1GC1H

Hiv-1 gp120 core complexed with cd4 and a neutralizing human antibody
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
229
structure length
229
Chain Sequence
b'QVQLLESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQGTLVTVTSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE PROTEIN GP120
publication title Structure of an HIV gp120 envelope glycoprotein in complex with the CD4 receptor and a neutralizing human antibody.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/receptor/immune system
total genus 44
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 1998-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gc1H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gc1H01
3GGWB 2VQTA 2AJXL 4HCRL 2R2BB 4I3SH 4F3FB 1K6QL 2Q6WA 3B3IB 4RGNC 3BPNC 4NM8L 4ZFFA 1LO4H 3K80A 1LK3H 3QIUB 5IJKA 1P4BH 4NC1E 3DBXB 3UJIL 1MI5D 1XGPA 2R9HD 1YUHA 2Q76B 4S0TD 1AGFA 3CZFB 4U1SA 1CR9H 4C56D 1J0ZA 2CUHA 3AY4A 3QDGB 4WWKB 4JZOB 1TPXC 1FNEA 1JK8B 1FZJB 1D5BB 4ODVL 4MCZA 2AXFB 1CIDA 5JW4R 1XAUA 1C5DA 4KZDL 5MERB 3CH1A 5AZEH 3TCLA 5FA3B 1YEFL 4AM0B 3ARDD 2IAMD 1KB9J 3PGCB 3QNZA 3NOIA 2KZ1B 1FDLL 5DJ6B 5EU4A 5D5MF 2WP3T 3VFNB 3QUXC 3BRDA 2Z31A 5FAAA 1H15A 2MKWA 2XY1A 1WUNT 3IAPA 1TITA 1G9EA 2A6JA 1I1FB 1I1RA 1MI5E 1MI5B 1SJEB 2ZUWA 3OSKA 3TF7C 4C56E 4GKOA 5C0AA 2CLVB 2DQDL 4J1UB 3DVIA 1GAFH 4JAMA 2O5ZH 3PQYB 3ULVL 1T0NA 4R7DA 3P11L 4UTBL 1GXEA 3GJEA 5CFHA 2VAAB 5EO9B 1JUFA 2K3TA 4PJFE 2FR4B 1QBMH 4J12A 4P3CH 2EE6A 3FL7A 3DX9A 3QXWA 3V6OC 1AO7A 4HH9B 4PRDB 4I5BB 3MC0A 2XNAA 2BVPB 3C9NB 1DFBL 5E6YA 2NPLX 2DQJH 4GXUN 3JSSA 4V2BA 5BZWB 3DGGA 4ODWB 1L0YA 2UUDH 3ILPA 4TUOA 1M71B 5FYJU 4MHHG 4ZFOA 4FFVD 4QOKA 3SE9L 2VH5L 1ETZA 5ALBL 4TQEH 3O2WL 4MXQC 4HKZA 5CEYA 2Y5TB 4OGZA 3LEYL 5J6GA 3GO1L 4AIXA 5A2LH 4LVNC 1VFBA 4UINL 3I6KA 4UT6H 4MDJB 2DYPD 2HFFA 3UTSA 5DHXB 5I66B 3GM0A 1VGKA 3ET9F 1DBAL 3HTLX 1HH9B 5DJAA 2VOTA 3REWA 3IRPX 3CDFA 3GDBA 4BELD 4OGAD 3BKYH 4S2SB 4QRSA 1GHFL 3X3GL 3W5MA 1LE5A 5I1CH 2A1WL 5CJOH 3I2CL 4IOFD 1UCBH 4XCYA 5CP3H 5FGCE 4PJ8D 1SM3L 3AREC 3B43A 1WVZA 1KJMB 4EI5A 4MNGB 3T1FB 2HJFB 1VEPA 2VISA 3FT2B 3IDJB 3WCYA 1OLLA 3K4AA 4NIKB 5INDB 1H3VA 4DGVH 1JMZA 4XI5D 1L9MA 3BKCH 1YN7B 3ZKND 5HDOA 1RZFH 3F7PC 3P9WB 3VD3A 2EDFA 2EDBA 4M1GH 4Y2DC 2VXSH 4NQDB 2BRRH 1A6AA 5DMIL 3LRSA 1NKOA 3FRUA 3K74B 3L95B 5JIPA 5CWSB 1NEZA 4TPRL 3SE3C 1YNKH 2AAVA 2F53E 2F53B 3O41B 3AFLA 4NQEA 5FK9B 3KLHC 5E6IA 3UZVB 4DJMA 3FOLA 3M8OL 5FO8A 1IC7L 2I60L 5GRJH 1NBVL 4GAGL 4URTB 3QZWB 1LO5B 5IB1B 3VFTA 4RA0C 4N0CC 4OLUH 3QDMD 4KJQD 3JTSA 2DM7A 2IFFH 5C2BH 1FFPB 3CU7A 2BOCA 1A5FL 4ZOEA 3QHFH 2DLFL 4GBXC 3VFRA 4BK5A 1S9XA 1EO7A 3NH7H 3OMZA 5JW4N 1NLBH 4OUOA 1U8IA 5I0ZA 5F3BB 3SN6N 1ZOXA 1JTTA 5ESQB 2UZIH 3DURA 3KPNA 4KKBC 4P9HC 4KWUA 2HVKA 2GK2A 5F6HI 3QPXH 5I30L 4HJGB 3WXWH 1PYWA 1T21A 5JIHA 1CFSB 2BMKB 4M7LH 4ONHB 4F2MB 3MR9A 4KY1H 1WQVT 5HVFB 5I9QB 3G08B 3MRLA 5FFLA 3QO0A 4EQ3A 4L4TA 1WBXA 4RX4A 3QEGL 2Z35B 4KDWA 2YA0A 3DYMA 2OZ4A 4ZTOL 3VWKC 3GI8L 5DD3L 1X5GA 2VXVL 3IDNB 1KTDB 2APBA 5A40E 1OAZH 3A6BL 1QKZL 3NN8A 1IKNA 4E0RA 1Z9MA 3IXTB 3T65A 3PUCA 2W07A 2XRAH 4I4WA 2N4IA 5KS9B 4JANB 1GGCL 5EIIB 3SDXE 3KNBA 3O4OC 4XNQB 5DUBB 3QDME 1R0AH 1DQDL 5F1IB 3NZ8B 3G6AA 4IIQB 3KYOB 1FSKC 7FABL 4YIQB 3ZE2E 4H5SA 1OP3K 2AQ3A 4I0PB 2AQ1A 3U48A 5FB8A 5EBLA 2NY3D 2PCPB 1AH1A 1SJHA 1U8QA 3OKMB 5HYIA 1XGRB 4HIEA 3H3BC 5FA4B 3W5NA 3MV8A 4ELMB 4Z8FL 3M45A 4Z7UF 1CL7H 2MCPH 3K81A 5DJ8B 5TE4L 2Q86B 3PWUB 3L3IB 4PRIE 3JUZA 4PRIB 4G8EB 1UWXH 2F54D 5C08B 1Q38A 3FMGL 3S3SA 1ZLSH 5EZOL 2OZ4H 5I76B 5IJVB 5C0RL 4MCYB 3HR6A 3QNYA 1K4CB 4K8RL 2BVEA 3O2DL 3O3DB 2ZUYA 4JQVC 1ZSDB 3P0YL 4K7PX 5D1QB 2YD3A 1C8PA 3KWWA 3MLTB 5F7DA 2XFXB 1AJ7L 1C5BL 1T6VN 32C2A 4X6DB 2IALB 3VW3L 2VLJD 4X7TB 3SDAD 1I3RB 4LKCB 1JV5A 2XTJB 2BOBB 5DA4A 4GG6A 3FQTB 3MLVL 3BEVB 4GH7B 4BFGA 4WO4D 4MMXC 5HGDB 5TF1L 4L4VD 3PDOB 2YD5A 3WE6A 1FL3B 4U1JA 3VWJD 5FHBL 2IANA 3U36B 1K3IA 3CXHJ 3W82A 3VRIB 3S96B 3PWNA 4MD0B 4HXBH 4GMSL 2LTQB 2F54E 2X10A 4QRRD 1FFNA 1JRHH 2B1AL 3I9GL 5DFVC 4WFHD 5DJZB 5DK0A 3DLQR 5DR5L 4Z0BH 3ZT5A 1J8HB 1Q1JL 4N0UB 4ZAKA 2ITDA 4G8GB 4EZMA 5DMGC 1PKOA 3ROLA 1BWMA 1G7MA 1U8MA 4X6BB 1IAKA 2SEBB 4XTRC 1LMKA 4MXWH 5JHDA 2ESVD 3V5DA 1XCTB 3D9AL 3ARBD 2P8MB 1BGXL 4B53A 2VLJE 2FZ3A 1OF2A 3BGMB 4D0CB 4HULB 3RQ3A 5E08L 1O7SA 5FUZL 2VITB 4WDIB 1JHKL 2FATH 2IPUK 5IR1B 3SCMB 3GB7A 2J6EL 5KVGL 3E8UH 2OTWA 5IFAL 4L4VE 3FN3A 1HHKB 1XF3B 3JV4B 4HQQL 1T1XB 4KDTC 3VWJB 5IT2H 1IILE 1U8JA 4DEPC 1JPTH 5IW1A 4QHLA 3U6RB 1BLNB 2QTEA 4ZUTB 1MNUL 2BNUB 4PREB 3INUL 1I7UA 4M5YH 3DX7A 1WWBX 2NX5B 2P8PB 4M1DH 1CFNA 2VDOH 2APWA 5LAXB 4QRRE 4ZSOE 4QRRB 4RNRA 2F8XC 4QCIA 4M43H 4WFHE 1QQDB 2R23B 3QUZB 2J6EA 5ESVA 4GS7C 5LBSL 2Q8AH 2VMFA 2CIIA 4GKNA 2X1PA 5DGRA 5EZIH 2ESVE 2ESVB 3QRFM 1P1ZA 4U1MB 3V7AG 1KEGH 1LEGB 5TGBB 3ZT7A 3MUY1 4RMUA 1E28B 4ZS6D 3K8MA 1MJ7H 5L9DL 5I8KL 1KUMA 2ZCHL 5CILL 3HZMB 4M1CC 3RVWC 4ZFZA 1RIUL 1YEEL 4PBWD 1XIWC 4QEGA 2V5RA 4P57B 3GFUA 1HSAB 1OTUC 1MCOL 1DBBL 4UIMA 3TBTB 3G6JF 5K59E 3O8XB 2W60B 5I1DB 1NUGA 1F4YH 4PJAE 3FOMB 4NP4L 4PV8A 2DLTA 5DZLA 3VFOB 1Z0NA 2D9CA 4JFOA 2WUBL 4XGZA 1WFNA 2VR5A 1FG9C 3G04B 3EDFA 2UVEA 1J8KA 2DJUA 3QXAA 4FZ8H 1VPOH 5ANMB 1QA9A 2UWEB 4OIIH 1I3UA 2NY0B 3RJQB 4BSWB 2XICA 3PIQB 1W72B 4L9LC 4X4ZA 1BQSA 1WLHA 4RISL 2DL9A 2G75B 2XPGA 5J06A 2WUCH 1KXVC 5DRNB 3QWRA 5IB3A 3P0GB 3B9KB 1JF5A 4XCCL 3DSFL 3VH8G 4HT1L 3MOAL 1KBGH 4R4FL 4F57H 5I16B 4X0KB 4H20L 3VFMB 4YHOH 5EUOB 3VDAA 4X98B 3QI9C 1YECH 2WBJC 4QLRA 3VA6A 4G9DA 5FYKL 1T83C 2IGFH 2UVFA 3VFVA 1CLZH 1JTOA 1P7HL 4JFPA 2FECL 5E2TH 4CW1B 1OAUH 2CXKA 2F8OA 3CIQA 3HR5A 5EPMB 4WW2B 2V2WB 2Y9RT 4WUKH 5SX4I 4K07A 3RVVC 3SDCA 3DJ9A 1CDJA 5HYQA 2PTTA 5HHOB 1O7VA 4NN5C 1JZ7A 4RRPA 1C12A 1VKXA 3DIFA 3U83A 4NPYB 4MNQD 4RAUB 5JW5A 4LU5L 4P3DB 3UTQA 3PL6B 1KPVA 4QXGL 3F58H 4OUUB 4BZ2L 2D9QB 2HLFC 2A9MH 4LAQL 4HFWB 2BSSB 4A2MA 2YR3A 4MAUL 1QSED 4KHTH 4QRPB 4HUVA 3MUJA 2CLZA 5E94B 3O3EB 1EHNA 1JGUH 5GZOC 1KT2A 5SWZD 1TIUA 5CEXB 4JR9L 4HK0A 3NIGF 4MNHA 1VFUA 1EEQA 5AUMB 3LQAH 1FVDA 1HHHB 1RQ5A 1UXWA 1LEKB 2PXYA 3FT4A 3NA9H 5B38B 5EC1A 1A9BA 4PP1C 3FHAA 5BQ7B 1WZ1H 3MREA 5FGBC 2HVJA 2EDKA 3ZZ1A 2ERJC 5F89B 1EJ6A 3IT8D 4PV9A 3BH9A 3C08L 1ZGLM 5AYUH 2ICCA 3BX7C 4C55A 3VXRB 4MNQE 2H9GB 4Y4HA 3X14B 8CGTA 4LCYA 5D7SL 4XNZC 5IOPB 4E41B 1RZIB 4UAOC 2P5WB 2OXHA 2PYFB 2LAAA 4S1DD 1A4KA 1A7RH 3OR7A 1E4XH 5IVXF 1OVZA 3D85A 4YR6A 1QSEE 4NRYB 4NNPL 5B21A 4MA7L 1F90H 3ZDYE 5D1QC 1YC7A 5EN2A 3VD5A 5SWZE 4RMSA 4ODUB 5J9PA 2NYYD 3QDMA 4JM2C 1KIRB 4TULL 5GIRA 4FRWA 2XTJC 5CIPA 2W9EL 1RJZA 2R1XB 3CXDH 4NNXB 1SBSH 4OZFA 3TBVB 4XPHH 5I1IH 1A7QL 2Q7YA 2ZP0T 5KSAC 3OZ9H 3K4ZA 4HXAH 4F7TA 4YAQB 2KUTA 1T5WB 5I1AA 2B0SL 3KPPB 2W0FA 4Q6IA 4OGYH 4XCEB 5AEAA 1AY1H 3MRKA 5C0CA 3VXOB 2B5IC 3LEVL 3VG9B 1CG9B 2VXUH 4F7EB 5C0FA 4M9OA 1UJ3B 4OJFH 1WAAF 3MFFB 4PRPD 3P0VL 3FTGB 3GEWB 4NWTL 4MWFA 3WUZA 4HBCL 1QVOB 4E42B 2WIIA 4P9MH 4ZUWB 3DO3A 2C3VA 3MJGX 2E8YA 4KZEH 3G9VA 4M6ML 4JFDA 2YPLD 3RGVA 4JY4A 4ONFL 4M7JH 4ZUUA 3WKML 1MCNA 2Q6WB 1S3KH 1P9MC 1RURH 3BESR 4Y4FC 4BH7A 4MX7A 4KVNH 2VUOA 2UYLA 2CDFA 1PBYA 3H3KA 3IFPA 3U1SL 3ARTA 1Z9OA 2J12B 1XGPB 3T8XA 3HG1A 1NCBH 3FRPG 1VGEH 5CIPH 5D6DC 1AGFB 2GT9A 4P23C 4U1SB 5IGXL 5GGSY 1MJUL 2ARJA 3QCVL 1IQWH 2IPUG 3CGTA 5HHXH 4M48L 1MUJA 2E3VA 2B20A 5ACLA 1CDGA 1BPVA 1IGMH 3FB5A 1XGTA 2Q1EA 5TE6L 5B8CA 1CL7I 1C5DB 1Z9SA 3MTRA 5D2NC 3VFWB 3CH1B 3EDDA 4KQ3H 1IKFH 2QQKL 4LL9A 2BVQA 3C60A 5F1NA 5GGUA 3V4PL 4PRPE 3QNZB 3GSRB 3RDTD 3KXFA 2JB5L 3H8NA 5EU4B 4PJDF 1XF5A 4J4PC 3VFPA 1ORSA 5IVZA 4LF3A 3FFDA 4R4BA 2Z31B 3H2WA 3BW9B 2YPLE 1D5XA 1H15B 1LP9F 5EBMA 5T1KD 3RTQA 2H2SC 5CHNA 5HGGS 4GRLC 3V5KB 2B4CH 1KCRH 3BPLB 3ROOA 2FX8L 2ZOLA 4HX1A 4HUMB 2OR8A 4EIZC 2EIZA 4LGPB 4MYWB 3LS4L 4TTDC 3D3VB 1D7FA 2YHGA 5C0AB 2CJUH 2X1WL 5SX5K 3BWAA 4GT7A 4I77L 3V0VA 3T04D 3CCHB 3EJJX 5IFJA 1R3JA 4XP6L 1YEHL 4R7DB 5ID1B 2Y5EA 2P7TA 3S5LG 1OTTD 1JUFB 3TH4T 4OCNC 1LHZA 5FUCC 3O8XC 4JB9L 15C8H 3DX9B 5GGRY 1JRHI 2XNAB 1ZHBB 1QBLL 3V95A 1A6ZA 5IMKA 5CBAA 3D0LB 1MIEH 1CXHA 2VLRA 3I3BA 2FEDD 1AE6L 1EVUA 3DGGB 4CU8A 2PO6D 2VLLA 4TUOB 1TENA 2CO7B 1UH3A 1YQ2A 4TNWK 4ZFOB 3IKCA 3LHPH 4QOKB 4UV7H 1PW3A 5DJCA 1KFAL 5J1AB 2NY0C 4XX1E 4JO3H 4PJGE 4Y16D 1FL6B 4HKZB 4JFFD 5DRXA 5CEYB 2ZUVA 2HN7A 2W65A 2GQHA 5J6GB 4G42A 4XCFH 2D7MA 2J2ZA 2ZSWA 1VFBB 2HFFB 4WI9A 3L1OL 5F9DC 4B7LA 1VGKB 5TQ2L 1I9IH 2IBZX 5DJAB 1NUFA 5DEFA 3REWB 1IAOA 4ZS7L 1BAFH 5IW6A 4QRSB 1LE5B 3FO2A 3HS0A 4NZTH 3VXUA 3WFHA 4JRXA 4OCSH 4X99A 4D3CL 4XCYB 5FKAA 4MA8H 4PLNC 4AG4L 4EI5B 1MWAH 1LEIB 3DTXA 3RKDC 4Y4KA 2R0ZH 4XVSL 4S1RH 5TFSH 1YA5A 1FE8H 4PLJD 4GW4A 4XNXL 5D7IA 4U1GC 1AFVH 3DXAD 3KLAA 3JVGC 2EDQA 3BWUC 2EYSA 2OP4L 1YQVL 1RUAH 1J5OH 1AD9A 4ZOAA 4NO2B 3O3BA 1A6AB 3PL6C 5HYEA 3LRSB 3FRUB 3ULUD 1NEZB 3SGDH 4R9HA 2BHYA 1PLGH 4JPKL 4F33A 5FV1L 3MRCB 1R5IB 3SKMA 5GHWL 5DUPH 4PLOB 4G6AC 4P2OD 5K9JH 3KS0J 4NQEB 3ARFC 4GQ9H 4POYA 1RZKL 5E6IB 3FOLB 1GGBL 4H8WL 4TOYH 5FO8B 1YEIH 4HG4J 4UIKL 3Q5TA 3VFTB 3CU1A 2VB5A 5TE7L 3BH8A 5I71B 5I1KH 1PZ5A 3JTSB 4YHMH 1UH4A 1S9WA 2BOCB 5KSUB 2ICWA 3BDXA 1GC1C 4GSDH 1RY7B 3GM8A 1U8IB 4NN6B 3UBXA 4JHAL 2OS7A 5E99L 3DURB 3KPNB 2HVKB 3CDCA 1PYWB 3HHRB 1T21B 1A6UL 3VCLA 4XPGH 4UT7H 3DXAE 2XQYG 2EECA 5DMKA 3BP5A 4W6XB 5HDBE 1FNFA 3M1BA 3MRLB 4V1DD 3QO0B 1MAMH 1WBXB 4HF5H 4L4TB 2I27N 2AGJH 4QXUH 5B3NA 3ULUE 3P2TA 1MCWW 3T2QA 1B4RA 5TDOA 1T2QL 5DEGB 1TXKA 2O26U 4NUJA 3BE1H 4AT6B 3Q0HA 1WF5A 1IGFL 4P2OB 3T65B 4P59H 2H3NA 4I4WB 5T5FH 3WFCL 4MJ5A 1JN6A 5FCSH 3KNBB 3S88H 3QYCA 1R3HB 4FMKA 4GAJL 1A1MA 3QH3A 1RU9L 4F58H 4X5XA 1NFKA 3T3PF 4F7CA 3G6AB 5KAQG 1F02I 1MRCL 2QSCH 2XN9A 1B4JH 4ISVA 3LIZL 4H5SB 3TO4D 1OAQH 3A0OA 2BDNH 4Q9QL 3TP4A 2D7TL 1SJHB 4PJIE 1U8QB 2Y36L 4HIEB 3MV8B 2ADFL 3QIBD 3Q6GL 4K8RD 2JJTA 4M61A 5FM8A 2ZNWA 5D7JD 1NCCL 2YD9A 4IJ3C 3N85L 2ZOKA 4V1DE 2QBWA 4WY7L 2EE3A 5IIEA 2MKLC 5AD0B 1B0RA 3RRQA 1WZLA 4KAQL 3NCFB 1OAKL 5HI3D 4Z7WA 3EYQD 4OKVA 2A77L 2AK1L 4K9EL 4FFYH 2BX5A 2R0WL 5D96C 5D1XA 1RFDL 3KWWB 5F7DB 1RUKH 4ONOA 1XR9A 5IQ7H 2HFTA 5IJKC 4F9PA 1JV5B 1P5UA 4JPWL 4Y1AA 25C8H 2AK4D 4JE4B 4GG6B 2V2XA 3J7HA 4G3YH 5E00A 3AY4C 3BEWA 2X4OA 5KG9A 1T7VA 4U1HA 3QAZB 3SKNA 3P40A 4KK8D 4JCLA 1DN2A 2IANB 2ICEA 4WFED 5D2LE 5D2LB 4RWHA 5D7JB 1EIBA 3JWDH 4TSBH 3KPRA 5C09B 2VDLH 2JIXA 4JPVH 1IFHL 2VXTH 3EOYG 1RK0A 1D5ZA 3RA7L 4DGIH 1FFNB 3LN5A 3RX8A 1AD0A 1T03H 1G9NH 4WI3A 5F1OB 3UP1A 1E4XI 5DK0B 4KFZC 1CLOH 3B8YA 1P84K 4ZAKB 3RNKA 4FQCH 1QSFA 2Z31C 5IUSA 1FN4A 1G7MB 3IS1X 2NY5L 1U8MB 1RMFL 4FQ1H 5JHDB 3RUGE 4GAYA 3P9MB 2CH8A 1S9KC 4XHJC 1CDCA 2EEDA 4NQSA 4ODSH 1N0XH 5LGKA 2FZ3B 2D31A 1OF2B 4QWWD 3KGRA 1Q9OA 4YFLF 3F7VA 4NFBA 2AK4E 3MACL 1HKLL 2AK4B 3HAEH 3GB7B 3ZHKA 4QHNA 4PJBE 5MEOB 4EN3A 1U8JB 1CE1L 4OTXH 5E4IA 4WFEE 4QHLB 5IW1B 1J11A 4GMTH 3VGEA 1AGBB 1OAXL 1W8NA 4H25A 5ITFA 2XWJB 5DJ2A 2ITCA 2D3VA 1NSNL 4OZGE 4OZGB 4XP4L 1I7UB 5I19H 2ZG1A 4LCCA 1CFNB 5DQ9A 1AGCA 4ZXBD 1P2CA 5I73C 5JOFA 1CGVA 3KPQA 4RBPK 4RNRB 2IF7A 4QCIB 3NCJL 3ME0A 5I8OH 3T0VA 1IAIH 2CRZA 5FHAL 5ESVB 3WDIA 5IP4A 2Z91B 5C07A 3RVTD 5FOBA 2CIIB 4GKNB 3QUYC 4UBDC 4UNUA 3S35X 2JCCA 1P1ZB 3GSOA 1YY9D 1YNLL 3P30H 3HNVH 5DVNA 4JGUA 2YOCA 1BQLL 3KJ6L 3GHEL 1OGTA 3TBWA 2FBJL 3LMJH 3EDKA 4ZFZB 4LMQE 2W38A 3GMPA 2YSSA 4DQOL 3PG2A 5FYJL 1U92A 4I0KA 2KDGA 4KK5C 5ERWA 3SOBH 3T77A 4UIMB 1LWRA 1NKRA 1B90A 4X6CE 3F65A 2DKMA 2ZJSL 3BI9X 3QQ4A 1S9YA 3OAUH 2PW2A 3ZE2F 3OGCB 2GJ6D 4JFOB 4GRWE 4XGZB 5JW3L 3PJSA 3V7MA 3ZKQD 2FLRT 3QXAB 1QA9B 2JTDA 4ELMF 1G6RA 2DWEA 3U7YL 5T1LD 2NY7L 1KPUB 4DK6A 3BT2L 5EZJA 1G0XA 4NZJA 3UDWA 4DAGH 1T0PB 3H9SD 2YC1A 4IMKC 1INDH 3F5WA 4KI5D 4KZDH 1BVKA 5FYKD 1MHEB 1WCBA 1EBAA 2XA8L 3HA0A 4QTIL 5HVWA 2XPGB 1MFEL 2DJ4A 5IB3B 4UNTA 3C6SA 3MA9H 1NCAL 1FDLH 4FTVD 3UBXG 4EDXA 1WIUA 2HG5A 5ABDE 2VQ1A 1CBVL 3UYOD 1KN4L 4G9DB 3O4LD 3VFVB 3MRHA 5I71C 1CTNA 5IROA 3QXDA 1RZ8B 4JFPB 4WCYH 2Q20A 2LE9A 1D9KD 1H3TA 3U2SA 3HR5B 1QFWH 1QLRA 2GJ6E 5GGQH 2HKFH 1F4WL 2VDKL 3O0RL 3SDCB 3DOSA 1P53A 5HYQB 2PTTB 4F8TA 1HWHB 4PLKC 2BERA 4X5WA 1G6RH 2HTLD 1VKXB 3EJZD 4Y16A 3DIFB 1C5CL 3O6KL 4JFFA 3FO1A 4OCYL 5CEZL 1G7HA 4AZ8A 3H9SE 4KI5E 2CK0L 4KJWD 3UTQB 5FYKE 1VFOA 1KPVB 1V5JA 4OT1L 4YBQC 1EEZA 1BFVL 4JG1H 5C7XL 1RUQH 3G5VA 4DWHA 2ILLA 5EO1B 2R0KH 4FTVE 3R4DA 4QO1A 4HUVB 2CLZB 4KUCD 5E56A 5F96L 4RA3A 1KT2B 2D4DA 1H3UA 2NW2B 4N1EA 1AR2A 1TQBC 1CICA 2VH5H 3O4LE 4HK0B 3O4LB 3TN0A 4D2NA 3MLRL 2R8SL 3E0GA 3C5ZC 1MFBH 1FVDB 1UM5H 5IHZA 4U4BA 4Q2ZA 2VN4A 2FO4A 3MRIA 1UXWB 2PTUA 2PXYB 3TA3D 5JQ6H 1A9BB 3WL9B 2OL3L 3MREB 2HVJB 1CXEA 2V5SA 1QFUH 3MODL 2APFA 4PV9B 3BH9B 3UO1H 5F7FA 5T3XL 1VFAA 3VRLE 5H37H 4BQBA 4Y4HB 3X3GH 4EKXA 4LCYB 2RB8A 4MAYC 2IBBA 4O2EA 3HAEG 5F7NC 3SGDI 3MLSL 1A4KB 5ICYA 1KJ2H 3OR7B 5HPOA 4OZIE 3GHBL 2N56A 3NFNA 2XXCB 3D85B 4YR6B 3QISA 3ECBB 2EYRA 4JZJA 5J13B 1U8LA 4PR5A 1HXYA 1TVBA 1MRDL 1EFXB 5EN2B 4M62H 4PGCB 1BJ1J 1HKFA 3B4NA 3BIKB 2NY1D 4HDIA 4HWNA 4NZDA 4LLWB 1NANH 5GIRB 1SJVA 3GI9H 4XMLH 2RFXB 5ESAB 4N1CA 3RPKA 1A7NL 2CLRA 3OKOB 1A3RH 1BQHA 3S4SG 1C08B 4OZFB 4LARL 4PD4J 1LO0H 2Q7YB 5BV7L 4XWGL 1M7IA 4F7TB 3TA3B 1CYGA 3CK0H 5I1AB 4P5KA 3DECA 1LGVA 5IBTL 2ZKHL 1E6JH 3EKCA 4ZDHB 2W0FB 1NFDA 3U0WL 4Q6IB 5FUOL 1AXSA 3S36L 1B6UA 4TNWF 3MRKB 2IQ9L 4KHXL 2M8XA 5C0CB 2YUVA 3MV9D 1QOKA 5GISH 4IRJD 1AGDA 4YDJA 4KJPD 3LKSA 1EUTA 4FQQA 3RZCD 4IHOA 4XPFH 5C0FB 4U6XA 3ULUH 3ISWA 2DWDA 4LASH 4ZFGL 4MWFB 2XKSA 4TNVK 2I07A 4WTWA 2WIIB 4JFYB 5I15H 4GFTB 4HZLB 3K1KC 2C3VB 3F62A 4M5ZL 3LKPA 4ZAKC 5A16A 1CK0L 1X5KA 4JFDB 3RGVB 5D70H 5HYJA 1FFOA 2UWEF 3FJTA 1WZMA 1WFTA 3C6LA 3RVXD 4MX7B 4TUKL 4LFHD 1F3DH 4J3SA 2UYLB 2CRYA 4LSRH 3IFPB 1G7PA 1C16A 3T8XB 3HG1B 4J3TA 4N8CH 2ICWI 1I1YA 2GT9B 2YUZA 3QEGH 3OG6B 5HVGB 2D03L 4OI9A 1T89A 4OIAA 3UBXI 5DD3H 1W0YT 2XZCL 2ZPKH 4HFUH 3FFCD 3QIBA 3TZVA 3P9LA 5I75C 3FB5B 1XGTB 3O11A 3HC4H 2DQCL 5EUOF 5B8CB 3DETD 4XC3L 1U91A 3MV9E 3MV9B 1KTLA 2HRLA 2E7CA 3TNMA 4Q74A 5IMMA 1AI1H 1K2DA 5F9WC 5C6TH 3FQNA 1FNGA 3C60B 5F1NB 2F19H 5GGUB 2OQJA 1I7TB 2EO1A 1E6OH 4UB0L 4PRNA 4WW2F 2HAZA 1XF5B 5LWYH 5IV2A 2FDBP 1YEKH 3KYKL 7FABH 1ORSB 3QT2A 3IDGA 4LF3B 3FFDB 5IVZB 5K9QI 5ICZA 4R4BB 4LOUD 4P5TA 5T5NF 1D5XB 4OD1H 5KTEH 2FH8A 5EBMB 1CQKA 1NMBH 3RTQB 4PJ7E 1CIUA 2JELH 4KK9D 3VXMD 1FLTX 1XF2A 4BUHA 2J7LA 4IRSD 3O2VL 5HVHC 1MFAH 1CN4A 3ROOB 4Z8FH 4HX1B 2ZOLB 2FHFA 2DTSA 4LRNL 2F5BL 3SGEH 3LKQA 3EO9H 2EH8H 2X4TB 2EIZB 2YN3A 1JGLH 2ENYA 1U95A 2DQEH 1B6DA 1T80A 1IGCH 2NY4D 3BWAB 3WHXA 1RHFA 3V0VB 4XWOD 4NGHL 5IFJB 3LH2L 4PJXA 5C0NC 1XEDA 2BZDA 3FFCE 4NYLB 2P7TB 5EBWA 4XX1G 1T20A 3O2DH 3MRBA 3TJEH 3TT3H 1I1AD 5D1ZD 4CRPA 1JYNA 2B2XH 3ARDC 1T2XA 2IAMC 1C5BH 1MF2H 4HWUA 3ZHLA 2CUMA 1A6ZB 3F7YB 1JIBA 4R96A 4RMVA 2VLRB 5IMKB 4K71B 3EZJB 2LU3A 4MB4A 3ZL4L 2VLLB 1EH9A 3O3UN 1DUYB 5DJCB 1S7WB 4HMDA 2YD7A 3EYFB 3E2HB 1UKTA 2YZ1A 2VABA 3F7QA 3VXME 4UDUA 5FEBA 4U6TA 4Q7DA 2YD2A 2HN7B 2W65B 2X4QA 5C0DA 4GLRH 3PWJB 4G42B 4DUXA 2ZSWB 1FGVL 1MCJA 5CKGA 2E27L 2R39A 5DMJB 5I1JH 1YYMH 1MHPH 2BJML 5MI0B 2G60L 5DEFB 2W9DH 3V9FA 4QGTA 1MH5B 4LPYA 1Q1JH 1BD2D 2I5YH 1K4DA 2AJYH 5IW6B 3H3PH 2AABL 3C5JA 4W4OC 2A9NH 1JF6A 4R0LA 2DQGH 2BHUA 5H35A 1X4YA 3MYJA 3FO2B 3HS0B 3VXUB 1NGQL 4K3GA 2ZCKH 4JRXB 1INEL 4X99B 1R3IL 1I1AB 5J56B 3X3FH 5D1ZB 2AERT 1IT9L 3LQAC 4N0FB 1BGXH 1WEJH 5DJ0A 5FKAB 3M17B 4NQTA 3TBSA 4OD2B 1U3HA 1FNSH 3T0ED 3DTXB 4Y4KB 4NC2B 4JY5H 4R26H 2AJZA 1DBKL 4UILL 1IAII 4FFVC 3FN0L 4AIOA 4R97C 4YC2B 1H3GA 4ZODA 1P6AB 4GW4B 4HQQH 5D7IB 1QHOA 5EB9A 3MOQA 3MMEB 3KLAB 5LVEA 2EYSB 3U4BH 1MNUH 4OFYA 1U6AH 2FX7H 5F9OL 1AD9B 2XQBH 3TIEA 4MQ7A 5C3TA 1RZJH 4LP5A 1DUZA 2HT2D 3BKJL 1N64H 4DOHE 3U9UB 1P4LB 2AV1A 2YPVL 3EZ8A 2MQCA 2BFVL 1Y18B 2IH3A 4F33B 1CLCA 3AVEA 3BD3A 3HE7B 3BN3B 3SKMB 3WS6A 4OAWA 4DW2L 3MBED 1BD2E 1PEWA 4HS6A 3CFJA 1F58H 1F4XH 1X9QA 1T1WA 2EDLA 3ZE0E 1AXIB 4IOFC 4LSTH 4OI8A 3BH8B 1PZ5B 1EJOH 1YMMD 4PJ8C 1UXSA 1N3NA 5SV4A 3MLWH 2FIKA 2ICWB 5BVPL 4JG0L 1Z0MA 3LB6D 1HHGB 1J1XH 3MOBH 5L9DH 2R1WA 3QUKA 2Z9TA 4XI5C 1DVFD 2WNGA 4JM4L 4R90L 3FONA 4YX2H 5LGHL 3E6FA 3ZKNC 5FM5M 3VCLB 2H1PH 1A7OL 1GZQA 1JHLL 5DMKB 3AM8C 5F44A 5H94A 4NO3B 3TNNA 2APVA 1SEQL 1XF1A 4L3AA 3WNKA 2FB4L 4MD5A 5TDOB 2OMBA 1OD9A 3HKFA 4NUJB 4WU5A 3SGKA 1E4KA 4YDIL 3DX8A 5E7BA 5L88H 3RVUD 5LG1A 1PKQE 2L4OA 1PG7W 2H3NB 4NZUH 3T2NH 5TPWH 4LHUD 4MJ5B 1QACA 4MLIA 5F6HJ 4KJQC 1I8IA 1A1MB 2NY6D 3QH3B 4NJ9L 6FABH 1YMME 3AMKA 5HJ3A 4F7CB 4IOIA 4RFOH 3SGJA 4RWYL 1QFWI 4ISVB 4RISH 1F2QA 5DFWH 1Y6NR 3MXWH 3I6LD 1DVFB 5KVMC 1F00I 4RQQA 4FFZL 5JORA 2DIAA 1FYTD 3DSFH 4M61B 2HRPL 2EKSA 5C0BA 5EIQA 3G9AB 1Z3GL 3WO3B 1UWEL 3A6CH 5JOEA 4YO0A 5CGYD 1J0YA 2NMSA 3T2OA 4KTDL 4YE4H 2ZUUA 3HI6L 3SKJL 5IIEB 1B0RB 4LSUH 5ISZD 2YXMA 1S5IL 4Z7WB 5KZCB 4MZ3A 1T1ZA 2VSCA 4OKVB 4Z7NF 2QHLA 3QXTA 4ENED 5D1XB 4DZBA 2P47B 2VDRH 1FBIL 3Q1SH 3ULVF 1HYSD 2B4CC 3BXNA 1XR9B 1NC2A 4U31A 1NCUA 3E3QE 3GJFA 1J18A 3VXTA 1UWGL 3EOAB 1WC7B 3W39A 3CSPA 5K93A 3X11A 3TVMD 4NUGL 4XNMB 5E00B 1IAIM 3BEWB 2X4OB 2NXZD 5KG9B 2QQNL 2NY2B 3I6LE 3LD8C 3SKNB 4YXLL 1XZ0B 2ICEB 4MAUH 1MCLA 1FYTE 3AC0A 2AEPH 1BZ7A 1KELL 3I85A 3WO4B 3KPRB 4P3WA 2JIXB 1JFQL 4FQLL 2X9WA 2FHBA 4PRHA 3FN9A 3QUXA 4UV4H 3K8LA 3LN5B 1AD0B 3EGSA 5GRUL 4TVPL 4ORGA 4J3OC 5ISZE 1DLFH 3TJHD 2ICES 3RNKB 1QSFB 1FN4B 1CLYL 2DTMH 2BVOA 3RTQC 4R8WL 3CVIH 2NCMA 4GAYB 3LKRA 4QRQB 4G7VH 4OM0H 2G5BA 4NQSB 3SDAC 5I1LA 1NANI 5IG7A 5CAYB 3BAEL 1FIGH 1FO0L 3GJFH 4CAGA 1Q9OB 4APQA 5D7SH 1NMCC 2XXMB 4WO4C 2CR3A 1CGUA 3KPSD 4QHNB 3BHBB 4K3JH 3IFNL 1RI8A 3CPLB 2OTUB 1HHJA 3QCUL 4Y0GA 3MRQB 3ESVF 4EN3B 3FQRB 3PABA 1KIQA 1TFHA 3X17A 1JPSL 4L8CA 1J12A 3V6OA 3Q3GA 3HMWH 1LD9A 3OAZH 3JUYA 4H25B 1A2YA 5F7MC 3LKOA 5ITFB 4OD3L 5DJ2B 2ITCB 4LHJB 3LQZA 3JV5A 5E2UH 1BZQK 4LCCB 3ARUA 1NAKH 2VLKA 5DQ9B 4LCUA 1AGCB 2WINA 1P2CB 4NO0D 4CJ0A 4ZPTA 2R0LL 2AVGA 1GOGA 1ZV5A 5FDYA 4M02A 4TTGA 4PTUA 1KTRL 3LZFH 2M26A 4CADA 2YMXH 3PWLA 3MRRA 1YEDA 1QSVA 5F72S 5C07B 3F6LA 5FOBB 4UU9A 3HE6D 3ARBC 1V3KA 1MFDL 2LAGB 2KQMA 1G9ML 2XWTA 5FYJD 3UJTL 3GSOB 1IVLA 4GRMA 1YMHA 1JI2A 1TJIH 3RWGA 3DNKA 1W0VA 3MROA 5HDLA 5C6PB 1QFWM 2WAHA 2OJEA 5I0DA 4LSVL 1OGTB 3IFOB 3B9EA 3DX6A 3KPSE 3OBAA 5AAMA 4NWTH 1O5DT 3VGAB 3GMPB 3VE0A 2YSSB 4ELKA 3GNMH 5C0JA 3BYTA 1U92B 4ONGL 2V9QA 5E5RB 4XNYH 5ERWB 4PJ9B 1EHLL 3T77B 2EH7L 3L5JA 1JF1A 4EBQL 3TCXA 3WKMH 2FBOJ 3AREA 3NFSL 2A83A 2GSGA 1EHAA 4K23L 4EDWH 5D5ME 1TTGA 4JJHA 4FQJL 2HYMA 4PGDA 3ULSB 5E24E 3QQ4B 3U1SH 3G5ZA 1S9YB 2PW2B 2DQIL 4J6RH 1KB9K 4XP1H 1V7MH 1IQDA 4Y5VA 3ZKSD 2OX5A 5IGXH 3TESA 3PJSB 1OGAD 3HZYA 1G6RB 5K9KA 2DWEB 1OWWA 4WV1C 2DQTL 4YPGA 3S37H 2Q3AA 1Q72H 3DUSA 4YHLH 5FYJE 5T1MA 2GJJA 2OK0H 5EZJB 1MY7A 4JO4L 5D7KD 3SGEI 4Y19D 3F5WB 1WCBB 3IFLL 4U3HA 5JA8B 1WCQA 4N1HB 4DKEL 5E5UB 1CZ8H 3FAWA 1RUMH 2ZUQB 4OLWH 2BXZA 5SWSD 3BVNA 2FGWL 4EDXB 2HG5B 3CVHH 3CD4A 4QHUA 1OSPL 2VQ1B 5IEKA 1I9JH 4GBXA 2BNQA 3RWDA 5KVDL 3MRHB 1XGQA 3QXDB 3LEXA 1CGSL 5EU6A 3QXVA 2NNAB 1DQQA 2NXYD 5DXWA 3U2SB 4U3XA 1XH3B 5T1DL 1TLKA 3DGCR 4PJCE 4KQ4H 4PJCB 4TNVF 4I18C 4HC1A 3ABZA 1OGAE 3DMMD 3TFKC 5D2LF 2YA2A 5JXED 4X5WB 4N8PA 3STBA 4MQXD 3HN3A 1S78D 1FZOA 4DKFH 1G7HB 2CD0A 5D7KE 4GLRI 4D0DA 4Y19E 3HNSH 1ADQA 2VTFA 4HWBL 4R2GB 5GGVH 5LXGL 3PGFL 4ZOCA 3W0WA 3OHXA 5LQBL 5DUML 1ITCA 3G5VB 1BQUA 3WXVL 1NGPL 4LVHB 1H8SA 4O02H 5SWSE 4N68A 5DQJA 3TT1H 4M9PA 3S35L 2CXGA 4LCWA 1LK2A 1CICB 3RU8L 3TN0B 1QUNA 5A43C 5T3XD 3T4AA 1KCVH 3ESUF 3W11D 3K2UL 3T0EA 4P4KD 5HI5C 1NDGA 4Q2ZB 2FO4B 5BRZA 3MRIB 4GG8A 3HC3L 3UZQA 3VXSD 3WIHL 1D5IL 1I8KB 3DO7A 2Y72A 3KJ4B 4JDZA 4HC1H 4W68A 5D93C 1YN6A 2OR9H 3DMMB 2PTVA 3SY0A 4AEHL 5GGTL 1KTKE 2JKXA 2JJTC 1OW0C 1VFAB 4PBVC 3VG0H 1DN0A 3JWDC 3WNOA 3OPZL 4KROD 4OZGF 4RFNB 4G9FD 1MRFL 4X80L 4JY6A 3MCKB 1ADQH 1U8HA 4O2EB 1JYWA 1NCWL 1G9NC 4Z78B 4JQVA 1GYAA 5DJYA 1RULH 1SY6H 4JRWA 5ICYB 4AG4H 3NCCB 1F11A 4OQTA 3NFNB 4WW1B 2VZ3A 2PYEA 4K2UL 2EYRB 3NTCH 4JZJB 5EFIA 1HQRA 2F58H 3RFZC 4DVRL 1ZVSA 1HXYB 1T66C 3WIHA 1TVBB 1DE4A 4N8VG 4NFCA 2OL3B 3P73A 4W81A 5IHUL 4YUEH 4HUXA 3IYLW 3QPQC 1VADA 3AB0B 5T3XE 2MTPA 1GIGH 1DQLH 1NCDH 2CLRB 1TZGH 4P4KB 1JPFB 1J0KA 3UYPA 5JR1L 2H41A 3VXSE 1ZEAH 3BPOB 1V8HA 3VXPA 4JKLA 5DJXB 4OGXL 4P5KB 1NFDB 5E9DD 4K7PY 1AXSB 2GY7B 3T0WA 3GKZA 1AGDB 4YDJB 4PG2C 3WO4C 3E6HA 2P5ED 3LKSB 1JNNH 4FQQB 4G9FE 4UIKH 3RAJL 4WFFD 4XNUH 3C09B 2DWDB 4S1DC 4C59B 2E7HA 5D72H 2I07B 3MJ9A 4KKLD 1JGEA 4H0HB 1N5YL 5MENA 4NSKA 1NBYA 1AKJA 4LQFL 4OQTH 5DQDH 4H1LG 4CJ1A 5HYJB 1FFOB 4M93C 4JHAH 3C6LB 2NYYC 1T4KA 4XBPA 5CUSH 4WGWB 1G7PB 3DSNA 1AC0A 4NBYB 2LU7A 2VWEC 1I1YB 1G7LA 2I26N 1P7QA 4FQIH 1UM4L 2R4RH 1N8ZA 4Z7UE 5E2JA 3I02A 4U0RC 1B2WH 3ZKXB 1FRGL 5E9DE 3TZVB 3S9DB 3BDBA 1B9ZA 3NPZB 1EBPA 4HS3A 3O11B 1G84A 4JO2L 1X5YA 3QULB 1U91B 5BXFA 4LFHG 1KTLB 4CVUA 1N7ML 2P5EE 3TNMB 5IMMB 5JMOC 1K2DB 2E9JA 2FEEL 3ZTNL 3HI5L 5J11C 3O9WD 4WFFE 3FQNB 1FNGB 2BNRA 2OQJB 1JGVH 4GAJH 2VYRE 4OQ1A 4PRNB 4JFED 3QG7H 3MJ9H 5CSZA 1O0VA 4DN3L 3IDGB 5ICZB 1G6VK 4P5TB 2IADA 4ZOBA 5MEQA 4X7SH 2VXQH 2V2TA 5I1GH 5CJ5A 3QRGL 4JVPA 3L5XH 4P46D 3NABH 4MA1B 2DMCA 2Y1VA 3IGAA 1ZVHA 4HGKC 5ALCL 1EMTL 3TVMA 4YGVA 1QG3A 2E8ZA 3BDYH 4LLYB 3N85H 1U95B 1XIWA 3R1GL 5EBGA 1RHHA 4OSUL 3WHXB 5M95B 5F97E 3GRWA 4MXVF 4PJXB 1DSFH 1GOHA 5ILTH 3C5SA 4MJID 4YHPA 4N9OB 1CF8H 2QADB 1T20B 3WFBL 3CXHK 4FABL 3STZA 4BUGA 4CMHB 3CFIC 2FHCA 3ARQA 5HYSG 2A6DA 1I3GL 4CN1A 3RDTC 5E2VL 3D1MC 1RUPH 3VFGL 4WEBH 5C0IA 5FDWA 1W0WA 1YDPA 4R96B 3T08A 4JFEE 5F8QC 2FD6H 4MJ4A 1ZA6A 4ZPVB 3W9EA 1A02N 2AQ2A 1IM3A 1EEUA 1QR1A 1KLFA 5KANI 5DVKA 3K0WA 1JJUA 4L9LA 1IM9B 1H3PL 1CCZA 3UPAA 1INQA 1NC4D 1Q0XH 2VABB 4UDUB 4MQTB 3THML 4NWUL 5DWUH 2OI9C 1CXFA 4LBEA 5CSBA 4S1SL 5C0DB 1ZXQA 5F7HA 5GSVB 4ZMAT 2V17L 2QJDA 4QT5A 1KGCD 2Y6SD 4X4ME 4LSPL 3QI9A 2DIBA 1Q9WA 5F6IC 3GRWH 1OTTC 4MJIE 3S97C 1FG2A 2OLDA 2C1OB 3C5JB 5CZVL 4R0LB 5H35B 3MYJB 3B2VH 2X89A 3U7WL 4YZFE 3CC5A 3V0AC 2YKLH 1CFVH 3BO8A 1DDHA 1K3ZA 2HT3D 3TBSB 4KMTL 4LIQL 2FEDC 3WD5H 4OCRH 5ID0A 3MLYL 1X5ZA 2VR9A 4I9WD 2OJZL 4ESKA 3D87B 2AJZB 5JXAL 1XGYL 5CJ8A 1KCKA 2A2QT 1NBZA 3GMLA 3MRPB 5ICXA 1I75A 1YC8A 4JPIA 1U41A 4Y16C 1A6WL 3TIEB 4JDTL 4MQ7B 3BZEB 4OZHE 1VEMA 4M7ZB 1DUZB 1FLRL 3QDJA 4XAKD 2D4FA 1F45A 4MJ6A 3NACL 4FQXD 3SDDD 4RFEA 1V7NL 2AJUL 1I4FA 3TEUA 2AV1B 1KGCE 4HV8B 2IH3B 3QIWA 4XBEL 3CNKA 1A7PH 1UJTA 3G6JE 4HPYL 1JGDA 4OAWB 5HXMA 4M6OL 4AIZA 3SE8H 4HS6B 5FHAH 1T1WB 1PX3A 3GMRA 4NQCA 1N4XH 4JVWA 2FWOA 3WLBA 1OY3B 3BKML 3IXAA 5FCUL 3CFCL 5E4EB 1SYSA 4OLYH 4YHIA 1UXSB 1GZPB 5A2KH 3S7GA 2O5XL 5IBUG 5B39A 1RIHL 1TVHA 4I9WE 2BVTA 2R1WB 3GHEH 3QUKB 1ODAA 2RHEA 3IAGC 4LSDA 3DRTA 1OB1A 3E6FB 3ALWA 4DQOH 2X5PA 1T6WA 3RWHA 5B3JF 5CJQL 4LEXL 1GZQB 2EIDA 4K7PH 1HK6A 2Z92A 1FNHA 2E9WA 2P24A 3QWOA 1BECA 3O81A 5H94B 1ZK9A 4AQOA 3NMEA 4U1KA 4LRIA 3ULUC 3TNNB 5DD0H 4XAKE 5GXBB 3D0VA 1CS6A 4MD5B 4WTXA 2DD8L 4QY8A 2DMKA 3EDJA 3OXSA 3D2UD 3VFUA 12E8L 4RGND 3BMVA 4WU5B 4LCIL 3DX8B 4JM2A 2CDEB 1OM3L 4FQPA 5JW3H 4AY0A 4HZAA 1BEYL 2FJFA 2MNUA 3UC0H 3V4VL 1I8IB 3PV6B 5DDHA 4G80A 3MLXH 5KSAA 4XVJH 4TSAL 4PJHA 5HJ3B 4IOIB 5JOPE 5IHLB 1WBYB 5D7LD 1IGTB 1R5WA 2C3XA 3HZKA 3L3HB 2K7PA 1K5NA 3T0AA 3HFML 3O6FD 4LLVA 5ITBL 4RQQB 4XPBL 4O51A 5JORB 1NCAH 4LHUG 2VL5A 3QB7C 3U30C 2EKSB 2CKBA 4I48A 3F12B 5C0BB 4KKCD 1KN4H 3DI3B 4OB5H 2FX9L 1BM3H 3QFJD 2P42B 4YO0B 3RKPA 5LCVL 3W81A 3QO1A 1YPZA 2X4PA 2B1HL 2AJSH 1LVEA 3GSUA 5FECA 1NMAH 4FFWC 1P9MA 4Y4FA 4RGNE 4DUWA 3AGVA 3BPNB 1T1ZB 4OLZH 4WI6A 4JFXB 1RZGB 3O0RH 3AS1A 1ZANL 3NIGE 4A2LA 4U1LA 1TZIA 4DZBB 1ES0A 1S7XA 3BZFA 1A64A 1NC2B 1KXQE 3GJFB 3VXTB 2A6KB 3EFDH 3H42L 4YWGH 3W39B 4WNQA 3X11B 3QEQD 1TPXB 2Q8BL 3MNZA 3D39D 4HAGA 5D7LE 5D7LB 3VGGA 5TQ0L 3GSVA 1II4E 2D0FA 4ZD3H 1T89C 2IG2H 4H88H 3GMMA 4Y5XC 1E4WL 5D2NA 4L3EA 2CGRH 3MV7A 3QIBC 3G6DL 3TZVC 4K8RC 4AL8L 1KSRA 5KN5A 3DRQA 3DVNB 3SPVA 2PW1A 3UYRL 2CKBH 1WSST 3N1MC 3QFJE 2WBWB 3JBG7 3QCTH 4PRHB 5IVXE 3QUXB 3OTTA 5FM5O 3EGSB 1XCQA 4RGOL 5HI3C 1VA9A 2PR4H 3EYQC 2HKHL 4GRLA 4WU7A 1IL1A 3CFDB 3CX2A 2BVOB 4L29A 5D7IF 1OARL 1RIVL 2HFGH 3LKRB 1TTUA 4WHDA 4JN1L 1UG9A 2G5BB 4KXZI 5I1LB 4DGYL 2EO9A 2DQHL 3HB3C 4TVSa 5F70A 3UCRA 1NAMA 2QV2A 3QEQE 4S1QL 2VDQL 3D39E 5F7UA 2X4UA 4LLUB 2GIYA 2BY0A 4KK8C 3N9GH 4LHQB 1HHJB 1JPGA 3OJ2C 4TVPE 3MNVA 4L8CB 2WWKO 1A3LH 1S7SA 1NDMA 3I3DA 1YYLL 1KF9B 5BO1H 1LD9B 1A2YB 1UYWH 35C8H 3LKOB 4X7DC 3ZE0F 2GTZA 3LQZB 5KSBE 1NLDL 5KSBB 3IB4A 2XZQH 1IGJA 1QRND 1EZVX 4XZUB 4PB0H 3R8QA 3GSXA 1MLCA 2VLKB 4J3WA 4LCUB 2WINB 5FO7A 4P2RD 5EWIH 2RQ8A 1FO0B 5MEPB 3QDAA 4PTUB 2DI7A 4CADB 4RDQG 4JO1L 3QA3A 1NUNB 3PWLB 1X4XA 3MRRB 4XWGH 1YEDB 4DTGL 2G9HB 4XHQA 4UU9B 4Y2DD 4PRBB 3U0WH 1CT8A 2XWTB 5L2JA 4LVNB 4M6NL 4GRMB 5DVOA 4BQ6A 1YMHB 4QWWC 2Q7NA 3RWGB 1RZJC 3SJVA 4FQ2L 3UTTD 3MROB 1W0VB 4M6AA 5C1MB 3WIFA 2R56L 1NAMH 3KDMB 4WUUA 3OF6D 2OJEB 1EHXA 4RMQA 4NM4H 1T04B 4FZEL 3K7UA 1D6VH 3DX6B 4LLQA 1MQKL 3KLHD 3BQUD 2ARJQ 1Q94A 3RWFA 1KB5A 1UKQA 2C9AA 4YNYA 1IMHC 3VE0B 4ELKB 4RGMC 4N0CD 1QPXA 4ERSH 5EOQH 4AMKL 1JF1B 4YDKL 1A14L 3BGFC 3AREB 43C9A 4HS8L 2A83B 2GSGB 2YN5A 3WNPA 1TCRA 1QRNE 4ZXBC 4FP8H 4NHCL 3LV3B 4P2RE 4KTEL 4NBXB 1QRKA 2CUIA 3G5ZB 1U3HC 2ZSVB 3UJJL 1UACH 1LP9E 2H45A 2X9XA 4LLMB 1I7RA 2IBZY 4A6YA 2ENSA 4UQ2A 3JVGA 4ZNEE 3RVTC 1F8TL 3SDYH 3W2DL 1UA6L 3O6ML 4PUBH 1AP2A 3HZYB 2UZXB 5K9KB 2Y07H 3AU1A 4YPGB 1YY9C 3T3MF 3DUSB 5FF6A 5T1MB 3VWKD 4V2CB 4XC3H 3UTTE 2O5YL 4ZO6A 2VZUA 3GMNA 3NCYS 2WQRA 4OIBA 3ARFA 1FAIL 4IS6A 3ARVA 4L5FH 1L6ZA 1FORH 4X9GA 1S5HA 1SBBA 1KB5H 1XGUA 2E6QA 2Z0BA 4G5ZH 3LSOB 4KRPD 3SEPA 3PWPA 1CGTA 3ARGD 3EOTL 3BVNB 5J6HA 3KYKH 1AQKH 4QHUB 5IEKB 3BSZH 4E9LA 2F5AL 1JNLH 2R2EA 4GBXB 2BNQB 3RWDB 3FT3A 4I3SL 4JRYD 5DC4B 3LEXB 1PY9A 5E4EC 5BS0D 5EU6B 2QKIA 4KUZH 4LRNH 1DQQB 1QHPA 3BIAX 1LK3L 1E27A 2DJSA 1P4BL 4A6YH 3BUYA 4C83A 4XMPH 5JIIA 1CR9L 3PV7A 4Y8DC 1KCSH 3WNLA 4BH8A 3E1F1 1GOFA 3LH2H 5AWNH 5B4MD 2Y25A 3VWKB 4ALAL 5L8LB 1FZOB 4KI5C 3RJDA 3RWIA 4D0DB 1X4ZA 1NL0H 2XI9A 5CINH 4I2XE 4NCDA 3W0WB 3OHXB 2X41A 2IH1A 3FKUS 5AZEL 2DOCA 4Y7MA 4XB7A 3G6JA 5AG8A 3D5OF 2B7DT 1BWWA 3SGKC 4PJ5A 1E4KC 1NGWB 1JNJA 3QIUD 1HQ4A 3O4OB 3ZL4H 5DQJB 1ZVYA 2YZ8A 3FO0H 4LCWB 1A6VL 1LK2B 1J1OH 1FSKB 4JHBA 4LAJH 3BP6A 4UUJA 5E1HB 4JREC 4JRYE 4JRYB 4YHZL 1R5VA 3QDGD 4WWKD 5HDQH 3TV3H 5BS0E 2O61A 1D9KC 5CJBA 3OKEA 3SGJC 1Q0YH 1NDGB 4JQXA 5BRZB 1DP0A 1NPUA 1OWRM 5J89A 1YN6B 3SY0B 2HTLC 3EJZC 4KVCH 5GS2D 1GAFL 2VIRA 3RP1A 2VLME 1DN0B 4MVBC 3KPMA 2O5ZL 1CXLA 5DFVD 5HGBA 4XAWH 4KJWC 1WICA 4JY6B 1DJSA 1OP9A 3MJ8B 5AZ2H 3MO1A 4P3CL 3KHOA 1JI1A 4K3EH 5DJYB 1RZ7H 3H9YA 5C0GA 1F11B 1JMXA 2YK1H 2PYEB 1M6OA 5KVFH 5EFIB 4U2ZA 1HQRB 1KPRA 2DQJL 1ZVSB 1DBKH 1FL5A 1DE4B 3MRMA 4JVUA 1OP5H 1RAMA 3HLAA 4HUXB 4M4PA 2WLZA 3VXQA 1VADB 1M1SA 1UT9A 4HG4K 1KACB 3QDGE 4K3DH 3WN5C 1UCTA 3W9DA 3MGTA 1CD1A 1P4IH 3PQYD 3HUJA 1OLZA 4HIIA 3MV01 3VXPB 5L2KA 4RDQF 4AYFA 1QD0A 4UT6L 4XRCA 4CUCA 1KCUH 2LABA 1V3JA 5IBLD 3GJFK 1RPQA 4WHCA 3GUTA 2OMNA 3AS0A 3E6HB 3UEZA 2Z4QB 3BKYL 2YWZA 3PP3H 1ED3A 1JYVA 4Z7OF 2E7LC 1A21A 1GRWA 1N6UA 3GBNH 4Z7VA 5I1CL 5CJOL 1NGXA 1JGEB 1U2CA 1UCBL 3GBML 3HMXA 5MENB 3MLUH 4NSKB 1AKJB 4UT9L 3CFEA 4P2QA 2EC9T 1Q9KA 3TLRA 9CGTA 5GJTH 1OAYH 3T3PE 5FKPA 2NY1C 4XP9H 4XBPB 3PWVB 4DGVL 4AEIH 4ZFOL 1KC5H 3BKCL 4APQC 1CVRA 4HHAA 4NKIH 1RZFL 1T0MA 3PQYE 1G7LB 2Q3ZA 4DEPB 5BOPA 1P7QB 2P44B 1OTUD 1N26A 4PY7B 4M1GL 2VXSL 1N8ZB 3I02B 2BRRL 2FB4H 3WYRA 3EYVA 4HS3B 5CP3A 1X44A 3DROA 4IRJC 2DBLH 3U9PH 5BXFB 1C7SA 3RZCC 1AQDA 3IJYA 5E1AA 1GPOH 4GOSA 5DURB 2QSQA 5GRJL 4Z6AT 3OKLA 4NKMA 1WGOA 5JIKA 4NHUA 4GS7B 4N9GA 1NGYB 4OLUL 3L6FA 3ZYJA 1XMWA 4PJCF 3QUYA 5C2BL 3HMXH 5IK3A 4CVXB 5HHPA 2X42A 4G6FB 1TCMA 2ICWJ 3QHFL 2IADB 3NH7L 3RVXC 1FV1A 5MEQB 4HKXA 2V2TB 2OTPA 1NLBL 4NQDD 3MA7B 3MRJB 3UZEA 5SWQA 4C57C 1KLGA 5BMFH 2UZIL 3EYUH 1CDUA 3IGAB 3QPXL 5ADOH 3WXWL 2AJVL 3JWOH 4YGVB 2KH2B 1Z3GH 4M7LL 4PY8J 1S8DA 2F53D 3GSNA 1QPPA 4PB9H 4KY1L 4TN9A 1XIWB 4YEFA 2JF1A 4CVZA 2HJLA 2ZZUT 1RHHB 3QG6A 2WBJD 2AKRA 5DD5L 3DETC 4QHKI 1WAAA 3JXAA 1OAZL 1JZ4A 1KNOA 1OCWH 2YD4A 5DYOA 2A6DB 1ZHKA 4QXTA 4MNGE 3LN9A 1FBIH 3BISA 4C4KO 4QGYA 2XRAL 4OCLC 4PG9A 1R3LA 1GJIA 1DBMH 5C0IB 2PNDA 5FDWB 1W0WB 1YDPB 1OPGH 3WSQH 4PTTA 4PP2A 3W9EB 4Y5VC 1ZWIA 1R0AL 4LOUC 4IDJL 1IM3B 4UQ3A 1QR1B 1DL7H 5A2IH 3LKNB 4L9LB 4U33A 2QQNH 4IMKA 4KK9C 4NQDE 4YXLH 4NJAH 3WFZA 1INQB 3RHWK 4WTZG 4IRSC 4NKQB 5LGJB 4LBEB 3LPGA 1CL7L 1JFQH 4Q9RH 2MCPL 3GSNH 1IBGH 3DYPA 2NY4C 1FIEA 5JQHC 4XWOC 4P2CG 5GRUH 3QI9B 2WBJB 1KG0A 1ZLSL 1FZKA 2Y06H 1Q9WB 3AROA 2GTWA 2OZ4L 3A6OA 1MHHA 2HTKD 1KENH 4NN7C 5GRVL 4WJ5A 5EG6C 3BJ91 4O2CA 2GY5A 4PJDA 4OV5A 3D18A 5ETUA 4ODHH 1NH6A 2NR6D 3CC5B 4I0PD 4ETQB 4PP1D 3BO8B 1DDHB 5DSCA 3VH8A 2AXGA 4QRUA 4LEOA 4NN5B 5HHVH 5ID0B 1N6QH 2ZUSA 4OF3A 5FM4A 3GMLB 5ICXB 1NFDF 3WUWG 1IGYA 2DLIA 4PRID 2C5DC 4KJYA 4JPIB 5EC2A 4XBGA 1JPSH 5C08D 3H6JA 1C7TA 4HUWB 1FFQA 1GGIH 3KYMB 3OF6A 3QHZL 5GZNC 4HXBL 4MJ6B 3ZYIA 4CGTA 4RFEB 2X4RA 4OF8A 5D1QD 2PN5A 5KS9E 4LIQE 3RNQA 3OB0K 4NC0B 1JRHL 1JGDB 2X09A 3LRHA 2DN7A 5CD3A 4AIZB 3K8KA 4Z0BL 2XTJD 4G8FA 1QYGH 3PDGA 3C5ZA 2C7UA 3GMRB 4ZQKA 4NQCB 4L8DA 3TC9A 3ZSTA 2FWOB 3WLBB 3IXAB 3CAFA 1HSBA 4MXWL 1H0DB 1SYSB 4FXLA 1TETH 4YHIB 3EFFA 5GS0H 5E2WH 5HHQB 3T0EC 4U0QB 1BF2A 5JZ7C 4NKOA 2C4FU 2ERJB 4ELME 5B39B 4UOW0 1TVHB 1RK1A 5L7XH 5DD1L 3OGOE 3DRTB 1OB1B 3WDJA 3A67H 2FATL 1DR9A 3GMQA 5DK3A 3E8UL 3FO9B 4XNZB 4MAYA 5HI4D 3UPRA 5TH2A 4J8RA 3RWHB 1RZKC 5C08E 4UAOB 2J8UA 5IB5A 4YFDB 2A74B 5IT2L 2DDQH 2Z92B 1UZ6F 1KIPA 1OQXA 2GUOB 2YBRA 3QWOB 2P24B 1A4JA 1JPTL 4NDMA 2WWMD 5F1SA 4O4YH 1Q9LA 4O58H 1J8HD 3FQUA 4U1KB 2HT2C 4MHHI 2DRUA 2E7BA 4G8GD 4LSQL 4R3SA 2ADGA 3D0VB 4QY8B 4M5YL 1MVUA 3OXSB 1J0HA 1PG7X 3VFUB 4HIXH 4M1DL 2VDOL 2Z8WC 3PP4L 3X12B 3FCTB 1CFQA 1ORQB 3MBEC 4X6DE 3MZGB 4JM2B 3REVA 4PJEE 3L9RA 4PJEB 4M43L 5FYLD 2XTJE 3T4YA 2AS5M 1LDPH 2EDTA 2GCYA 3NZHH 3SCMD 2E6PA 5DDHB 4G80B 2Q8AL 5KSAB 3I6GA 5EZIL 3HCVA 4L4JA 4PJHB 2V5YA 1H5BC 3LB6C 1ZT1A 1HHIB 1C1EH 1KEGL 2KZWA 1OD7A 1R5WB 1TMCB 3HZKB 4JGMA 4R4ND 3IFLH 4KKAC 1K5NB 1TZHB 2B5IB 1MJ7L 4LLVB 4PJXF 3QQ9D 3HRZA 4O51B 3JV6A 4PGEA 2NX5D 1EK3A 4NZRH 3TIDB 2VL5B 3IF1A 3PNWB 1OSPH 2CKBB 4I48B 2OXGA 1ZKAA 3IAQA 3VD7A 4J4PD 1J8HE 3QUZD 1MIMH 4N0UE 3QO1B 1OP3H 1YPZB 1QO3A 1MREH 2X4PB 4G8GE 5CCKH 3LQMA 4KC3B 3GSUB 5FECB 1F4YL 2LFGA 2H2SD 3EOBA 3ZDXF 4Y4FB 3RVUC 3UX9B 1WIPA 4U1LB 1TZIB 1JCKA 5FYLE 1S7XB 1VESA 3E3QC 2IJ0C 2DAVA 4P23B 4UTAL 3OB8A 4FZ8L 1VPOL 5BJTA 4XMKH 4OIIL 1JK8A 4WNQB 2AV7B 5ELIA 1T1YA 3MNZB 3MBXH 5SV3A 4Z18A 4P4RA 1ONQA 4Q0XH 3WEXB 3GMMB 3FZUD 5D2NB 3O8XD 4L3EB 5JUEH 3MV7B 2NX5E 2WUCL 5KN5B 3L3DA 3FRPA 3DRQB 1PD6A 5DJ6A 3QJFA 3SPVB 2PW1B 2DI8A 2P43B 5CGYC 2I24N 1KBGL 2J4WH 3F6IA 4YZFF 4F57L 1EGJH 4YHOL 4OV6F 1CFTB 1G7QA 1YECL 1QNZL 3U0TB 5F7KC 5HD8C 1XCQB 3Q6FB 3B2UD 2IGFL 5CLTA 4NO5A 1CLZL 3U0PA 2A0LD 2NY0D 1EXUA 2ORBH 5E2TL 4GRLB 2MMXA 1OAUL 1D5IH 4WU7B 1IL1B 5DK2A 1MI5A 1SJEA 4L29B 1HZHH 1HYSC 4WUKL 4BZ1H 4C56A 2C4FT 2ATKA 4KKNA 3CFKA 2KQNA 3TVMC 4OZHF 1NAMB 1BZ9A 3B9KD 2J88L 1JZ3A 4X5LA 3J8F7 2X4UB 2NXZC 1F2XK 5E6ZA 4PJFA 2LQRA 2FR4A 3ALXA 4CDHA 5CMAA 3I50L 3GZKA 4PD4K 4R6UA 1JPGB 3MNVB 3NAAH 4I5BA 1S7SB 2A9ML 3QBTB 1NDMB 3ARDA 1A6PA 4EOWH 5GS2H 2IAMA 3NFPA 2XZAH 4DVRH 5GRYA 2GTZB 4KHTL 4LP4A 5BZWA 3MCLL 1IZKA 1RVFH 3GSXB 4G6MH 1JGUL 5L0QC 5FO7B 3MJ6A 3IU4H 3VMNA 5HHOD 1T7YA 5ANME 3S5LA 2N1KA 2UWEE 3L3JA 1TDQA 3LQAL 1FNLA 1TJHH 4JEGB 2MOVA 2A6IA 4QHMA 4O9HH 3VGDA 3NA9L 3PL6D 1BX2A 1KXTB 5HSFA 1CT8B 1BFOA 4LGSB 4Q6YA 4PRAA 1WZ1L 5I66A 3SJVB 3WJJC 4XPAH 4KRNA 5B22A 5KW9H 3WIFB 1AC6A 5AYUL 4WUUB 4QRPD 1PGRB 1SMAA 4G6AD 4I1NB 4LLQB 4BM7A 1KEMH 1Q94B 3S36X 3RWFB 1LO2H 3ZE1E 5EUOE 4IOSD 5E8DL 3OKKA 4YNYB 4W4OA 5I8CA 1SMOA 4BKLA 2NTSP 1MPAL 2L0DA 4C58B 1DANU 2CK2A 1A7RL 1E4XL 2F15A 1KJMA 43C9B 1L0QA 1F90L 1TCRB 3IDJA 4MMZC 2RCSH 1F3DJ 5HHOE 1YN7A 4HJJH 3RL2A 3WFDH 4U1GB 4A6YB 1UC6A 4UQ2B 1G0DA 3MXVH 2GI7A 3V0WH 1YEGL 1G0YR 3CXDL 3VXRD 1SBSL 3HE6C 5EU3A 1AP2B 1WBZA 4XPHL 5DT1H 4TSCH 5I1IL 3AU1B 3OZ9L 4E41D 4HXAL 4YBHA 2DYPA 5FF6B 4NT6A 2P5WD 4OGYL 1AGEA 1AY1L 1RV6X 5GSRA 5F7EH 2F53A 2XIDA 4G6JH 5BVJA 1MJ8L 2YA1A 4QRPE 3VI3F 3L7EB 3ARFB 4IS6B 4YQXL 4U6HA 2AEWA 2VXUL 1S5HB 3QIWC 4OJFL 3PWPB 4JJ5A 3JTTA 5J6HB 2W0KA 5F9JA 4L1DA 4P9ML 4PJ8A 1S7QA 4Z76A 4KZEL 2R2EB 4OLVH 4TYUA 3MLPA 2BP3A 4M7JL 5F3BA 3FT3B 4UOW1 1S3KL 1RURL 2QKIB 4MB5A 4KVNL 3H7LA 4HJGA 5A3ID 4JFHD 1YEJH 1E27B 3STLA 2IPTH 4ONHA 4F9LA 1F3JA 3BUYB 4QNPF 1NCBL 4C83B 1VGEL 4FNLH 1ZLWK 3AM8A 3VXRE 4BQ9A 4BH8B 1IQWL 2EDHA 5HHXL 4E41E 2R69H 1AHWC 4Z95H 3SE4C 2P5WE 1KTDA 4HK3J 4P0DA 1U8PA 1IGML 2FIRT 3RWIB 2E7MA 1HINH 3TYGH 3IXTA 4QRTA 4LRIC 3BRGC 5E8EA 2X44D 5JHLH 4TRPH 2C4XA 2IH1B 5E2VH 5ADPH 4G7YH 4JANA 1D5MA 1UM6H 4KQ3L 2DM3A 2NLJA 4WHTA 1IKFL 2XKNA 3SDXA 3ZYOA 4YHYC 3VFSA 4OCWH 4PJ5B 4XNQA 1ZGLB 4EUPG 1HQ4B 3KYOA 4YIQA 2C3HA 2WSKA 4KPHH 1R24B 1ZLUK 3BP6B 4N5ED 5GS3A 4UUJB 2IEPA 1R5VB 3KHQA 1HCVA 4PFEA 3OKMA 4NWUH 2O61B 1NGZB 5EU5A 2NXYC 1HIMH 3OKEB 2B4CL 1KCRL 3LOWA 4JFHE 2EE2A 4XVTH 5HGHA 4CBPA 5DJ8A 3PWUA 3L3IA 4Z5RA 4PRIA 4IJ3B 2F74A 5CJXC 5DLMH 4JFZH 2CJUL 5INCB 4MQXC 4G6KH 2D7QA 2ED7A 3KPMB 5KSBF 5HGBB 3EW3B 4ODBD 4W6WB 3MO1B 5DC9B 3RPIA 2Z31D 3SO3C 15C8L 5D96B 3L3GA 5C0GB 1CFBA 2QR0A 2X4SA 4ZFFB 2VE6A 1I3RA 1KPRB 4DUVA 5E8NA 3CLFH 1MIEL 3MRMB 3QUMA 4GXVH 3HLAB 2XG4A 3TWCH 1YUHB 3VXQB 5HGDA 3D3VD 3LHPL 4UV7L 5C0AD 3W11C 4U6YA 1FL3A 2BC4A 5AYQA 3T0XA 3MGTB 3W9DB 1FNEB 4JO3L 3UTPD 1FHGA 3HUJB 4DVBA 1ACYH 4MCZB 1TJGH 1U36A 4HIIB 3RBGA 3SQBA 5L2KB 1MY5A 1U42A 3BP7A 2AJUH 4XCFL 1BHGA 5KOMC 4XRCB 1L7TH 3TCLB 4X4XA 4YXKH 2F54A 4X9HA 1I9IL 3FQWA 5EOTA 2EDYA 4KROC 4BFIA 4WHYG 3GUTB 5F71A 3KG5A 4L3CA 3MRFA 5KJRH 5DRZA 1BAFL 3RHWF 1Y0LA 1A1OA 1ED3B 1GVIA 2ADIA 2P1YA 3GSQA 2SEBA 4Z7VB 4GW5A 4K3HA 4NZTL 4QOKD 1TQCC 2QQLH 1NGXB 2CMRH 3T0BA 2O5XH 3ULVD 5BV7C 4MA8L 3CFEB 2DF3A 2VO5A 2VLJA 3SDAA 2AEQH 4P2QB 3BGMA 5IVOA 1Q9KB 1MWAL 2A6JB 4XP5L 3QUMH 4S1RL 5TFSL 2APTA 4HKJA 5FKPB 43CAA 2ZCLH 1FE8L 3D3VE 1SYVA 1H9VA 4WO4A 5C0AE 4L4VA 1FGNH 5HY9A 3VWJA 1AFVL 4X4YA 4JAMB 3UTPE 1ZMYA 4ZUTA 3O6LH 1T0NB 1RUAL 1J5OL 4M8VA 2MWCA 3GJEB 5JO5A 1IEAA 4F37K 4Z7QE 3EYVB 1AO7E 1AO7B 4DCQA 4LCIH 1PY4A 3DROB 1PLGL 4ZSOA 4QRRA 5I18H 4KGLA 2BVUA 4Q58C 5I73B 4K94H 1MWAA 1QQDA 5DUPL 4EI5D 1PEZA 1AQDB 1MEXH 2R23A 3IJYB 5K9JL 4GQ9L 2VDNH 2XT1B 4TOYL 1YEIL 3ILPB 3OKLB 1IC4L 3I84A 2X70A 4NKMB 5CGTA 4Z7NE 3ARPA 4KKLC 2VZSA 4NHUB 4QOKE 4OM1L 4N9GB 2ESVA 3L6FB 5I1KL 2X1OA 3ARBA 1ETZB 3QUYB 4U1MA 5IK3B 5HHPB 4YHML 2WP3O 3ULVE 4JGJA 5MP6H 5TGBA 4JFQA 2MQ0A 1FV1B 1E28A 4HKXB 4GSDL 3BMWA 5FYLH 5ITBH 4OLXH 5IHBA 1IARB 5SWQB 2HP4A 1KLGB 3HZMA 3I6KB 3UTSB 3MLZH 4PS4H 2CR6A 1HNFA 1MCCA 4XPGL 4UT7L 5I1HH 1S8DB 3GSNB 5EUKA 1U0QA 4NQED 1BOGA 1DBJH 5EOCH 4CVZB 2HJLB 5E6ID 3V5HA 2VDMH 3QG6B 3TBTA 1MAML 4G43A 4HF5L 3DUUA 2AGJL 3VJ6A 5I1EH 4QXUL 3RY6A 4PJAA 2NZ9D 5EIVA 2HH0H 2D7NA 3VFOA 4F80A 1KNOB 3BE1L 5DYOB 5EH1A 1ZHKB 1IGIH 4QXTB 2DKUA 5HHMB 3H0TA 3O9WC 1PQZA 4U7MA 2VISB 3G04A 4P59L 4PG9B 4YDLC 1R3LB 1CDHA 5T5FL 1BJMA 1AXTH 2UWEA 2VRAA 4FG6C 3S88L 3IDXH 5KSVA 1MCFA 3VU2A 3GIVA 4NCC2 5TDPA 4PTTB 4PP2B 4WV1A 4F58L 1ZWIB 3PIQA 4AENA 4RAVA 4J3VA 4UQ3B 3QZWG 4XXCC 5TQ0H 2QSCL 1B4JL 2J1KA 5DI8A 5C9KA 4HLZG 4L4TD 4P46C 5CZXD 1OAQL 1NEUA 2BDNL 3C8KA 5GPRA 3VMOA 3P3YA 1Z5LA 3GIZH 4S0SD 4ACPA 3WDHA 3WBDA 5I16A 3OAYK 3HNTH 4NQEE 4X98A 4EXPX 3EBAA 5IW3A 4XXDA 4DZ8A 5T3ZL 1KG0B 1OTSD 1FZKB 1WWCA 4HGMA 5I2IA 1MHHB 4CW1A 1JPST 2VDPH 4O2CB 1WT5A 4OV5B 1OARH 5T33H 3D18B 3VFRB 4FFYL 1S9XB 5EA0H 1L7IH 4JN1H 4I18A 1U3YA 5GGSA 5DSCB 4IRZH 1RUKL 3L3OA 3VH8B 5IQ7L 3MV8D 4BK4A 3VXNA 1N2RA 4RSVA 25C8L 3MR9B 2QSVA 1P69B 3CMOH 1W72H 4B0MM 4G3YL 1IGYB 5J4MA 1NCNA 3KLSA 5EC2B 2EC8A 4L4TE 4D9LH 4XBGB 1L9NA 1YJDH 3CLEH 4WGVB 4M7KH 1R6VA 3GKWH 1Z2KA 5J3HD 2J5LC 4PIRF 3NN8B 2JLLA 1NLDH 4E0RB 2VKWA 1I9RH 2RGSA 3O3EA 3JWDL 3SQOH 2Y6SC 2VDLL 4JPVL 5F21B 2VXTL 1F5WA 3UTOA 3RNQB 4N0YH 1TQBB 2DQUH 4POUB 1T03L 1G9NL 1QLFA 5CD3B 1CLOL 4G8FB 4H0IA 3C5ZB 2C7UB 4X83A 2CPCA 4ZQKB 4RMTA 4FQCL 2HMID 3WFEL 4X7EC 3ARRA 4L8DB 1LEKA 5B38A 4JHWH 2R4SH 1KJ3L 4FQ1L 5BQ7A 5FB8B 2HT3C 5EBLB 3EFFB 5GJSH 3QQ3A 2IAND 4ODSL 4JQXC 3MV8E 1N0XL 1ULVA 2N7AA 1RK1B 1OW0A 3VXRA 4QKXB 4LNRA 4MNQA 5C09D 3GMQB 4DN4H 5DEZA 4MAYB 5KVEH 3OKDA 5TH2B 4J8RB 5IB5B 2J8UB 5GGRA 1KIPB 3IS0X 4OTXL 1A4JB 4NDMB 1Q9LB 4GMTL 3P4NA 3FQUB 1QSEA 2WK2A 4FQXC 4ZAKD 3QNYB 3SDDC 4ZUSA 2VC2H 4R3SB 2ADGB 5I19L 5JHDD 1QZ1A 5SWZA 4OI7A 2ZUXA 5HHNA 1CFQB 32C2B 1J0JA 4FHBD 1UEYA 3L9RB 1E0OB 3T4YB 5I8OL 3HAEA 3PP3K 4GG6E 4RIRA 2GCYB 4U6VH 1IAIL 2MJWA 3MPCA 3I6GB 3WE6B 1ZTXH 4OF7A 1HOCA 4U1JB 3KPPA 1IJ9A 4OF5A 3ZKMD 2IANE 1WV7T 1V05A 1KIUA 4JKPH 4JCMA 4XCNA 3P30L 1W2KT 2G5RA 3GK8H 3PWNB 4Y5YC 4PG2A 4WI2A 3HRZB 4LLAA 5C09E 3T09A 4PGEB 3LMJL 4YFLI 3MFFA 4PBXA 3FTGA 4WEUD 3IF1B 3S4SA 1QVOA 1VDGA 2EXWC 4E42A 3OX8A 4I3RH 4ZUWA 3WIIL 3SOBL 1VCAA 1QO3B 2ITDB 3VI4F 1FPTH 4GQPH 3ROLB 4LPUA 1IAKB 5EU7E 5JHDE 2AI0H 4HIJA 3EOBB 3V5DB 4LPVA 1A0QH 3MSPA 3OAUL 4OLEA 2B39A 4PYHA 3ELAT 2R1YA 2UUDK 3LS5H 1OHQA 5BJTB 3JWOC 1WJ3A 1QLEH 2AXJA 2OTWB 2X7LA 4ALAH 3NGBC 3OXRA 5C0ND 1T1YB 3S34H 3C2AH 4LDEB 4FXKA 5I75B 3O6FC 4DAGL 1JWMA 4P4RB 1INDL 1ONQB 4HCRA 3VFWA 3BYYA 2QHRH 5D6CA 3DX7B 3ILQD 4GJTB 5J12C 5F9WB 1JWUA 3GSRA 4PRPA 3L3DB 3MA9L 4KKCC 1PSKL 1URLA 3QJFB 1P7KA 3V2AR 2L7UA 3ZMRA 1MCPH 1A6VH 4YXHH 1EO8H 3O3AA 1G7QB 3BW9A 2YPLA 4YHZH 1X6LA 4OKDA 1XFPA 2Y23A 5EORH 4HUKB 4NO5B 3U0PB 3UMTA 3KR3L 1EXUB 3V5KA 4WCYL 2GW5A 1K9TA 5C2UB 5DK2B 5HVHB 1QFWL 5GGQL 2HKFL 4ZTPH 5MHSD 4C56B 3D3VA 2ATKB 4Y2OA 4M8QA 4MGXA 3CFKB 1J1PH 2HJKA 3QWRD 4YHKH 3CCHA 1BZ9B 1G6RL 1QTYT 5ID1A 3NCBB 1VB9A 2MPAH 1PG7L 2YRLA 3FAXA 4YEEA 4PJFB 3CMGA 2AJXH 4C54A 5KS9F 4U05A 5CMAB 1Z6JT 4HCRH 1K6QH 2DM4A 2CQVA 4JG1L 4NM8H 3ARDB 2IAMB 1RUQL 4PV8B 1ZHBA 3NFPB 3RDTA 5JPNA 2R0KL 3D0LA 3UJIH 4NFDA 3MJ7A 5SX4H 3SDCD 3L3KA 5T1KA 4H26A 5J1AA 5KBNC 3S5LB 3HI1A 4U1NA 3L3JB 4ODVH 4PJGA 2RIKA 4HIHA 1FL6A 4BYHA 1MFBL 1QFOA 1S7TA 1UM5L 2A6IB 4QHMB 1HCFX 4QTHA 5JQ6L 3MGAA 1BX2B 5MHSE 1BFOB 4PRAB 1MCDA 1VFMA 1FNAA 1YEFH 1QFUL 4RBPH 4G8IA 3UO1L 2GEEA 5T5NG 1JBJA 3NCYP 2DM2A 3OWEA 3OKKB 2OR7A 5I8CB 4BKLB 4WFGD 3GBMH 3RX5A 4JM2F 2FSEA 4X6DF 4PJEF 1T5XA 4UT9H 1HILA 5FGCB 5J7CC 1KJ2L 4DK3A 1BBDL 1D3CA 2YPKA 4YFEA 3OKNA 1LEIA 2V7HA 3WHE0 5IM7A 1G9MC 5CZKA 2PO6A 2PXYD 1IAMA 5GS0C 4PJHF 4M62L 1IEHA 2DQDH 4UNVA 4GXUM 4R97B 2YEZA 3RL2B 4AH2A 1X5HA 2BVYA 1LO3L 2MSPA 1C12B 3GI9L 4XMLL 3ULVH 3N1GC 3P11H 4UTBH 1A3RL 3P4OA 5GS1C 4NO2A 4LVOC 4Y4HD 2AJ3A 5EU3B 5JW5B 1EPFA 1WBZB 1LO0L 3CK0L 2EZ0D 2I9LA 2DYPB 2VZTA 4NT6B 5EZLA 1E6JL 1KJ2A 5B38G 1DFBH 1AGEB 3MRCA 1R5IA 5GSRB 3D85D 1YPZF 5BVJB 5GISL 3BQUC 4MXVE 3TPUA 1EFXD 4U6HB 4XPFL 2HWZL 1UWXK 3NIDF 3SE9H 3ULUL 4JJ5B 4WFGE 4J2XA 4LASL 3JTTB 4QYOA 5F9JB 5ALBH 5KSUA 5I15L 4MNHB 3O2WH 4PJ8B 1S7QB 4Z76B 5GRVK 2BSRA 1CGXA 3LEYH 3GO1H 5D70L 3FT4B 4UINH 4HBQA 5EC1B 1JP5A 2AJVH 2R15A 1DBAH 3IDYC 4L9DA 3STLB 3DXAA 4LSRL 1MCEA 2VUYA 5C0CD 1F3JB 4N8CL 1GHFH 1UADC 2A1WH 2YUXA 3RIFK 3I2CH 5DD5H 2FL5A 2Z93A 5DEGA 4HFUL 2ZPKL 1U8PB 1KOAA 2BCKA 3HC4L 1SM3H 4AT6A 4QRTB 4P2OA 5E8EB 4JFDD 3RGVD 1GGUA 1AI1L 1D5MB 4BZYA 2NLJB 4KRPC 4WHTB 2XKNB 3SDXB 4YBLC 3VFSB 3ARGC 5C6TL 1R3HA 2F19L 5J9PB 3QDMB 1NBQA 1E6OL 4LDLB 4IDJH 5LWYL 3RWEA 2CRIA 1YEKL 4F37F 5CIPB 3HG1D 2EXYD 1RJZB 1M7DA 3C8HA 4OD1L 5KTEL 2MHAA 1NMBL 5DMIH 2JELL 4PJIA 1I8LA 4KK6D 5EU5B 2D2OA 2VQUA 1U93A 4TPRH 3CSYA 4HJ0D 3HC0A 1MFAL 5JW4M 5HGHB 5C0CE 3EO9L 2EH8L 2YRPA 1JGLL 4Z5RB 3M8OH 3OJMB 2DQEL 2F74B 1IC7H 2I60H 3IETA 4V1DA 1NBVH 4GAGH 5B4MC 1IGCL 3C60D 4ZYKA 4MZ2A 1KULA 5AD0A 3KXFD 4HPOL 5FO9A 3QWQB 3IJSA 5DTFA 4EI6A 1A5FH 2DLFH 3RPIB 3O45A 4JFDE 2FCBA 3TJEL 3TT3L 4JY4B 5J8OA 3RTQD 3L3GB 4ZUUB 3EJYD 2B2XL 2XV6B 4BH7B 3U4AA 2QR0B 2X4SB 1T3FA 2B8OT 1Y6MR 3QIUC 1MF2L 8FABA 5I30H 2VE6B 4NC1C 4LDOB 5E8NB 2CDFB 3QUMB 2EKJA 4MLSA 3HG1E 3CSGA 4F8QA 3TO4A 2ARJB 4WWKC 2NY3B 4U6YB 2BC4B 4ZTOH 1MUJB 1MAKA 3GI8H 2GK0A 2VXVH 3LD8B 4Y5XA 5D2LA 4DVBB 3A6BH 1QKZH 3QHZH 1HWGB 4X8JA 2K1MA 3O2DA 3ZE1F 1EAJA 2AEIT 5D7JA 4PY8I 4Y89A 1N59A 3BP7B 5B3JE 5C09A 2VN7A 4WIQA 1GGCH 4X4XB 2F54B 5I1JL 1YYML 2BVQB 1MHPL 1JZ5A 3FQWB 5EOTB 4BFIB 2W9DL 3KXFE 3KXFB 3ARSA 1DQDH 4L3CB 5CP7A 3MRFB 2VLRD 5DRZB 4BSVA 4KMLB 2I5YL 1Y0LB 1A1OB 3S3JA 2AJYL 3VFPB 3H3PL 1ZLVH 2ADIB 2A9NL 2DQGL 3GSQB 4GW5B 5E95B 5K33A 3TBYA 2ZCKL 4IM8A 4ZO8A 3RUGA 3P9MA 3X3FL 5CHNB 1WEJL 1U8KA 4DFIA 2VLJB 3SDAB 4D94A 1BJ8A 1UZ8A 2HT4D 1FNSL 3QFDA 5DD1H 2AK4A 2R9HC 5TE4H 4JY5L 3LCYA 4R26L 1MJJA 2FNBA 4HKJB 43CAB 2EDJA 5IEHA 4KRLB 1NMCB 4W70A 4WO4B 1SYVB 3DV6A 5MEOA 4PJBA 4L4VB 3MRGA 4BSJA 1ZS8A 3FMGH 5HY9B 4X4YB 2FLBT 5EZOH 1I8MA 3HRPA 3U4BL 5C0RH 1R3JB 1U6AL 2FX7L 1AGBA 2XQBL 4K8RH 1RZJL 2XWJA 4LSQH 5JO5B 1IEAB 4OZGA 1TVDA 3VXU