ZA 1UCYK 1P04A 2SGAA 3ATIA 1F5LA 1S81A 1C2LA 2GCHG 3UNSA 1Z71A 1TNHA 1XM1A 3Q00A 3SHAH 1O39A 3RXVA 1K1NA 2THFB 2TIOA 2R3YA 1OWDA 5J4SA 4Z0KA 4UEHH 5C5NA 1ZPZA 1QL9A 4XDEA 2GGVB 3QZRA 3S7KB 1DXPA 2WUBA 3VXFH 3ZV8A 8ESTE 3GDVA 1OP2A 3LH1A 2QA9E 1O36A 4F4OC 2Q6GA 2OBOA 3DHKH 2GX4A 1TPPA 2FOAA 4RSPA 4ZROA 3BEFB 3ZZ7A 1NO9H 1GBMA 2ASUB 5FCKA 1ZSJA 3KHVA 1THSH 4O03A 3Q3XA 1BRAA 1GJ8B 3H5CB 1WQSA 2HOBA 3M5NA 3SZNA 1UHBA 1CGHA 5T6DA 3MO9A 1TE0A 2O8LA 1PPHE 1MD8A 5BPEA 3UWIA 1BHXF 5HMAA 4M7GA 3DT0H 4YLQH 2ESTE 3JZ1B 1EJAA 1G3EA 3MNCA 4HZHA 1OPHB 3A8BA 4BAOB 2PWXA 1Z8RA 1P2NA 1HBTH 1TQ0B 2CF9H 1NZQH 1WAYB 3LGTA 1H4WA 1OWKA 3M36A 1HJ8A 4A5TS 3LGUA 1RRKA 2GDDA 1TBRH 3O8DA 4ZHLU 1TNGA 2ALVA 3PLBA 4IC6A 1IQGA 1T31A 3TJOA 2QGRA 4UE7H 4GCHG 1P0SH 4FUBA 3SNEA 2FTMA 1QA7A 1HAOH 1N6YA 1YKTA 4FUEA 2WPKS 1JXPA 4XOJA 1D3PB 5PTPA 3SQEE 1EAWA 1PQAA 3OYPA 1O2QA 1SLXB 3Q3KA 1G30B 1LVMA 3RC6A 4B71A 4E06H 2TGTA 4YESB 4KELA 3MU4A 1AKSA 1ANEA 1KXCA 1RIWB 2J38A 4A1TA 5FPTA 1SHYA 5I25A 2BD3A 4F49A 4SGBE 3UQOA 1ELBA 1ZHPA 2TPIZ 2SNVA 4HI3A 4X8TH 5AHGH 1GGDC 3SU2A 2VWNA 1FY3A 1P3EA 2OC8A 1BTZA 5A8YA 1FAXA 5DGJA 1C1SA 4IMZA 1G36A 2AGEX 3U69H 2EC9H 1LKBA 1SSXA 1C4V2 4NA8A 1FXYA 1W2KH 2FS9A 3ELAH 1UCYE 1ARCA 2ILNA 1W0ZU 4X6PA 1O2PA 1GJBB 1QR3E 5ETXA 2VWOA 3KQEA 1CA0B 2ZWLH 1P2OA 3GYLB 1MKWH 3SJOA 1GWAA 2Z3CA 4Z6AH 4CRGA 2G5NA 1AVXA 1GHXH 1T32A 1WQVH 3M7UA 3NZIA 2NWNA 5SGAE 1A7SA 1FY8E 3K6ZA 1O3LA 1HAYB 1VJAU 2R9PA 3T29A 5F03A 1UTKA 9LPRA 3MH4A 2ZO3H 3RXHA 1TMUH 3RMOH 1ZRBA 1SOZA 3M3VA 4INLA 1C1RA 1DY8A 2ANKH 3M5MA 2QCYA 2VGCB 4I8JA 3UY9A 4K5ZA 1DICA 1C1TA 3PYHA 1FY5A 1FPCH 3D23A 1C1UH 1O5BB 1TNIA 1U6QA 2ZGCA 1HYLA 1FJSA 1VITF 1S83A 3SNCA 1GJ7B 3DFJA 3UNQA 3UREA 1QQ4A 1AVGH 1Y3VA 1E38B 4LZ1H 2Q1JA 5J4QA 4OGXA 3E6PH 4H42U 1OS8A 2BOHB 3F1SB 1TBQH 4XBDA 1G9IE 4D8NA 1KTSB 2G8TA 1BMAA 2UWPA 3PB1E 2VIVA 3FZZA 3MU1A 5I46H 3SO3A 3U9AH 1PPZA 4JCNA 2BLVA 2ZTZA 2ZDVH 1LHCH 3AASA 3LT3A 1KXAA 1SLVB 2ZTXA 3GY6A 1QJ6B 1SFQB 1ABIH 2V0BA 2SGEE 2ZGJA 3BIVH 1GCTC 2FOGA 1MTUA 1O2XA 1S85A 3PO1C 3O8RA 4CHAB 1TBZH 1V2KT 4WF8A 2P3UB 1Y3WA 1L2EA 1MCVA 1P2IA 1C5OH 4AG1A 1A3BH 3MNBA 4XFQA 1CO7E 3ZZ4A 1EZSC 4X1PU 3GOVB 1XUHA 1Z7KA 2AFQB 1GPZA 2W3IA 3AAUA 2M5TA 1TYNA 1Y59T 1EKBB 4Y10E 1F0UA 3EYDA 4A1VA 3ZZBA 2UUJB 1O2JA 4NA7A 3RXSA 2C93B 1GI2A 1JBUH 1AE5A 3W94A 1VJ9U 2Z3DA 1MQ5A 4ABIA 3RUOA 1BOQA 4GHTA 1L0ZA 3QGNB 1FIWA 1AKSB 1ZPBA 1IQLA 3C1KA 2CV3A 1OOKB 3TH4H 3UQVA 3P17H 3KQDA 4ABDA 3KN2A 2A32A 3QK1A 5T6FA 1C5LH 4X2VA 2Z7FE 3F68H 3PTNA 1TIOA 2Z9KA 3TJUA 1Y3UA 4INHA 3TK5A 1XUIA 2WPIS 4Y79A 2ZQ2A 1T8OA 2Z94A 1BJUA 2D8WA 2C90B 4I8HA 3ZVFA 2TGAA 4UFEH 4CRCA 2OLGA 1K1JA 1QB9A 3MH6A 1CU1A 2P95A 5C2ZA 4MLFB 1G3BA 5F8ZA 1BQYA 1WUNH 5EPNA 2XXLA 2BLWA 3A7ZA 2A5KA 2VINA 4GUXA 1C1NA 1VCWA 3A85A 3BN9A 4B1TA 2VB0A 2WV5A 4X6MA 1XMNB 3A8DA 2ZFRH 1UTMA 1SQAA 1QBNA 1F5RA 5JBAS 1C5XB 4DW2U 2B0FA 3BTME 1GVLA 2D2DA 2VVCA 1UHBB 1ZHRA 2ZECA 2QF3A 1W7XH 1GHBG 3BG4C 4D7FA 1IHTH 1G2MA 4DT7B 3HGPA 1KXFA 3TPIZ 2OP9A 1EX3A 3S9BA 2DUCA 1GI6A 1QBVH 4U2WA 1WCZA 4YOIA 3BTQE 4AN7A 2ZFFH 1UK4A 2PHBA 4NFEA 2BD7A 1CT0E 4OS7A 4YOGA 4IN2A 1NFXA 1BBRH 5JBCS 1O33A 2CGAA 3UWJH 1MBQA 1M9UA 4MNWA 1N6XA 5CE1A 1FN8A 2BD4A 2O8TA 4RKOB 1P01A 2BZ6H 2VWLA 1Q31A 2WPJS 2Y81A 1TALA 4XBBA 1VITG 2UWLA 1W3CA 3TJVA 1GBCA 2O9QA 1C2JA 1H9IE 2GCTB 4AGKA 1C2HA 1ELFA 5E0JA 1ZSKA 3PWCA 1HJAB 2VVUA 2HPPH 3BG8A 1GHAG 1GL1A 2CXVA 2CN0H 5EW1H 1C5MD 1JRSA 5GIBA 1NRRH 2BZAA 1GJ4H 1BA8B 3H7TA 1RTFB 4ABAA 2G00A 4X6OA 1BCUH 2QV1A 5ESBA 3BIUH 3MU0A 3U98H 2ZU4A 4ZH8A 1AGJA 1QL7A 2O8UA 3GY7A 2PUXB 2Z9IA 1MTWA 1SGCA 1V2RT 1NRPH 3FZDA 3U1JB 2SGDE 1LHDH 5HGGA 1O3GA 2QXHA 1YPEH 2PGBB 3SV6A 4Y71A 2BQWB 4Y11E 1ZYOA 3UNRA 3ZVEA 1NRQH 2FOCA 1O2WA 2H6MA 1UJ1A 4DGJA 1GBDA 3A88A 1ZR0A 3NPSA 3STJA 3SW2B 2R2MB 1FY1A 2WPLS 9ESTA 3PTBA 2A4RA 1C2EA 4JK6A 1QY6A 5FPSA 3CP7A 1XUGA 3SGBE 4TYDA
chains in the Genus database with same CATH superfamily
1GCDA 3PWBA 3DSGA 2FIRH 4I32A 3F2GA 2XBWA 2ZU5A 3RXQA 2DE8A 1HJ9A 1YP9A 4LZ4B 5LPFA 3ZVCA 2P94A 1EPTC 2P93A 5DP5A 2G4TA 2BX3A 5FXLA 2ZHQH 1HAPH 1S0RA 2FM2A 3VB5A 4K2YA 3A8AA 5AFZH 4CRFA 2J95A 1FLEE 2HALA 3MI4A 3RU4D 1C2GA 1COWD 2ODQA 2AH4X 1SQTA 3RXKA 2ZHFH 2ZDKA 2R0LA 1TX8A 1P8VC 1AB9C 1SGPE 2WPMS 1ZJDA 4BTIB 1YPLH 2BVXH 5C67A 3A80A 4DIIH 3SGQE 1LCYA 1L1GA 1A0HB 3SI4H 3GCTF 1QB6A 1HXFH 2ANWA 2BLQA 3SV9A 2STAE 1O2HA 4P00A 5ESTE 1GG6C 1F0RA 2GV7A 1WXRA 3QZQA 1DUEA 1WOFA 2FTLE 1O5DH 5LPEA 4BXSA 1O2ZA 3VB6A 1MKWK 3E90B 4NIWA 1HAVB 1CHOG 1YGCH 3MU8A 1ZPCA 1O31A 1AUJA 7LPRA 5C1UA 2NU1E 5E2OA 3UIRA 1BTWA 3SBKA 1UW7A 1BB0B 1ZRKA 1J15A 1TRMA 2CK3D 3SOSA 1WU1A 2QN5T 1NBMD 4UFDH 3RC4A 2ZI2H 2ODPA 1O3BA 3SUGA 5DKMA 1OWEA 1H8DH 1Z1IA 1KDQA 1OX1A 2G5VA 4FUIA 1O37A 1H9HE 2JJ1D 3E1XB 1GHWH 1E35B 1L1NA 5AVDA 2EI7A 1RIWC 3P8FA 3L3TA 1GBJA 3MFJA 4FOUC 1AZ8A 1LPGB 1MTNB 1WTHD 1KTTB 4B2CA 3T25A 1F5KU 4LXBH 4HG6A 1ZSLA 3FP7E 1EQ9A 3MO6A 1ANCA 2Y5HA 3VPKA 1FPHH 2BX4A 1GBIA 4TWYA 6CHAB 1JMOH 2HNTF 2BM2A 1HAZB 5LGOA 1SI5H 5C0UA 1C2IA 1XVMA 5A0CA 1UTQA 4MNVA 1TPAE 2FLBH 2ZCKP 4AB9A 4TWWA 4X6NA 3RXPA 5DN6D 3RLWH 1Y3YA 1C1VH 1C9TA 3B23B 1SL3A 2VU8E 4WY3A 3AAVA 4BANB 2V3MA 2FOFA 1HCGA 3RXLA 4E7NA 2R3UA 5B6LA 3GY5A 1UVOA 4JYTA 3KL6A 1OSSA 2ZCLP 4TPYA 4Q4LA 1C5UA 3VXEH 2QE7D 1QA0A 2OC0A 1SC8U 1DSTA 2Z6BD 5C1XA 3IG6B 5E0GA 1MTNC 2Z9LA 2ZDAH 4YO9A 4J2YB 1AVWA 2F43B 1MAYA 3MNXA 6LPRA 3U8TH 1TGNA 3SNAA 4FUDA 1AWFH 1JOUB 4ISHH 1EXFA 1BRCE 3GYMA 4ASUD 1AMHA 2IPHA 1CQQA 3SJKA 1K22H 2FOEA 1GBKA 3O8BA 1Z1JA 1GJ5H 5TCAA 5A8ZA 1EAIA 4YXWD 3PLPA 3RM0H 4D76A 1C4Y2 2J9NA 3TJNA 5GDSH 3QWCH 3T2NA 4DVAU 2PKAA 3QX5H 1XUJA 2UUYA 2B5TB 1SPJA 3HATH 2BXUH 2HLDD 4BAHB 1QNJA 1KYNA 3SV8A 2AS9A 1GJ9B 4H6TA 1A0JA 4UONA 4B2AA 1AQ7A 2PLXA 1NS3A 3GDSA 1HB0B 1EB2A 2BB4A 3KGPA 2IPQX 3L33A 2ZA5A 3RXFA 1GCTB 1V6DA 2A2QH 1O3PB 3SNDA 2XCFA 1BMLA 2ZU2A 3ENSB 3NXPA 4FUGA 5DP4A 1E1QD 1ZGVA 2Y5GA 1YLCA 4FUJA 1W12U 3RU4E 1GI5A 1QJ1B 1S84A 2XYAA 3ODDA 1Z8JB 1XXDA 2A7JA 3AVZA 1DANH 1BTHH 1EUFA 1O35A 4JMYA 2FEQH 1NY22 3NK8A 2D26C 1H8IH 3PMBB 1O2LA 3LH3A 3Q76A 1ELDE 1A0LA 4A6LA 5H4IB 2W7SA 2FXRA 2LP6A 1T8LA 1O34A 1O30A 3LKWA 3BTEE 1SBWA 1O2IA 4O3TA 4JZDH 3SU5A 5A0AE 1C1WH 1JWTA 3A81A 1A5IA 4FUCA 1SR5C 1GI0A 8KME2 2A1DB 1GJDB 1UVSH 2QF4A 2PFEA 3V12A 1YM0A 4OGYA 2PW8H 2ZGXH 4IS5A 3LJJA 3ZVAA 2OCVB 3GY8A 2FO9A 1HDTH 1EJNA 4AX9H 1FV9A 2FP7B 4ABBA 2VIWA 4RT0A 2XCNA 2OD3B 4GCHF 1VGCB 1DLKB 2KCYA 2Q6DA 2D1JA 3ZVBA 1BTXA 1XKAC 2ALPA 1TX7A 3R0FA 2W6JD 4NCYA 3BTDE 2XW9A 1D6RA 2PKSB 1O2VA 1ACBE 3RXIA 1HNEE 2ULLA 3FFGA 1TGCA 1LMWB 2P8OC 3ZV9A 5EXMA 5JB9S 1KXDA 4Y0ZE 1SVPA 4U32A 4QT8C 1GI8B 3ZZ3A 3LJOA 1DY9A 3KF2A 2Z3EA 3LPRA 3SU4A 1HAVA 1Q3XA 1V2ST 3BV9B 1P09A 1HXEH 3LGYA 3MH7A 5DP8A 1QB1A 5CMXH 3D62A 2L74A 1IHSH 3P8GA 7KMEH 4I8LA 1BTPA 1LQEA 4FXGH 1F0TA 3FO8D 1FUJA 5CHAC 1OP8A 1YLNA 3PMHB 1FONA 1EPTA 3EDXB 1TPOA 1LHGH 3ZZDA 1V2QT 1IQIA 1Z6JH 2ZKSA 4JZ1A 1G3CA 3VGCB 2HPQH 1TGBA 1Y5UT 2A4OA 4Q7XA 5DJ7A 3M7QA 1P9UA 5L2ZH 2ZDMA 4CRBA 1HIAB 2OC1A 5EXLA 5GWZA 2Y5FA 1C2KA 3SU1A 1KLTA 1TRNA 3P8OA 2J92A 1CT4E 1OWHA 2BDBA 1TONA 4O9VA 1A61H 1C5YB 3P92A 4ZUHA 3IITA 4AOQA 1NRNH 3OY6U 1C1QA 3RXDA 5K0HA 4WMFA 3A89A 1CE5A 3LGWA 1HAGE 1SGDE 3LGVA 5FX6A 1YCPM 3BSQA 3KCGH 5EODA 2A45B 1KMHB 5GPIB 4HGCA 1YPHE 5A09A 4ABEA 4THNH 1IOEA 4I8KA 4X8SH 2TGDA 2GDEH 2K0QA 2TBSA 1UK2A 4OS6A 1QL8A 1YPKH 4R0IA 1VCPA 2W6ID 4Y8XA 1ELCA 2KCOA 3TVJB 1C9PA 3OEHD 3S9AA 3GISB 1TOCB 2JJ2D 1Q2WA 4TY6A 1TA6A 3FP6E 4H4FA 1AWHB 3GDUA 3SUFA 3RMMH 4ISNA 1MZDA 1GDQA 1EP6A 2F9BH 1JIRA 1GI4A 3PO1B 2P3FH 4ZXXH 4K8YA 1HPGA 2WV4A 1GMHG 2HNTE 4FU7A 2AEIH 3RXCA 1ZJKA 1QCPA 1N1LA 3DSOA 2BD2A 2H9TH 2WV9A 3GCHB 4R8TB 1QIXB 1D3TB 1D6WA 5FCRA 1PQ8A 1ABJH 1MH0A 1A4WH 2VGCC 1C5WB 1O3EA 5E2PA 1A5HA 3BEUA 4YOJA 3F0PA 1NROH 5LH8A 3M5LA 1ETRH 3ATLA 3UTUH 1TOMH 3A7YA 1K1PA 1BRBE 2J4IA 1YBWA 2I6QA 4ISIH 4Y6DA 1UTLM 3UR9A 1PQ7A 1N8OB 2EI8A 1IQHA 1TRYA 4FVBA 5DP9A 1LKAA 4D9RA 5KECA 4A7IB 1DLEA 3EA9A 1SGYE 1O2OA 1X7AC 3FP8E 3TITA 4WH8A 1CSOE 1GVZA 1XX9A 5EXNA 1BDAA 1RJXB 2JETC 2AIPA 1S6HA 1TMTH 1RXPA 1C5QA 2CHAC 3KQCA 3PV2A 1V2LT 3Q77A 3TH2H 1C2MA 3A87A 1O2NA 2BOKA 2STBE 5GJ4B 2VIDA 1S6LA 4DCDA 1IQKA 4F55A 3SNBA 2F83A 4ZHMU 4AYYB 2BD8A 3R3GB 1A1RA 3P6ZB 1UO6A 4AYVB 4I33A 2BHGA 1BHXB 4ZKRU 2CJIA 1ZLRA 4ZKNU 2UUKB 1OKXA 4NWLA 5HYOA 4JZIA 2GZ9A 4UFFH 3W95A 1Z8GA 1CT2E 2ODYB 5EQRA 1JIMA 3QO6A 3VEQB 3GCNA 4KKDA 5EQSA 3BTWE 2EEKA 2GP9B 1P05A 1T8MA 3ZZ5A 5JBTA 1FN6A 1C5ZB 1GJCB 5HM2A 2FS8A 8LPRA 1G2LA 1XVOA 3ATKA 1MKXK 1SGRE 1UTNA 2CMYA 3PRBA 2ZHWH 1CGJE 2ZPQA 3RMNH 2H2ZA 2PUQH 3TH3H 1EB1H 2R2WU 5GCHF 5F6MA 2GCTC 2KAIA 3TGKE 1O3NA 2OQ5A 2GTBA 2A5IA 2XWBI 2FZZA 2YNBA 1O3FA 2EY4C 3KNXA 1WDIA 2ZFSA 2RA3A 4IN1A 1GVKB 1IQEA 1O2SA 2QXIA 4UFGH 2KX4A 3WWFA 2G51A 1GMCG 4H6SB 1XUFA 5EOKA 3SQHE 1D3DB 3ATMA 1WBGB 1E37B 2BVRH 2XWAA 1OWIA 1AE8H 2FESH 2JH0D 1MCTA 1MQ6A 1BUIA 1SOTA 3MH5A 1H1BA 4TY7A 1OWJA 4KTSA 4ZMAH 1B0EA 3RMLH 3L6PA 1ESTA 4Y8YA 3GICB 5DO4H 1DWEH 4MPXA 4CRDA 2OBQA 1SG8B 2YMSD 4HFPB 4B75A 4IW4E 1T4VH 2OK5A 4ZKSU 1YCPK 3SJ9A 1SGQE 3P95A 1V2PT 1ELGA 1O2MA 1W14U 2ZCHP 3BG4B 4WVPE 2WZQA 3SU0A 3N7DA 4E05H 2B8OH 1K1MA 1O3OA 3QDZB 1HJAC 4K69A 4NZLA 1DVAH 2VH6A 1SFIA 5FPYA 3TIUA 1O5FH 1GBHA 4DT4A 1NTPA 2V3OH 2GZ7A 2GVFA 2Z9GA 4JZEH 1SMFE 1YYY1 1L4DA 1GL0E 1PJPA 2IJD1 1B7XB 1GJ6A 1HUTH 3A7WA 1ZOMA 3GCHC 1DITH 1F2SE 4K8BA 2FI5E 2G52A 2G4UA 1YY3A 1YPJH 4WMEA 4MQAA 1HAIH 3OAAD 4ZKOU 1GDNA 3MU5A 5AFYH 2ZP0H 2L6OA 1BBRK 4JYVH 1EATA 1GMDF 3F9HA 4VGCC 2BD5A 3QGJA 1P2MA 7GCHG 4XSKU 4DY7B 1BJVA 8GCHF 1PYTC 3C27B 2AERH 1LVOA 1BMNH 4ZCNA 1NPMA 1UK3A 1DWCH 2BY8X 1QFKH 1K9OE 2IJOB 2XTTB 4ACAA 1GHVH 3LU9B 1P10A 1SGNE 2PV9B 1SLWB 1UMAH 4Q7YA 2RA0A 1TFXA 1O2RA 2WUCA 3NCLA 1TGSZ 4U30A 1MZAA 4YTAA 3M37A 3EQ0H 3A84A 5GCHG 3F9GA 2I6SA 2A5AA 3U1IB 3F6UH 4B6FA 5BRRE 1BZXE 1DS2E 1SGIB 1A5GH 3MO3A 2KM0A 1J8AA 1NFWA 3A7VA 3BEIB 3PRDA 4WJG2 3M7TA 1SLUB 1PYTD 2GV6A 1K1IA 4IBLH 1W10U 1O3CA 2A31A 1S0QA 1E36B 2FI4E 2RG3A 4AFUA 1MU8B 3A7TA 2A4QA 1EFRD 1RS0A 1SQOA 1O3MA 1TX6A 1AZZA 2ZHDA 1C5TA 3FANA 5KGOA 1VKYA 5ABWA 4TSFD 2ANYA 1WV7H 3VB3A 6GCHF 1L1JA 3GY4A 5EG4A 5DP6A 2FODA 5T6GA 3UUZA 1PQ5A 1TABE 1K28D 1Y8TA 2YMSB 1E1RD 2GT8A 3GS9A 2OC7A 3VG8A 1ZHMA 4YLUA 1AD8H 2V6NA 5C5OA 1C4U2 2F3CE 2J34A 1W8BH 1C1PA 3MYWA 4Y0YE 5F53A 1O3KA 4KGAA 1LHEH 1ZTKA 1XUKA 4BOHA 4MNYA 3WWBA 2DE9A 3SZEA 2FOMB 4NWKA 1DT2A 1YLDA 3N7OA 1ZTLA 1QJ7B 5A8XA 1RGQA 3TK9A 5FBEA 2C8XB 1ID5H 4ZHAA 1LVYA 2HGTH 2M2AA 3BTHE 1FZZA 4LOYH 5HKKD 1AUTC 1V2TT 3S9CA 1YPMH 1BITA 3TNTA 1QURH 4RKJB 3RXRA 3QN7A 3DFLA 3RP2A 4GPGA 5B6OA 2KAIB 1SGEE 2FDAA 4K3JA 5JPMH 3SORA 1GBEA 1AU8A 1GI3A 2QIQA 1SQRA 1O2UA 1H8ED 1ANBA 1OYTH 3GCOA 2FPZA 1ZMLA 2W7UA 2YNAA 3ZZ6A 3TU7H 5L2YH 2K1QA 1UTOA 1J16A 1BBRE 1H9LB 3MMGA 4X8VH 1QZ8A 1XXFA 3Q3YA 1SGTA 2QYIA 3S7HB 2FYRA 2BVSH 5GXPA 5HXFA 3RM2H 1HLTH 2GT7A 3PV4A 3A82A 3SJ8A 1LPZB 2H5DA 4X1NU 3STIA 4BAKB 1KXEA 2BQ6B 2H9HA 4GVUA 1LPKB 2AGIX 2V3HH 1GHAF 2WPDD 2UUFB 2BY9X 2GMTB 2XC5A 5DP7A 3TGJE 1P2QA 1AN1E 2KCPA 4KTCA 5L30H 4WXVA 2OINA 4CBNA 5TJXA 5JBBS 4AFQA 4NGAH 4NIVA 3OEED 3M3TA 2W5EA 2ZF0H 5E0HA 1DOJA 5EPYA 3WY8A 3NUMA 1ARBA 1C1MA 4BAQB 2SGPE 2ZNKH 1WYKA 3HKIB 1EAXA 4BTUB 1THRH 2BY7X 2ZC9H 2Y80A 3LOXA 2OQUA 1S6FA 2P3TB 1NU7B 4O97A 3RC5A 2NU3E 4OS2A 4MPUA 1HGTH 1SGFG 3M61U 1DPOA 4CHAC 1Y5AT 2HNTC 3OTPA 3P70B 3F9FA 2F9OA 3ATWA 3KEEA 3E91A 2CHAB 1F92A 1GMDG 4WMDA 3RU4T 3AW0A 1V2VT 1SHHB 1T4UH 2BY6X 5C0TA 5CDFE 4D9QA 1NESE 1EZQA 3F2FA 3FOAA 1O2TA 2WYGA 2H5CA 2BDYA 2ZTYA 1MTVA 3I77A 2NU0E 4X0WU 2WINI 2ZHEH 3CS7A 1FNIA 2QXGA 4ABGA 2GMTC 2AGGX 4X2WA 2KZ4A 3VFEA 3QLPH 1P57B 1VZQH 4Q80A 7GCHF 1EAUA 4FUFA 4KTUA 5FX5A 1KIGH 3AW1A 2YMSC 2ZDNA 3NKKA 4B76A 1YF4A 2C8ZB 2W26A 1THPB 2ZFQH 3RXOA 2B9LA 5EW2H 3ZVDA 3RXGA 1AO5A 1D3QB 1YCPH 4XE4A 1FI8A 2RDLA 4CRAA 1TQ7B 2AMQA 3K6YA 5T1VA 1RFNA 2IOTA 2O8WA 2Y82A 3OTJE 4CH2B 5C3NA 1TAWA 2JDID 2G81E 1KSNA 5HM9A 3OSYA 5L6NH 1O38A 4CREA 1FQ3A 1DDJA 1CHOF 1ORFA 5TCCA 3A83A 1IQMA 3A86A 1HRTH 2LPRA 2BDGA 1C1OA 4I31A 1LO6A 5FHTA 4ISOA 1ZMJA 1CVWH 1EZXC 3SV2H 2LNCA 1GJAB 3M3SA 2RDEA 1NRSH 3KQBA 3BTTE 5FBIA 1IAUA 3TNSA 2ZGHA 1CA0C 1HAHH 4B74A 3VB7A 2JH6D 4UDWH 4Y76A 4MDSA 1O5AB 3K9XB 4NFFA 3RLYH 3ZVGA 1ELVA 2BY5X 3SHCH 2Y6TA 1C2FA 1BTYA 2ZPSA 2JETB 5DSFA 1O2GH 4KP0A 4Y8ZA 4X1QU 1MU6B 2XBVA 3EA8A 2AMDA 2F9PA 1W0KD 1HIAA 1NT1A 3PV5A 2UWOA 1FDPA 4X1SU 3EE0B 5LPRA 2VIOA 2ZU3A 5IYTA 2HVYB 4WWYA 2V35A 3UR6A 1GMCF 3LC3A 3SN8A 1O5CB 4FVDA 4MG3A 4DIHH 1XKBC 1O3IA 1BTUA 3LC5A 1UVPA 4J1YA 1E0FD 2JIZD 4CBOA 1V2NT 1TNJA 3ZZ8A 5C94A 1INCA 2GD4B 5JB8S 2VWMA 2A0QB 2GCHF 2HRVA 1EPTB 3RXMA 1JRTA 1K21H 3A8CA 3MWIU 1LQDB 4ESTE 5F8XA 1V2OT 3DSPA 3T27A 4BXWA 1EZUC 4NIYA 1DXWA 4YT6H 1UVTH 1GG6B 5E8EH 4U01A 3EGKH 4FU8A 2F91A 5A0BA 1EASA 4DJZB 2PSYA 3PM3A 2HWLB 3RXAA 3SUEA 2A7CA 4X1RU 3OFND 2P8OB 4ABHA 5CHAB 6CHAC 4NZQA 2BD9A 2ZFTA 2QY0B 4RI0A 2A4GA 2VH0A 1RD3B 2XOKD 4AGJA 1EOLA 4WH6A 2CF8H 1GBLA 1ZGIA 2PSXA 3T26A 1PPFE 1W0YH 2C3SA 1SGFA 1NFUA 3EA7A 3GY2A 1MBMA 1K1OA 5EU8A 2FOHA 4OS5A 1KLJH 1W7GH 2F4LA 1B0FA 2XBYA 2HVXA 4IGDA 4GAWA 4YZUA 1P03A 1AFQC 2Y7ZA 1C5PA 1GGDB 3VB4A 1GDUA 2KFWA 2P59A 2QC2A 4NA9H 1NU9A 1W11U 1B5GH 5EGMA 3H7OA 1EP5A 4AORA 5FAHA 2JKHA 4MVNA 2PKSC 3FAOA 2BMGB 2J2UA 1ESAA 5C1YA 4INKA 2PGQB 4MPVA 2F9UA 1EOJA 3T28A 4AFSA 4PROA 1FAKH 1MABB 1T8NA 1TNKA 3HGNA 1C5RA 4FU9A 3MHWU 3N7EA 3A7XA 5HIYA 3P8NA 2B7DH 4FETA 2VNTA 2BYAX 1P02A 3HKJB 1HAXB 3SJIA 1GHZA 1DWDH 3PLKA 1TLDA 1V2MT 3V0XA 1G32B 3S69A 3GCTG 4GLYA 5EQQA 1QTFA 2ZEBA 1KDQB 2R0KA 1V3XA 2VJ1A 2FYQA 2SNWA 3CS0A 4ABFA 3RDZA 1GBTA 2F9VA 2A2XH 3CENA 1CBWB 4YT7H 3LGIA 1QRXA 4ZXYH 1GBFA 4Q7ZA 3E0NB 1ELAA 1ZTJA 1OXGA 2FI3E 2OUAA 1VCQA 3ZZCA 2XNIA 1AI8H 3B8JA 3NWUA 2PR3A 1NN6A 1W13U 2BDAA 3QTVH 5HIZA 3URDA 1TA2A 1A3EH 1O32A 1TPSA 3IWMA 5JYIA 4E7RG 4RN6A 1TB6H 1D4PB 1PPCE 2GZ8A 1VR1H 2SGFE 5DP3A 2Q6FA 4IMQA 1BRUP 5EJZA 3ESTA 6GCHG 1DWBH 1TNLA 2PKAB 2V7QD 1IQFA 1DSUA 5A2MH 1A46H 1DE7H 1HFDA 3SV7A 4NIXA 5DPAA 3ZZAA 3K65B 3V3MA 4ABJA 1KLIH 3UOPA 1D9IA 1MUEB 4X2XA 3OU0A 2IN2A 1P2KA 1DUAA 4K60A 2BXTH 1O5EH 3DUXH 3T5FH 4GHQA 1P12E 3QTOH 4LK4A 1G37A 1C5NH 1GBBA 4AG2A 2W3KA 1ZMNA 3KIDU 4NSYA 4TPIZ 1P9SA 2Y7XA 2SGQE 5T3HA 3EAJA 3SUDA 1AHTH 4A1XA 4AFZA 1IQNA 1ELEE 1RTLA 2FLRH 3FKSD 1Y3XA 3B9FH 1QHRB 1FY4A 3U8RH 3SI3H 2A7HA 1LTOA 1NFYA 4MTBA 2ZFPH 3TGIE 2RCEA 2XC0A 3PMAB 1DM4B 1GI9B 1F0SA 1CGIE 3I29A 3VGCC 4CR5A 3HPTB 2XBXA 5IDKA 1RTKA 2ZZUH 1O3HA 1F7ZA 1K0HA 1KXBA 4X8UH 3D65E 1S82A 1W0JD 3RXEA 1O0DH 4NSVA 8GCHG 2XNDD 4DURA 4TT3D 1GBAA 4YM9A 3V13A 1QBOA 4ISLA 3MTYA 1QRWA 5F8TA 7ESTE 4VGCB 1Y5BT 2BDCA 1YPGH 1ETTH 3T62A 4K1TA 1TMBH 3LONA 1C5VA 2C4FH 1O3DA 2VVVA 1S5SA 3RXTA 1SKYE 3U8OH 1YWUA 2EI6A 2FX6A 3CNRA 2J94A 2BDIA 5DK1A 4BNRA 2JH5D 4CR9A 1MD7A 2PTCE 1QGFA 2XRCA 4D7GA 1LDTT 1QQUA 2H1UA 1OHHD 2ZGBH 3PROA 2EA3A 4O3UA 3E3TA 3RXUA 4B6EA 2ZDLA 1BMMH 1NM6A 2NU4E 4ASHA 2BDHA 1EJMA 2ZPRA 2AIQA 1DX5M 1O3AA 1PPGE 3HK3B 4UD9H 2OTVA 1ETSH 1FIZA 1LHFH 1PFXC 4K1EA 4JZFH 2FWWA 2J98A 5CHBA 4FUHA 2C8WB 2Z9JA 4BTTB 3FVFB 3D49H 4B73A 3OX7U 3WW7A 1Z8IB 4MNXA 4CH8B 3O8CA 5AF9H 1GMHF 1MKXH 4I8GA 3QUMP 4OM9A 4HTCH 2P16A 1GHBF 2TGPZ 1CHGA 2FX4A 3LIWA 3G01A 2AMPA 2XC4A 6ESTA 1C5SA 1Z6EA 1QRZA 1ANDA 2VIPA 1ELTA 2O8MA 3ITIA 1SB1H 3JZ2B 1KY9A 4WXIA 2ZG0H 2F9NA 3UFAA 3DD2H 1AB9B 4BAMB 3SU6A 4A92A 3BTKE 3E16B 4XRNA 3SGAE 3E8LA 1DFPA 3BF6H 3I78A 3ODFA 4X2YA 4I7YH 1P3CA 1WSSH 1AFEH 1OP0A 1AY6H 2OXSA 1CA8B 1TGTA 1K2I1 1HV7A 1WTGH 1FMGA 3E0PB 4DOQA 1GHYH 3F9EA 5K7RA 2PTNA 3HK6B 3ZYDA 3S0NA 1G3DA 1CBWC 1PPBH 1ZZZA 1C2DA 4K1SA 1YC0A 1FX0B 1YPHC 2H9EH 2ZQ1A 4Y7AA 5C20A 3GY3A 4AB8A 3UPEA 3BTGE 3MNSA 1P06A 4DG4A 4Y7BA 5G4BA 1AIXH 3V7TA 2YOLA 2QF0A 1UTJA 2WYJA 3DA9B 1MTSA 2WPHS 1O2KA 1LVBA 1OYQA 5JDUB 3ZYEA 3URCA 1J9CH 4GSOA 3TLOA 3PMJA 2FOBA 4MPWA 2C8YB 1MAXA 3M5OA 1K1LA 1T7CA 2TRMA 1GI7B 2J97A 1P11E 1NC6A 2ANMH 5DG6A 3FN8A 4Q2KA 2GKVE 1UTPA 3SU3A 3DCLA 2QAAA 1J14A 1AFQB 1GI1A 4AZ2B 1ESBA 1UCYH 3RXBA 3BTFE 3K2UA 1E34B 3MOCA 1O3JA 4JYUH 1IQJA 2VIQA 3M35A 4IC5A 4ZAEA 4JK5A 4B2BA 1V2JT 2QXJA 1V2WT 2BQ7B 1A2CH 2G55A 1MMJN 2FMJA 3UOUA 2AYWA 4OS4A 2HLCA 1O5GH 2SFAA 3ZZ9A 3OY5U 2ZU1A 3LDXH 1BT7A 3NRLA 4SGAE 2BLOA 3RXJA 1P2JA 2BTCE 2ZIQH 1PPEE 1O2YA 1BIOA 1J17T 1V2UT 1UVUH 1TWXB 1VITH 3TK6A 2NU2E 4XBCA 4OS1A 1N8OC 4NG9H 1VGCC 1L4ZA 1UCYK 5EIYA 1P04A 2SGAA 3ATIA 1F5LA 1S81A 1C2LA 2GCHG 3SYJA 3UNSA 1Z71A 1TNHA 1XM1A 3Q00A 3SHAH 1O39A 3RXVA 1K1NA 2THFB 2TIOA 2R3YA 1OWDA 5J4SA 4Z0KA 3EE7A 4UEHH 5C5NA 1ZPZA 1QL9A 4XDEA 2GGVB 3QZRA 3S7KB 1DXPA 2WUBA 3VXFH 3ZV8A 8ESTE 3GDVA 1OP2A 4Q63A 3LH1A 2QA9E 1O36A 4F4OC 2WSSD 2Q6GA 2OBOA 3DHKH 2GX4A 1TPPA 2FOAA 4RSPA 2J5UA 4ZROA 3BEFB 3ZZ7A 1NO9H 1GBMA 2ASUB 5FCKA 1ZSJA 3KHVA 1THSH 4O03A 3Q3XA 1BRAA 1GJ8B 3H5CB 1WQSA 2HOBA 3M5NA 3SZNA 3ZIAD 1UHBA 1CGHA 5T6DA 3MO9A 1TE0A 2O8LA 1PPHE 1MD8A 5BPEA 3UWIA 1BHXF 5HMAA 4M7GA 3DT0H 4YLQH 2ESTE 3JZ1B 3KYGA 1EJAA 1G3EA 3MNCA 4HZHA 1OPHB 3A8BA 4BAOB 2PWXA 1Z8RA 1P2NA 2QF5A 1HBTH 1TQ0B 2CF9H 1NZQH 1WAYB 2KCAA 3LGTA 1H4WA 1OWKA 3M36A 1HJ8A 4A5TS 3LGUA 1RRKA 2GDDA 1TBRH 3O8DA 4ZHLU 1TNGA 2ALVA 3PLBA 4IC6A 1IQGA 1T31A 3TJOA 2QGRA 3AK5A 4UE7H 4GCHG 1P0SH 4FUBA 4M9FA 3SNEA 2FTMA 1QA7A 1HAOH 1N6YA 1YKTA 4FUEA 2WPKS 1JXPA 4XOJA 1D3PB 5PTPA 3SQEE 1EAWA 5IK2D 1PQAA 3OYPA 1O2QA 1SLXB 4I86A 3Q3KA 5GNDA 1G30B 1LVMA 3RC6A 4B71A 4E06H 2TGTA 4YESB 4KELA 3MU4A 1AKSA 1ANEA 3MQKC 1KXCA 1RIWB 2J38A 4A1TA 5FPTA 1SHYA 5I25A 2BD3A 4F49A 4SGBE 3UQOA 1ELBA 1ZHPA 2TPIZ 2SNVA 4HI3A 4X8TH 5AHGH 2AHME 1GGDC 3SU2A 2VWNA 1FY3A 1P3EA 2K8IA 1BTZA 2OC8A 5A8YA 1FAXA 5DGJA 1C1SA 4IMZA 1G36A 2AGEX 3U69H 4ACBA 2EC9H 1LKBA 5EJLA 1SSXA 1C4V2 4NA8A 1FXYA 1W2KH 2FS9A 2GJGA 1UCYE 1ARCA 2ILNA 3ELAH 1W0ZU 4X6PA 1O2PA 1GJBB 1QR3E 5ETXA 2VWOA 3KQEA 1CA0B 2ZWLH 1P2OA 3GYLB 1MKWH 3SJOA 1GWAA 2Z3CA 4Z6AH 4CRGA 2G5NA 2WHXA 1AVXA 1GHXH 1T32A 1WQVH 3M7UA 3NZIA 2NWNA 5SGAE 1A7SA 1FY8E 3K6ZA 1O3LA 1HAYB 1VJAU 2R9PA 3T29A 5F03A 1UTKA 9LPRA 3MH4A 2ZO3H 3RXHA 1TMUH 3RMOH 1ZRBA 1SOZA 3M3VA 4INLA 1C1RA 1DY8A 2ANKH 3M5MA 2QCYA 2VGCB 4I8JA 3UY9A 4K5ZA 1DICA 1C1TA 3PYHA 1FY5A 1FPCH 3D23A 1C1UH 1O5BB 1TNIA 1U6QA 2ZGCA 1HYLA 1FJSA 1VITF 1S83A 3SNCA 2RFKC 1GJ7B 3DFJA 3UNQA 3F2HA 2PP6A 3UREA 1QQ4A 1AVGH 1Y3VA 1E38B 4LZ1H 2Q1JA 5J4QA 4OGXA 3E6PH 4H42U 1OS8A 2BOHB 3F1SB 2KR7A 1TBQH 4XBDA 1G9IE 4D8NA 1KTSB 2G8TA 1BMAA 2UWPA 3PB1E 2VIVA 3FZZA 2EQNA 3MU1A 3SO3A 5I46H 3U9AH 1PPZA 4JCNA 2BLVA 2ZTZA 2ZDVH 1LHCH 3AASA 3LT3A 1KXAA 1NBME 1SLVB 2ZTXA 3GY6A 1QJ6B 1SFQB 1ABIH 3W1EA 2V0BA 2SGEE 2ZGJA 3BIVH 5KEDA 1GCTC 2FOGA 1BMFD 1MTUA 1O2XA 1S85A 3PO1C 3O8RA 4CHAB 1TBZH 1V2KT 4WF8A 2P3UB 1Y3WA 1L2EA 1MCVA 4P02A 1P2IA 1C5OH 4AG1A 1A3BH 3MNBA 4XFQA 1CO7E 3ZZ4A 1EZSC 4X1PU 3GOVB 1XUHA 1Z7KA 2AFQB 1GPZA 2W3IA 3AAUA 2M5TA 1TYNA 1Y59T 1EKBB 4Y10E 1F0UA 3EYDA 4A1VA 3ZZBA 2UUJB 1O2JA 4NA7A 3RXSA 2C93B 3KQ5A 1GI2A 1JBUH 1AE5A 3W94A 1VJ9U 2Z3DA 1MQ5A 4ABIA 3RUOA 1BOQA 4GHTA 1L0ZA 3QGNB 1FIWA 1AKSB 4Z1MD 5EJ1A 1ZPBA 1IQLA 3C1KA 2CV3A 1OOKB 3TH4H 3UQVA 3P17H 3KQDA 4ABDA 3KN2A 2A32A 3QK1A 5T6FA 1C5LH 4X2VA 2LELA 2Z7FE 3F68H 3PTNA 1TIOA 2Z9KA 3TJUA 1Y3UA 3KYFA 4INHA 3TK5A 1XUIA 2WPIS 4Y79A 2ZQ2A 1T8OA 2Z94A 1BJUA 5C17A 2D8WA 2C90B 4I8HA 3ZVFA 2TGAA 3H09A 4UFEH 4CRCA 2OLGA 1K1JA 1QB9A 3MH6A 1CU1A 2P95A 5FL7D 5C2ZA 4MLFB 1G3BA 5F8ZA 1BQYA 1WUNH 5EPNA 2XXLA 2BLWA 3A7ZA 2A5KA 2VINA 4GUXA 1C1NA 1VCWA 3A85A 3BN9A 4B1TA 2VB0A 2WV5A 4X6MA 1XMNB 3A8DA 2ZFRH 1UTMA 1SQAA 1QBNA 1F5RA 5JBAS 1C5XB 4DW2U 2B0FA 3BTME 1GVLA 2D2DA 2VVCA 1UHBB 1ZHRA 2ZECA 2QF3A 1W7XH 1GHBG 3BG4C 4D7FA 1IHTH 1G2MA 3F0OA 4DT7B 3HGPA 1KXFA 3TPIZ 2OP9A 1EX3A 3N99A 3S9BA 2DUCA 1GI6A 4F48B 1QBVH 4U2WA 1WCZA 4YOIA 3BTQE 4AN7A 2ZFFH 1UK4A 2PHBA 4NFEA 2BD7A 1CT0E 4OS7A 4YOGA 4IN2A 1NFXA 1BBRH 5JBCS 1O33A 2CGAA 3UWJH 1H8HD 1MBQA 1M9UA 4MNWA 1N6XA 5CE1A 1FN8A 2BD4A 2O8TA 4RKOB 1P01A 2BZ6H 2VWLA 1Q31A 2WPJS 2Y81A 1TALA 4RT1A 4XBBA 1VITG 2UWLA 1W3CA 3TJVA 1GBCA 2O9QA 1C2JA 1H9IE 3UAIC 2GCTB 4AGKA 1C2HA 1ELFA 5E0JA 1ZSKA 3PWCA 2J98B 1HJAB 2VVUA 2HPPH 3BG8A 4AC9A 1GHAG 1GL1A 2CXVA 2CN0H 3F3BA 5EW1H 1C5MD 1JRSA 5GIBA 1NRRH 2BZAA 3UB0A 1GJ4H 1BA8B 3H7TA 1RTFB 4ABAA 2G00A 4XD7D 4X6OA 1BCUH 2QV1A 5ESBA 3BIUH 3MU0A 3U98H 2ZU4A 4ZH8A 1AGJA 1QL7A 2O8UA 3GY7A 2PUXB 2Z9IA 1MTWA 3OE7D 1SGCA 1V2RT 1NRPH 3U28C 3FZDA 3U1JB 2SGDE 1LHDH 5HGGA 1O3GA 2QXHA 1E79D 1YPEH 2PGBB 3SV6A 4Y71A 2BQWB 2VBCA 4Y11E 1ZYOA 3UNRA 3ZVEA 1NRQH 2FOCA 1O2WA 2H6MA 1UJ1A 4DGJA 1GBDA 3A88A 1ZR0A 3NPSA 3STJA 3SW2B 2R2MB 1FY1A 2WPLS 9ESTA 3PTBA 2A4RA 1C2EA 4JK6A 1QY6A 5FPSA 3CP7A 1XUGA 3SGBE 4TYDA
chains in the Genus database with same CATH topology
1GCDA 3PWBA 2FIRH 4I32A 2XBWA 2ZU5A 3RXQA 2DE8A 1HJ9A 1YP9A 4LZ4B 5LPFA 3ZVCA 2P94A 1EPTC 2P93A 5DP5A 2G4TA 2BX3A 5FXLA 2ZHQH 1HAPH 1S0RA 2FM2A 3VB5A 4K2YA 3A8AA 5AFZH 4CRFA 2J95A 1FLEE 2HALA 3MI4A 3RU4D 1C2GA 2ODQA 2AH4X 1SQTA 3RXKA 2ZHFH 2ZDKA 2R0LA 1TX8A 1P8VC 1AB9C 1SGPE 2WPMS 1ZJDA 4BTIB 1YPLH 2BVXH 5C67A 3A80A 4DIIH 3SGQE 1LCYA 1L1GA 1A0HB 3SI4H 3GCTF 1QB6A 1HXFH 2ANWA 2BLQA 3SV9A 2STAE 1O2HA 5ESTE 1GG6C 1F0RA 2GV7A 3QZQA 1DUEA 1WOFA 2FTLE 1O5DH 5LPEA 4BXSA 1O2ZA 3VB6A 1MKWK 3E90B 4NIWA 1HAVB 1CHOG 1YGCH 3MU8A 1ZPCA 1O31A 1AUJA 7LPRA 5C1UA 2NU1E 5E2OA 3UIRA 1BTWA 3SBKA 1BB0B 1ZRKA 1J15A 1TRMA 3SOSA 1WU1A 2QN5T 4UFDH 3RC4A 2ZI2H 2ODPA 1O3BA 3SUGA 5DKMA 1OWEA 1H8DH 1Z1IA 1KDQA 1OX1A 2G5VA 4FUIA 1O37A 1H9HE 3E1XB 1GHWH 1E35B 1L1NA 5AVDA 2EI7A 1RIWC 3P8FA 3L3TA 1GBJA 3MFJA 1AZ8A 1LPGB 1MTNB 1WTHD 1KTTB 4B2CA 3T25A 1F5KU 4LXBH 1ZSLA 3FP7E 1EQ9A 3MO6A 1ANCA 2Y5HA 3VPKA 1FPHH 2BX4A 1GBIA 4TWYA 6CHAB 1JMOH 2HNTF 2BM2A 1HAZB 5LGOA 1SI5H 1C2IA 1XVMA 5A0CA 1UTQA 4MNVA 1TPAE 2FLBH 2ZCKP 4AB9A 4TWWA 4X6NA 3RXPA 3RLWH 1Y3YA 1C1VH 1C9TA 3B23B 1SL3A 2VU8E 4WY3A 3AAVA 4BANB 2FOFA 1HCGA 3RXLA 4E7NA 2R3UA 3GY5A 1UVOA 4JYTA 3KL6A 1OSSA 2ZCLP 4TPYA 1C5UA 3VXEH 1QA0A 2OC0A 1SC8U 1DSTA 2Z6BD 5C1XA 3IG6B 5E0GA 1MTNC 2Z9LA 2ZDAH 4YO9A 4J2YB 1AVWA 1MAYA 3MNXA 6LPRA 3U8TH 1TGNA 3SNAA 4FUDA 1AWFH 1JOUB 4ISHH 1EXFA 1BRCE 3GYMA 1AMHA 2IPHA 1CQQA 3SJKA 1K22H 2FOEA 1GBKA 3O8BA 1Z1JA 1GJ5H 5TCAA 5A8ZA 1EAIA 3PLPA 3RM0H 4D76A 1C4Y2 2J9NA 3TJNA 5GDSH 3QWCH 3T2NA 4DVAU 2PKAA 3QX5H 1XUJA 2UUYA 2B5TB 1SPJA 3HATH 2BXUH 4BAHB 1QNJA 1KYNA 3SV8A 2AS9A 1GJ9B 4H6TA 1A0JA 4UONA 4B2AA 1AQ7A 2PLXA 1NS3A 3GDSA 1HB0B 1EB2A 2BB4A 3KGPA 3L33A 2ZA5A 3RXFA 1GCTB 1V6DA 2A2QH 1O3PB 3SNDA 2XCFA 1BMLA 2ZU2A 3ENSB 3NXPA 4FUGA 5DP4A 1ZGVA 2Y5GA 1YLCA 4FUJA 1W12U 3RU4E 1GI5A 1QJ1B 1S84A 2XYAA 3ODDA 1Z8JB 1XXDA 2A7JA 3AVZA 1DANH 1BTHH 1EUFA 1O35A 4JMYA 2FEQH 1NY22 3NK8A 2D26C 1H8IH 3PMBB 1O2LA 3LH3A 3Q76A 1ELDE 1A0LA 4A6LA 5H4IB 2W7SA 2FXRA 1T8LA 1O34A 1O30A 3LKWA 3BTEE 1SBWA 1O2IA 4O3TA 4JZDH 3SU5A 5A0AE 1C1WH 1JWTA 3A81A 1A5IA 4FUCA 1SR5C 1GI0A 8KME2 2A1DB 1GJDB 1UVSH 2PFEA 3V12A 1YM0A 4OGYA 2PW8H 2ZGXH 4IS5A 3LJJA 3ZVAA 2OCVB 3GY8A 2FO9A 1HDTH 1EJNA 4AX9H 1FV9A 2FP7B 4ABBA 2VIWA 2XCNA 2OD3B 4GCHF 1VGCB 1DLKB 2Q6DA 2D1JA 3ZVBA 1BTXA 1XKAC 2ALPA 1TX7A 3R0FA 4NCYA 3BTDE 2XW9A 1D6RA 2PKSB 1O2VA 1ACBE 3RXIA 1HNEE 2ULLA 3FFGA 1TGCA 1LMWB 2P8OC 3ZV9A 5EXMA 5JB9S 1KXDA 4Y0ZE 1SVPA 4U32A 4QT8C 1GI8B 3ZZ3A 3LJOA 1DY9A 3KF2A 2Z3EA 3LPRA 3SU4A 1HAVA 1Q3XA 1V2ST 3BV9B 1P09A 1HXEH 3LGYA 3MH7A 5DP8A 1QB1A 5CMXH 3D62A 1IHSH 3P8GA 7KMEH 4I8LA 1BTPA 1LQEA 4FXGH 1F0TA 1FUJA 5CHAC 1OP8A 3PMHB 1FONA 1EPTA 3EDXB 1TPOA 1LHGH 3ZZDA 1V2QT 1IQIA 1Z6JH 2ZKSA 4JZ1A 1G3CA 3VGCB 2HPQH 1TGBA 1Y5UT 2A4OA 4Q7XA 5DJ7A 3M7QA 1P9UA 5L2ZH 2ZDMA 4CRBA 1HIAB 2OC1A 5EXLA 5GWZA 2Y5FA 1C2KA 3SU1A 1KLTA 1TRNA 3P8OA 2J92A 1CT4E 1OWHA 2BDBA 1TONA 4O9VA 1A61H 1C5YB 3P92A 4ZUHA 3IITA 4AOQA 1NRNH 3OY6U 1C1QA 3RXDA 5K0HA 4WMFA 3A89A 1CE5A 3LGWA 1HAGE 1SGDE 3LGVA 5FX6A 1YCPM 3BSQA 3KCGH 5EODA 2A45B 5GPIB 4HGCA 1YPHE 5A09A 4ABEA 4THNH 1IOEA 4I8KA 4X8SH 2TGDA 2GDEH 4OS6A 2TBSA 1UK2A 1QL8A 1YPKH 4R0IA 1VCPA 4Y8XA 1ELCA 3TVJB 1C9PA 3S9AA 3GISB 1TOCB 1Q2WA 4TY6A 1TA6A 3FP6E 4H4FA 1AWHB 3GDUA 3SUFA 3RMMH 4ISNA 1MZDA 1GDQA 1EP6A 2F9BH 1JIRA 1GI4A 3PO1B 2P3FH 4ZXXH 4K8YA 1HPGA 2WV4A 1GMHG 2HNTE 4FU7A 2AEIH 3RXCA 1ZJKA 1QCPA 1N1LA 2BD2A 2H9TH 3GCHB 4R8TB 1QIXB 1D3TB 1D6WA 5FCRA 1PQ8A 1ABJH 1MH0A 1A4WH 2VGCC 1C5WB 1O3EA 5E2PA 1A5HA 3BEUA 4YOJA 5LH8A 1NROH 3M5LA 1ETRH 3ATLA 3UTUH 1TOMH 3A7YA 1K1PA 1BRBE 2J4IA 1YBWA 2I6QA 4ISIH 4Y6DA 1UTLM 3UR9A 1PQ7A 1N8OB 2EI8A 1IQHA 1TRYA 4FVBA 5DP9A 1LKAA 4D9RA 4A7IB 1DLEA 3EA9A 1SGYE 1O2OA 1X7AC 3FP8E 3TITA 4WH8A 1CSOE 1GVZA 1XX9A 5EXNA 1BDAA 1RJXB 2JETC 2AIPA 1S6HA 1TMTH 1RXPA 1C5QA 2CHAC 3KQCA 3Q77A 1V2LT 3TH2H 1C2MA 3A87A 1O2NA 2BOKA 2STBE 5GJ4B 2VIDA 4DCDA 1IQKA 3SNBA 2F83A 4ZHMU 4AYYB 2BD8A 3R3GB 1A1RA 3P6ZB 1UO6A 4AYVB 4I33A 2BHGA 1BHXB 4ZKRU 2CJIA 1ZLRA 4ZKNU 2UUKB 1OKXA 4NWLA 5HYOA 4JZIA 2GZ9A 4UFFH 3W95A 1Z8GA 1CT2E 2ODYB 5EQRA 1JIMA 3QO6A 3VEQB 3GCNA 4KKDA 5EQSA 3BTWE 2EEKA 2GP9B 1P05A 1T8MA 3ZZ5A 5JBTA 1FN6A 1C5ZB 1GJCB 5HM2A 2FS8A 8LPRA 1G2LA 1XVOA 3ATKA 1MKXK 1SGRE 1UTNA 2CMYA 2ZHWH 1CGJE 2ZPQA 3RMNH 2H2ZA 2PUQH 3TH3H 1EB1H 2R2WU 5GCHF 5F6MA 2GCTC 2KAIA 3TGKE 1O3NA 2OQ5A 2GTBA 2A5IA 2XWBI 2FZZA 2YNBA 1O3FA 3KNXA 2ZFSA 2RA3A 4IN1A 1GVKB 1IQEA 1O2SA 2QXIA 4UFGH 2G51A 1GMCG 4H6SB 1XUFA 5EOKA 3SQHE 1D3DB 3ATMA 1WBGB 1E37B 2BVRH 2XWAA 1OWIA 1AE8H 2FESH 2JH0D 1MCTA 1MQ6A 1BUIA 1SOTA 3MH5A 1H1BA 4TY7A 1OWJA 4KTSA 4ZMAH 1B0EA 3RMLH 3L6PA 1ESTA 4Y8YA 3GICB 5DO4H 1DWEH 4MPXA 4CRDA 2OBQA 1SG8B 4HFPB 4B75A 4IW4E 1T4VH 4ZKSU 1YCPK 3SJ9A 1SGQE 3P95A 1V2PT 1ELGA 1O2MA 1W14U 2ZCHP 3BG4B 4WVPE 3SU0A 4E05H 2B8OH 1K1MA 1O3OA 3QDZB 1HJAC 4K69A 4NZLA 1DVAH 2VH6A 1SFIA 5FPYA 3TIUA 1O5FH 1GBHA 1NTPA 2V3OH 2GZ7A 2GVFA 2Z9GA 4JZEH 1SMFE 1YYY1 1L4DA 1GL0E 1PJPA 1B7XB 1GJ6A 1HUTH 3A7WA 1ZOMA 3GCHC 1DITH 1F2SE 4K8BA 2FI5E 2G52A 2G4UA 1YPJH 4WMEA 4MQAA 1HAIH 4ZKOU 1GDNA 3MU5A 5AFYH 2ZP0H 1BBRK 4JYVH 1EATA 1GMDF 3F9HA 4VGCC 2BD5A 3QGJA 1P2MA 7GCHG 4XSKU 4DY7B 1BJVA 8GCHF 1PYTC 3C27B 2AERH 1LVOA 1BMNH 1NPMA 1UK3A 1DWCH 2BY8X 1QFKH 1K9OE 2IJOB 2XTTB 1GHVH 3LU9B 1P10A 1SGNE 2PV9B 1SLWB 1UMAH 4Q7YA 2RA0A 1TFXA 1O2RA 2WUCA 3NCLA 1TGSZ 4U30A 1MZAA 4YTAA 3M37A 3EQ0H 3A84A 5GCHG 3F9GA 2I6SA 2A5AA 3U1IB 3F6UH 5BRRE 1BZXE 1DS2E 1SGIB 1A5GH 3MO3A 1J8AA 1NFWA 3A7VA 3BEIB 4WJG2 3M7TA 1SLUB 1PYTD 2GV6A 1K1IA 4IBLH 1W10U 1O3CA 2A31A 1S0QA 1E36B 2FI4E 2RG3A 4AFUA 1MU8B 3A7TA 2A4QA 1RS0A 1SQOA 1O3MA 1TX6A 1AZZA 2ZHDA 1C5TA 3FANA 5ABWA 2ANYA 1WV7H 3VB3A 6GCHF 1L1JA 3GY4A 5EG4A 5DP6A 2FODA 5T6GA 3UUZA 1PQ5A 1TABE 1K28D 1Y8TA 2GT8A 2OC7A 1ZHMA 4YLUA 1AD8H 2V6NA 5C5OA 1C4U2 2F3CE 2J34A 1W8BH 1C1PA 3MYWA 4Y0YE 1O3KA 4KGAA 1LHEH 1ZTKA 1XUKA 4BOHA 4MNYA 2DE9A 2FOMB 4NWKA 1DT2A 1YLDA 3N7OA 1ZTLA 1QJ7B 5A8XA 1RGQA 3TK9A 5FBEA 2C8XB 1ID5H 4ZHAA 1LVYA 2HGTH 3BTHE 1FZZA 4LOYH 1AUTC 1V2TT 3S9CA 1YPMH 1BITA 3TNTA 1QURH 4RKJB 3RXRA 3QN7A 3DFLA 3RP2A 4GPGA 5B6OA 2KAIB 1SGEE 2FDAA 4K3JA 5JPMH 3SORA 1GBEA 1AU8A 1GI3A 2QIQA 1O2UA 1ANBA 1OYTH 3GCOA 2FPZA 1ZMLA 2W7UA 2YNAA 3ZZ6A 3TU7H 5L2YH 2K1QA 1UTOA 1J16A 1BBRE 1H9LB 3MMGA 4X8VH 1XXFA 3Q3YA 1SGTA 2QYIA 3S7HB 2FYRA 2BVSH 5GXPA 5HXFA 3RM2H 1HLTH 2GT7A 3PV4A 3A82A 3SJ8A 1LPZB 2H5DA 4X1NU 3STIA 4BAKB 1KXEA 2BQ6B 2H9HA 4GVUA 1LPKB 2AGIX 2V3HH 1GHAF 2UUFB 2BY9X 2GMTB 2XC5A 5DP7A 3TGJE 1P2QA 1AN1E 4KTCA 5L30H 4WXVA 2OINA 4CBNA 5TJXA 5JBBS 4AFQA 4NGAH 4NIVA 3M3TA 2W5EA 2ZF0H 5E0HA 1DOJA 5EPYA 3WY8A 3NUMA 1ARBA 1C1MA 4BAQB 2SGPE 2ZNKH 1WYKA 3HKIB 1EAXA 4BTUB 1THRH 2BY7X 2ZC9H 2Y80A 3LOXA 2OQUA 1S6FA 2P3TB 1NU7B 4O97A 3RC5A 2NU3E 4OS2A 4MPUA 1HGTH 1SGFG 3M61U 1DPOA 4CHAC 1Y5AT 2HNTC 3P70B 3F9FA 2F9OA 3ATWA 3KEEA 3E91A 2CHAB 1F92A 1GMDG 4WMDA 3RU4T 3AW0A 1V2VT 1SHHB 1T4UH 2BY6X 4D9QA 1NESE 1EZQA 2WYGA 1O2TA 2H5CA 2BDYA 2ZTYA 1MTVA 3I77A 2NU0E 4X0WU 2WINI 2ZHEH 3CS7A 1FNIA 2QXGA 4ABGA 2GMTC 2AGGX 4X2WA 3VFEA 3QLPH 1P57B 1VZQH 4Q80A 7GCHF 1EAUA 4FUFA 4KTUA 5FX5A 1KIGH 3AW1A 2ZDNA 3NKKA 4B76A 1YF4A 2C8ZB 2W26A 1THPB 2ZFQH 3RXOA 2B9LA 5EW2H 3ZVDA 3RXGA 1AO5A 1D3QB 1YCPH 4XE4A 1FI8A 2RDLA 4CRAA 1TQ7B 2AMQA 3K6YA 1RFNA 2IOTA 2O8WA 2Y82A 3OTJE 4CH2B 5C3NA 1TAWA 2G81E 1KSNA 5HM9A 3OSYA 5L6NH 1O38A 4CREA 1FQ3A 1DDJA 1CHOF 1ORFA 5TCCA 3A83A 1IQMA 3A86A 1HRTH 2LPRA 2BDGA 1C1OA 4I31A 1LO6A 5FHTA 4ISOA 1ZMJA 1CVWH 1EZXC 3SV2H 2LNCA 1GJAB 3M3SA 1NRSH 3KQBA 3BTTE 5FBIA 1IAUA 3TNSA 2ZGHA 1CA0C 1HAHH 4B74A 3VB7A 2JH6D 4UDWH 4Y76A 4MDSA 1O5AB 3K9XB 4NFFA 3RLYH 3ZVGA 1ELVA 2BY5X 3SHCH 2Y6TA 1C2FA 1BTYA 2ZPSA 2JETB 1O2GH 4KP0A 4Y8ZA 4X1QU 1MU6B 2XBVA 3EA8A 2AMDA 2F9PA 1HIAA 1NT1A 2UWOA 1FDPA 4X1SU 3EE0B 5LPRA 2VIOA 2ZU3A 5IYTA 4WWYA 2V35A 3UR6A 1GMCF