1GC1H

Hiv-1 gp120 core complexed with cd4 and a neutralizing human antibody
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
229
structure length
229
Chain Sequence
QVQLLESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQGTLVTVTSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an HIV gp120 envelope glycoprotein in complex with the CD4 receptor and a neutralizing human antibody.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/receptor/immune system
molecule keywords ENVELOPE PROTEIN GP120
total genus 44
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 1998-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gc1H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gc1H01
1A1OA 3RY6A 4PRHB 4AYFA 4OGXL 1YJDL 1U0QA 3IAQA 1F8TH 3FHAA 1DANT 4LCCC 1JGVH 2H26B 1A7QL 3VI4F 2HT4D 4FFWD 1D5IH 5EOCH 5KSAA 4PB9H 1ZANL 3CX5K 1WCQA 4L9LB 3RY4A 5DT1H 3C8HA 3BQUC 5ADPL 5B8CB 5IQ9B 4KK9C 1F3DH 2HKHH 4C4KT 1U8KB 1A7OL 1AXIB 1J8HE 5TH2B 5TDNB 3VGBA 5JUEL 3TH3T 1S7SA 4C56B 3H3KA 2AAVA 4LSDA 4OM0L 5EU7E 1IAKB 3V4UL 1JPTL 1NCTA 2Y36L 3V7AG 1NFDA 3OV6A 3GO1L 3VXPA 1AGEB 1QLRB 3RTQC 3CVIL 1IKNC 3LKOA 4YHNB 1G9EA 2GSIA 1NCBL 3KXFE 1J8HB 1ZLUK 2CSPA 2J5LC 4ZYKB 1LNUA 2R56H 3GSNB 4NNPH 4R7NA 5D7JD 1H3PH 1MRCL 2NYYC 3TA3A 4QHMB 3T3MF 5K9QG 2RR3A 2NTFA 3DROA 3ARDC 3VD9A 4P49A 4PRPD 1DQLH 2OZ4H 2X7LB 1MSPA 4AQOA 4MXQD 5T5FL 4CVUA 4JFDE 4NNYB 1J7VR 5K9JH 5C1MB 5JXED 3DVGA 1XIWB 3O2DA 4PJDE 1CGXA 2X42A 4OZHF 5F7DA 3G6JA 5SWQB 4TUOB 2ATKB 2F8OA 1JPFA 1XGQB 3H3BC 4XAKE 4YDLC 4JZJC 1OLZA 1VHPA 4LFHG 4MNGE 4WTZG 4OZFB 4YHKL 1EO7A 1YN7B 2LTQB 2IFGA 3FB6B 5DZLA 3MLSH 2FB4L 3M07A 4JM4H 3L3IB 4OZFG 1BBDH 4JDTH 5ELIA 3MRNA 4JPVL 1WWWX 1BLNA 1U8MB 2NCMA 1CXIA 3JTSB 2VDLH 4W68A 1TFHA 5CKGA 3PV6A 5D9SA 1U8LA 1IVLA 1N7MH 5DD6A 3MOQA 3C5ZD 4PREA 1RVFH 4O2FB 4HEPG 1IAIM 3VRLE 4EBQL 4ZFGL 5CJQL 1U91A 5IT2L 1K2DB 3D39D 4OLZL 4NC1C 4U1HB 1KXTB 3HMWH 1CFTB 2ZSVB 3B2UD 1J8HA 4JVUA 3JV6B 4JRWA 1KPUA 3AREA 3DARA 3MV8E 4N0CC 4KTEL 5K9OB 5B22A 4KRPB 5I6XB 3O6LL 5J12B 2BCKB 3TGXA 4KK6D 3H3PL 5CILL 1IKNA 3CLEH 4O2CB 4XVTH 5D1ZC 4PY7B 4Y1AA 3DV4B 4LEXL 1FORH 1M7IA 4RZCA 3VH8B 2Q86B 4RWHA 2FEDC 3MV7E 4N8CH 3DECA 1NQBA 3MA7A 2QBWA 4PJAE 3ZKXB 3WJLA 2DLIA 2A38A 5JQ6L 3ORJA 5ACZB 5DD1H 4G8GD 3CAFA 1RUPH 2YA0A 1DL7H 4JG1H 5DYOB 4M48H 1CQYA 5C09B 4FXKB 4P2OA 3RWFA 2K3TA 3HE7B 3VGAC 5E6IB 1F3DJ 3MRCB 1DBKH 2FEDD 3OB8A 4QHLA 2DQIL 3VGHA 1NFIB 3I2CH 1YNKL 3IGAA 2NZ9D 4MVBD 2VLMD 4LHUA 3BO8A 5IMKB 4U1HA 3HB3D 3QA3B 4IMLA 4IIQB 3Q6GH 4KAQL 4YBQC 3GRWH 4WU7A 4AENB 3HG1D 4NN6C 4I9WD 4NQCD 4X6BA 3IETB 2BCKA 3D2UB 1Q38A 1FVCB 1JZ5A 2DKSA 2EDOA 4K3DL 3ARBA 5J4MA 3G5ZA 4LLUB 1JGLH 5GS1B 1SEBA 5F7NC 4HS3A 3CDGB 4ZO9A 5DUBA 4HXAH 3LIZL 1OAQH 1C5BL 4P5MB 3TH2T 4LP5A 5SWSB 5DWUL 3D3VD 1F90L 5I74C 2VITB 4H1LA 3IAPA 1D9KD 4LDEB 4KUZL 3ZKXC 5I73C 4JRYE 3VXOB 1HYSD 3NCJL 5BV7L 5I1DA 3D69B 2IH3A 4HUMB 1KPRB 4ODUB 3WIIL 3UX9B 5GGUA 4WEBL 2YMXL 5EWIH 1IQWL 1HI6A 3RPKA 4I3RH 4R4NC 1T5XB 1S9YB 4NZRH 5GHWL 3W0WB 4UQ2B 2BOCB 1XZ0B 4U1MA 3VXRE 1UGNA 4XNZC 1P4LA 4WNQA 5GRUL 1ONQA 2FIKB 3EFDH 2P42B 5ALCH 3NPZB 4YXLL 1X6LA 3U7WL 3B6SB 2X10A 1OWRM 4IIQA 3NH7H 4LSSH 5BRZA 3V5HB 8CGTA 3T0BA 2VXVL 4JY5H 1DR9A 3GSRA 5IIEA 1WWCA 3NFNB 1F5WA 3VD4A 4NNXA 1HHGB 2C3VB 4Z7VB 5ALBL 4Z9KB 4B7IA 5GGVY 1IKFL 3LV3A 3QFDB 1FVCA 2ZG1A 1IBGL 5LVEA 1A47A 4ZFFB 4JFPB 5CZKA 1A6WL 3QCUL 4PJGE 2D31B 5MEND 4LSVL 1J0KA 3QIBC 3WFZA 2AV7A 4GAJL 4OLVH 3NTCH 2MKLC 5HHXL 3QJFB 4H1LB 2VXQH 2CIKB 3WXWH 5T3ZD 4PP2B 4Y5XC 1N64L 1RZKC 1Y18A 3VWJC 4L1HA 4L8SA 5SX4H 3VD7A 3LEXB 5INCA 2MNUA 1OTSC 5A2LH 1D6VL 2AEQH 1S9YA 4L3EA 5T3ZL 2UZYB 5F96H 1LEGB 5IK3A 1B6UA 4PRPE 1KLGB 4LARL 3G6AB 1KJ2L 4ZUTA 5A3IC 1W8NA 1EERB 4R7DA 4I4WA 4WCYH 4NQDA 3DHJA 2ZUSA 1RZ8B 4UDTB 1N5AA 5E08L 3ILPB 2AABH 2XY1A 4JM2D 3QH3A 4ZSOA 4F37K 3D9AL 2PTTB 1V7MH 4HIEA 3L1OH 4NKIL 3QI9A 1FZKB 5INDB 3EJZC 4ISVA 1MIEH 4K7PL 4I3GA 4PRAB 3MLPA 5EUOA 1VPOL 5L7XL 2W0PA 2YHGA 2J88L 4TNWK 1BQLL 4O51B 2GJ6E 5FO8A 2Z31C 2PCPA 1I7ZA 3BP4A 2X1OA 5JW3H 4TSCL 3MA9L 3SJVD 1GGBL 4Q9RL 4NZTH 5MENA 5DEZA 4YZFE 1KCUH 2H32H 2J8OA 3RVTC 1SMOA 2CK2A 1JHLH 1A9EB 3CGTA 2CDFB 4Y2DC 2QQLH 4I5BA 4KK9D 4Z6AT 1RHHB 5IWLC 1AO7D 1BQHG 2DDQH 4ZODA 3KJ4C 1MJ7L 3PP3K 4QF1B 1MJUH 4U2ZA 4YEEA 5E2WL 5FEBA 2D3VA 4KY1L 1RZ7H 2XYCA 1MH5A 2ZOKA 1JMZA 2PTVA 3NFPB 2FIRT 3BP5A 3SCMD 4GW1B 1I1CA 2Q7YA 3QEGH 1DCLA 1LP9E 1MCPL 3AFLA 3PUCA 4HLJA 5CZXD 1MPAH 3LN4B 3KXFA 4NRXB 3SDCA 4OB5L 1PAMA 1RUAL 5B8CA 3LQAL 1QYGL 2C26A 1MCFA 2EIDA 3LB6D 3CXHK 3GEWB 3EYOB 4IRJB 5TH2A 4CGTA 4M7KH 2EEAA 2YWYA 3WLBB 5FV1L 3UJIH 1IZJA 2HLAA 3H9SB 1P5VA 4O51A 2GITB 4HKZA 5IF0B 3LMJL 3UPRB 4PJGB 1HOCA 1G84A 4RGNE 4K7PY 4EN3A 2V5MA 2FD6H 2W65B 5HGHA 3TBVB 1W72H 2AJZB 2XTJC 4OZGB 4WI3A 4JR9H 1BIIA 4ELMF 5K9KA 4JPKH 4R7NB 3FJTA 4PB0H 5ICZB 4BQ6A 3TBWB 4MZ3A 5H8DA 4Z7WB 1HXMB 4RA0C 1IRAY 2YN3A 4XAWL 1IGYB 1EHNA 2VDRL 3ZDZF 3S88L 2E7LC 2H2PD 3OWEA 3BZ4B 4G7VH 2D03H 2D9QB 4FNLL 4MWFB 12E8H 4TVPH 3HRPA 2QSCH 1CTNA 3B9KC 3ZKMC 4M62L 4H88L 1JJUA 2BVPB 1T4KB 5JQHC 3BP7A 3MRGB 4QNPF 5I19L 1XGQA 4EJ1C 4GRLC 3L3OA 1UQSB 2H1PL 4HGWB 5EZJA 4PUBL 5H94A 2X4OB 3LD8B 4KJWD 4DZ8B 4XZUB 1XMWA 2AEIT 3RX5A 2JJSA 4AH2A 2A9NL 4P5TA 1G0YR 3TNNA 3RZCC 3P4MB 1JNHA 3C8KA 1TVDA 1OD7A 1A4JA 3DRQB 1UCBH 3TBSB 5BS0D 1WIUA 3TV3L 1C7SA 2NZIA 2WSKA 5CINH 3UPRA 1Z2KA 2GSIB 4TULL 3RAJH 1MHHB 1E4XH 4U6TA 4BSJA 2P43B 4PJAA 5BZWB 1IGMH 1C1EL 5EU4B 5D8JL 1SEQL 3O0RL 3UBXB 3TCLA 2V9RA 2ESVD 4X80H 4X6DF 3SDYL 4POYA 4F7CA 1ZLWH 5ICZA 3FKUS 4FN0A 2X9WA 4RFNB 5JW5B 1TTGA 4TPRL 3MRRA 3T2NL 5DHVB 3ZDYF 1OAUL 4HPOH 2I07B 4G6FB 4QHKJ 5DD0H 2YPLD 1NCAH 1ZA3A 2X1WL 1F4YL 4JM2B 5E9DE 3HC4H 2KH2B 4NKDA 1S7XA 3IJSB 5A16B 1J86A 3MLUL 1EEYA 2HT3D 3CNKA 4XCNA 1U95B 5F9JB 3PWLB 1AGFB 2X4OA 3R0NA 3FO0L 4MQXC 1KEGH 1KTRL 3VFVA 4M7LL 5I0ZA 2NY0B 2PO6B 5CZXC 4XB8A 4LVNC 2X4TB 2BJML 3BDYL 4N9OB 3CFJA 4LLWB 2ZNWA 1DBAH 2Y07L 5IB4A 2P8LA 1KCSL 4PBVC 1QBLH 1CGSH 3IJHA 3QAZC 1T2QL 4PPTA 5C0JA 1B0GB 3MRLA 1LD9A 3DMMD 1YY9D 4YDJA 3JUYA 4AMKH 3L3DA 4IOSD 3GFUA 1IC7L 2QSQA 5AZEH 4JFOB 1JVKA 3NIGE 1AXTL 1XAUA 4FQ1L 4MLSA 3QPQC 3RGVD 5KJRH 2V2WB 4UBDD 4S1SL 5FV2A 3NMEA 4R26H 4LGRB 5C07A 4LHJB 1FP5A 1VFAB 4TSBH 1NLBH 3IDNA 3TN0A 3KWWA 3P9LA 5E2TL 1J11A 4EUPH 3UMTA 4HLZG 2WUCL 2H8PA 1T1WB 2E9IA 1FQ9C 4NFCA 1BFVH 3O2DL 3TN0C 5DMGD 4UTBH 3ARZA 2QSVA 5FGBC 2HT2C 4RAVA 3X3FH 1S7WA 4JM2C 3VG0L 5T3ZE 2WWMC 4YFLI 1RIVL 1JNNL 3W82A 3ARDB 1KJMA 3WNPA 3EDFA 5F44A 3WS6A 1YMMD 5D70L 4EXKA 4PY8I 2PNDA 2JKXA 4U1NA 2WAHA 5MHSE 1NBYB 2ARWA 4Y19D 5T3XL 5GGUB 4DKDC 5E24E 1A7NL 1ZT4A 2NY0C 3ARRA 3MOAL 4JJHA 1A3LL 5DSCA 4KMTH 4UT9L 2KL6A 1KGCE 2FHBA 4GRWE 4V1DB 1MREH 2PN5A 4TRPH 5HYJA 3F5WB 3SO3C 3EOYG 4JRXD 4GG6E 4JFYA 3S96A 4HG4J 3HC3L 4HIXH 2R69L 2AEPH 3WHE1 3K81A 5EO9B 1DBJH 4GAGH 4GS7C 5TQ2L 2CLVA 4MXWL 1UZ8A 3LKPB 4G42B 3O4OB 5CEZE 3RVVD 4PTUA 5DFWH 2E9BA 4MCYB 2XZCH 1JRHL 4QRRB 4RMTA 4WFEE 3FQNA 4JHWH 3ULUC 3ZE2F 2ZJSH 3V4PH 3AGVA 3LDBB 4NC1E 4R96A 3HC0A 3BPLC 3FONB 3O8XD 1DUYA 2VLRB 5B4MC 2BMKA 5JPNB 3X11B 4OFIA 5D71L 2VWEE 1U91B 3ZTNH 1HI6B 4LBEA 4ZSOE 1IZKA 1INDH 2DMCA 4YHZH 3BJLA 1CXHA 1UH4A 2ZCHL 2XG5A 3AAZB 4MJ6A 2HWZL 4N8PA 5T1KA 4P2QA 4U3XA 3U0WH 5CD3B 1YNLH 2GIYA 4HWZA 3UTSD 5J56B 1UYWL 5EC2A 5IUSA 5FYLL 1WT5A 3IDIB 2YD3A 3OXSB 3GSRB 5IIEB 5D2LB 5ITFB 4MX7B 3SCMB 3MUZ1 2BHUA 2FEEL 1EJOH 5CP7B 5HYSG 4S11A 1S3KH 2AI0L 4U2YA 1J9CT 3EAKA 4D9RD 3SE4C 4Z7UE 5CIPH 1BM3H 2IALA 2WK2A 3DTXA 4O00A 3QUZB 3MRNB 3MV9D 4M9PA 4X6DE 4X4MA 4GS7B 5D6DA 3MJ9H 3P0GB 5DJCA 1OT1A 3C5SB 5GSVA 1S7TB 3O8XC 5FUOL 1GOHA 3V6FB 2PUQT 1YEKL 1A2YA 5INCB 1MVUA 4QCIB 4NQTA 5I71C 4Z5RB 4E41E 3Q5YA 5IHUH 5JIHA 4NHCL 2JCCF 4L3EB 2YBRB 4Y7MA 3D3VE 2B4CC 1RHHA 2WIMA 3RPIB 1F8TL 3T77B 4CRPA 3IDGB 3GBNH 1HCFX 1CS6A 1W0VA 2BNRE 1JNJA 4GH7B 3DGGB 4ODWB 5F1IB 4PJ7F 2FL5B 3PP4L 3O2WH 4F58L 3PGDB 2Q86A 4UI2A 4PJEB 3ARBB 1AJ7L 1OCWL 2XRAH 1U41A 5IFHH 2N56A 3RVWD 2CDEB 1KN2H 1NAMB 5D2NA 1UXSA 3KPRA 4OBSA 1RUMH 1JTPA 4KVCL 1BZ9B 1ZVYA 1JPTH 2YPLA 3MUGB 5EH1A 2IAMA 2NY0D 4F37F 2VITA 2DLFH 5DEGA 3QPXH 4K3EH 3QUZA 2F19H 4OV5A 2GI7A 4IRZL 1ZLVH 4Q2ZB 5BS0E 3HE7A 1JPGB 1ACYH 2C5DC 1V8HA 2ADJB 4AIZA 4TNWF 4FFVD 1UACL 2WLZA 5JPMA 4NFBA 5DQ9A 5EO1A 3LKRA 4PGJA 3EIFA 4P2OC 5ANMB 5IW1A 5L2JB 4HMDA 4JKPH 1C08B 3EBAA 4QXUL 3UYOD 3CK0L 3GIVB 4LCWD 4OD2B 4MZ2A 5JLZA 5F70A 4Z5RA 1FHGA 1VENA 3MLVH 4JLRB 3VG9B 1BIIB 4UIKH 2R23A 3T0EC 5K9JL 5KSVA 3IDXH 5I6XC 5B39A 1JF1A 3IFPB 5I71B 4GQPH 3V6OE 1XF4A 4NM8L 1CD0A 4XMPL 4PJIE 3OTTA 4PJBE 2G5BB 4ODWA 5F1IA 4HC1A 3TO2B 4E5XB 2BVOB 4YHKH 1KB5H 2NR6D 3DMMB 3BDXA 2Q7NA 3EYSL 2FGWL 2BOBB 5HDLA 3HE6A 1P7HL 3HNVL 1R5WB 3CDCA 4UBDC 1Z9LA 2JE8A 4Y5YC 3E8UL 3INUH 1JPSL 1DQDH 2V7NA 3FT2A 2E9JA 2YD2A 3V9FA 1C16A 2ADIB 5GRJH 3KPRB 4EI5C 3S34L 3S3SA 5TF1H 5JR1L 4FOMA 1QFWL 4FRWA 4DGYL 4EI5A 5CJQH 5D2LF 4XH2A 3I6GA 3B83A 5EA0H 4P2YA 3C8DA 1Y18B 1ZSDB 3FT3B 1HOCB 4ONGH 3FFDA 3FZUD 3ARED 4X4YB 1T5XA 4H20H 4XWGH 3ZE0E 4PJHE 3IXAB 1I8LC 2X4PA 2P24A 2CUMA 3L5WB 1FSKB 5F7UA 3AVEA 4G3YH 3ULUE 4JFFD 4O4YH 3MRQB 3IF1B 1Z9MA 3JVGA 2C4XA 1EBPA 3LN5A 2H41A 4OCWH 2UY7A 1OP3K 4KKCD 1MIML 4PRBB 3HZYB 1JWMA 4PBXA 5D1QA 3WUWB 3U82B 4YXHH 1P7QB 4NT6B 3C6LA 2VTFA 3CSBA 5EU6A 5DJ6A 2A83A 5C0ND 2C1PB 1MCEA 3STLB 4CW1A 4NJ9H 1I1AD 1LO5B 1RK1B 1MFBL 3I02B 1FIEA 4Y16C 1BQSA 5K9QI 3MYJA 3FT2B 5BOPA 2OL3B 3PHQA 2V17L 1S9XB 1T2JA 3HUJA 2ITDA 4IDJH 4ZDHB 3ULVE 2P8MB 3HE7D 2L0DA 2X44D 4GRMA 1MWAL 4PLJD 4WVRA 1ZHNB 3MRPA 1T03H 2GJ6D 2YD8A 2ATPA 4N9GA 2VDQH 1EFXD 4H8WL 1FYTE 4PR5A 5L0QB 3VWJA 3FZUC 4MD0A 2DM2A 4B41A 1WZ1H 2X4NA 5D7SL 3OHXA 4R0LB 4NRZB 2FJFA 3MODH 4S1QL 5JW5A 5DS8B 1I3GH 4ELKB 4ODTL 4Z0BH 2I25N 1G7PB 4AIOA 3C6LB 3DWTA 1FO0L 5J6GB 4PP1C 3OF6A 5KS9A 4NKDB 4XPHL 1PYWB 3S36L 1T1WA 4WUUB 5BW7A 2XTJB 4WWKA 4NYLA 4Y5VC 3L5JA 4UAOC 1UWGL 1S8DA 1K4DA 2FH8A 5B3JF 4KZDL 3O3AB 1U3YA 4PLKC 4D0BB 2X89A 4Y5XB 1KJMB 2UVFA 1RULH 2QQKL 3MLZL 1IQDB 1DLHA 4NWTH 4EN3B 2VDKH 2G60H 3QUKA 2AERT 4JY4A 1A9EA 1FJ1B 5CEZH 2OXHA 2P5EB 1TZGL 5F9AC 4AEFA 4LSSL 4XPFH 1ZS8B 1UM5L 1JFQH 3ULSA 4UNUA 1U58B 3KS0H 4P5KB 1LO3H 4MQ7A 4ALAL 2VAJA 4M6OL 4DUVA 5L0QC 3BP5B 4XCFH 3STZA 1F6LL 4OF6A 5HHOA 1U9KA 1IC5H 1A4KB 1A6PA 4MJID 3BKML 1HNFA 1MFCL 4TOYL 3EYUL 3O6FB 2VXTH 5KW9L 2P8PB 4C55A 2Z8VC 2VXQL 4P2QE 3QEHB 4QKXB 3DETD 5D1XC 5IBUG 4JPWL 1HILA 3MMEA 1DE4A 4WUUA 4JY6B 4Z77B 2GQHA 2Y06H 1RUQL 5J13B 1ZKAA 2V5SA 1FL3B 3PWPD 4O58H 3DSFH 2EDRA 2FX9H 1B0RB 1YYLL 4KGLA 1FNGB 4WFFE 3HC0B 3HA0A 1J0ZA 1CE1H 3EO1A 4WGWB 3H9SE 1QD0A 3RL1B 3O3EA 1PKOA 2Z31D 4LHUD 4ZS7L 5T33H 1KJ2H 2NXZC 4G6MH 3FOMB 3UAJD 3BW9B 3BSZL 4EN3C 3CDFA 4JDVA 3V95A 1ZMYA 1BMGA 4AM0A 5DQJB 5EC2B 4Q74A 4OFVA 4M7LT 4H8WC 2QHRL 3MRRB 1LK2A 1WIPA 4HF5L 4IHOA 4RGNB 2D7TH 4QRSB 3WXVL 8FABA 2P5WD 1EVTC 3O11B 1D9KA 3RWDA 1AR1D 1T4KA 2AW2A 5C86A 5L6YL 1A5FH 1IGIL 5EUKB 3QCTL 4Y8AA 4HLZH 4F7TA 1CQKA 4I48A 5HY9B 4PJFE 1VFUA 2R0KH 3FO2B 2YD1A 3NCYS 1GCFA 2EDTA 4P5TB 3TNNB 2F5BH 5JW3L 3QZWA 1NGPH 4Q9BA 1KB9K 4JFQA 4HKJA 5JIIA 3J8F7 3QDMA 4XXDA 5IROA 2NX5A 3CFJB 5C0GB 4O5LH 3BKYL 2A0LD 1YECL 2CLRB 3G9AB 1KLFA 2DJ4A 2H6PA 3RWIB 1F11A 3KPRE 1ZA6B 3TBYB 2VNCA 5CCKL 1CDIA 1ZTXH 3HNSH 1IM9D 5KN5B 4UOJA 4YBQD 3OJDB 1EGJL 3DX8A 1C5CL 4X6EA 3IDMB 5HHNA 4FHBD 4GAFB 3WSQL 1G7IB 4WEUD 5I75C 4GUPA 4RGNC 1A6VL 2AJVH 4RAHA 4X0KB 1JPFB 5C3TA 1HNGA 1NAMA 5D2NB 1P7KA 1X3DA 4R9HA 5LWYH 1A9BA 4JN1H 3C60D 1DZBA 1OP3H 1WFNA 3UEZA 3EOAB 1IEHA 3VXSB 2Y6SD 1P4IH 1R5IA 1ZHBB 4MHHG 4Y0GA 4OV5B 2J1KA 3JWOL 4DK3A 5I1EH 3JWOC 3MLYH 4LLWA 3QIUC 3T1FA 4PJBA 4FMKA 5FCUH 1NDGB 5GRWA 3LY6A 1E27B 1ES0B 1IFHH 3SO3B 4PREB 4QXTA 5ISZD 2MSPA 5JPMB 4JR9L 4YHYB 1OTTC 1J0IA 1Q9LB 4DEPB 35C8H 2VIRA 4JFFA 1LD9B 1C08A 3B3IA 5DZNA 4YR6B 5HD8D 5ID0A 2VDRH 4PGBB 4D9QD 1KELH 3C60C 4KK8D 1ZA6A 1K6QL 1CU4L 4KK6C 3J7HA 1MFEH 5SX5H 2GAZA 2VLJD 5EZIL 3T0EA 1FZOB 1XF4B 4FFZL 2EDHA 2W92A 1KXVC 5I8KL 4Z7VE 3K2UL 2JJVA 4JFYB 3MLXL 5DHVH 4AEEA 4GKZA 4HQQH 3S5LG 1MFAH 4PG9A 4RGMC 3UTSB 1EO5A 5D6CB 2HFGL 4M6NL 3HKFA 3LEYL 4U0RC 5MERB 4Z8FH 1X6NA 1ULVA 4RNRB 3D0LB 1GGTA 3GSWB 4MAYA 1UCBL 3ELAT 5AG8A 3C9NA 4JB9H 5EOCJ 4KTDH 5L9DL 4PLOB 1AE6H 4OCNC 4W81A 3LEVH 4OGYL 3BWAB 3GSNL 1N4XL 2AK1H 3KGRA 1ZANH 2AGJH 3RVUD 5EU6E 1T04B 4G8GA 1K85A 2LVEA 2JK5B 1NCUA 2ZG3A 3CMGA 3BT2H 5ICYB 3KYMA 1Q9LA 1I8KA 3QHZH 5E2JA 3UO1H 5JORB 1T1YB 3P4NB 2EDJA 3G08A 5HGDA 3WCYA 3IKCA 3V4UH 1B6DA 2JB5H 3ARFC 3UTZB 4L9DA 2B0SH 1U8IA 3UJJL 1ONQB 1I4FB 1ITBB 5ISZE 2R1WB 3MV8A 3CUPA 1DDHB 3L3JA 4PRBA 3PGCA 1MI5D 4F7MB 4NO2A 4JG0L 3SN6N 3MRDA 3GSXB 4NZJA 2UZIL 5DVNA 5J11C 5FF6B 3QEQA 4MDIB 2CLVB 3WFCH 5FO7A 4BH8A 2PW1A 3QHFL 3I84A 3QXDB 3OKKB 1ACZA 1Q8MA 3QXUA 4XBGA 3P4LA 3TN0D 2YOCA 4M1GL 3OGCB 2HFFA 5T5FH 4JFPA 4EN3D 3TFKD 1GC1H 3V5DA 3D0LA 3FTGB 2IANB 3H6JA 5BS0B 3V52H 2V2XB 4RCAA 2IANE 1NCNA 2VLLB 1QNZL 1TJHH 1WC7B 4K7FA 1R3JA 1EUUA 1F45A 5EO0B 1QO3B 4LBEB 2ESVA 4CMMB 2P1YA 3PV7A 5IMOA 3IXAA 4M43L 4I0PD 1HWGB 3MLSL 1KTDA 3LRSA 3CMOL 5I1JL 5CGYD 3VDBA 1BBDL 4JDTL 3DHMA 2YBRA 3QPQD 3RGVC 3EO9L 1E6JH 2DQHH 3E2HC 3GI8L 3FMGL 2EEBA 5C0AD 3ES6B 3ZHDA 1T1YA 3KR3L 3P4NA 1L9MA 4GMSL 1RVFL 5IVZB 4YNYA 5FECA 4L9LC 4TSBL 4ZFGH 3UJTL 5T3XE 3CFDB 5EZOH 4PRIE 3N1GC 2R1WA 4CDGC 3DBXA 1HIMH 3WS3B 1Y6MR 1SYSB 4PGCA 2R4RH 5I30H 3SKMB 3QWOA 1P6FA 2CO7B 3DJ9A 5LQBL 4RX4A 3B9VA 4B53A 3HZMA 3D85D 5IVXB 1YQVL 3MJGX 2PR4L 5EORL 2MQ3A 5ISZA 2OL3A 1U8OB 3RWHA 4NO5B 4YPGB 2HJKB 2I60L 4JQXC 5CD5D 4D0BA 5I0DA 4GG6F 5GS0C 3ZYOA 4HUKB 3I3DA 4CN1A 4TVPD 3HZKA 2PCPB 1L7IH 4JO4H 4E41B 4N0YL 3TT1L 4FQJH 5F9WB 1M6OA 5TGBA 3S37H 4M48L 4JFXA 3TYGL 5AZ2L 2R0ZL 1AH1A 2E27L 3SE9L 3BMWA 3HS0A 3OHXB 1N26A 1NCWL 1FO0A 4R0LA 5FGSA 1CLCA 2DQEL 3FFCB 2J8UF 3PIQA 2DQIH 3REWB 2MQCA 1O5DT 2VLJB 3GSQA 5HYEA 3A6CH 4U05A 4EDXB 3VXUA 3RGVA 3WS3A 5L88L 3EZ8A 43CAB 4ZSOB 3L3HB 1G7JB 4S0TD 3DYOA 3B4NA 3K2MC 3K3QA 4V2CB 2DQFA 3SKMA 1FZKA 4H25A 4PJ5E 3I9GL 3PJSB 5TDNA 3H9HB 3HZMB 4BKLA 2JIXD 4CU6A 2ERJB 3O8XB 2Y72A 5HYQA 1VDGA 1JIBA 3SOBL 1FNSH 5IB5B 1C7TA 4PJCA 3LKOB 4UDUA 1IGJB 2IQAB 3HZVA 3PP3H 5HDBE 4HS8L 4J8RB 1FJ1A 3P0VH 1GPOH 1HN1A 1I9EA 3TZVC 3KPLB 1NGWB 3P4OA 4HIHA 1PG7H 3BH8B 4E0RA 2EYRB 4I5BB 1JF1B 3IFPA 4LKCA 3F8UB 5EIIB 2ICEA 5I2IB 1MCKA 4C54A 3LN5B 1ZLWK 3AS0A 4HKBB 2WWKT 1LO2L 3HZYA 2AI0H 4P9ML 4X7CC 2BNRD 3GJFH 1QFWI 2BVOA 4ZXBB 3JWDH 2CMRH 1CLOH 3ARBC 3SKUD 4NQDE 4PV8A 2NY2B 3EFDL 1CZ8L 3MFGB 4BSVB 1U6AH 4M93B 3DSNA 3OR7B 5CIPA 4K55A 3LN4A 3NH7L 3HRZB 1INEH 1L7TL 1N3NB 2J4WL 3VGAB 43CAA 3VA2C 5I8EB 4KGJA 3G6JE 3GMRB 4I0PA 2UY6A 1A1MA 4V1DE 3VXUD 4LSUH 4NJAL 1LO4H 4PRDA 4M7JH 3MRMA 1H8SA 4MD5B 1FCCA 1ADQH 1QLEL 3UBXI 4O2FA 3C2SA 2ADGB 3AMKA 4H1LH 4WY7H 3BQUB 4G80B 3NACL 4NHUA 3MJ8A 5ETUA 1NKOA 2D0FA 5TFSL 3U7YL 2UUDH 2CK0L 4HUWB 3PNWA 3GSVB 4ETQB 1N64H 4MA7H 3ZKSD 1C12A 1DBMH 4U6HA 3TZVB 2WBJD 2FEEI 5DS8A 5ID1B 1LK2B 3LRGA 4Z7NE 1ZOXA 4DQOL 1NAML 4Y1AB 4I18B 1ROWA 2VWEC 1GYAA 3RWDB 3OAZK 4X6EB 4KVCH 1MFNA 2XZAL 1JZ8A 4Z7WE 4G8FA 5DA4A 1A0QH 4Y4KB 1I7RB 4JM2A 3MV7A 2CLZB 2EH7L 5H94B 1N3NA 2DBLH 4HWBA 3SE8L 1XGYL 3S35L 2IG2L 3TPUB 4B7LA 3QO1B 1J5OH 4P2OD 5K59E 3L7FA 5FA4B 1ITCA 1IQDA 2EH8H 5E6IA 3MV9A 2CRYA 2HVKA 4TQEL 4QXTB 1DEEA 1BOGB 2X4UB 2YPVL 4TSAH 4ESKA 1K4CB 1MHHA 4OZ4A 4UT6H 1KPUB 3O6KH 4F15C 2ZG2A 4U1GC 4XP9L 1U58A 4WI7A 4LCUA 1Q72L 4MQ7B 4Y2OA 2Q8AL 4X8JB 3OL2A 4TTGA 1IE5A 4F80A 4MA3B 5C2BH 4WHTB 3DV4A 2HRLA 4EIZC 1SY6A 2NY4B 4HD9A 3GJFB 4NO3A 3VFMB 4GBXA 2GY5A 2UWEB 4X6CB 1AP2B 4DTGL 1MJUL 5E2WH 1G9MH 3E6FB 2GTWA 4RX4D 5FGBA 5IQ9A 3TNMB 4QO1A 3HR5B 1FE8H 2BNUA 1QLFA 5D1ZB 4GSDH 4S2SA 1W8OA 1FAIH 1NGYA 2EIBA 4XNQA 4KHXH 1MQKL 3VWKC 2DLGA 3MRCA 4QRPE 3X12A 5HHME 3CVHH 1X5ZA 3A67H 4OB5H 2X4RA 4LCWB 1FRGH 3FB8B 5KVEL 2HFEB 2VIRB 4MB4A 1IT9L 2GJZB 1JNLH 4UNTA 5IB3B 5J9PA 5JOFB 4XGZB 2CJUH 4GXVL 4JDVB 4OCXH 4L4VD 2Q76A 1JTOA 2ICWI 4ODHH 5CSBA 4OF7A 3LSOA 4RFEA 1GGIL 1LGVA 2CQVA 3ZTJG 2OI9C 3CFCL 1A7PH 3V0VB 5EOTA 5DVOA 4F7MA 4CN4A 4DK6A 4MNHA 3T8XA 4P48A 3VFMA 2B20A 5SV4A 4QNPE 3S3PA 4F7TB 4RNRA 2VQUA 3QIBD 4Y5VB 1A6TA 2H3NA 1MWAH 2AXJA 4FNLH 4RFOL 1CFNA 1Q9OB 5LXGL 2B1AH 3FQNB 4QRTA 5AWNL 1FN4A 2A1WH 5FA3A 3VFRA 1NGYB 1SM3H 4N1CA 4K7FB 5DVLA 4LLVA 1OAKH 5I19H 3S35X 1E6OH 1QO3A 1FC2D 4OZGE 4XCCH 4XVSH 3Q48A 3QIWC 3PWNB 3K4DA 1AQKH 4ELME 5M94B 5DLML 2BRRL 3G08B 5E2UH 2HVJA 4ZXBD 3ZL4L 1NBQA 2ZUUA 2L7UA 2R29L 5E00B 2PYEE 3VGDA 3U1SL 4NO2B 3DXAD 2A6KB 2HAZA 3GB7B 3M17A 4JFHD 5LGHL 3VH8A 3MQIA 2Y23A 3HMXA 1RK0A 3X3GH 4UU9A 1NGQH 2GY7B 1FVDA 4L4VA 2J2ZA 2VC2L 2OJZL 4RISH 4HUUA 5F1NA 1QQDA 1IEAB 4EUPG 2ZUXA 5B3NA 3ARSA 4YHIB 5JNYB 2D2OA 4HPYL 3SGDH 5BMFL 3T0DA 5EZLB 2G75A 2VRAA 3KHQA 4XWOC 1TLKA 2NY7H 1UEMA 4K3GA 5K33A 1XR9A 3BPCA 1NL0H 2GJ6B 3V6ZA 2OJEA 4D8PB 1XCQA 4Y4HD 1NLDL 5IV2B 4Y4FB 1RZJH 3D18A 1BF2A 4QRPB 1UENA 4R8WH 1UM5H 5EFIA 1U3HD 5HYSA 5I15H 5GGSY 3RU8H 5EPMB 5LKNA 4GQ9L 2FHCA 4RGMB 3ULVC 3F6IA 3BI9X 4PGBA 3SGEI 4YAQA 3AAZA 3WLWD 4JFXB 3MNZB 2BJMH 3FHQA 1F4HA 1MHCA 2GAZB 3BYYA 4J3OC 4XNYL 3UXFA 1IARB 5AYUL 1DSFL 1MLBA 3SKOA 3VRIA 5IGXL 5IW6B 2WP3O 3BKMH 2R0LH 4KPHL 3S7GA 3MV01 1PKQA 1VA9A 3DBXB 4BH7A 1QSFE 4HBCL 5GRXG 4GKZB 1R3HA 3DRTB 3QH3B 5HI3D 5CKAA 3UTSA 4FQ2L 5D7IA 4JDZB 5C08E 4X4XA 4YHOL 3WD5L 3B5HA 4XP6L 4HS3B 3CDGA 5DUBB 3TO4D 1JWUB 4I77H 2CKBB 2Y06L 5DRWA 3IU3A 1J1OL 5CMAB 1QQDB 3IKKA 1MJJB 4HAGA 1MUJA 3LAFA 3QUMA 1R3LA 5C8JB 3ULUL 4YPJA 4TUJB 2GITA 4HKZB 4KRLB 4LF3B 4XWOD 3W39A 4G9DA 4ZFOA 5IF0A 1TJIH 4DGIH 4OF8A 5IB5A 2DLEA 5AUMB 2W65A 1G7QB 1GAFH 1QSVA 3TIEA 3O6LH 5GGSB 3IKCB 3U36A 3H3PH 5CILH 3UTZA 2XZQH 5F7EL 3P73B 5HVHB 4LKCB 4ZNEA 5A2IH 3O3BB 1V5JA 1Q0YL 4XCEA 4K8RC 4APQB 1KCVH 2HH0L 4X9FA 2X2YA 4JRXA 3ULVF 2V5TA 1A5FL 4LASH 4Z18A 4NQEB 4DKFL 3PHOB 1MOEA 3MOAH 3ARGC 4IBLT 3BEWB 4OD1L 1Z9OA 4XVJL 1JZ3A 4JQVC 5BVPH 4NRXA 2BVPA 3MOBL 4WV1B 3UYRH 1LQSR 4PJ8A 2UZXB 4M6ML 2W0FB 3SGDI 4RQQA 5C0BD 3GBLA 3CXDH 3IU3B 4LK4A 3T3PF 3RX8A 3QQ3A 3BKJH 2V7NB 5EOQH 5FUCC 1IJ9A 2LE9A 3QAZB 4O5LL 3WLBA 1ORSB 4HIXL 2ADIA 3O8XA 5FHBH 5DJ0A 4FFWC 5FK9B 3QUMB 2PO6D 3G5VB 4OCYH 4L8CA 5TQ2H 5HBBA 4RGOH 2ESVB 4DZBA 4YFDB 4Y5YA 4OLEA 5HGBA 2XZCL 3LKRB 2N4IA 1E4KC 5IB1B 4JHWL 3Q6GL 2APWA 5ETUB 3QRGL 5K9KB 4YDVA 2P24B 3HNTL 2XPGB 3RFZC 1URLA 4RMUA 2HG5A 3FQWA 4C83B 3AXLB 5E03A 5GGSA 4U3HA 5KVGH 4OQTA 1HXMA 4K9EL 1C5CH 4NQXA 2R23B 3F7QA 1FV1A 2RCSH 2X4QA 1JGLL 5ID1A 2NR6C 1M7DB 1A6VH 1WFTA 3DXAA 1X5KA 1Q9KA 5DRZA 1F58H 4MNQD 3MXWL 4R4BA 3OKKA 1F90H 2HRPH 3GDBA 5BW7C 1ZGLA 3TA3C 3BWUC 4WV1A 1S7RB 2VH5L 1TCRB 3V5DB 4Y4KA 5KG9A 3RDTC 3E3QE 4P46D 4DVBA 3AUVA 1U8OA 2VQ1A 5BV7H 1YMME 3R1GL 2YPLE 4UT7H 3FN0H 1E4WH 1ED3A 4KK8C 4D0DB 4XPTL 4LSTH 4CMMA 2P8MA 3CU1A 1HXYA 5DHYA 1UM6H 4P9HC 3FFDB 4PJAB 3C2AL 3U4BL 3RP1A 3LOWA 3UZVB 2PETA 3MBED 3U7WH 3QUYB 4UV4L 3KLAB 3A6BH 6FABH 1VKXB 3D39B 5IVZA 3L3DB 3B8YA 5BXFB 4WJ5B 1JF5A 3WIHL 4KZEH 4ZUSA 2UYLB 4NQXB 2IMMA 3LEYH 5DUMH 1L0QA 2JJTC 4PJIA 3M8OH 2Q6WB 4LOUC 3KDMB 3QG7H 5IQ7L 4NM4H 5DJ6B 3STBA 3EUUA 1S7XB 3IJSA 3SDXB 3E0GA 3QDJA 4FQLH 4GAJH 4PJ5B 2DQDH 3BDBA 4XCNB 4PG2C 3F7YA 1DP0A 1N8ZA 4KUCD 1MVFA 1KG0B 4FZ8L 3WNOA 4WO4C 2F54E 4KKNA 4FQCH 3D25B 4IOFC 3HFMH 1S9XA 3FAWA 1MNUL 2ZCLL 1E28B 5IFHL 2VZSA 3CFKA 1SHMA 3K8KA 2E7HA 3EYFA 4GRMB 4P2RD 4FQHA 5T5NG 3PWUA 3TBVA 2JCCE 5C0JB 2XICA 3UJJH 4K3EL 3VXQA 4OD3H 1UZ6E 3VXTB 3GBML 5EU7C 1HINL 2EDXA 3VFUA 5F72S 3T2OA 2OR9H 1S9VA 2OMBA 4PLNC 2OQJA 2AABL 3LSOB 1IGFL 5E5UB 1A1OB 3QB7C 1T83A 1V7ML 3QUZC 4JGUA 5JIKA 3IDJB 1CICB 3BKCH 3OR6B 1PX3A 1VPOH 1Y6NR 3WNKA 1L9NA 5C0IA 1UKSA 4U1JB 3QFJB 1LVEA 5SWZE 3TNMA 4LPYA 1Q1JH 1XF1A 4OIIL 3SDXA 2NY6C 1EPFA 3VFGH 2BSTA 4LCYB 4TSCH 1QACA 4G43B 1NGZB 5JXAL 1XGUA 4H26A 1EZVY 4MD5A 1EH9A 1E4JA 3FONA 3HNVH 3KPNA 4LMQE 4PS4L 1IAKA 5GRVK 3MRFB 1ZHKA 1NBYA 1RZKL 5F9DC 3KVQA 3B8SA 3LS5H 4I18C 4TVPE 1AGEA 1QLRA 3P30L 3MC0A 1B4JL 4BZ1H 3TLRA 3CDYA 3ULUD 3L3KA 1LE5A 4N5EC 3PNWB 2NW3A 1N0XL 4OGAC 1T6WA 3QEQD 4AK1A 2HN7B 4N1EA 3WUZA 4RFEB 3KJ6H 3QXAB 2R4RL 1EA9C 4I18A 4NNYA 5FHAH 4NKOB 2CRIA 4HWUA 4G3YL 4QRSA 4W4NA 3OXRA 3ARVA 1CICA 4K8RH 2DWEB 1BD2E 4G42A 1HHHA 2I24N 5GZND 2BHZA 5GGQL 2O5XH 5DC0A 1MIMH 1CICC 2QHLA 4F9PC 5E70A 2CLZA 2EE9A 3I3BA 1H3XA 4EXPX 2VLME 4NP4H 1A6ZA 4PGDA 2VZUA 2F74B 2CRMA 5FO9B 5CJOL 3BPCB 4ZPTB 1JGEB 1MHPH 2JF1A 2LVCA 5LG1A 3O6ML 2NY6B 2VABA 1PKQE 4GAYB 5IB4B 3MV9B 4EVNB 2YXFA 4JFEA 4DW2L 4XXDB 2NY4C 1A2YB 1WEJL 4YHNA 2IBZY 4WW1B 2VB5A 4LHQB 5EB9A 3ETBF 1RFDL 3S88H 4LNRB 1QEWB 4NQEE 4P3DB 1F42A 1KC5L 1OPGL 4N5ED 4HV8B 4MXVF 1V7NL 5K9OA 3ARGA 3SCMA 4QHKI 5L88H 3ZTJH 4PJCF 5IM7B 2RBLA 2K7QA 5IVXE 1SQ2N 3TA3D 1R3HB 3DRTA 4EQ3A 2DI8A 5F7DB 1D9KB 3MTRA 3GI9L 4HUUB 5J06A 1I1AC 1IAIH 3GHEL 4W6YB 2E9WA 4P46A 3THML 1MCWM 4EUPA 4X0KA 1S7WB 2D4DA 5BO1L 4OIAA 3U2SA 3X13B 3RJDA 4DKAA 2IPUG 3BPNC 1FNSL 2I9TA 4QXGL 4R4ND 4XNQB 5CINL 3MGTB 4HS8H 3BP6B 3SKJL 1TIUA 1ZVHA 3DO7B 1X5HA 4XVUD 1CL7H 4OLUH 5I66B 2R4SH 1HYSC 1YC7A 4O02L 2QQNH 1KEML 2GJZA 5I8OL 5JOFA 4YHML 4JFFB 2OP4L 2ZSVA 3GGWA 2V2TB 4X8JA 3TEUA 2D7OA 3MFFA 3QDGE 3VFNB 2DIBA 1QVOB 3GO1H 4GKSB 4JFED 4WHTA 2F8XC 1W2KT 4P3DA 4DUWA 4JRXB 1P9MA 4PJEA 3ZT6A 2VUYA 3BVNA 4NCDA 3GMPA 5AG9A 1OVZA 4OF0A 4A2MA 1T20B 3MA7B 3EYQD 4Y8DC 3VI4E 4ALAH 1BZ9A 3KLHD 1KIPB 5HGAA 3MLRH 5JW4N 5HPMA 3AU1B 1QSFB 2B4CL 4ZUUA 1TTUA 5HHQA 2D7NA 4PP1D 1H3UA 2DQGH 3NACH 1QBLL 1H3TA 1ZSDA 3FT3A 3G5VA 4MJ2A 1K5NB 5FYKH 1EEZB 1FH5L 5DR5H 4ZTOL 1SBSH 4YWGH 2EE2A 1JP5A 3MRHB 4KDTC 5E6IC 5IB3A 5J9PB 5GGRY 3W0WA 2LAAA 2X5PA 3B3IB 3WFEH 5ICYA 2BDNH 4XPBL 2BVQB 5JORA 3C5ZB 3P3YA 3O3BA 1JUFA 4Q6YA 1G9NC 3V0VA 5LJYH 2XZAH 2I9LA 3VW3H 3PHOA 1K9TA 3MCLL 1J1XH 3ROOB 1SJEA 4TN9A 1L0YA 2I27N 4GRLD 2AV1A 4QTIH 4HX1B 1DFBH 4XPAH 3G5ZB 9CGTA 4MHHI 3W5NA 1TQBB 3SDDC 4ZO8A 2HKFL 3TF7C 4HMCA 3QDGA 4WWID 1T20A 4Z0XB 1J5OL 1TCRA 1U36A 4PYHA 5D72L 5CUSH 4XBGB 4YBLC 1NAKL 3AU1A 2I5YL 3NZHH 4LAJH 3I6GB 4TQEH 2NX5D 1KJVA 1I3VA 1KIRA 3FQUA 3V2AR 4X4YA 2Z9TA 2WV3A 4FQQB 5F6IB 2R8SL 1NEUA 1NBVL 2YK1H 3TFKC 4Y5YB 3IB4A 2FATH 3C09B 4MAUH 3JUZA 4R90L 3HAEH 1YEEL 1EEZA 1YYMH 3ROLA 5HI4D 2VL5B 4F8QA 4GW4A 2CKBH 3QUML 5E2VH 4MJ4A 4ZUVA 3MRQA 4WTZA 4N0FA 4WNQB 2V6HA 4OJFH 1CGYA 1FYTA 1LEGA 1EHAA 2ADFH 5JDJA 3HC3H 2BVQA 2P5WA 4F57L 5IJVB 4POZC 4CMHB 1A02N 1RV6X 2IQ9H 2EDNA 2IAMC 4YNYB 5TE4L 2APTA 1VSCA 4OCLC 1CR9L 4AT6B 3EJJX 1ZEAH 1G7PA 2C3VA 4Z7VA 1F4AA 5C7XH 5D7IB 4MA8H 3EDDA 1IMHC 3DX7B 2EDQA 3W0WE 3CVHA 1ZGLB 5EZLA 2YPLB 3MUGA 2DLTA 2E7BA 3R4DA 3SDAA 3PHQB 4PRAA 3NCEB 1KCKA 1JPGA 4HT1H 2AJSH 2DYPD 4XMKL 5KVEH 4OCSH 5KANI 5BS0A 3BRGC 4GKNA 3FO9A 4K23L 25C8L 4LPXA 5HI4C 4Y5XA 4UOW0 1INDL 4OGZA 4P2RB 4M7ZB 5DQ9B 1AI1H 1PJ9A 5EO1B 5M7QA 3EHBD 1N2RB 3CCHB 1YQ2A 1FIGL 4QWWC 1I9IL 4FQQA 1DLFH 5DGQA 3VWJB 3R8BB 1YNLL 3W5MA 4AIXA 2N1KA 4P59H 7CGTA 1I3UA 4EZMA 1FDLL 3ZLQC 4L8BB 4F33B 1VEMA 2KQNA 5B39B 1HKLH 3NCJH 2MPAH 4PRHA 1HQRA 5E1AA 5E8PB 3P9MA 2OQJB 1O7SA 2ICWB 2WBJB 4NQDB 3MCKB 3DLQR 4YO0B 2QV2A 3BIKA 4P5TC 3MNVA 3U0TB 1FFQA 5HHPB 1JWUA 4OZIE 4X99A 5TE6L 4YDKH 4U1KA 4LRIC 4HCRA 1K8IA 4XT1C 1CK0H 5I1KH 3QWOB 4DJMA 2P8PA 3MJ9L 4G6JH 1J8KA 1ORSA 4DWHA 3CH1B 1WZKA 1BX2B 1FBIH 1X5YA 4BUGA 1IKFH 3WHE0 4Z7VF 1FGNH 3OQ3B 1HZHH 3PGFH 4M6NH 4Y4FC 1CT8A 1J18A 3MRFA 5I17A 5IHUL 5DLMH 5C92A 3L7EA 1MRCH 1QSEE 3GBNL 3P0YH 5T3XD 1OOAA 5HDQL 3PXHA 4IJ3B 3NZ8B 2Z92B 2BNQB 2XPGA 2OZ4L 3TA3B 3P11L 3NIDF 2VAAA 4UMGA 1BGXL 3IAGC 4HJ0D 5I75B 5BV7B 1T3FA 4J12A 4JO1L 3G04A 3WS6C 4NQCB 4KH2A 4UQ3A 1A4KA 1TVBB 3L5XL 1PSKL 4HKBA 5DUPH 3MJ9A 1XIWA 4PJ7E 4AEHH 4IS6B 5F89A 4M5YH 4QHNB 4HCRL 5C0RL 3SKNB 4LU5L 4ZXBA 4YHLL 5GJSH 1QUNA 3OXRB 1IL1B 3FFCE 4X7EC 1VCAA 2EDDA 2CGRH 1NMBL 4ZO6A 5GGRB 2X41A 4X7DC 3QUXA 3OR7A 2VDLL 5CIPB 2VN7A 3R06B 1BBJB 4DEPC 4H25B 3VGFA 1RZJL 5KVFH 1EK3A 4JFZH 4YUEL 3LQZB 4DZBB 2KPNA 1HSAB 1ORQA 5HPOA 5JHDD 1MIEL 1CT8B 1FFRA 4RMQA 5GZOD 4XPGL 1HSBA 4LLDA 3HCVA 4XNYH 5IGXH 4ZTPL 4ODSH 1QNZH 1NGXA 3UBXA 3NZ8A 4MDJA 1Q0XL 2FJFB 4NO0D 1QEWA 3QULB 3V7AE 5KN5A 4PRID 3KPQB 3ARGB 4WTXA 1S7UB 2O5ZH 3K74B 5KAQF 1M7IB 3IDMA 4RZCB 1QFUH 5J6GA 1YMHB 3NA9L 1R5VB 5E8DH 2QR0A 1DEDA 4HK3N 4U3CA 3SDCD 1RUPL 3T0VA 2O61B 1QZ1A 1UQSA 2QADB 3ULUH 5FYKD 1KCLA 4MGXA 1VGEH 4OLYH 4PGDB 1A6ZB 4YXKH 3UZEA 4WI6A 2VL4A 2MCPL 1BZ7B 1R5IB 5MP6L 2Q8BH 4I3SL 3IFOA 4KROB 4LCIL 5DF0A 2PO6A 4LVEA 4U6XA 3HI5L 1NFIA 2A6JB 3BHBB 1F4WH 3MGAA 2ADGA 4MSWB 1GJIA 3RWIA 1NFDB 3MZTA 2R15A 5DD5L 4L5FL 1AO7E 1ZWIB 1DEEB 4JREC 2MWCA 1RD6A 1YEJH 2XN9B 5J11B 3B9DA 4YXHL 4JFFE 4HFUL 1V3JA 4KVNH 1OGAE 2J8UE 4WU7B 2D7MA 4AENA 43C9B 5DJ2A 1ZAGA 4UILH 3C08L 1FZOA 1YPZA 3BEVA 1OW0C 2JJWA 4K3DH 4XP1H 4NJ9L 5HHNB 3TVMA 3ZDXF 3GK8H 3VXRD 5D7LB 4KKAC 3SY0B 2I07A 3T1WA 5DJ8B 3K0WA 3O6FA 1CBVL 5EOQL 3RBGA 2DQEH 4BSWB 2HTKD 2MJWA 4RGOL 2HA1A 5EBWA 1MRDH 4ZUUB 1G9MC 1YN7A 1R0AH 5CBEB 2QADC 5F3HB 3ARTA 4HJ0C 4I3RL 2BERA 4HHAB 4PRNA 5IHLB 2ORBH 3PWUB 5F6HI 3B2UC 5I16A 1MEXL 3KPPB 5D2NC 4PUBH 2OL3L 3QXWA 4LGSB 2GYSA 2H9GA 5D5MA 5D7SH 2ZUWA 2X4RB 4LCWA 3RA7L 4YXLH 5ID0B 4U1MB 4TYUA 4E42B 1T89C 1NSNL 4TUKL 3GGWB 5GJTL 1OAZL 4YDJB 1AFVH 4G5ZH 4PGEB 4YX2L 4K07A 3EDJA 1NBZB 3TJHD 3SOBH 5TQ0L 4IHOB 1J05A 2NY1D 1DDHA 2DQTH 2R0WH 2X1XR 2W59A 2FO4B 3GMQA 3L3JB 5DJ2B 3HI6L 2F58H 1RZJC 5FKPB 3QUZD 2RIKA 3MSPA 4PRHD 2Z8RA 3ZMRA 1VFMA 2W9DH 5IROC 2UWEA 3GJFK 4LSVH 1X5JA 4X6DB 2DOCA 3BH9A 3QI9D 1F4XL 1LO2H 4KJPC 5JXEC 1KBGH 3C9NB 1EAPB 1X7QB 4DVRL 2UV3A 1XGUB 3F12A 3SGEH 3MLZH 5F9WC 4ERSL 5D1ZA 5FYJH 4LGPB 4NWTL 4QGTA 4KQ4H 4LSQL 2VABB 4GAYA 1PFCA 1TENA 3ZE1E 5KTEH 1K5NA 4YDIH 2CUIA 2MTPA 4U1NB 3S3JA 5HTSA 5BQ7A 1BFSA 6FABL 4LLVB 4WW1A 4S1DD 2GFBB 4P57A 4ONHA 4YLQT 3WFDL 4QRRE 4G6AC 3PL6C 1T66C 1I4FA 5HVWA 3KPOB 1KJ3H 1WSST 4QTHA 1R3IH 4W4OC 4MNQB 1MCJA 4GMTL 3DX8B 1GL4B 4WHYH 1MFCH 1B4RA 1HDMB 4I1NB 3RQ3A 1OL0A 3ARWA 1T2QH 1G7HB 5D2LA 5EOTB 2FO4A 3GMQB 5F97E 5ITFA 3L95B 3HG1E 3REVB 5DJYB 4PV9A 5F7HA 1IAOA 2YA1A 4ZO7A 4NDMB 1AXTH 4FQ1H 5C0BA 4N8VA 5TJWK 3X14A 3CZFB 1UZ8B 3GIZH 1ZGLP 1RPQA 4O58L 2DI9A 1GSMA 1P1ZA 3GRWA 3SDAB 1A6TB 4YHIA 3VXME 5JNYA 4MJIA 1FZJA 3HHRB 3MA9H 3T1FB 4F7EB 2OCFD 3FO9B 1B2WL 2FECL 3QYCA 4Z7OF 4G6ML 1YEIH 3QXTA 2OJEB 4JZOA 4L3EE 3SQBA 2R9HC 5IV2A 4MQTB 1U92A 1R3KA 3X3FL 4U31A 3RWEA 4N0CD 5CSZA 3V5KA 3MXVL 2APBA 2ZZUT 2IC2A 2J6EH 2VDOH 4G7YH 1CDUA 4BQCA 4UQ2A 3N50A 5D7LE 2I26N 1KT2B 4FS0A 5FECB 3NAAL 3VI3E 2OK0H 1MCOL 5C0CA 1D5IL 5EOCL 4PB9L 3O3DA 4NQDD 1F2XK 2HYMA 3O4LD 1OP5H 4YC2C 1CXEA 2V5YA 4MX7A 1AR2A 1JCKA 4NOFA 2HKHL 1PQZB 4DGVL 5BJTB 3GB7A 3GMPB 4HUXB 3RGVB 2HTKC 1LDSA 2QEJA 3WO3B 1Q72H 4OM0H 1QSEA 1TMCB 4PJFF 1IAOB 3LB6C 1NH6A 3VXUE 4RWYL 3X13A 3U2SB 3EFFA 5ERWB 4UTAL 1RU9H 4G6KH 4Q0XH 3T3ME 1FVEB 4EEEA 2NLJB 3FB5A 4QHUB 4BKLB 1MF2L 3ZDXE 1CLYH 4OF5A 3OX8A 1TNNA 2EICA 1CYGA 3AREC 5HYQB 3MRJA 2ADJA 3AY4C 4P23D 3CFIC 4PJDF 4Y4FA 3W39B 1CGVA 4POZD 4RMVA 2ARJB 3CPLB 4J8RA 1N0XH 3O2VL 4Q58C 4OZGA 4GSDL 5MEQB 2YA2A 1YDPB 4U1LB 4XHJD 1MQKH 5E7FA 3RWCB 5KSAD 4YAQB 1RHFA 3LQAC 3PIQB 2BRQA 4YBLB 1FRGL 2GSGA 3VXSE 3ZHLA 2W9EL 4QY8B 1YEDA 3ARGD 2GEEA 2G5BA 5FO7B 3ZYIA 3WJJA 4KKCC 4OCXL 3VFOA 2CUHA 3QXDA 3MRGA 3QFJE 4NQSA 2EO9A 1A6AB 2KKQA 2R2HA 2CKBA 3WN5A 4D94A 1IGTB 1YEFH 5I8EA 5GGRA 1MHPL 3VD5A 2Y5TA 5KSAC 1QP1A 3O6FD 3BQUD 4ZPVA 4CAGA 4EBQH 3JWNC 4Z95H 3RNKA 4ISVB 4JQIL 2MCG1 2GW5A 5D96B 5EUOB 1Z3GH 1KJVB 2PXYB 3RAJL 4NUGL 4LSRH 5CJ5A 1NANI 3IFLL 1NFKA 1CCZA 5IJKA 2YSSA 5BRZE 3RNQA 3MJ8B 1UCTA 1D5ZA 1GHFH 1UA6H 1LO0H 1EHLH 2PYED 4ORGB 5IMMA 1I75A 2ERJC 4NN6B 1FORL 5FUOH 1YDPA 1U3HA 4TPRH 1RAMA 3VG9C 3IRZA 1MCSA 5FIEA 5FKAB 2CXKA 1JHKL 1G1YA 3KPQA 1KCRH 1F4YH 1NCBH 1RJCA 2O5YH 2Y6SC 3SQOH 4G9FD 2W60A 1NJ9A 3THMH 3SDDA 2YUWA 4FABH 2YD4A 2R56L 3WYRA 3DX7A 3N85L 3FQRA 4Z7QE 1TJGL 1AXSA 5SWSD 3MR9A 4R3SB 3STLA 5HYFA 4JO3L 5DJXA 3QIWA 1P53A 2A73A 1DQJA 3FO0H 1DQLL 5SX5K 5ILTH 3QQNA 4H0IA 3CFBA 4PJ7B 1OSZB 1T66D 1HH6B 3RZCA 4PD4K 5I1IH 1EMTL 3QQ3B 3HPLB 4EI5B 1KCSH 4NN7B 2VC2H 4HK3J 3ULVD 3EYVA 5FK9A 4S1DC 4J6RL 4D0DA 3BPOC 3F65A 5DD3L 4OGAD 2OP4H 3RUGB 3SBWA 5DRNA 2VE6B 3VXNA 2MHAA 2F15A 3C5JB 5CLTA 4OQTL 1AQDB 5I1HL 4ZUVB 3HR6A 1K8DA 1JN6B 5CGTA 1A6UL 1OARH 1D5ZB 4JPVH 3T2PA 3TJEL 5E56A 4YDVB 3QUYA 5CJBA 4FFYH 4KKAD 1SJHA 4ENEC 3NCBB 2RJMA 4HDIB 3UBXG 3QEUB 5GRZA 4MA3A 2IPKB 5T5NF 3RU8L 5MEOB 2B1HL 4KTYA 1M7DA 5D7IF 3CK0H 1BFVL 1BJMA 5C0CD 4KUZH 3SDDB 2WBWB 5BOZG 1WITA 3RGHA 32C2A 3QIBB 1LO5A 1RK1A 5IEKB 4QRUA 4MB5A 4OZIB 1Z5LA 5DK2B 4R3SA 4XX1G 3PJSA 1J0HA 3WIIH 3LH2L 2ZCKH 3MYJB 4HGMA 2IPTH 4PJ5A 1WBXA 2WM0A 2XNAB 4OM1L 4XNXL 5D70H 2A6DB 1K3IA 2WP3T 1KB5L 1FH5H 5DR5L 3LKNA 4HULB 4Y88A 5CLWA 5DFVD 4ZOBA 5KZCB 3T4AA 2HVKB 2NY5H 5IHZB 3O41A 1ZHNA 2LFGA 1U2CA 1FPTH 5C2UB 3WKML 1NUNB 3Q0HA 4YH6A 4AY0A 1I7TB 4WI4A 5DRNB 3OG4B 5I1CL 4H5SA 4F3FB 3IDUA 3DYPA 3KLAA 2IFFL 3MCLH 4GJTB 2R1YA 2DL9A 1MJ8H 4WHCA 3SPVA 4KV5E 5IESH 4R0LC 4YZFF 4WRLA 1NMAH 5IFJA 3RWJB 2DKMA 1AP2A 4ZOCA 1WICA 4PJIB 3BD5A 4TVSa 4U1KB 5GS0H 2LAGB 3HRZA 3NZHL 3GSOA 3BJ91 2HH0H 4PFEA 4QRRA 2PKDA 1KYOK 1BEYH 4S2SB 1N8ZB 4PJ8D 4LRIA 1L7IL 3MO1A 1HILB 5HHVH 1EEYB 3JSSA 1YMMA 1VFBA 5I17B 4H0GA 1CVRA 2ZSWB 4LLQB 3RRQA 3GSUB 2HFEA 3QUMH 1CXFA 3VFVB 4OZGF 5CJXA 3PWNA 1FYTD 4OAWB 2FR4A 3QUKB 4HXBL 3EO1B 5IHZA 2VKWA 2WLYA 3NPSC 4IDJL 3VFWB 1ZS8A 1BHGA 3GSNA 4ETQA 4PGEA 5JO5A 2P5ED 2OSLA 3LKSB 1C12B 3G04B 3VWKB 1B0GA 1RUKL 4POUB 1G9NL 1EJOL 3OXSA 2WBJC 1WGOA 3PF2A 3WFBL 1OTUC 2YWZA 1S9WA 3L5HA 1A21A 5F93C 3B2VL 2XKSA 4JQXA 4YQXL 1SY6L 3I9GH 4LIQL 4TUOA 4LAQL 5HVGB 3JV0A 2IALB 4Y5VA 3BH9B 1VFAA 4PJGF 4FG6C 2NY2D 4I48B 3GZKA 5HY9A 1QRKA 4NZTL 4YE4L 1AI1L 3MMEB 3O81A 4L4TA 3W11C 5D4QA 1YEKH 5CP3H 5KAQG 5TE7H 4C59B 4UINH 4EKXA 1MCDA 1CLZL 1YA5A 3D18B 1MJ7H 3MV9E 2FX8L 2Y7QB 1GZPB 1UJ3A 4LLMB 1FDLH 2ZSWA 4WUUD 1HSBB 4F8TA 2KZ1B 1ZWIA 4BK4A 2MPAL 4OAWA 2NXYD 5EG6C 1CFQB 3RI5F 2FR4B 3RWEB 3DV6A 3L3KB 5A1AA 1QBBA 2XN9A 1J87A 5B21A 1MCPH 3OAZH 4K94H 2AJ3A 1DVFA 5E9DA 5E6YA 5DSCB 2H2PC 4JZJA 2VDKL 4MNQE 3GJFA 4NO3B 4BH7B 1FLTX 4WFGD 5F88B 1RURH 1AKJA 3IJYB 4TNVK 2EECA 5HDBF 1CDJA 4KDTA 4D3CL 5I1GL 3RL2A 5DJ8A 5DJYA 4HUXA 1JFQL 3MNWA 4RRPA 1UXSB 4HK0A 1LO3L 3SO5A 4XCFL 5EO9A 4PY8J 4WFHE 1HHHB 2MOVA 5GS0D 1DJSA 5DUML 1I9RH 2NLJA 4Q6IC 4RDQG 3VXSA 5IQ7H 1XCQB 4NPYB 2EE3A 3RWFB 4G8EB 4QRPA 4KC3B 4NKIH 3H9SD 1NMCC 3KPPA 1ZVSA 4JO2L 1U92B 4PGZA 5I66A 4FP8H 4GO6B 3BRFA 1CFTA 5C07E 2WW8A 3KPSD 4WDIB 2EKJA 2QSCL 5ABDE 3PDOB 1CE1L 2XG4A 3KYNA 1I7UB 4JM2F 3NIFE 4GW5B 4LKXB 2VMFA 1N59A 4LPUA 4WHYG 3NFSL 1I1RA 1IM9B 1UKTA 1KYOJ 2YUVA 5DO2C 3MGOA 1A0QL 3ZE0F 2HLFC 2N7AA 1DQDL 3PDDA 2UUDK 4LDOB 5GRVL 4MA1B 1I85A 4P3CL 4OTXH 3LCYA 1WWAX 1MJJA 4J3XA 4P46B 1BD2A 4DGYH 3IDYB 3FB7B 1A9BB 4R2GD 3RY5A 3RDTA 2DQJL 3QEGL 1E4XL 1BP3B 2Z8SA 3BP6A 4JE4B 2JIXB 4PJ9D 3MX0A 1ES0A 2H9GB 3NCCB 5D5MB 1Q1JL 2ARJA 1F6FB 1BREA 3QUYD 5ADOL 3KYMB 3U9PH 2F54B 3P73A 5MEPB 3SE4A 1P4LB 1PBYA 1H15A 4L3CB 1CD8A 4MNGB 2EXYD 5DD0L 1JGUH 4WDIA 1QVOA 4FXGA 4NQEA 1HH9B 1JUFB 15C8H 5EIQA 5C6TH 2EC8A 1B4JH 3PQYE 4BZ1L 3NIGF 2D0GA 1MLCB 3NFNA 4GLRI 3RTQB 3KLDA 4P5TD 3GUTB 5AAWA 1IM9A 1MFBH 4PV9B 1FE8L 2EXWD 5FF6A 1BJ1H 1XGPA 2G75B 1S7RA 3F58L 4BFIB 4AZ8A 3BDYH 1AGBB 2AXFA 1TDQA 5FGCB 3D39E 2HFFB 3BGMB 1XT5A 4ZDHA 3O45A 3FB7A 4F7EA 3VMPA 1Y0LA 4PJHA 5HHQB 4CKVX 1CG9A 1XGTA 1U8HA 4K8RL 3GMLA 1ZLSL 1KPRA 4PP2A 3DURA 3PL6D 5EO0A 1FL5A 4HUVA 3I6LD 1W72B 5SWZB 4AIZB 5FOBB 3UDWA 4C56E 3LZFH 1MFDH 3FN9A 4HBQA 2XN9D 3MNZA 3KPSA 1RJZB 5I1EL 2B39A 2VLRE 2Z35A 4KU1A 5TF0A 1XR8B 3ES6A 1GIGH 2P7TB 2XQYG 1FYTB 2HJFA 1A7QH 1AGCB 1XIWD 35C8L 5D7LD 1HH9A 5D8JH 4JDZA 5DMKA 5ENWB 4OUUA 1L6ZA 1MI5B 3QFDA 4JFHE 1K6QH 3BN9C 5IFAH 3GUTA 2NY1C 3DOSA 1IC4L 3BAEL 1OPGH 4ONOA 3EFFB 5AWNH 3MJ7A 1ETZB 2A1WL 3ZKNC 4EDWH 1SM3L 2IADA 5FGCE 1U8PB 2ORBL 3JV5A 3D0VA 1WCBB 4ZFZB 1WBXB 4GRWB 3QJFA 4HPOL 2ZKHL 2EC9U 4TUJA 5E94B 1HHKA 3PQYA 4U4BA 5KZCD 5DC4B 3GI9H 5LGJB 2YRZA 5ESAB 3SGKC 5C0EB 1HXYB 1E0OB 4HAFA 1UWEH 4NFDA 3OKOA 3GMLB 2ZNXA 4TUKH 2VLJE 1OAZH 3LKQA 1J12A 2E7CA 2M26A 1UZ6F 3TIEB 5EU3A 4JB9L 4M4RA 3D39A 1LDPL 1M6OB 2ZUYA 5FOBA 5IK3B 2G5RA 3FAXA 2R69H 3CIQA 1CL7L 5H37G 3RY6C 4OLUL 4UB0H 3X3GL 5HHOB 1DBJL 1NGQL 5ITBH 1D5XB 2YD5A 4FFVC 1VGKA 4LLAA 5E1AB 5E8PA 4Y4HC 1KEMH 3IDJA 1JRHH 1Z6JT 4HPYH 5BMFH 1HWHB 3HAEB 2A77L 4ZQKB 1EX0A 4P9HL 4RQQB 3HI1B 1C5DB 5IVOA 3CLFH 4Z77A 3QNXB 4XBEH 5JIPA 3QIUA 1JI1A 5E8EB 5EU5B 5KSUA 4YHZL 2A9ML 1MAKA 3H9HA 4L8CB 5E6ID 3MPCA 4L29B 5IWLA 4I2XA 4FMFA 1NLBL 1YMMB 5BVJA 3LIZH 4OLZH 3CPLA 5DWUH 3ZE1F 3QNYB 1WWBX 3QQ4B 4HH9A 1J88A 2ITCA 2DQUL 1DSFH 3V52L 5F1OB 3BD3A 5BZDA 2QHRH 5JW4M 4F33A 3RWGA 3VWKA 4YC2B 4RMWA 4A6YA 4HSQA 1IGYA 4OSUL 3W2DH 2VLJA 2ICWA 2APXA 1NJ9B 4NKOA 5IFJB 4LPTA 3C87A 1VGKB 3FQRB 5CEXA 5HI5D 5C0IB 3HPJB 2R0KL 3MNVB 5DD1L 1X5XA 4U1JA 2DWEA 5KOMC 1AHWB 2F5BL 5KBNC 1RQ5A 5KG9B 3AROA 3L3OB 4LCCA 2PW2B 4QRRD 1X4XA 1P4BH 1NGZA 1PYWA 1QHPA 5HD8C 1DQQA 3BZFA 4QTIL 3H9SA 4LSPH 4XPAL 4XCYB 2DJUA 5KSUB 1YY9C 1M1SA 1NPUA 3JV4B 3MRIA 2HKFH 4OUOA 2YUZA 2NQCA 3RUGA 2YRPA 1VEPA 4ODVL 3FRPG 3I75A 1H0DB 2DL2A 3VGEA 1TNMA 2PR4H 1NCDH 1QFPA 2NXYB 5FM5O 3ZKND 1JYVA 1K8DB 4XNUL 2I5YH 3PP4H 5C0AA 2EZ0C 1CFQA 1P6AB 4LLDB 3U9UB 2EYRA 4D9RE 2VERN 4JCLA 4ZUSB 3TT3H 2QQQA 5H2BB 3QXAA 1NEZB 1JTTA 4KJQD 3ULSB 4MAUL 3QULA 1DVFC 4Y1AD 5F7KC 5I74B 3WSQH 5MI0C 1ZT7B 5L2KA 4O2EA 2H45A 4J1UA 5F88A 3S37L 2CKBL 3O9WC 5D1ZD 5ESQA 2CIIA 2XWJB 4GUPB 5B4MD 1GXEA 3KPRD 3DVGB 3O9WA 3QDJE 4OZIA 3WJJC 4NQVA 5J3HC 4YFLF 4S1RH 3RVVC 3GHBL 4FQXC 5I8CA 5FCUL 4ZOAA 1JZ4A 1KNOB 2AKRB 5D96C 3BE1H 1H5BA 2LV4A 4XNZB 3D9AH 3QEHA 1OY3B 4X7FC 1FLRL 4NUJB 3L3IA 4K7PH 2M1KA 1YN6A 5GHWH 5L7XH 2P4AB 3C5ZC 4PJ9B 5J1AA 1KB5B 1HEZA 2SEBA 3HNTH 3IDXL 1RMFL 2YKLH 3VXQB 4LFHD 4HZAA 2A6JA 3BHBA 4MSWA 4KI5E 4HT1L 4NZUL 4OFKA 4ONFL 1K4CA 2W9EH 3OAYH 2F53B 3GSVA 1EXUA 5DO2D 3VFNA 1NKRA 1HCVA 5KS9E 4JFOA 3BW9A 4R4FL 1ADQA 3NABL 1A3RL 2VXUH 4D0CB 3IXTA 4KI5C 3IJYA 1AKJB 2B5IC 3IT8D 2MQ0A 3BVNB 1OGTB 5E99L 3QO0A 4MMZC 1LE9B 3TBTB 5MERA 1IILE 1R5VA 1LP9F 4GXUM 4JQIH 1AE6L 1HKFA 4NIKB 3GSWA 1A7BA 3FN0L 5CHNB 2ZWLT 5F6IC 3GSNH 3O9WB 4BQBA 4OZHA 2VZTA 5D7JC 1CDCA 4YJZL 2VLKD 4NUGH 3C09C 1LMKA 1T22B 5F9JA 3F7PC 5DURB 2DM7A 2CRZA 5KANG 4NN7C 1UM6L 1WTLA 3OKMB 3DO7A 3JXAA 1CDBA 1AC6A 1GHFL 3NCMA 4XC3L 4XI5D 4MB3A 1ZVSB 4O4YL 2JIXA 4JFQB 5DTFA 2FNBA 3PV6B 5MHSD 1MQ8A 4G6AD 4W4OA 5FYKU 1V3MA 2VDPL 4YIQB 5GRYA 2CXGA 1ZT1B 2DLFL 1OD9A 4P4KB 2P48B 3DETC 5HGDB 1K2DA 2HLFD 3WIHH 5KVDH 2ZUQB 4E42A 4RAUA 4WO4D 2O5YL 3ECBA 4IRJC 3JV6A 4U1GB 5LCVL 4FQXA 1G7MA 3M8OL 5B3JE 3N85H 1PEWA 3QG7L 1TJGH 3C6LC 3RWJA 3QHFH 2XFXA 2EYSA 2VZ3A 2CK0H 2F53E 1QRNA 2AJUH 4JHAL 4FQCL 1EMTH 5T1DH 2NYYD 4JO1H 2WQRA 4KI5F 3OJMB 2ZCLH 5GS1A 1BFTA 4BSWA 4XMPH 4DQOH 3QHTC 5DUPL 4X98B 2VDQL 1JYXA 1GGBH 4M03A 3C6LD 5D7KE 2R2CA 2BXYA 2GJJA 2Y7QA 5IMOB 2D7QA 1JPSH 3INUL 2QTEA 2DM4A 4IRJD 3MRHA 3V6OA 3FL7A 5GRJL 2DBLL 3WN5C 3G5YB 1J1PL 3OJ2C 3FQXA 3UJTH 1PX4A 4Z0BL 3WV0A 2B1HH 5T1KB 2BY0A 4LQ1A 4P2QB 2Z35B 4YR6A 4F2MA 1N5YH 1FZMA 1OHQA 1VEOA 2BNRB 4XWGL 3QEQE 5HHOD 2COQA 1SEQH 2VZ1A 2HJFB 3O0RH 3ROOA 5IM7A 3JVGC 3VRJA 5JOEA 3RTQA 4MS8D 3EJZD 5FKPA 1A3QA 1HHJB 3VXRB 4XP9H 4ZUWB 1CGUA 1JL8A 1G7HA 1RUAH 3N1MC 3ZDYE 1ZHLA 1FVDB 1H3WM 4JCMA 3QQ9D 4EUPB 4NC0B 3UROR 3A0OA 4ZNCD 4QOKA 1O7VA 4X5LA 3VGGA 1MCBA 3IS0X 3CVIH 3GNMH 1EAPA 3LMJH 3ULUF 3LVEA 1QFUL 5CEZL 3N1QC 4DN3L 3HC4L 1G9ML 4NNPL 1QRNE 3VXOA 4PJHF 4KV5F 5FAAA 3SGJC 4Z7QF 2XA8H 2NXZB 1KF9B 3CX5J 2IFFH 4ODUA 2VKXA 4JPKL 5EFIB 5AZ2H 4APQD 3FT4B 3VFSA 4OI9A 5EU3B 1UB5A 4X83A 1WJ3A 1F13A 2EYTA 3PABB 3RVWC 4X6CE 5MP6H 2Q8BL 4LCWE 5J1TC 3HS0B 1DBAL 2Y07H 4E9LA 1I8KB 4P46C 4PJXF 4LEOA 2FJHB 3CVHL 2FIKA 3HI5H 3MREB 4BZYA 3PWPE 1F4WL 1AGCA 4XX1E 1T7XA 4F2MB 4B0MM 1Z0NA 5L8KB 3BIBX 1D5XA 3QWQB 5BRZB 4J7RA 2A6KA 3M17B 1OSPL 3BIKB 3RZWA 1T6VN 3CVHB 5FXCH 4L4VB 4FQXD 4KVNL 4NP4L 3SDCC 4X4XB 4HKXB 2VR4A 5CJOH 1KJ2A 2UWEE 4N8VB 2A9NH 2CKNA 3RBSA 4OGXH 2IAMB 5CMAA 3G6JF 2H32A 4J4PC 5KS9F 1OW0A 3O9WD 5DFVC 3G6DL 4ZG1A 3QI9C 1PDKA 5JHDE 2CR6A 4N68A 1CFVL 3LHPL 1WEJH 5ESAA 1OP5K 1HQ4A 3H7LA 3FRUA 4W6WB 4Z78B 1A1NA 1WC7A 1MVUB 2AP2A 3JWDC 2EIZA 3QNYA 4HIHB 3BH8A 5DJAB 5LXGH 4HJJL 2IEPA 5F7FA 1KTDB 3RHWK 3T77A 3CX2A 4P9MH 3KYNB 3PDOA 4PYGA 1U8NB 4L4JA 2BZDA 5KSVB 3TYFA 2VR9A 3RWGB 1OTSD 5EC1B 1MEXH 5T1LB 4PBWD 1SYVA 5SWZD 3QCTH 4QF1A 4WFED 2WUBH 4M1DH 1LEIB 3MREA 2NNAA 1P5UA 3LPWA 1JV5A 1OM3H 1I1YA 4UT9H 4OLWH 1L7TH 4XPFL 5CEXB 4MMXC 5GGTH 3F6LA 3DVFA 5D7KD 2IBGA 4BFIA 1T7ZA 5TQ0H 4QXGH 3FOLB 3QDHA 4LSUL 4NQSB 3GMNA 1LEKA 5C0BE 4LCCB 3HI6H 2R2HB 4QEGA 2R2EA 3QIUB 3FN3A 5HHMD 1MCCA 4PJCE 3VXMA 3ISWA 5C8JA 4U7KA 3ARUA 1XGTB 1U8HB 2BY3A 2VISA 4RISL 5DJ0B 5L2KE 2R9HD 2KBGA 3JV4A 3BRDA 4NO0B 5C09D 2VXTL 2VDNL 2JELH 1ZTXL 5L2JA 3CC5A 1UXWB 3EO0B 3WIFA 2PYFB 3C60B 5T1MA 1IC7H 1ZV5A 3BX7C 1UVQA 1EGJH 3DGCR 2OLDA 2FLRT 2ZUVA 4ZD3H 5JLZB 5MEQA 1T3FB 3M45A 4JN2B 4NBXB 4Y4FD 3ULVL 5I1LB 4R26L 4XTRD 5DRXA 5ICXB 1NC4B 5B39G 3D48R 5I15L 2GK2A 1FV1B 2GCYA 4ZOEA 1NC2B 4CADA 1BJ8A 2HWZH 4JVPA 4MCZB 5T33L 1WK0A 5FKAA 3HG1B 2WUCH 4U0RB 2LU3A 4NBYB 3LRHA 4WUUE 2BOBA 4I0CC 4PRIB 3OAYK 3U4AA 3BZ4A 1P4IL 1JWSB 4CW1B 3S36X 3U30B 5DHXB 1S5HB 2E8ZA 2NY3B 2YUXA 3MLYL 1KJ3L 2APVA 3IU4L 2BY1A 3I02A 3SE3C 2UVEA 2EDLA 2Y1VA 3L3HA 2Y5TB 4XVTL 3D1MC 1T7VA 1Y0LB 3WXVH 3N1PC 2VQ1B 2EH8L 4WGVB 4RMRA 3HUJB 2Q20A 1H5BB 1EEQA 4XNMA 4YDLB 1X5IA 1HH6A 3KPTA 4NRYA 5T3XH 4UOW1 1KV3A 1VADB 3MLWH 4KRNA 4AH2B 2LTQC 5E4EC 1IGIH 4D2NA 4M00A 5ALCL 1BF8A 4JEGB 1DVFD 3DRQA 1A4JB 4FTVB 4PJGA 5E9DD 3PWJB 5EZIH 2W0KA 2VE6A 1WF5A 3KPSB 1FNEB 3K2UH 3C5JA 3DI2B 2Z93B 5A2KH 4X7SH 2X4NB 1RIUL 2HG5B 3EHBC 3FQWB 2P7TA 4J3TA 4PRHE 4JKMA 3TCLB 5J6HB 1YECH 1DBKL 1AY1L 1S7UA 5DK0A 3U46B 4Z7WA 2ICCA 2WBKA 4NT6A 1TPXC 1UG9A 3LN9A 2BSRB 1YMHA 1GAFL 4HG4K 3TIDA 5J89A 3KYAA 4R4BB 3BPLB 4KRPC 2RFXA 3LEVL 4OGYH 3NTCL 2DWDA 5K93A 2DQJH 1UB6B 1TVHA 4HIIA 3V6OC 1DQJB 4KHXL 3CH1A 4A6YL 4OZHB 1BZ7A 5ESVB 4DKFH 3CFBB 4GRWF 1HHKB 3PQYB 4NCC1 5E8EA 5EU5A 4DGVH 5DMIL 5LAXB 3A67L 5IMLB 1RJYB 1F3RB 2C9AA 4HHAA 3PWLA 4JKLA 4XNMB 3MRPB 3L7EB 2Z0BA 3MRMB 3UTQA 1DLHB 2Z91A 4HXAL 4LARH 2BVUA 3PWVA 3WNLA 4FTVA 5E4EB 3Q6FA 4MAYD 4P4KA 1AHWC 2DS4A 2GUOB 4JG0H 2BX5A 5FYJE 1EXUB 5D5ME 2UZIH 1UACH 3N9GL 1PY4A 5GS2H 5I18H 1JF6A 4KDVA 2E6PA 2NZ9C 2YMXH 5EWIL 1S3KL 1IQWH 3SPVB 4YEFA 2FX7L 4NZRL 1U93B 3SKNA 4IIQC 2H26A 3CU7A 4GT7A 1IL1A 2D9CA 3QO0B 2EYSB 4ZQKA 2FYYA 2NY1B 3HI1A 5C07B 5KVGL 2VJXA 2AQ1A 5FDWB 5GSRB 3MJ6A 1KLUA 2VXSH 4LHUG 1S7SB 4L29A 1F58L 3MUY1 1FN4B 1FL3A 5TPWL 4KKLD 3VJ6B 1MFAL 1DLFL 4OV6F 3MO1B 3KYOA 1QOKA 1VACA 3QG6B 1IBGH 5DGRA 2LABA 2QLVB 2BSED 2VH5H 4HH9B 1RZ7L 2RGSA 3D85B 1GIGL 1I7TA 2Q1EA 1RIHH 1HIML 4H5SB 5HHXH 4ZAKA 3U1SH 2GUOA 3WEXB 2OS7A 4FQXB 1CXLA 2OR8A 4LVOC 5DVMA 4AL8H 1KIUA 4DN4H 1LILA 5E0QA 2ID5A 1HDMA 4LRNH 1II4E 3L95A 4V1DA 1OAXL 4HZLB 2DIAA 4G6JL 2XTLA 2ATKA 3K46A 1UM4L 1PY9A 2B0SL 4NQVB 1BECA 3BIAX 4RSVA 4X6CA 3GSOB 4IRZH 5IG7A 1P1ZB 2H8PB 1ACYL 1DE4B 1KNOA 2AKRA 1L4IA 4X98A 1MCLA 2BSTB 1UWXH 3B5GA 4LCYA 1P84J 4XCYA 4FABL 2FD6L 4X6FA 1HHIA 4MCYA 1UJ3C 4O9HL 5IKCA 1IGCH 4NUJA 3UTPD 4D8PA 1YJDC 3ZYZA 2IJ0C 5BQ7B 3ARDA 4JO3H 3ILQC 1H0DA 5J1AB 2AQ2A 2E27H 3SE9H 1JZ6A 1QBAA 4JFEB 4MQXD 5DQDH 1R3KB 4HIJB 1FCGA 3TVMC 1KFAH 1AO7A 1RZIB 2Y25A 3VA6A 3FB8A 3FOMA 3QRFM 1J0YA 5ITBL 2D03L 1MNUH 1T0NB 4JZNB 1I9JL 4RDQF 5H2BA 5FB8A 1XGRA 1KT2A 5EN2A 1YPZB 4BYHA 1FZMB 4LEOB 4XC1H 2ZOLA 1I8IA 4HWZB 4FQ2H 3OJDA 4HV8A 4XBPA 5D7LA 3V8CA 1CFSB 1FFOA 2H1PH 2VDMH 3KYKL 2CIIB 2XWJA 1GC1C 5AYQA 1A6UH 1OARL 5EBLA 3VFTA 3E8UH 2ILLA 3TBTA 2DQHL 1BZQK 3WUWG 5KSBF 4OF3A 1KENL 4FQIH 5A40E 5FYLD 4JFZL 4YUEH 2QSTA 3DNKA 2P47B 3GJEA 3KXFD 4NCC2 5EA0L 4BA8A 3MRBB 4L9LA 1FO0H 1BIHA 2HT4C 5DYOA 4N5UA 2BSSB 4X4ZA 3F7RA 4H20L 1U8KA 4X6FB 5C0GA 1NDGA 3SBWC 3CSPA 1CI5A 2ARJQ 4QRTB 4DKEH 7FABH 3B43A 5AUMA 3SDYH 2BMKB 2NXYC 1S7TA 2OR7A 1UJ3B 2FBJH 3OKEB 3ALWA 3FT4A 3VFSB 2EIZB 1OQXA 2IBBA 2OTPA 2X09A 1KTKE 2ZP0T 4OCWL 1TETH 3BZDA 1RULL 4OSUH 3JZ7A 5D6DC 3ECBB 4XCEB 1XEDA 4J2XA 1T0NA 4JZNA 1J05B 2FLBT 1EFXB 2B8OT 4K2UL 4XVJH 1DVFB 5E9DB 3IXTB 4WUKL 4Y16B 3DUHA 1AC0A 4QY8A 2C7UA 1TZGH 1FFPB 4FZEH 1I8IB 4DAGH 5EBMA 2FL5A 3SE3A 1VGEL 3PGDA 4CVWA 1X4YA 4MS8C 5F7MC 1AIFA 2XA3A 1RK0B 3NGBB 4M7LH 3K8LA 2BHYA 3WN5B 1ADQL 1IC5L 1I1AB 2FCBA 4LPCA 3QDJD 3F12B 1LEKB 3GMNB 3OKMA 3GJEB 4TOYH 4N0UB 3V0WL 3SJVB 3FRUB 5GGQH 2HTLC 4NO0A 4WW2F 5IB1A 1JGDB 4L4TD 5D9SB 4HFUH 3T0AA 3P9WB 3VD3A 3TT3L 4ZNEE 5EUOE 1QBML 2AXGB 1CE6A 2BFVL 5HHVL 4UILL 3BGFC 4S1QH 4XP1L 5D1XB 3O6MH 4X5WB 5TDOB 4CVZB 1G7MB 5IBUB 3GIVA 4OD2A 4GKSA 1U8IB 3BGAA 1X9QA 1K3ZA 4J3WA 1YEDB 2B2XH 1I7UA 3GKWL 3I6KA 3HMWL 3Q3GB 4TULH 3OSKA 3REVA 1JV5B 1NC2A 4CADB 3BSZH 3TVMD 2DI7A 2C7UB 3MRDB 3HG1A 4S1RL 2BVEA 4O2CA 5C0BB 1ZHLB 5F71A 3S35H 1BFOA 4M61B 4QRQB 5JHLH 3ILQD 3QCVL 4BH8B 6CGTA