1GBMA

Alpha-lytic protease with met 190 replaced by ala complex with methoxysuccinyl-ala-ala-pro-phenylalanine boronic acid
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbmA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbmA01
1SHHB 1NC6A 1CHGA 2BLVA 2ZP0H 2VWMA 3E1XB 4GPGA 4A7IB 1WTGH 5FHTA 2VIOA 3LGVA 1GI9B 4Y76A 1SQOA 1D9IA 1A7SA 8GCHF 3RUOA 2OINA 3E91A 2GZ9A 3UOPA 3CP7A 1P04A 4DG4A 1SOZA 1WQVH 1HAXB 3BTFE 1QFKH 2JETB 2VIWA 1PPFE 2VWLA 1IHSH 3RXIA 1GMDG 1O5FH 2EI8A 4X1PU 1BBRE 1UTNA 4BTUB 8LPRA 4WJG2 4B1TA 1A0LA 2F83A 1K2I1 1G36A 2OCVB 1MU6B 5E2PA 1MKWH 2CF9H 3BTKE 3C1KA 4Z6AH 1MTVA 3IG6B 1ZHRA 1Z1JA 2W3IA 3OY5U 3RXPA 4YLUA 4NZLA 2QYIA 1K1JA 4GHQA 3RM2H 2BLQA 3TH2H 1MCTA 4SGAE 5CE1A 3UTUH 1MD7A 5L2YH 1NFUA 1P09A 1SMFE 2FP7B 2WINI 1TFXA 2B8OH 4F49A 1THRH 1G30B 3RM0H 1ANEA 4IW4E 1NRSH 2H5DA 3GCNA 2H5CA 4AORA 3ZV9A 3UNSA 1TIOA 2FYQA 5F6MA 3SOSA 6LPRA 1JRSA 1HIAB 1CGHA 2A4GA 4GHTA 4IC5A 4MTBA 2TBSA 1J15A 4NCYA 4BAMB 2J94A 1ZMNA 3GCHB 5ESBA 3ODFA 2ZFRH 3LIWA 3FP7E 4RN6A 1GBLA 1OKXA 2XC0A 2VIDA 3SV2H 1BT7A 4D8NA 5DP4A 1EPTC 1K28D 2I6SA 5FCRA 4ZAEA 2LNCA 3O8DA 3ZVCA 3M5MA 1ESAA 1HAGE 2VGCB 3A7VA 1W10U 3SGAE 2ZFFH 3FP6E 1LTOA 4E05H 3TNSA 2ZGCA 1SGEE 2FOCA 2BY5X 1AUJA 3RMLH 2BDIA 3LGUA 2VIVA 1NO9H 1SGNE 4YTAA 2G4UA 2VWOA 3VB5A 4TY7A 3O8BA 4IS5A 3TK6A 3SJOA 1OXGA 2O8LA 4FUCA 6CHAC 2BD7A 1ELGA 1O3HA 2Y7XA 1GBEA 4E7RG 1O36A 4Y7BA 2QXJA 1ZRKA 2NU4E 3TNTA 3VB3A 1V2MT 2A0QB 3RXLA 1EZXC 2FODA 4NIWA 2XW9A 1YPMH 2QXIA 4FXGH 4BAOB 4CRFA 1UVUH 1N6YA 4K69A 4WXIA 1KDQA 1BIOA 3ATIA 3LJOA 2NU3E 4O9VA 1DWBH 3HPTB 3SBKA 2UUKB 4JZ1A 2BY8X 4AZ2B 2PKSC 2QC2A 3LGYA 3T25A 1GGDC 1P3CA 1ANCA 2GX4A 2W3KA 1IQNA 1OWEA 3QTVH 2ZI2H 2FOBA 3BTEE 5EQSA 3VEQB 4ZUHA 4ZH8A 1GJBB 1HB0B 3D49H 3UQOA 1AE8H 1ZHPA 4E7NA 2P3UB 3UWIA 2DE8A 3TU7H 2W7UA 1SFQB 3RU4D 1C2JA 5K7RA 2BOHB 1HDTH 1OWIA 3MI4A 2VJ1A 1C2HA 1CT0E 2FOFA 3AAUA 2EI7A 3TK5A 1TNGA 1SLXB 3AW0A 3U8RH 3NKKA 1O34A 3OYPA 4A1XA 2BD9A 4Y8ZA 2FI5E 4CR5A 4XOJA 1O2XA 2YNAA 1EP6A 4O97A 4XBDA 1EASA 1YPEH 4JMYA 4I8JA 1QL8A 5CHAB 1TRMA 1GHXH 5FPSA 1C5OH 3V7TA 3SV8A 1P2QA 1O37A 4A1TA 1MZDA 2C93B 2R0LA 1Y8TA 4B2BA 2VH0A 4NA9H 4K1EA 1TE0A 3A7XA 3D62A 3F9FA 1EOJA 1VR1H 2AYWA 1PQ8A 3RC6A 5JB8S 1PFXC 2B9LA 1DSUA 2AERH 3MFJA 3KL6A 3JZ2B 5ETXA 4DVAU 2ZFTA 4AGJA 1XUFA 2F9PA 2FOAA 2P59A 3F1SB 1V2TT 4DT7B 1P9UA 2G55A 3MU5A 1UK3A 4AB8A 4Y10E 1FPHH 4KGAA 1NY22 4JZIA 1H4WA 2OQUA 1KXFA 4DCDA 1XKBC 5C1XA 1ELVA 1C4V2 1UCYE 2B0FA 1LO6A 1C1WH 2OBQA 2SGAA 4OS5A 2Z9KA 1J16A 1RJXB 1O3JA 1QY6A 4FVDA 4B74A 1TRNA 2TGDA 3ZV8A 2SNVA 2ZCHP 2BOKA 2V3HH 4ASHA 2A7HA 5A8ZA 5E8EH 1GHAG 2QN5T 1SGYE 4F4OC 2VGCC 1O3GA 1ABJH 4AN7A 2J34A 1KTSB 1QA0A 4OGXA 1BDAA 3M36A 3SO3A 3SU6A 1NN6A 3T29A 1S81A 2JKHA 5SGAE 4NSYA 1P05A 2IN2A 3BIVH 2BM2A 3K9XB 3P8GA 1V2VT 1YC0A 2BZAA 3RXAA 4ZXYH 1XXFA 1YF4A 4K8BA 2UUYA 1XVOA 2FMJA 4K1SA 3ITIA 2Y7ZA 1IQKA 3RU4E 1OWHA 4FUGA 1GVLA 4AX9H 1UTJA 2GCHG 3ZVDA 3R3GB 4TY6A 1EAUA 2FXRA 4X0WU 2XYAA 1TGBA 4NA7A 4I8GA 1AZ8A 4HGCA 1GHWH 4I32A 2GTBA 1VITF 2A4RA 1DITH 4CRDA 2KAIA 3JZ1B 4R0IA 6GCHF 2PLXA 3UWJH 2C8WB 5EODA 3UUZA 1OS8A 1LKAA 1O2IA 5F8TA 3GY6A 1C2GA 3OTJE 3QZRA 4A92A 4UEHH 5DG6A 1TMUH 1W7GH 3LH1A 3TLOA 2TIOA 2VIQA 1DS2E 4GAWA 4NIVA 3RXHA 3MO6A 2ZDLA 1K1LA 3T26A 5C1UA 1HJ8A 1O3DA 1DSTA 2Z3EA 2C8XB 3NK8A 2D2DA 3PLBA 1V2OT 2F9BH 1UMAH 1L4DA 1AN1E 4DJZB 2BDHA 1FN6A 1HXEH 2G5VA 2O8UA 2K1QA 3ZVAA 3ZZ7A 1WOFA 3L6PA 1MAXA 2ZG0H 2G81E 3NXPA 1BTPA 1C5MD 2CGAA 5T6FA 3EA9A 1GCTB 1O2JA 2BD4A 4AFQA 1TWXB 2XCNA 4KTCA 4K5ZA 1V2NT 1KLTA 4GVUA 1C2DA 1LKBA 2ZTXA 2ZEBA 1C1RA 2FLBH 2HOBA 3GY8A 2J4IA 4MPUA 3RXMA 1C5LH 3RXEA 1GJDB 1DANH 1BZXE 2ZHFH 2A4OA 2V3OH 1FY4A 2BD2A 1J17T 1UO6A 1P8VC 2LPRA 3RU4T 4DW2U 5DO4H 1ZTJA 2ZFSA 3H5CB 3F9EA 4LOYH 4Q2KA 3PWCA 3LC3A 2PKAB 4IGDA 4I31A 1ANDA 2BHGA 2ZU1A 3E8LA 1LPKB 1TNHA 2ZHEH 4GCHG 1Z7KA 3GDUA 4I8LA 1F2SE 1UTPA 4U01A 4YLQH 4UDWH 1PYTC 1HUTH 3A8CA 5EQQA 3ZZ6A 1A5HA 2BDCA 1WSSH 2C8ZB 3P6ZB 5G4BA 1W14U 3SUDA 5C1YA 2A4QA 4ABFA 3BTME 3QTOH 4RSPA 3UNQA 4DOQA 4Y11E 1G3CA 5HGGA 4ZKRU 1UJ1A 1C1UH 3SV7A 1O5GH 1YGCH 4JZEH 4K8YA 1QQUA 1A3BH 2WUBA 4Y8XA 4H6SB 1NU7B 3MO9A 1O2VA 2H9HA 5J4QA 2XBXA 1NU9A 4KP0A 2ZU5A 1Z8IB 3TJOA 1NT1A 1C5NH 4ISHH 2HNTF 3A80A 4XFQA 1HJ9A 1WCZA 3SGQE 4NWKA 5AFYH 1W13U 4ESTE 4O3TA 4NGAH 2FEQH 3F68H 1MBQA 1C2IA 3GY4A 4ZHAA 4KKDA 2QXGA 3FP8E 4UFEH 2EI6A 5AHGH 1X7AC 4HFPB 2FPZA 1SLWB 2PFEA 4OS2A 2A7JA 4K60A 2Y80A 5GJ4B 2AGGX 5JDUB 5L6NH 3FAOA 1AY6H 2AEIH 3EAJA 3MOCA 1ETSH 1IQMA 2YNBA 1ZGIA 3IWMA 1MQ5A 1GMDF 2H6MA 4BXSA 2Z3DA 4AB9A 3I78A 1C5TA 3NWUA 1XUJA 4KELA 5E2OA 1MD8A 2D26C 1AD8H 5LH8A 2R3YA 3TH3H 1E34B 4FUEA 1GHBG 1F5LA 2F3CE 3AVZA 2XBWA 1GWAA 4OS1A 1LVMA 1CE5A 1E36B 1FY5A 5HXFA 1WQSA 4ISOA 2VVCA 1FONA 2G8TA 3S69A 4WXVA 1B7XB 3MNXA 1NZQH 1O2NA 1HBTH 5FBIA 3D23A 1TA6A 3TGKE 1D6RA 1K1OA 2HALA 4JYUH 3RMNH 2FI3E 4ZMAH 6CHAB 1Z8JB 5DPAA 1F5RA 1O2RA 1G3EA 1TPAE 2CXVA 2ZDVH 2BX3A 2ASUB 1QHRB 2VVVA 4A6LA 1SGRE 4I7YH 2A2QH 3BTHE 4CBNA 1LQDB 1AB9B 2Q6GA 1K9OE 1OYTH 1JOUB 5DK1A 1AFEH 1RTKA 1JBUH 1ZJDA 3SU3A 3KQEA 2GZ8A 4B75A 1OP8A 3A7ZA 3BEUA 4YO9A 2XBVA 4Y0ZE 1S6FA 2NU0E 1V2QT 1XUHA 5DP3A 4FVBA 4ZHMU 3NUMA 4TYDA 5GXPA 1LHEH 1TQ0B 3ZVEA 1BITA 1NROH 1T8OA 2GKVE 3DFJA 2A2XH 3ZVFA 1KXBA 4BTTB 2G52A 3R0FA 2QIQA 4U32A 4UFGH 5L30H 1CO7E 2JH5D 1TALA 3URCA 1AUTC 1TGTA 2BQ7B 2ZTYA 3A88A 2BVXH 1F5KU 5A0CA 2EA3A 1P2NA 1IQLA 1S83A 3H7OA 1A0HB 2ILNA 4VGCB 4ZHLU 3M35A 2WYGA 1ID5H 1C1NA 2GT7A 2ZNKH 1QNJA 5F8ZA 1SPJA 3SHCH 1QGFA 3NZIA 2O8TA 4CRCA 1T8MA 1DPOA 1C1TA 1P03A 1DUAA 1V2UT 4ZXXH 2XC4A 1P2JA 4MNVA 5E0GA 1HCGA 1FDPA 1QL7A 1CA8B 1HNEE 1PPBH 2J9NA 4JZDH 2WPIS 3QZQA 4MNWA 2AMPA 1AKSA 3UFAA 1TONA 1Y59T 3T62A 3URDA 2ZF0H 1V3XA 2FS9A 2TGPZ 3EGKH 5GWZA 3FZDA 3UREA 4X2YA 3U8TH 4FUHA 4XDEA 3K6YA 1QL9A 1OWDA 2GMTB 1O2HA 2HPPH 1ELEE 2THFB 1OX1A 2FZZA 2PSYA 3S9CA 5HMAA 1EAIA 2SGQE 1V2WT 5F8XA 1SGFA 4AG2A 2ZIQH 1ZYOA 3Q3YA 2UUFB 2H9TH 1XMNB 1YKTA 1CHOF 1GBKA 1S82A 3KQBA 1BMLA 4NG9H 3A8DA 9ESTA 1K21H 1TOCB 4M7GA 1OSSA 4XBCA 1V2RT 3ESTA 4MVNA 4FUBA 2B5TB 1NRPH 1GBDA 2Z3CA 2ZPRA 4O03A 1CA0B 1ELFA 1MAYA 1AU8A 3RDZA 4AFZA 1NESE 2BD3A 3ZVBA 1KXAA 1Y3UA 1ZSLA 4BTIB 1G2MA 4D7FA 1PPGE 1C5QA 2Q1JA 4CRBA 4H6TA 1O2OA 2BVSH 3TVJB 1EPTA 2OC0A 3QWCH 1UHBA 1ELDE 1MBMA 4I8KA 3PV4A 3ZZ3A 1AGJA 3A81A 2FTLE 4X6NA 1DM4B 1WAYB 4SGBE 1AFQC 1BTZA 1GHYH 5EG4A 5FBEA 4NFFA 2SGEE 1G3DA 3Q3XA 1VJ9U 5C2ZA 4X6MA 5HM9A 4CREA 1HXFH 4JK6A 4INKA 1RS0A 4ABGA 1FN8A 1PPCE 4TWYA 1KLJH 1AB9C 2JH0D 3GY7A 3LKWA 3VPKA 2ZPQA 5BRRE 2FLRH 1DXPA 1WV7H 1O2ZA 1L1GA 1D6WA 1ELCA 2QV1A 1HAVA 2B7DH 4OGYA 1YCPK 1FLEE 1SBWA 8GCHG 2CJIA 3RC5A 2WV5A 3LGWA 5A0BA 3B23B 1EJMA 1KXCA 1KXDA 5E0HA 1SQTA 1O2YA 2ZHQH 1UVPA 2ZFQH 1GBCA 3SUFA 1O2WA 1O3PB 2Z94A 3SI4H 4A1VA 3A7YA 3ZZ8A 5T6GA 5I46H 3EQ0H 1P0SH 4AG1A 5E0JA 4LXBH 5EQRA 1QRWA 3MU1A 3SU4A 1T4VH 1BMAA 1DFPA 2OQ5A 2PTCE 1JIMA 1G2LA 1ZR0A 1LVBA 3M5OA 3W94A 2ALPA 1DXWA 3HATH 1TOMH 1T8LA 1LVOA 5GCHG 1K1IA 4TPIZ 1SG8B 1TX6A 2G51A 1P2MA 3QX5H 5TCCA 2QF3A 2ZC9H 2SGDE 4UE7H 4VGCC 1EB2A 1GJ4H 2J2UA 1DE7H 1MMJN 3VB4A 2XXLA 1V2LT 5AFZH 1AO5A 1E38B 1TQ7B 2XC5A 1TLDA 4WY3A 3RP2A 1LCYA 2H1UA 2RA0A 4X8VH 3ZZ4A 1E37B 7GCHF 2SFAA 1O3LA 1QQ4A 5JB9S 5FAHA 4B71A 2HLCA 1C1PA 4R8TB 2OD3B 1HAYB 1SSXA 2QCYA 2W26A 1QB6A 1GI8B 2FX6A 4FU8A 2XWBI 1YPHE 1F0UA 1GMHF 4DURA 1ANBA 5A8XA 1TX8A 1SGTA 2OBOA 4B76A 1ZPCA 2QY0B 1GDNA 1T8NA 2GMTC 3LONA 3RMOH 3GDVA 1U6QA 3SU1A 2WV4A 4ABAA 4D7GA 4IN1A 2NU2E 1LMWB 4A5TS 5DJ7A 1B0EA 3RC4A 3S0NA 3MH5A 2Z9IA 1P57B 1V2PT 3BG4B 2ZO3H 2BD8A 1O3CA 1YPGH 3GYMA 1CGJE 1SGPE 4HI3A 2P16A 3TH4H 4Y6DA 1DLEA 2H9EH 3QDZB 2ZDMA 3UIRA 2ZTZA 2Z7FE 3SJIA 2ZGBH 4BXWA 2BVRH 1UK2A 3Q76A 1N6XA 3ZZ9A 2PW8H 4UD9H 1O2KA 1ZOMA 2UUJB 2VH6A 3PMHB 2AH4X 1CU1A 1FJSA 2ZQ1A 4NFEA 1MTSA 1CA0C 1Z8GA 5FCKA 5JBCS 1OWJA 1HIAA 3F6UH 3MU0A 1S6HA 3A86A 1V6DA 1L0ZA 3LU9B 3PMBB 4Q80A 1YBWA 1ELBA 6ESTA 3KHVA 1TRYA 5J4SA 4DGJA 1THPB 4MPVA 4ISLA 2XWAA 1A3EH 3E0PB 4Q7YA 4CH2B 2Y5HA 3WY8A 2C3SA 3SV6A 1YPHC 5EPNA 1QR3E 4OS6A 1QCPA 1HFDA 3C27B 3LPRA 1IQEA 1QIXB 1O38A 5AF9H 3S7HB 1JXPA 1P01A 1N1LA 3TJVA 2BLOA 1GBFA 4IC6A 1TNJA 4ABDA 3ODDA 3KQDA 1C5SA 5A2MH 1P2KA 1NRRH 3MNSA 2QA9E 3BEFB 2PHBA 1G3BA 5F03A 1GJCB 4X6OA 1KYNA 3S7KB 1IHTH 3SJ9A 4E06H 1IQHA 1YCPH 5I25A 1SGQE 1O5CB 1HRTH 3SJKA 5EXNA 1O3IA 1TABE 1W12U 1DDJA 4FUJA 1HAZB 4JYTA 1SB1H 4X8TH 1NTPA 3KGPA 1TX7A 2SNWA 3PTNA 1ZMJA 1ARBA 5FX6A 1QBVH 4UFFH 4X1SU 3BTGE 1GCDA 2VVUA 1SC8U 3GCOA 3SNBA 3CENA 1WTHD 3M5NA 4IMZA 1WYKA 3SV9A 3SNEA 2GT8A 1WBGB 4RKJB 2EC9H 1MTUA 1ELTA 1EAXA 1MZAA 5LPFA 2M5TA 2YOLA 1O2SA 1ZLRA 4YZUA 1GPZA 4YOIA 1IQGA 1UVSH 1O33A 2F9OA 5JBBS 1XUGA 3U69H 3VFEA 3BF6H 4U2WA 2BTCE 1FMGA 5DKMA 3LDXH 5TCAA 3EA8A 3KF2A 3GCTF 1MQ6A 1TBQH 1BTUA 1LDTT 1EOLA 2A5IA 2Z9JA 1XUIA 3SZNA 4BNRA 3CS0A 1RTFB 2BB4A 1SFIA 7KMEH 3P92A 4X2WA 1W2KH 3DT0H 4K2YA 3A89A 5T3HA 4KTUA 3OSYA 3RXQA 2ZGHA 2STAE 3SQHE 1SQAA 1H9LB 1FI8A 3A83A 3ELAH 3GICB 2AMQA 2OC7A 3RXKA 4ISIH 1J14A 1ZPBA 1Q3XA 4Y8YA 2A31A 2RDLA 5PTPA 1L1JA 1G9IE 1RFNA 3D65E 2FOGA 1J9CH 1GMCF 3L3TA 4NIXA 1GI7B 3EYDA 4I33A 3ZYEA 2ZA5A 2A32A 3BTQE 2ANWA 1T7CA 3MNBA 3STIA 3T28A 3BG4C 1BJVA 1TPSA 1LPZB 1N8OB 7ESTE 1RXPA 2ZU4A 1KTTB 3GY5A 1O30A 1EJAA 1PQ7A 1P12E 3UR9A 1C5YB 3E0NB 1YYY1 1GVZA 2ANKH 1GG6B 1A0JA 1P10A 4D9QA 1B5GH 3M7QA 1TBRH 2AGEX 2FO9A 4U30A 1C5PA 1ESTA 2BZ6H 1VITH 1T4UH 2DE9A 5EGMA 1JMOH 2CF8H 1BTXA 4H4FA 1GL0E 1SOTA 1DY9A 2ZGXH 1DY8A 3A82A 4PROA 1GJ8B 4QT8C 1OOKB 2Q6DA 1AVXA 1VCQA 3FZZA 8KME2 1MCVA 1VITG 1EZUC 3QK1A 1EZSC 1HAPH 1TPPA 4D76A 1FXYA 1SGIB 3F9GA 2RA3A 1ZMLA 1C5UA 1EX3A 4JK5A 1V2ST 4CHAB 1C1QA 1C5ZB 1HLTH 2ZU2A 2RG3A 3SI3H 3FANA 4NIYA 4Y79A 4MPXA 3MHWU 2D8WA 1QRZA 1BMNH 3Q77A 2ODYB 3SU5A 1ETRH 2CHAB 1BJUA 1L1NA 1TMBH 1ZSJA 1OPHB 2R2MB 1BTHH 1HPGA 2Z9LA 3ZYDA 4YESB 3RXTA 2ZDAH 5DP6A 1EATA 1BTWA 3T27A 1P2IA 2TGTA 1L4ZA 2NWNA 1UK4A 3E16B 3E90B 4ISNA 3SQEE 4ABBA 1UTLM 1S5SA 1AFQB 3SGBE 1PJPA 1VJAU 3TJNA 1C5VA 4IBLH 1OWKA 2C4FH 3QLPH 1H1BA 1NFYA 1IAUA 1GI3A 5DGJA 1C2LA 1KIGH 3SHAH 4FU7A 1C4U2 2O8MA 1O5EH 3BTTE 3UPEA 3HGNA 1AMHA 1E0FD 1LVYA 3ZZDA 2A7CA 3MH7A 1FAXA 2IPHA 1O0DH 1GI6A 1SLVB 2PWXA 4UONA 1JRTA 1NFXA 2R0KA 1O2TA 1NRNH 4CR9A 3V3MA 1Q2WA 1SLUB 2WPHS 4JYVH 1JWTA 1VCWA 1O3KA 1GJAB 1KDQB 2FIRH 3GY3A 3QO6A 4FU9A 2VWNA 1QJ7B 1A5GH 4X1RU 2F9UA 1TGNA 2ZDKA 2TGAA 1FIZA 1KSNA 1A1RA 1TBZH 2ULLA 2FWWA 1NRQH 1J8AA 1DX5M 2GGVB 1BRAA 3AASA 3UOUA 3QGJA 5EPYA 1C5XB 3M5LA 3RXGA 3PTBA 1PPEE 1O3OA 1F7ZA 5EW2H 1NPMA 1D3TB 1TNLA 2BLWA 4IN2A 4Y7AA 3BG8A 3MH4A 3PWBA 4MQAA 2VB0A 5GIBA 1BBRK 2GCTB 3SUEA 1MH0A 2UWPA 3TPIZ 1WU1A 1GBJA 2V35A 4GLYA 3SNCA 1Q31A 3FFGA 1H8DH 1TYNA 1CGIE 3IITA 4WVPE 4ZKNU 2PV9B 2OTVA 1SI5H 4WH8A 3OY6U 4D9RA 2V0BA 1EAWA 3LOXA 3AW1A 2F91A 3DA9B 2UWLA 5ESTE 5EXMA 2PKAA 2TRMA 4OS7A 5JBAS 3RXUA 1THSH 4CH8B 1Z71A 1O2UA 3KQCA 1W0ZU 1HAHH 3K2UA 1N8OC 4B2AA 1M9UA 1LHFH 2JH6D 4ABEA 1S84A 1OYQA 1AWHB 3PMJA 1UVTH 1Y3VA 4J1YA 4OS4A 3GOVB 1DOJA 4X1QU 1AE5A 3U1IB 4MPWA 2ZKSA 1GG6C 1BHXB 3S9AA 3BSQA 1LQEA 3TIUA 4X8UH 2ZFPH 1GBMA 1ZTKA 1A5IA 1GDQA 2AIPA 1BCUH 1QRXA 3RLYH 2HVXA 3I77A 3P95A 1GVKB 1ORFA 2ODQA 1QURH 5GCHF 5B6OA 2GP9B 5IDKA 3Q3KA 2C8YB 1AHTH 2QF0A 5JPMH 1BB0B 2DUCA 3MMGA 1GJ5H 1GBIA 1ZSKA 2NU1E 3A85A 2PUXB 5AVDA 1C9PA 1C1SA 1LHCH 4X6PA 2HPQH 3U1JB 3TGJE 4CHAC 2ZHWH 4KTSA 2FESH 2IOTA 1ZPZA 4NSVA 1NS3A 2BXTH 3M3TA 4Y0YE 1TNKA 2CHAC 2PUQH 1Y5BT 2QGRA 1TMTH 2ZWLH 4Z0KA 5C3NA 2ODPA 3CS7A 2FDAA 2BYAX 3I29A 4NA8A 5TJXA 3VGCC 1MTNC 2F9NA 8ESTE 3RXBA 2OP9A 1EP5A 2PTNA 1AZZA 3EE0B 3UNRA 4BAQB 1AVGH 1Y3YA 1EZQA 4FUFA 1VCPA 3HGPA 1BOQA 2WYJA 2P3TB 1EQ9A 2ZECA 1W0YH 2BDYA 2J92A 4X1NU 5DP8A 1DUEA 1O3BA 1KXEA 2R9PA 3V0XA 4ABHA 1ZHMA 1SGFG 1HJAB 4MG3A 2P94A 4LZ1H 1EJNA 1H9HE 1RGQA 5LPRA 4AOQA 2GV6A 4LK4A 2FI4E 5BPEA 1HAIH 2KAIB 3ATLA 1O2GH 5C67A 4O3UA 5C5OA 2VU8E 1GHAF 4RKOB 2GDEH 4BAHB 1ABIH 1P3EA 1QJ6B 1RRKA 4H42U 1O3AA 1C1MA 3MO3A 3DUXH 2Y81A 3RLWH 3TK9A 4X8SH 5FXLA 3SNDA 2O9QA 2OXSA 9LPRA 4JCNA 2FX4A 2W5EA 1A2CH 2BY9X 5H4IB 4TPYA 1RIWC 2O8WA 2GZ7A 2J38A 4ZROA 2ZQ2A 1BUIA 3MYWA 1TAWA 2P3FH 1BBRH 1QJ1B 1FY3A 2GCTC 1XUKA 5A09A 1MKXK 3GY2A 1H8IH 5JBTA 4I8HA 2Y5FA 4J2YB 1Y5AT 3P8NA 2OUAA 3NCLA 1BHXF 4BANB 3U9AH 2GCHF 4XE4A 3G01A 1QB9A 3HKJB 3SU0A 2P8OB 4DIIH 3OU0A 4IMQA 2WPKS 2P93A 3BTDE 1CHOG 5A8YA 3HK6B 1XX9A 1OP0A 3DHKH 1T32A 3PM3A 1CT2E 2BY7X 2G00A 1EKBB 2FOHA 2JETC 2FM2A 3RXSA 3E3TA 1KY9A 1AI8H 1FIWA 1O35A 1XKAC 1W7XH 3QN7A 5GDSH 4WH6A 2Y6TA 1W11U 1BMMH 2GDDA 3TITA 1INCA 1PPZA 4FUIA 1FZZA 5GPIB 3ZVGA 1UCYK 2ZZUH 1SVPA 1ZZZA 2Z9GA 1PYTD 2R2WU 3SU2A 3VB6A 1UTQA 1Z6JH 3UY9A 2A5KA 3U8OH 2A45B 1QTFA 1PQ5A 3LJJA 1C9TA 2A1DB 4UFDH 3M3SA 3P70B 5L2ZH 3M37A 1ZRBA 4B2CA 4YOJA 2BQWB 2IJOB 1UTKA 1YCPM 1CBWB 3ZZBA 1O3NA 3BIUH 3KCGH 3T5FH 1XXDA 4ABIA 1WUNH 4AFUA 2PSXA 1L2EA 1RTLA 1K22H 2R3UA 2AS9A 5EOKA 4JZFH 2OC8A 1C2EA 3PLPA 4MDSA 1FY1A 3RXJA 5LGOA 1FV9A 1GI5A 1YPJH 1DVAH 3PYHA 5CMXH 1PPHE 1TPOA 2QAAA 3GCHC 2RCEA 2G4TA 3SW2B 3EA7A 4WMFA 1LHGH 3SORA 1Z8RA 3MU8A 2SGPE 4GCHF 2H2ZA 4AYYB 1MTWA 1ELAA 3ZZCA 1CQQA 4BOHA 4X2XA 3MH6A 2FOMB 2ALVA 5FPTA 1C5RA 4HTCH 4DY7B 1O31A 3S9BA 2QXHA 1D3DB 3GISB 2GD4B 4HZHA 3LC5A 3L33A 2EEKA 1QB1A 3P8FA 2AMDA 1FY8E 3LGIA 3O8CA 3P17H 2AGIX 1A4WH 2ZPSA 1GJ9B 5LPEA 1K1PA 1P11E 1C2MA 1SGDE 1IQJA 4X2VA 2BD5A 4TWWA 1HJAC 2ESTE 3GYLB 2C90B 2XTTB 3SN8A 1GBTA 1YPLH 1IQIA 1EB1H 1SR5C 3RXCA 4WMEA 2XRCA 1C1OA 3N7OA 2GVFA 2TPIZ 2ZHDA 4NWLA 3KEEA 3PROA 3PB1E 7GCHG 1V2KT 3Q00A 1F0RA 3O8RA 2HGTH 1VGCB 1A46H 4WF8A 5FX5A 1GJ6A 1DLKB 1F0SA 5K0HA 5EXLA 1C4Y2 3VB7A 1EXFA 2ANYA 3MWIU 1RD3B 5DP5A 2ZU3A 2W7SA 2BDGA 1GMHG 2BY6X 1IOEA 1NFWA 1BRBE 1K1NA 3BV9B 3MU4A 4GUXA 1Y3XA 2BQ6B 2WUCA 1A61H 1GI4A 1JIRA 1FPCH 1MKXH 1B0FA 1BRCE 3V13A 2V6NA 2ZCLP 2WPMS 4INLA 1QBOA 1DWCH 1PQAA 1Z1IA 2G5NA 1GBAA 2WPJS 1O5BB 2P8OC 3LT3A 3RXFA 1H9IE 3QGNB 2P95A 3GDSA 3PLKA 4BAKB 1GHBF 1S85A 2XCFA 4YT6H 1KLIH 4XBBA 1TNIA 1BRUP 3ENSB 1O2QA 1EUFA 1S0QA 1HGTH 1QA7A 1TGCA 2XNIA 3E6PH 3F9HA 3PO1B 1XM1A 5T6DA 5A0AE 2I6QA 4YT7H 4FUDA 1GBBA 1DICA 3B9FH 4AFSA 4CRAA 2Q6FA 2BDAA 3RXVA 1Y3WA 2F9VA 2CV3A 4AGKA 4AYVB 1O2PA 1W3CA 1K1MA 3ZZAA 1UCYH 3MTYA 5CHAC 2Y5GA 5JYIA 3NPSA 1O3MA 4K1TA 4NZQA 1O3EA 1TA2A 4Q7XA 4THNH 3KN2A 1AKSB 1YP9A 1GHVH 1V2JT 1CSOE 2CN0H 3UR6A 1GI2A 5IYTA 2FTMA 2ZCKP 2HNTE 5C5NA 3A7WA 2A5AA 1CBWC 3KNXA 3ZZ5A 1BTYA 1GBHA 3RXRA 1GI1A 1D3PB 1FAKH 2PGBB 2BMGB 1C2FA 5C20A 2BXUH 1YLDA 3SNAA 1Y5UT 4Q7ZA 5DP7A 1C2KA 1AVWA 4ZKOU 3U98H 1MKWK 1P2OA 3VXFH 1P02A 1OP2A 3HKIB 2PGQB 1UTOA 1DT2A 3MNCA 2STBE 3RXOA 3A87A 3M3VA 3LH3A 2ZGJA 4YM9A 3PMAB 6GCHG 3RMMH 1NM6A 4ZKSU 1F0TA 1MU8B 2ZDNA 1YM0A 3STJA 4WWYA 1XVMA 2BX4A 1BA8B 4WMDA 3SUGA 1SL3A 5HM2A 1UVOA 1IQFA 2OC1A 2CMYA 3BN9A 2AFQB 2VNTA 3W95A 1SHYA 1O3FA 3DFLA 1ZGVA 5EU8A 3H7TA 1VZQH 4CRGA 3ATMA 3VGCB 1EPTB 2BDBA 1MTNB 1F92A 1MUEB 1SGCA 1UHBB 2HRVA 1FUJA 1G37A 3KIDU 3ATWA 3OX7U 1CT4E 2VINA 1QBNA 2FS8A 2OLGA 3P8OA 2HNTC 3BEIB 1HV7A 4ABJA 1YPKH 2WPLS 3HK3B 3GCTG 4DIHH 1HAOH 1ARCA 3FVFB 3A8BA 4K3JA 2J95A 3V12A 1O39A 2Y82A 3M7UA 1DWEH 3A7TA 1S0RA 1GL1A 1G32B 1GJ7B 3BTWE 1HYLA 1O5DH 1VGCC 3RXDA 3K65B 3T2NA 1D3QB 5FPYA 2Z6BD 3M7TA 1AQ7A 3K6ZA 2AIQA 2FOEA 1BQYA 3SJ8A 1HAVB 4GSOA 3LGTA 1ZTLA 1O2LA 3ATKA 5HYOA 1O32A 1Z6EA 1AWFH 2HWLB 3A8AA 3EDXB 3A84A 5ABWA 1P9SA 2PR3A 1W8BH 2UWOA 1C5WB 4MNXA 2XBYA 1D4PB 1LPGB 3AAVA 1TB6H 1GMCG 3QUMP 1E35B 1O5AB 1YLCA 2GV7A 1FQ3A 4INHA 1UTMA 4Y71A 1P06A 4CBOA 5DP9A 3UQVA 4LZ4B 1AIXH 1GI0A 1GHZA 4MNYA 3VXEH 1RIWB 3TGIE 1CVWH 1GDUA 3B8JA 2PKSB 1GCTC 1GGDB 2D1JA 4YOGA 7LPRA 2VIPA 1ESBA 1ETTH 1LHDH 3PO1C 1FNIA 1O2MA 2ANMH 1ZJKA 3DD2H 4B73A 1ACBE 1T31A 2FYRA 1TGSZ 5EW1H 4MLFB 3M61U 1DWDH 1C1VH 2SGFE 4XSKU 3TJUA
chains in the Genus database with same CATH superfamily
1SHHB 1NC6A 1CHGA 2BLVA 2ZP0H 2VWMA 3E1XB 4GPGA 4A7IB 1WTGH 5FHTA 2VIOA 3LGVA 1GI9B 4Y76A 2V7QD 1SQOA 1D9IA 1A7SA 8GCHF 3RUOA 2OINA 3E91A 2GZ9A 3UOPA 3CP7A 1P04A 4DG4A 1SOZA 1WQVH 1HAXB 3BTFE 1QFKH 2JETB 2QF4A 2VIWA 1PPFE 2VWLA 1IHSH 3RXIA 1GMDG 3EE7A 1O5FH 2EI8A 4X1PU 1BBRE 1UTNA 4BTUB 8LPRA 4WJG2 4B1TA 4ACAA 1A0LA 2F83A 1K2I1 1G36A 2OCVB 5GNDA 2XNDD 1MU6B 5E2PA 3OFND 1MKWH 2CF9H 3BTKE 3C1KA 4Z6AH 1MTVA 3IG6B 1ZHRA 1Z1JA 2W3IA 3OY5U 3RXPA 4YLUA 4NZLA 2QYIA 1K1JA 1S6LA 4GHQA 2KCYA 3RM2H 2BLQA 3TH2H 1WDIA 1MCTA 4SGAE 5CE1A 3UTUH 1MD7A 5L2YH 1NFUA 1P09A 1SMFE 2FP7B 2WINI 1TFXA 2B8OH 4F49A 1THRH 1G30B 3RM0H 1ANEA 4IW4E 1NRSH 2H5DA 3GCNA 2H5CA 4AORA 3ZV9A 5KEDA 3UNSA 1TIOA 2FYQA 5F6MA 3SOSA 6LPRA 2F4LA 1JRSA 1HIAB 1CGHA 2A4GA 4GHTA 4IC5A 4MTBA 2TBSA 1J15A 4NCYA 4BAMB 3FN8A 2J94A 1ZMNA 3GCHB 5ESBA 3ODFA 2ZFRH 3LIWA 3FP7E 4RN6A 1GBLA 1OKXA 2WZQA 2XC0A 2VIDA 3SV2H 1BT7A 4D8NA 5DP4A 1EPTC 1K28D 2I6SA 5FCRA 1H8HD 4ZAEA 2LNCA 3O8DA 3ZVCA 3M5MA 1ESAA 1HAGE 2KR7A 1YY3A 1W0KD 2VGCB 3A7VA 1W10U 3SGAE 2ZFFH 3FP6E 1LTOA 4E05H 3TNSA 2ZGCA 4RI0A 1SGEE 2FOCA 2BY5X 1AUJA 3W1EA 3RMLH 2BDIA 3LGUA 2VIVA 1NO9H 1WXRA 1SGNE 4YTAA 2G4UA 3SYJA 2VWOA 4I86A 4ASUD 3VB5A 4TY7A 3O8BA 4IS5A 3TK6A 3SJOA 1OXGA 2O8LA 3KYGA 4FUCA 6CHAC 2BD7A 1ELGA 3KQ5A 1O3HA 2Y7XA 1GBEA 4E7RG 1O36A 4Y7BA 2QXJA 1ZRKA 2NU4E 3TNTA 3WWFA 3VB3A 1V2MT 2A0QB 3RXLA 1EZXC 2FODA 5HIYA 4NIWA 2XW9A 1YPMH 2QXIA 4FXGH 4BAOB 4CRFA 1UVUH 1N6YA 4K69A 4WXIA 1KDQA 1BIOA 3ATIA 3LJOA 2NU3E 4O9VA 1DWBH 3HPTB 3SBKA 2UUKB 4JZ1A 2BY8X 4AZ2B 3OAAD 5CHBA 2PKSC 2QC2A 3LGYA 3T25A 1GGDC 3F2HA 1P3CA 1ANCA 2GX4A 4Q4LA 2W3KA 1IQNA 1OWEA 3QTVH 2ZI2H 2QF5A 2FOBA 3BTEE 5EQSA 3VEQB 3DSPA 4ZUHA 4ZH8A 1GJBB 1HB0B 3DSOA 3D49H 3UQOA 1AE8H 1ZHPA 4E7NA 2P3UB 3UWIA 2DE8A 3TU7H 2W7UA 1SFQB 3RU4D 1C2JA 5K7RA 2BOHB 1HDTH 1OWIA 3OTPA 3MI4A 2VJ1A 1C2HA 1CT0E 2FOFA 3AAUA 2EI7A 3TK5A 2RFKC 1TNGA 1SLXB 3AW0A 3U8RH 3NKKA 1O34A 3OYPA 4A1XA 2BD9A 4Y8ZA 2FI5E 4CR5A 4XOJA 1O2XA 2YNAA 1EP6A 4O97A 4XBDA 1EASA 1YPEH 4JMYA 4I8JA 1QL8A 5CHAB 1TRMA 1GHXH 5FPSA 1C5OH 3V7TA 3SV8A 1P2QA 1O37A 4A1TA 1MZDA 2C93B 2R0LA 1Y8TA 4B2BA 2VH0A 4NA9H 4K1EA 4ACBA 1TE0A 3A7XA 3D62A 3F9FA 1EOJA 1VR1H 2AYWA 1PQ8A 3RC6A 5JB8S 1PFXC 2B9LA 1DSUA 2AERH 3MFJA 3KL6A 3JZ2B 5ETXA 4DVAU 2ZFTA 4AGJA 1XUFA 2F9PA 2FOAA 2P59A 3F1SB 1V2TT 4HG6A 1P9UA 4DT7B 2G55A 3MU5A 4YXWD 1UK3A 4AB8A 4Y10E 1FPHH 4KGAA 1NY22 4JZIA 1H4WA 2OQUA 1KXFA 4DCDA 1XKBC 5C1XA 1ELVA 1C4V2 1UCYE 2B0FA 1LO6A 1C1WH 2OBQA 2SGAA 4OS5A 2Z9KA 1J16A 1RJXB 3OE7D 1O3JA 1QY6A 4FVDA 4B74A 1TRNA 2TGDA 3ZV8A 2SNVA 2ZCHP 2BOKA 2V3HH 4ASHA 5T1VA 2A7HA 5A8ZA 5E8EH 1GHAG 2QN5T 1SGYE 4F4OC 2VGCC 1O3GA 1ABJH 4AN7A 2J34A 1KTSB 1QA0A 4OGXA 1BDAA 3M36A 3SO3A 3SU6A 1NN6A 3T29A 1S81A 2JKHA 5SGAE 4NSYA 1P05A 2IN2A 3BIVH 2BM2A 3K9XB 3P8GA 1V2VT 1YC0A 2BZAA 3RXAA 4ZXYH 1XXFA 1YF4A 4K8BA 3U28C 2UUYA 1XVOA 2FMJA 4K1SA 3ITIA 2Y7ZA 1IQKA 3RU4E 1OWHA 4FUGA 1GVLA 4AX9H 1UTJA 2GCHG 3ZVDA 3R3GB 4TY6A 1EAUA 2FXRA 4X0WU 2XYAA 1TGBA 4NA7A 4I8GA 1AZ8A 4HGCA 1GHWH 4I32A 2GTBA 1VITF 2A4RA 1DITH 4CRDA 2KAIA 3JZ1B 4R0IA 6GCHF 2PLXA 3UWJH 2C8WB 5EODA 3UUZA 1OS8A 1LKAA 1O2IA 5F8TA 3GY6A 1C2GA 3OTJE 3QZRA 4A92A 4UEHH 5DG6A 1TMUH 1W7GH 3LH1A 3TLOA 5KECA 2TIOA 2VIQA 1DS2E 4GAWA 4NIVA 3RXHA 3MO6A 2ZDLA 1K1LA 3T26A 5C1UA 1HJ8A 1O3DA 1DSTA 2Z3EA 2C8XB 3NK8A 2D2DA 3PLBA 1V2OT 2F9BH 1UMAH 1L4DA 1AN1E 4DJZB 2BDHA 1FN6A 1HXEH 2G5VA 2O8UA 2K1QA 3ZVAA 3ZZ7A 1WOFA 3L6PA 1MAXA 2ZG0H 2G81E 3NXPA 1QZ8A 2CGAA 1BTPA 1C5MD 5T6FA 3EA9A 1GCTB 2OK5A 1O2JA 2BD4A 4AFQA 1TWXB 2XCNA 4KTCA 4K5ZA 1V2NT 1KLTA 4GVUA 1C2DA 1LKBA 2ZTXA 5EIYA 2ZEBA 1C1RA 2FLBH 2HOBA 3GY8A 2J4IA 4MPUA 3RXMA 1C5LH 3RXEA 1GJDB 1DANH 1BZXE 2ZHFH 2A4OA 2V3OH 1FY4A 2BD2A 1J17T 1UO6A 1P8VC 2LPRA 3RU4T 4DW2U 5DO4H 1ZTJA 2ZFSA 3H5CB 3F9EA 4LOYH 4Q2KA 3PWCA 3LC3A 2PKAB 4IGDA 4RT1A 4I31A 1ANDA 2BHGA 2ZU1A 3E8LA 5F53A 1LPKB 1TNHA 2ZHEH 4GCHG 1Z7KA 3GDUA 4I8LA 1F2SE 1UTPA 4U01A 4YLQH 4UDWH 1PYTC 1HUTH 3A8CA 5EQQA 3ZZ6A 1A5HA 2BDCA 1WSSH 2C8ZB 3P6ZB 5G4BA 4AC9A 1W14U 3SUDA 5C1YA 2A4QA 4ABFA 3ZIAD 3BTME 3QTOH 4RSPA 3UNQA 4DOQA 4Y11E 1G3CA 5HGGA 4ZKRU 1UJ1A 1C1UH 3SV7A 1O5GH 1YGCH 4JZEH 4K8YA 1QQUA 1A3BH 2WUBA 3N99A 4Y8XA 4H6SB 1NU7B 3MO9A 1O2VA 2H9HA 5J4QA 2XBXA 1NU9A 4KP0A 2ZU5A 1Z8IB 3TJOA 1NT1A 1C5NH 2W6JD 1MABB 4ISHH 2HNTF 2WPDD 3A80A 4XFQA 1E1QD 1HJ9A 1WCZA 2F43B 2KFWA 3SGQE 4NWKA 5AFYH 1W13U 4ESTE 4O3TA 4NGAH 2FEQH 3F68H 1MBQA 1C2IA 3GY4A 4ZHAA 4KKDA 2QXGA 3FP8E 4UFEH 2EI6A 5AHGH 1X7AC 4HFPB 2FPZA 1SLWB 2PFEA 4OS2A 2A7JA 4K60A 2Y80A 5GJ4B 2AGGX 5JDUB 5L6NH 3FAOA 5EJZA 1AY6H 2AEIH 2QE7D 3EAJA 3MOCA 1ETSH 1IQMA 2YNBA 3PRDA 5DN6D 1ZGIA 3IWMA 1MQ5A 1GMDF 2H6MA 4BXSA 2Z3DA 4AB9A 3I78A 1C5TA 3NWUA 1XUJA 4KELA 5E2OA 1MD8A 1H8ED 2D26C 1AD8H 5LH8A 2R3YA 3TH3H 1E34B 4FUEA 1GHBG 1F5LA 2F3CE 3AVZA 2XBWA 1GWAA 4OS1A 1LVMA 1CE5A 1E36B 1FY5A 5HXFA 1WQSA 4ISOA 2VVCA 1FONA 2G8TA 3S69A 4TT3D 4WXVA 1B7XB 3MNXA 2KX4A 1NZQH 1O2NA 1HBTH 5FBIA 3D23A 1TA6A 3TGKE 1D6RA 1K1OA 2HALA 4JYUH 3RMNH 2PP6A 2FI3E 4ZMAH 6CHAB 1Z8JB 5DPAA 1F5RA 1O2RA 1G3EA 1TPAE 2CXVA 2ZDVH 2BX3A 2ASUB 1QHRB 2VVVA 4A6LA 1SGRE 4I7YH 2A2QH 3BTHE 4CBNA 1LQDB 1AB9B 2Q6GA 1K9OE 1OYTH 1JOUB 5DK1A 1AFEH 1RTKA 1JBUH 1FX0B 1ZJDA 3SU3A 3KQEA 2GZ8A 4B75A 1OP8A 3A7ZA 3BEUA 4YO9A 2XBVA 4Y0ZE 1S6FA 2NU0E 1V2QT 1XUHA 5DP3A 4FVBA 4ZHMU 3NUMA 4TYDA 5GXPA 1LHEH 1TQ0B 3ZVEA 3FOAA 1BITA 1NROH 1T8OA 2GKVE 3DFJA 2A2XH 3ZVFA 1KXBA 4BTTB 2G52A 3R0FA 2QIQA 4U32A 4UFGH 5L30H 1CO7E 2JH5D 1TALA 3URCA 1AUTC 1TGTA 2BQ7B 2ZTYA 3A88A 2BVXH 1F5KU 5A0CA 2EA3A 1P2NA 1IQLA 1S83A 3H7OA 1A0HB 2ILNA 4VGCB 4ZHLU 3M35A 2WYGA 4FOUC 1ID5H 1C1NA 2GT7A 2ZNKH 1QNJA 5F8ZA 1SPJA 3OEHD 3SHCH 1QGFA 3NZIA 2O8TA 4CRCA 1T8MA 1DPOA 1C1TA 1P03A 1DUAA 2JIZD 1V2UT 4ZXXH 2XC4A 1P2JA 4MNVA 5E0GA 1HCGA 1FDPA 1QL7A 1CA8B 1HNEE 1PPBH 2J9NA 4JZDH 2WPIS 3QZQA 3WW7A 4MNWA 2AMPA 1AKSA 3UFAA 1TONA 1Y59T 3T62A 3URDA 2ZF0H 1V3XA 2FS9A 2TGPZ 3EGKH 5GWZA 3FZDA 3UREA 4X2YA 3U8TH 4FUHA 4XDEA 3K6YA 1QL9A 1OWDA 2GMTB 1O2HA 2HPPH 1ELEE 2THFB 1OX1A 2FZZA 2PSYA 3S9CA 5HMAA 1EAIA 2SGQE 1V2WT 5F8XA 1SGFA 4AG2A 2ZIQH 1ZYOA 3Q3YA 2J5UA 2LP6A 2H9TH 2UUFB 1XMNB 1YKTA 1CHOF 1GBKA 1S82A 3KQBA 1BMLA 4NG9H 3A8DA 9ESTA 1K21H 1TOCB 4M7GA 1OSSA 4XBCA 1V2RT 3ESTA 4MVNA 4FUBA 2B5TB 1NRPH 1GBDA 2Z3CA 2ZPRA 4O03A 1CA0B 1ELFA 1MAYA 1AU8A 3RDZA 4AFZA 1NESE 2BD3A 2CK3D 3ZVBA 1KXAA 2JJ1D 1Y3UA 1ZSLA 4BTIB 1G2MA 4D7FA 1PPGE 1C5QA 2Q1JA 4CRBA 4H6TA 1O2OA 2BVSH 3TVJB 1EPTA 2OC0A 3QWCH 2L74A 1UHBA 1ELDE 1MBMA 4I8KA 3PV4A 3ZZ3A 1AGJA 3A81A 2FTLE 3N7DA 4X6NA 1DM4B 1WAYB 4SGBE 1AFQC 1BTZA 1GHYH 5EG4A 5FBEA 4NFFA 2SGEE 1G3DA 3Q3XA 1VJ9U 5C2ZA 4X6MA 5HM9A 4CREA 1HXFH 4JK6A 4B6FA 4INKA 1RS0A 4ABGA 1FN8A 1PPCE 4TWYA 1KLJH 1AB9C 2JH0D 3GY7A 3LKWA 3VPKA 2ZPQA 5BRRE 2FLRH 1WV7H 1DXPA 1O2ZA 1L1GA 1D6WA 1ELCA 2QV1A 1HAVA 2B7DH 4OGYA 1YCPK 1FLEE 1SBWA 8GCHG 2CJIA 3RC5A 2WV5A 3LGWA 5A0BA 3B23B 1EJMA 1KXCA 1KXDA 5E0HA 2L6OA 1SQTA 1O2YA 2ZHQH 1UVPA 2ZFQH 1GBCA 3SUFA 2VBCA 1O2WA 1O3PB 2Z94A 3SI4H 3UAIC 4A1VA 3A7YA 3ZZ8A 5T6GA 3KYFA 5I46H 2M2AA 3EQ0H 1P0SH 4AG1A 5E0JA 4LXBH 5EQRA 1QRWA 3MU1A 3SU4A 1T4VH 1BMAA 1DFPA 2OQ5A 2PTCE 1JIMA 1G2LA 1ZR0A 1LVBA 3M5OA 3W94A 2ALPA 1DXWA 3HATH 1TOMH 1T8LA 1LVOA 1SKYE 5GCHG 1K1IA 4TPIZ 1SG8B 1TX6A 2G51A 1P2MA 3QX5H 5TCCA 2QF3A 2ZC9H 2SGDE 4UE7H 4VGCC 1EB2A 1GJ4H 2J2UA 1DE7H 1MMJN 3VB4A 2XXLA 1V2LT 5AFZH 1AO5A 1E38B 1TQ7B 2XC5A 1TLDA 4WY3A 3RP2A 1LCYA 2H1UA 2RA0A 4X8VH 3ZZ4A 1E37B 7GCHF 2SFAA 1O3LA 1QQ4A 5JB9S 5FAHA 4B71A 3NRLA 2HLCA 1C1PA 4R8TB 2OD3B 1HAYB 1SSXA 2QCYA 2W26A 1QB6A 1GI8B 2FX6A 4FU8A 2XWBI 5C0UA 1YPHE 1F0UA 1GMHF 4DURA 1ANBA 5A8XA 3N7EA 1TX8A 1SGTA 3WWBA 2OBOA 4B76A 1ZPCA 2QY0B 1GDNA 1T8NA 2GMTC 3LONA 3RMOH 3GDVA 1U6QA 3SU1A 2WV4A 4ABAA 4D7GA 4IN1A 2NU2E 1LMWB 4A5TS 5DJ7A 1B0EA 3RC4A 3S0NA 3MH5A 2Z9IA 1P57B 1V2PT 3BG4B 2ZO3H 2BD8A 1O3CA 1YPGH 3GYMA 1CGJE 1SGPE 2V3MA 4HI3A 2P16A 3TH4H 4Y6DA 1DLEA 2H9EH 3FO8D 3QDZB 2ZDMA 3UIRA 2ZTZA 2Z7FE 3SJIA 2ZGBH 4BXWA 2BVRH 1UK2A 3Q76A 1N6XA 3ZZ9A 2PW8H 4UD9H 1O2KA 1ZOMA 2UUJB 2VH6A 3PMHB 2AH4X 1CU1A 1FJSA 2ZQ1A 4NFEA 1MTSA 1CA0C 1Z8GA 5FCKA 3SZEA 1OWJA 5JBCS 1HIAA 3F6UH 3MU0A 1S6HA 3A86A 1V6DA 1L0ZA 2J98B 3LU9B 3PMBB 4Q80A 1YBWA 4P00A 1ELBA 6ESTA 3KHVA 1TRYA 5J4SA 4DGJA 1THPB 4MPVA 4ISLA 2XWAA 1A3EH 3E0PB 4Q7YA 4CH2B 2Y5HA 3WY8A 2C3SA 3SV6A 1YPHC 5EPNA 1QR3E 4OS6A 1QCPA 3DSGA 1HFDA 3C27B 3LPRA 1IQEA 1QIXB 1O38A 5AF9H 3S7HB 1JXPA 1P01A 1N1LA 3TJVA 2BLOA 1GBFA 4IC6A 1TNJA 4ABDA 3ODDA 3KQDA 1C5SA 5A2MH 1P2KA 1NRRH 3MNSA 2QA9E 3BEFB 2PHBA 1G3BA 5F03A 1GJCB 4X6OA 1KYNA 3S7KB 1IHTH 3SJ9A 4E06H 1IQHA 1YCPH 5I25A 1SGQE 2K0QA 3MQKC 1O5CB 1HRTH 3SJKA 2WHXA 5EXNA 1O3IA 1TABE 1W12U 1DDJA 4FUJA 1HAZB 4JYTA 1SB1H 4X8TH 1NTPA 3KGPA 1TX7A 2SNWA 3PTNA 1ZMJA 1ARBA 5FX6A 1QBVH 4UFFH 4X1SU 3BTGE 1GCDA 2VVUA 1SC8U 3GCOA 3SNBA 3CENA 1WTHD 3M5NA 4IMZA 1WYKA 3SV9A 3SNEA 1E1RD 1WBGB 2GT8A 4RKJB 2EC9H 1MTUA 2EY4C 1ELTA 1EAXA 1MZAA 5LPFA 2M5TA 2YOLA 1O2SA 1ZLRA 4YZUA 1GPZA 4YOIA 1IQGA 1UVSH 1O33A 2F9OA 5JBBS 1XUGA 3U69H 3VFEA 3BF6H 4U2WA 2BTCE 1FMGA 5DKMA 3LDXH 5TCAA 3EA8A 3KF2A 3GCTF 1MQ6A 1TBQH 1BTUA 1LDTT 1EOLA 2A5IA 2Z9JA 1XUIA 3SZNA 4BNRA 3CS0A 1RTFB 2BB4A 1SFIA 7KMEH 3P92A 4X2WA 1W2KH 3DT0H 4K2YA 3A89A 5T3HA 4KTUA 3OSYA 3RXQA 2ZGHA 2STAE 3SQHE 1SQAA 1H9LB 1FI8A 3A83A 3ELAH 3GICB 2AMQA 2OC7A 3RXKA 4ISIH 1J14A 1ZPBA 1Q3XA 4Y8YA 2A31A 2RDLA 5PTPA 1L1JA 1G9IE 1RFNA 3D65E 2FOGA 1J9CH 1GMCF 3L3TA 4NIXA 2HVYB 3GS9A 1GI7B 3EYDA 4I33A 3ZYEA 2ZA5A 2A32A 3BTQE 2ANWA 1T7CA 3MNBA 3STIA 3T28A 3BG4C 1BJVA 1TPSA 1LPZB 1N8OB 7ESTE 1RXPA 2ZU4A 1KTTB 3GY5A 1O30A 1EJAA 1PQ7A 1P12E 3UR9A 1C5YB 3E0NB 1YYY1 1GVZA 2ANKH 1GG6B 5CDFE 1A0JA 1P10A 4D9QA 1B5GH 3M7QA 1TBRH 2AGEX 2FO9A 4U30A 1C5PA 1ESTA 2BZ6H 1VITH 1T4UH 5HIZA 2DE9A 5EGMA 1JMOH 2CF8H 1BTXA 4H4FA 1GL0E 1SOTA 1DY9A 2ZGXH 1DY8A 3A82A 4PROA 1GJ8B 4QT8C 1OOKB 2Q6DA 1AVXA 1VCQA 3FZZA 8KME2 1MCVA 1VITG 1EZUC 3QK1A 1EZSC 1HAPH 1TPPA 4D76A 1FXYA 1SGIB 3F9GA 2RA3A 1ZMLA 2LELA 1C5UA 1EX3A 4JK5A 1V2ST 4CHAB 1C1QA 1C5ZB 1HLTH 2ZU2A 2RG3A 3SI3H 3FANA 4NIYA 4Y79A 4MPXA 1OHHD 3MHWU 2D8WA 1QRZA 1BMNH 3Q77A 2ODYB 3SU5A 1ETRH 2CHAB 1BJUA 1L1NA 1TMBH 1ZSJA 1OPHB 2R2MB 1BTHH 1HPGA 2Z9LA 3ZYDA 4YESB 3RXTA 2ZDAH 5DP6A 1EATA 1BTWA 3T27A 1P2IA 2TGTA 1L4ZA 1UK4A 2NWNA 3E16B 3E90B 4ISNA 3SQEE 4ABBA 1UTLM 1S5SA 1AFQB 3SGBE 1PJPA 1VJAU 3TJNA 1C5VA 4IBLH 1OWKA 2C4FH 3QLPH 1H1BA 1NFYA 1IAUA 1GI3A 5DGJA 1C2LA 1KIGH 3SHAH 4FU7A 1C4U2 2O8MA 1O5EH 3BTTE 3UPEA 3HGNA 1AMHA 1E0FD 1LVYA 3ZZDA 2A7CA 3MH7A 1FAXA 2IPHA 1O0DH 1GI6A 1SLVB 2PWXA 4UONA 1JRTA 1NFXA 2R0KA 1O2TA 1NRNH 4P02A 4CR9A 3V3MA 2KCOA 1KMHB 1Q2WA 1SLUB 2WPHS 2KCAA 4JYVH 1JWTA 1VCWA 1O3KA 1GJAB 1KDQB 2FIRH 3GY3A 3QO6A 4FU9A 2VWNA 1QJ7B 1A5GH 4X1RU 2F9UA 1TGNA 2ZDKA 2TGAA 1FIZA 1KSNA 1A1RA 2RDEA 1TBZH 2ULLA 3UB0A 3PRBA 2FWWA 1NRQH 1J8AA 1DX5M 2GGVB 1BRAA 3AASA 3UOUA 3QGJA 5EPYA 1C5XB 3M5LA 3RXGA 3PTBA 1PPEE 1O3OA 1F7ZA 5EW2H 1NPMA 1D3TB 1TNLA 2BLWA 4IN2A 4Y7AA 3BG8A 3MH4A 3PWBA 4MQAA 2VB0A 5GIBA 4F48B 1BBRK 1SQRA 2GCTB 4XD7D 3SUEA 1MH0A 2UWPA 3TPIZ 1WU1A 1GBJA 2V35A 4GLYA 3SNCA 1Q31A 2KCPA 3FFGA 1H8DH 1TYNA 1CGIE 3IITA 4WVPE 4ZKNU 2PV9B 2OTVA 1SI5H 4WH8A 3OY6U 4D9RA 2V0BA 1EAWA 2J97A 3LOXA 3AW1A 2F91A 3DA9B 2UWLA 5ESTE 5EXMA 2PKAA 2TRMA 4OS7A 5JBAS 3RXUA 1THSH 4CH8B 1Z71A 1O2UA 3KQCA 1W0ZU 2K8IA 1HAHH 3K2UA 1N8OC 4B2AA 1M9UA 1LHFH 2JH6D 4ABEA 1S84A 1OYQA 1AWHB 3PMJA 1UVTH 1Y3VA 4J1YA 4OS4A 3GOVB 1DOJA 4X1QU 1AE5A 3U1IB 4MPWA 2ZKSA 1GG6C 1BHXB 3S9AA 3BSQA 1LQEA 3TIUA 4X8UH 2ZFPH 1GBMA 1ZTKA 1A5IA 1GDQA 2AIPA 1BCUH 1QRXA 3RLYH 2HVXA 3I77A 3P95A 1GVKB 1ORFA 2ODQA 1QURH 5GCHF 5B6OA 2GP9B 5IDKA 3Q3KA 2C8YB 1AHTH 2QF0A 5JPMH 1BB0B 2DUCA 2EQNA 3MMGA 1GJ5H 1GBIA 1ZSKA 2NU1E 3A85A 2PUXB 5AVDA 1C9PA 1C1SA 1LHCH 1W0JD 4X6PA 2HPQH 3U1JB 3TGJE 3F0PA 4CHAC 2ZHWH 4KTSA 2FESH 2IOTA 1ZPZA 4NSVA 1NS3A 1YWUA 2BXTH 3M3TA 4Y0YE 1TNKA 2CHAC 2PUQH 1Y5BT 2QGRA 1TMTH 2ZWLH 4Z0KA 5C3NA 2ODPA 2W6ID 3CS7A 2FDAA 2BYAX 3I29A 2KM0A 4NA8A 5FL7D 5TJXA 3VGCC 1NBMD 1MTNC 1UW7A 2F9NA 8ESTE 3RXBA 2OP9A 5C17A 1EP5A 2PTNA 1AZZA 3EE0B 3UNRA 4BAQB 3F2GA 1AVGH 1Y3YA 1EZQA 4FUFA 1VCPA 3HGPA 1BOQA 2WYJA 2P3TB 1EQ9A 2ZECA 1W0YH 5C94A 2BDYA 2J92A 4X1NU 2YMSD 5DP8A 3FKSD 1DUEA 1O3BA 1KXEA 2R9PA 3V0XA 4ABHA 1ZHMA 1SGFG 1HJAB 4MG3A 2P94A 4LZ1H 5DSFA 1EJNA 1H9HE 1RGQA 2WV9A 2YMSB 2GV6A 4LK4A 4AOQA 5LPRA 2FI4E 5BPEA 1HAIH 2KAIB 3ATLA 1O2GH 5C67A 4O3UA 5C5OA 2VU8E 1GHAF 4RKOB 2GDEH 4BAHB 1ABIH 1EFRD 1P3EA 1QJ6B 1RRKA 4H42U 1O3AA 1C1MA 3MO3A 3DUXH 2Y81A 3RLWH 3TK9A 4X8SH 5FXLA 3SNDA 2O9QA 2OXSA 9LPRA 3PV2A 4JCNA 3H09A 2FX4A 2W5EA 1A2CH 2BY9X 5H4IB 4TPYA 1RIWC 2O8WA 2GZ7A 2J38A 4ZROA 2ZQ2A 1BUIA 3MYWA 1TAWA 2P3FH 1BBRH 1QJ1B 5EJLA 1FY3A 2GCTC 1XUKA 5A09A 1MKXK 3GY2A 1H8IH 5JBTA 4I8HA 2Y5FA 4J2YB 1Y5AT 3P8NA 2OUAA 3NCLA 1BHXF 4BANB 3U9AH 2GCHF 4XE4A 3G01A 5C0TA 1QB9A 3HKJB 3SU0A 2P8OB 4DIIH 3OU0A 4IMQA 2WPKS 2P93A 3BTDE 1CHOG 5A8YA 3HK6B 1XX9A 1OP0A 3DHKH 1T32A 3PM3A 1CT2E 2BY7X 2G00A 1EKBB 2FOHA 2JETC 2FM2A 3RXSA 3E3TA 1NBME 1KY9A 1AI8H 1FIWA 1O35A 1XKAC 1W7XH 3QN7A 5GDSH 4WH6A 2Y6TA 1W11U 1BMMH 2GDDA 3TITA 1INCA 1PPZA 4FUIA 1FZZA 5GPIB 3ZVGA 1UCYK 2ZZUH 1SVPA 1ZZZA 2AHME 2Z9GA 1PYTD 2R2WU 3SU2A 3VB6A 1UTQA 1Z6JH 3UY9A 2A5KA 2GJGA 3U8OH 2A45B 1QTFA 1PQ5A 3LJJA 1C9TA 2A1DB 4UFDH 3M3SA 3P70B 5L2ZH 3M37A 1ZRBA 4B2CA 4YOJA 4XRNA 2BQWB 2IJOB 1UTKA 2JDID 1YCPM 1CBWB 3ZZBA 1O3NA 3BIUH 3KCGH 3T5FH 1XXDA 4ABIA 1WUNH 4AFUA 2PSXA 1L2EA 1RTLA 1K22H 2R3UA 2AS9A 5EOKA 4JZFH 2OC8A 1C2EA 3PLPA 4MDSA 1FY1A 3RXJA 5LGOA 1FV9A 4TSFD 1GI5A 1YPJH 1DVAH 3PYHA 5CMXH 1PPHE 1TPOA 2QAAA 3GCHC 3CNRA 2RCEA 2G4TA 3SW2B 4M9FA 3EA7A 4WMFA 1LHGH 3SORA 1Z8RA 3MU8A 2SGPE 4GCHF 2H2ZA 4AYYB 1BMFD 1MTWA 1ELAA 3ZZCA 1CQQA 4BOHA 4X2XA 3MH6A 2FOMB 2ALVA 5FPTA 1C5RA 4HTCH 4DY7B 1O31A 3S9BA 2QXHA 1D3DB 3GISB 2GD4B 4HZHA 3LC5A 3L33A 2EEKA 1QB1A 3P8FA 2AMDA 1FY8E 3LGIA 3O8CA 3P17H 2AGIX 1A4WH 2ZPSA 1GJ9B 5LPEA 1K1PA 1P11E 1C2MA 2IPQX 1SGDE 1IQJA 4X2VA 2BD5A 4TWWA 1HJAC 2ESTE 3GYLB 2C90B 2KZ4A 2XTTB 3SN8A 2YMSC 5IK2D 1GBTA 1YPLH 1IQIA 1EB1H 1SR5C 3RXCA 4WMEA 5B6LA 2XRCA 1C1OA 3N7OA 2GVFA 2TPIZ 2ZHDA 4NWLA 3KEEA 3PROA 3PB1E 7GCHG 1V2KT 3Q00A 1F0RA 3O8RA 2HGTH 1VGCB 1A46H 4WF8A 5FX5A 1GJ6A 1DLKB 1F0SA 5K0HA 5EXLA 1C4Y2 3VB7A 1EXFA 2ANYA 3MWIU 1RD3B 5DP5A 2ZU3A 2W7SA 2BDGA 1GMHG 2BY6X 1IOEA 1NFWA 1BRBE 1K1NA 3BV9B 3MU4A 4GUXA 3VG8A 1Y3XA 2BQ6B 2WUCA 1A61H 1GI4A 1JIRA 1FPCH 1MKXH 1B0FA 1BRCE 3V13A 2V6NA 2ZCLP 3OEED 2WPMS 4DT4A 4INLA 1QBOA 3F0OA 1DWCH 1PQAA 1Z1IA 3F2FA 2G5NA 1GBAA 2XOKD 2WPJS 1O5BB 2P8OC 3LT3A 3RXFA 1H9IE 3QGNB 2P95A 3GDSA 3PLKA 4BAKB 1GHBF 1S85A 2XCFA 4YT6H 1KLIH 4XBBA 1TNIA 1BRUP 3ENSB 1O2QA 4B6EA 1EUFA 1S0QA 4Q63A 1HGTH 1QA7A 1TGCA 2XNIA 3E6PH 1K0HA 3F9HA 3PO1B 1XM1A 1YLNA 5T6DA 5A0AE 2I6QA 4YT7H 2JJ2D 4FUDA 1GBBA 1DICA 3B9FH 4AFSA 4CRAA 2Q6FA 2BDAA 3RXVA 1Y3WA 2F9VA 2CV3A 4AGKA 4AYVB 1O2PA 1W3CA 1K1MA 3ZZAA 1UCYH 3MTYA 5CHAC 2Y5GA 5JYIA 3NPSA 1O3MA 4K1TA 4NZQA 1O3EA 1TA2A 4Q7XA 4THNH 3KN2A 1AKSB 1YP9A 1GHVH 1V2JT 1CSOE 2CN0H 3UR6A 1GI2A 5IYTA 2FTMA 2ZCKP 2HNTE 5C5NA 3A7WA 2A5AA 1CBWC 3KNXA 3ZZ5A 1BTYA 1GBHA 3RXRA 1GI1A 1D3PB 1FAKH 2PGBB 2BMGB 1C2FA 4Z1MD 5C20A 2BXUH 1YLDA 3SNAA 1Y5UT 4Q7ZA 5DP7A 1C2KA 1AVWA 4ZKOU 3U98H 1MKWK 1P2OA 3VXFH 1P02A 1OP2A 3HKIB 2PGQB 1UTOA 1DT2A 3MNCA 2STBE 3AK5A 3RXOA 3A87A 3M3VA 3LH3A 2ZGJA 4YM9A 3PMAB 6GCHG 3RMMH 1NM6A 4ZKSU 1F0TA 1MU8B 2ZDNA 1YM0A 3STJA 4WWYA 1XVMA 2BX4A 1BA8B 4WMDA 3SUGA 1SL3A 2J98A 5HM2A 5HKKD 1UVOA 1IQFA 2OC1A 2CMYA 3BN9A 2AFQB 3DCLA 2VNTA 3W95A 1SHYA 1O3FA 3DFLA 1ZGVA 5EU8A 3H7TA 1COWD 1VZQH 2HLDD 4CRGA 3ATMA 3VGCB 1EPTB 2BDBA 1MTNB 1F92A 1MUEB 1SGCA 1UHBB 2HRVA 1FUJA 2IJD1 1G37A 3KIDU 3ATWA 3OX7U 1CT4E 2VINA 1QBNA 2FS8A 2OLGA 3P8OA 2HNTC 3BEIB 1HV7A 4ABJA 1YPKH 2WPLS 3HK3B 3GCTG 4RT0A 4DIHH 1HAOH 1ARCA 4OM9A 3FVFB 3A8BA 4K3JA 2J95A 3V12A 1O39A 2Y82A 3M7UA 1DWEH 3A7TA 1S0RA 1GL1A 1G32B 1GJ7B 3BTWE 1HYLA 1O5DH 1VGCC 3RXDA 3K65B 3T2NA 1D3QB 5FPYA 2Z6BD 3M7TA 1AQ7A 5KGOA 3K6ZA 2AIQA 2FOEA 1BQYA 3SJ8A 1HAVB 4GSOA 3LGTA 1ZTLA 1O2LA 3ATKA 5HYOA 1O32A 1Z6EA 1AWFH 2HWLB 1E79D 3A8AA 3A84A 3EDXB 5ABWA 1P9SA 2PR3A 1W8BH 2UWOA 1C5WB 4MNXA 2XBYA 1D4PB 1LPGB 3AAVA 1TB6H 3PV5A 4ZCNA 1GMCG 3QUMP 1E35B 5EJ1A 1O5AB 1YLCA 2GV7A 1FQ3A 4INHA 4FETA 1UTMA 4Y71A 1P06A 4CBOA 5DP9A 3UQVA 4LZ4B 1AIXH 1GI0A 1GHZA 4MNYA 3VXEH 1RIWB 3TGIE 1CVWH 1GDUA 2WSSD 3B8JA 2PKSB 1GCTC 1GGDB 2D1JA 4YOGA 7LPRA 2VIPA 1ESBA 1ETTH 1LHDH 3F3BA 3PO1C 1FNIA 1O2MA 2ANMH 1ZJKA 3DD2H 4B73A 1ACBE 1T31A 4F55A 2FYRA 1TGSZ 5EW1H 4MLFB 3M61U 1DWDH 1C1VH 2SGFE 4XSKU 3TJUA 1VKYA
chains in the Genus database with same CATH topology
1SHHB 1NC6A 1CHGA 2BLVA 2ZP0H 2VWMA 3E1XB 4GPGA 4A7IB 1WTGH 5FHTA 2VIOA 3LGVA 1GI9B 4Y76A 1SQOA 1D9IA 1A7SA 8GCHF 3RUOA 2OINA 3E91A 2GZ9A 3UOPA 3CP7A 1P04A 4DG4A 1SOZA 1WQVH 1HAXB 3BTFE 1QFKH 2JETB 2VIWA 1PPFE 2VWLA 1IHSH 3RXIA 1GMDG 1O5FH 2EI8A 4X1PU 1BBRE 1UTNA 4BTUB 8LPRA 4WJG2 4B1TA 1A0LA 2F83A 1K2I1 1G36A 2OCVB 1MU6B 5E2PA 1MKWH 2CF9H 3BTKE 3C1KA 4Z6AH 1MTVA 3IG6B 1ZHRA 1Z1JA 2W3IA 3OY5U 3RXPA 4YLUA 4NZLA 2QYIA 1K1JA 4GHQA 3RM2H 2BLQA 3TH2H 1MCTA 4SGAE 5CE1A 3UTUH 1MD7A 5L2YH 1NFUA 1P09A 1SMFE 2FP7B 2WINI 1TFXA 2B8OH 4F49A 1THRH 1G30B 3RM0H 1ANEA 4IW4E 1NRSH 2H5DA 3GCNA 2H5CA 4AORA 3ZV9A 3UNSA 1TIOA 2FYQA 5F6MA 3SOSA 6LPRA 1JRSA 1HIAB 1CGHA 2A4GA 4GHTA 4IC5A 4MTBA 2TBSA 1J15A 4NCYA 4BAMB 2J94A 1ZMNA 3GCHB 5ESBA 3ODFA 2ZFRH 3LIWA 3FP7E 4RN6A 1GBLA 1OKXA 2XC0A 2VIDA 3SV2H 1BT7A 4D8NA 5DP4A 1EPTC 1K28D 2I6SA 5FCRA 4ZAEA 2LNCA 3O8DA 3ZVCA 3M5MA 1ESAA 1HAGE 2VGCB 3A7VA 1W10U 3SGAE 2ZFFH 3FP6E 1LTOA 4E05H 3TNSA 2ZGCA 1SGEE 2FOCA 2BY5X 1AUJA 3RMLH 2BDIA 3LGUA 2VIVA 1NO9H 1SGNE 4YTAA 2G4UA 2VWOA 3VB5A 4TY7A 3O8BA 4IS5A 3TK6A 3SJOA 1OXGA 2O8LA 4FUCA 6CHAC 2BD7A 1ELGA 1O3HA 2Y7XA 1GBEA 4E7RG 1O36A 4Y7BA 2QXJA 1ZRKA 2NU4E 3TNTA 3VB3A 1V2MT 2A0QB 3RXLA 1EZXC 2FODA 4NIWA 2XW9A 1YPMH 2QXIA 4FXGH 4BAOB 4CRFA 1UVUH 1N6YA 4K69A 4WXIA 1KDQA 1BIOA 3ATIA 3LJOA 2NU3E 4O9VA 1DWBH 3HPTB 3SBKA 2UUKB 4JZ1A 2BY8X 4AZ2B 2PKSC 2QC2A 3LGYA 3T25A 1GGDC 1P3CA 1ANCA 2GX4A 2W3KA 1IQNA 1OWEA 3QTVH 2ZI2H 2FOBA 3BTEE 5EQSA 3VEQB 4ZUHA 4ZH8A 1GJBB 1HB0B 3D49H 3UQOA 1AE8H 1ZHPA 4E7NA 2P3UB 3UWIA 2DE8A 3TU7H 2W7UA 1SFQB 3RU4D 1C2JA 5K7RA 2BOHB 1HDTH 1OWIA 3MI4A 2VJ1A 1C2HA 1CT0E 2FOFA 3AAUA 2EI7A 3TK5A 1TNGA 1SLXB 3AW0A 3U8RH 3NKKA 1O34A 3OYPA 4A1XA 2BD9A 4Y8ZA 2FI5E 4CR5A 4XOJA 1O2XA 2YNAA 1EP6A 4O97A 4XBDA 1EASA 1YPEH 4JMYA 4I8JA 1QL8A 5CHAB 1TRMA 1GHXH 5FPSA 1C5OH 3V7TA 3SV8A 1P2QA 1O37A 4A1TA 1MZDA 2C93B 2R0LA 1Y8TA 4B2BA 2VH0A 4NA9H 4K1EA 1TE0A 3A7XA 3D62A 3F9FA 1EOJA 1VR1H 2AYWA 1PQ8A 3RC6A 5JB8S 1PFXC 2B9LA 1DSUA 2AERH 3MFJA 3KL6A 3JZ2B 5ETXA 4DVAU 2ZFTA 4AGJA 1XUFA 2F9PA 2FOAA 2P59A 3F1SB 1V2TT 4DT7B 1P9UA 2G55A 3MU5A 1UK3A 4AB8A 4Y10E 1FPHH 4KGAA 1NY22 4JZIA 1H4WA 2OQUA 1KXFA 4DCDA 1XKBC 5C1XA 1ELVA 1C4V2 1UCYE 2B0FA 1LO6A 1C1WH 2OBQA 2SGAA 4OS5A 2Z9KA 1J16A 1RJXB 1O3JA 1QY6A 4FVDA 4B74A 1TRNA 2TGDA 3ZV8A 2SNVA 2ZCHP 2BOKA 2V3HH 4ASHA 2A7HA 5A8ZA 5E8EH 1GHAG 2QN5T 1SGYE 4F4OC 2VGCC 1O3GA 1ABJH 4AN7A 2J34A 1KTSB 1QA0A 4OGXA 1BDAA 3M36A 3SO3A 3SU6A 1NN6A 3T29A 1S81A 2JKHA 5SGAE 4NSYA 1P05A 2IN2A 3BIVH 2BM2A 3K9XB 3P8GA 1V2VT 1YC0A 2BZAA 3RXAA 4ZXYH 1XXFA 1YF4A 4K8BA 2UUYA 1XVOA 2FMJA 4K1SA 3ITIA 2Y7ZA 1IQKA 3RU4E 1OWHA 4FUGA 1GVLA 4AX9H 1UTJA 2GCHG 3ZVDA 3R3GB 4TY6A 1EAUA 2FXRA 4X0WU 2XYAA 1TGBA 4NA7A 4I8GA 1AZ8A 4HGCA 1GHWH 4I32A 2GTBA 1VITF 2A4RA 1DITH 4CRDA 2KAIA 3JZ1B 4R0IA 6GCHF 2PLXA 3UWJH 2C8WB 5EODA 3UUZA 1OS8A 1LKAA 1O2IA 5F8TA 3GY6A 1C2GA 3OTJE 3QZRA 4A92A 4UEHH 5DG6A 1TMUH 1W7GH 3LH1A 3TLOA 2TIOA 2VIQA 1DS2E 4GAWA 4NIVA 3RXHA 3MO6A 2ZDLA 1K1LA 3T26A 5C1UA 1HJ8A 1O3DA 1DSTA 2Z3EA 2C8XB 3NK8A 2D2DA 3PLBA 1V2OT 2F9BH 1UMAH 1L4DA 1AN1E 4DJZB 2BDHA 1FN6A 1HXEH 2G5VA 2O8UA 2K1QA 3ZVAA 3ZZ7A 1WOFA 3L6PA 1MAXA 2ZG0H 2G81E 3NXPA 1BTPA 1C5MD 2CGAA 5T6FA 3EA9A 1GCTB 1O2JA 2BD4A 4AFQA 1TWXB 2XCNA 4KTCA 4K5ZA 1V2NT 1KLTA 4GVUA 1C2DA 1LKBA 2ZTXA 2ZEBA 1C1RA 2FLBH 2HOBA 3GY8A 2J4IA 4MPUA 3RXMA 1C5LH 3RXEA 1GJDB 1DANH 1BZXE 2ZHFH 2A4OA 2V3OH 1FY4A 2BD2A 1J17T 1UO6A 1P8VC 2LPRA 3RU4T 4DW2U 5DO4H 1ZTJA 2ZFSA 3H5CB 3F9EA 4LOYH 4Q2KA 3PWCA 3LC3A 2PKAB 4IGDA 4I31A 1ANDA 2BHGA 2ZU1A 3E8LA 1LPKB 1TNHA 2ZHEH 4GCHG 1Z7KA 3GDUA 4I8LA 1F2SE 1UTPA 4U01A 4YLQH 4UDWH 1PYTC 1HUTH 3A8CA 5EQQA 3ZZ6A 1A5HA 2BDCA 1WSSH 2C8ZB 3P6ZB 5G4BA 1W14U 3SUDA 5C1YA 2A4QA 4ABFA 3BTME 3QTOH 4RSPA 3UNQA 4DOQA 4Y11E 1G3CA 5HGGA 4ZKRU 1UJ1A 1C1UH 3SV7A 1O5GH 1YGCH 4JZEH 4K8YA 1QQUA 1A3BH 2WUBA 4Y8XA 4H6SB 1NU7B 3MO9A 1O2VA 2H9HA 5J4QA 2XBXA 1NU9A 4KP0A 2ZU5A 1Z8IB 3TJOA 1NT1A 1C5NH 4ISHH 2HNTF 3A80A 4XFQA 1HJ9A 1WCZA 3SGQE 4NWKA 5AFYH 1W13U 4ESTE 4O3TA 4NGAH 2FEQH 3F68H 1MBQA 1C2IA 3GY4A 4ZHAA 4KKDA 2QXGA 3FP8E 4UFEH 2EI6A 5AHGH 1X7AC 4HFPB 2FPZA 1SLWB 2PFEA 4OS2A 2A7JA 4K60A 2Y80A 5GJ4B 2AGGX 5JDUB 5L6NH 3FAOA 1AY6H 2AEIH 3EAJA 3MOCA 1ETSH 1IQMA 2YNBA 1ZGIA 3IWMA 1MQ5A 1GMDF 2H6MA 4BXSA 2Z3DA 4AB9A 3I78A 1C5TA 3NWUA 1XUJA 4KELA 5E2OA 1MD8A 2D26C 1AD8H 5LH8A 2R3YA 3TH3H 1E34B 4FUEA 1GHBG 1F5LA 2F3CE 3AVZA 2XBWA 1GWAA 4OS1A 1LVMA 1CE5A 1E36B 1FY5A 5HXFA 1WQSA 4ISOA 2VVCA 1FONA 2G8TA 3S69A 4WXVA 1B7XB 3MNXA 1NZQH 1O2NA 1HBTH 5FBIA 3D23A 1TA6A 3TGKE 1D6RA 1K1OA 2HALA 4JYUH 3RMNH 2FI3E 4ZMAH 6CHAB 1Z8JB 5DPAA 1F5RA 1O2RA 1G3EA 1TPAE 2CXVA 2ZDVH 2BX3A 2ASUB 1QHRB 2VVVA 4A6LA 1SGRE 4I7YH 2A2QH 3BTHE 4CBNA 1LQDB 1AB9B 2Q6GA 1K9OE 1OYTH 1JOUB 5DK1A 1AFEH 1RTKA 1JBUH 1ZJDA 3SU3A 3KQEA 2GZ8A 4B75A 1OP8A 3A7ZA 3BEUA 4YO9A 2XBVA 4Y0ZE 1S6FA 2NU0E 1V2QT 1XUHA 5DP3A 4FVBA 4ZHMU 3NUMA 4TYDA 5GXPA 1LHEH 1TQ0B 3ZVEA 1BITA 1NROH 1T8OA 2GKVE 3DFJA 2A2XH 3ZVFA 1KXBA 4BTTB 2G52A 3R0FA 2QIQA 4U32A 4UFGH 5L30H 1CO7E 2JH5D 1TALA 3URCA 1AUTC 1TGTA 2BQ7B 2ZTYA 3A88A 2BVXH 1F5KU 5A0CA 2EA3A 1P2NA 1IQLA 1S83A 3H7OA 1A0HB 2ILNA 4VGCB 4ZHLU 3M35A 2WYGA 1ID5H 1C1NA 2GT7A 2ZNKH 1QNJA 5F8ZA 1SPJA 3SHCH 1QGFA 3NZIA 2O8TA 4CRCA 1T8MA 1DPOA 1C1TA 1P03A 1DUAA 1V2UT 4ZXXH 2XC4A 1P2JA 4MNVA 5E0GA 1HCGA 1FDPA 1QL7A 1CA8B 1HNEE 1PPBH 2J9NA 4JZDH 2WPIS 3QZQA 4MNWA 2AMPA 1AKSA 3UFAA 1TONA 1Y59T 3T62A 3URDA 2ZF0H 1V3XA 2FS9A 2TGPZ 3EGKH 5GWZA 3FZDA 3UREA 4X2YA 3U8TH 4FUHA 4XDEA 3K6YA 1QL9A 1OWDA 2GMTB 1O2HA 2HPPH 1ELEE 2THFB 1OX1A 2FZZA 2PSYA 3S9CA 5HMAA 1EAIA 2SGQE 1V2WT 5F8XA 1SGFA 4AG2A 2ZIQH 1ZYOA 3Q3YA 2UUFB 2H9TH 1XMNB 1YKTA 1CHOF 1GBKA 1S82A 3KQBA 1BMLA 4NG9H 3A8DA 9ESTA 1K21H 1TOCB 4M7GA 1OSSA 4XBCA 1V2RT 3ESTA 4MVNA 4FUBA 2B5TB 1NRPH 1GBDA 2Z3CA 2ZPRA 4O03A 1CA0B 1ELFA 1MAYA 1AU8A 3RDZA 4AFZA 1NESE 2BD3A 3ZVBA 1KXAA 1Y3UA 1ZSLA 4BTIB 1G2MA 4D7FA 1PPGE 1C5QA 2Q1JA 4CRBA 4H6TA 1O2OA 2BVSH 3TVJB 1EPTA 2OC0A 3QWCH 1UHBA 1ELDE 1MBMA 4I8KA 3PV4A 3ZZ3A 1AGJA 3A81A 2FTLE 4X6NA 1DM4B 1WAYB 4SGBE 1AFQC 1BTZA 1GHYH 5EG4A 5FBEA 4NFFA 2SGEE 1G3DA 3Q3XA 1VJ9U 5C2ZA 4X6MA 5HM9A 4CREA 1HXFH 4JK6A 4INKA 1RS0A 4ABGA 1FN8A 1PPCE 4TWYA 1KLJH 1AB9C 2JH0D 3GY7A 3LKWA 3VPKA 2ZPQA 5BRRE 2FLRH 1DXPA 1WV7H 1O2ZA 1L1GA 1D6WA 1ELCA 2QV1A 1HAVA 2B7DH 4OGYA 1YCPK 1FLEE 1SBWA 8GCHG 2CJIA 3RC5A 2WV5A 3LGWA 5A0BA 3B23B 1EJMA 1KXCA 1KXDA 5E0HA 1SQTA 1O2YA 2ZHQH 1UVPA 2ZFQH 1GBCA 3SUFA 1O2WA 1O3PB 2Z94A 3SI4H 4A1VA 3A7YA 3ZZ8A 5T6GA 5I46H 3EQ0H 1P0SH 4AG1A 5E0JA 4LXBH 5EQRA 1QRWA 3MU1A 3SU4A 1T4VH 1BMAA 1DFPA 2OQ5A 2PTCE 1JIMA 1G2LA 1ZR0A 1LVBA 3M5OA 3W94A 2ALPA 1DXWA 3HATH 1TOMH 1T8LA 1LVOA 5GCHG 1K1IA 4TPIZ 1SG8B 1TX6A 2G51A 1P2MA 3QX5H 5TCCA 2QF3A 2ZC9H 2SGDE 4UE7H 4VGCC 1EB2A 1GJ4H 2J2UA 1DE7H 1MMJN 3VB4A 2XXLA 1V2LT 5AFZH 1AO5A 1E38B 1TQ7B 2XC5A 1TLDA 4WY3A 3RP2A 1LCYA 2H1UA 2RA0A 4X8VH 3ZZ4A 1E37B 7GCHF 2SFAA 1O3LA 1QQ4A 5JB9S 5FAHA 4B71A 2HLCA 1C1PA 4R8TB 2OD3B 1HAYB 1SSXA 2QCYA 2W26A 1QB6A 1GI8B 2FX6A 4FU8A 2XWBI 1YPHE 1F0UA 1GMHF 4DURA 1ANBA 5A8XA 1TX8A 1SGTA 2OBOA 4B76A 1ZPCA 2QY0B 1GDNA 1T8NA 2GMTC 3LONA 3RMOH 3GDVA 1U6QA 3SU1A 2WV4A 4ABAA 4D7GA 4IN1A 2NU2E 1LMWB 4A5TS 5DJ7A 1B0EA 3RC4A 3S0NA 3MH5A 2Z9IA 1P57B 1V2PT 3BG4B 2ZO3H 2BD8A 1O3CA 1YPGH 3GYMA 1CGJE 1SGPE 4HI3A 2P16A 3TH4H 4Y6DA 1DLEA 2H9EH 3QDZB 2ZDMA 3UIRA 2ZTZA 2Z7FE 3SJIA 2ZGBH 4BXWA 2BVRH 1UK2A 3Q76A 1N6XA 3ZZ9A 2PW8H 4UD9H 1O2KA 1ZOMA 2UUJB 2VH6A 3PMHB 2AH4X 1CU1A 1FJSA 2ZQ1A 4NFEA 1MTSA 1CA0C 1Z8GA 5FCKA 5JBCS 1OWJA 1HIAA 3F6UH 3MU0A 1S6HA 3A86A 1V6DA 1L0ZA 3LU9B 3PMBB 4Q80A 1YBWA 1ELBA 6ESTA 3KHVA 1TRYA 5J4SA 4DGJA 1THPB 4MPVA 4ISLA 2XWAA 1A3EH 3E0PB 4Q7YA 4CH2B 2Y5HA 3WY8A 2C3SA 3SV6A 1YPHC 5EPNA 1QR3E 4OS6A 1QCPA 1HFDA 3C27B 3LPRA 1IQEA 1QIXB 1O38A 5AF9H 3S7HB 1JXPA 1P01A 1N1LA 3TJVA 2BLOA 1GBFA 4IC6A