1GC1H

Hiv-1 gp120 core complexed with cd4 and a neutralizing human antibody
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
229
structure length
229
Chain Sequence
QVQLLESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQGTLVTVTSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an HIV gp120 envelope glycoprotein in complex with the CD4 receptor and a neutralizing human antibody.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/receptor/immune system
molecule keywords ENVELOPE PROTEIN GP120
total genus 44
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 1998-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gc1H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gc1H01
5E08H 3S4SA 5E4EC 3CIQA 4UT6H 3ARFA 4XAKD 3SQBA 4EUPH 1ZGLM 4F15B 5DHYB 5F7WC 1N0XH 4A6YB 3O11B 2WUCL 5IVNA 3PQYA 1D3CA 5EOQL 4G8IB 1ZSDA 1KN4H 4Q2ZB 3MV7E 5K9KA 4NKDA 1P4IH 1DBJH 1KB5B 4XTRC 5EBWA 4CADA 2W0LA 3HS0B 2PYED 5DQDH 3RWDA 1FFPA 2HMIC 3O3AA 4XZUA 4JFPA 1CDBA 1AKJD 3HZMA 3MLYH 3P4LA 3HC4H 1S9WB 4OGXH 3GKWH 2VO5A 4TSAL 4PR5A 3V6ZA 3PP4H 4DOHE 3BAEL 4D0BB 1ZEAL 2EC8A 1YEKH 4RRPG 1G7PB 5JIPA 5FGSA 1VDGA 2EYSA 3CFCL 4XP9H 4QRSB 2R2CA 4UIKL 5C09E 1FVEA 4JPWH 4KV5F 5MP6H 3EOBA 4YEFA 3WYRA 3GRWH 4PJAE 3P73B 4Y4FB 2B8OT 1NDMB 1HHKB 3VWJD 3G6DL 3SE4A 1BM3H 2FO1A 1UT9A 5C2BL 1T1WB 3G5XA 4XAWL 3T3PE 1MAJA 5BMFL 4Z0XA 1NJ9A 4JZNA 3ZYJA 1FL6A 5MI0B 4D2NA 2AABL 4JFFB 3LKNA 1S3KH 1LQSR 4ELME 3FONA 1N26A 2GUOA 1I7TB 3VD5A 2BVEA 1CR9L 3HNVH 3ZTJG 1AR1C 3QG6A 5D1XC 4JHAH 2YD2A 3D39E 5TPWH 4A6YA 5I1GH 1F4WL 3IS1X 3HG1E 3D69B 4PLNC 1RHHB 3KDMA 3WLBB 1RFDL 1ZMYA 3I6KA 3QG7H 5CUSL 2DQTL 3RKDD 1EGJA 4D94A 5CWSB 5C6TH 3RAJH 3DX7A 4PJIE 2AXHA 5L8JB 1NLBH 2DQGH 4LFHG 3U7WL 4G7VL 1MCKA 3L5IA 4OLXH 5DFVD 4X7TB 4J6RH 5FYLL 1JWUB 1HXMB 1LNUA 3DROA 1A22B 4PY8J 3V6OC 3ZE0F 4G6FB 1B2WH 4UT6L 1T2QL 2EH7L 1J8KA 1QKZH 3OGCA 1I1FB 2CRYA 2J8HA 2CLVA 2XPGA 4X6EA 2EYSB 3DUSB 4LLDB 2JELL 4R4NC 3O11A 1ZANL 5I1LA 4PJFE 3R0MA 5JR1H 3PGFL 1OSPL 1OP3H 4Z7QE 4ZAKD 5HYFA 1RK1B 1S7QB 4MD4A 5HXMA 1ZLUK 2GK2A 1T80A 2ZSWB 3UYRH 5EBWB 4CADB 4MSWB 1H5BA 3A6CH 1F6AB 3QUXD 2BNUB 4RNRB 2H6PB 1ZVHA 3QJFA 1JI2A 4YHYB 1CL7I 3ARYA 1TCMA 3GMLB 1FJ1A 5F9OH 2VDMH 4G8GB 4Q0XH 3H9SA 3UTSB 2GUOB 5E03A 4ZS6C 1YECH 3L6FA 3T0BA 1U36A 1OTSD 3V5HB 4FG6D 1YEDB 2PTVA 3PP4L 2RCSL 4HKBB 3L3OB 1DDHA 3WS6A 3FFDB 1FCGA 4WEMB 4XGZA 1P9MC 4S1SL 1FNHA 4NGHH 3LRSA 3CVHA 3ILQC 2BERA 1QLRB 4WTZG 2QSCL 1R3HA 2XZZA 3C6LB 4Y4KC 3LDBB 3KPSB 2IALB 5F70A 4NUGH 3NPZB 4GMSH 5FUOH 1FYTE 2HFTA 3FB6A 3NFNA 4NRYA 4Y4FC 2JIXD 2NW2A 4GAJH 1WZMA 1QEWB 1U8MB 3OKLA 1MREL 5DRNB 3C9NB 4GAYB 3RWJB 3C60D 3S96B 1T2XA 1GOFA 3DUSA 2VSCA 3WXWL 3P0VL 2DQEL 1WT5C 5D2NE 3WLWD 1NANH 1BP3B 5GS0D 2W0FA 3FZUC 3QUMH 4LQFH 4H5SB 4XP6L 3RL1B 5L0QC 2OXHA 1J0KA 2XQBH 1RUAH 1C5BL 3BN9D 1ZWIB 2ZSWA 3C6SA 4NO0D 4X6FA 2V17H 5HYEA 1S7SB 3GZKA 1OGTB 1AHWA 1SM3L 3LEXA 5IEHB 1JPGB 5E99L 3NOIA 3KPPA 3EO9L 4ZOEA 1R5WB 4NQVA 5MENE 5CEZE 1N6UA 1NH6A 1FNSL 5FO7A 3O4OC 5KTEL 4MJIB 3GSXB 1ORQB 4C4KO 2VDNH 4RCAA 3ARRA 2ZG2A 2YC1B 5ESVA 1LHZA 3VXSE 5CJQL 4R97B 2DQDH 3B5GA 4PJDF 4NNPL 5FYKE 3O2DA 3SKNA 3PQYB 2MPAH 3FOLB 1I7ZB 4Z7VB 1EEZB 1R3HB 4I2XE 5BQ7A 3NGBC 2WBJD 2PYFB 3KYNB 4WCYH 4J3WA 1AD9B 3RZCB 2ID5A 1JF6A 4K7FB 5IVXB 4HWZA 2ESVD 1EJOH 4YHIA 2EE6A 1NPUA 1P6FA 3CX5J 2ZUVA 1ZS8B 4DWHA 1WUNT 4GAGH 3CDFA 4LSSH 5T3ZD 2YPLD 5FHAL 5AWNL 3QDJE 2G60H 2YSSA 4FTVA 1Q9LA 4LCYA 3JV4A 4LCCC 5BRZE 1ADQA 4JVUA 4M93B 4H5SA 4WFGD 1FGNL 1KCUL 4HZLB 3ZKSD 1FO0B 1U8IB 4GBXB 2YPLB 1OGAE 1QLRA 2HJKA 1INQB 2ZP0T 2ZOLB 5I8EB 5I17A 3U0TB 4MD5B 5D71H 3LKRB 4YIQB 3LMJH 4RWHA 3QDGB 4D9QD 3FB6B 5B3NA 1TCRA 3E1F1 3FT4B 1ORQA 3O6FD 1UVQB 4WVRA 2VE6B 5C08E 3QG6B 1A6VH 4ODWB 1JPSH 4N0RA 5IT2L 1RUQL 4OCSH 1KYOJ 2ATPB 3IVKB 1M6OB 3SO3B 5DMGC 4H20L 1I9IH 1IMHC 3FCTB 3AM8A 2VZSA 2J6EA 4JY6A 1RURH 2HTLD 4O51B 2DBLL 1FV1B 3C5ZA 4X9BA 4RGMB 1IEBA 1KLFA 3MRRA 3CLEL 4HS3B 4NC1C 4NN5B 3ELAT 3LHPL 1UH3A 2VXVL 4X4YA 3E3QC 4JQVA 3BGMA 3SY0A 2VDLH 1V7NL 3PHSA 5E99H 5D7KE 1ZLSH 4QHLA 3RL2B 3MOQA 4UQ2B 1YEEH 1TITA 2VDKL 1QVOA 4AYFA 4N8PA 4QO1A 4TQEH 3MGOB 5ENWA 4OM0H 3EJZC 1J0IA 2DYPD 2NY7L 1VFAA 3MXWH 4P2RE 2LTQB 4HC1L 1YJDH 3CZFA 1DLHA 4YHNB 3QIUB 1FVDA 5CJOH 2Z92B 2A73A 1U8IA 3CMGA 5I74C 3ZDYE 4X5XA 4F7CA 2QTEA 4XBEL 1T1ZB 4F3FA 3BPNC 5FYLD 5IFHL 4XWOC 4QXWA 4RRPA 5HJ3A 1T7WA 5J3HC 4D8PA 4EZMA 3O3UN 1NEZG 4UV7L 3CSPA 1D9KC 1X44A 1NC2B 1WWWX 1IBGL 3EYVA 3RUGF 2BSTA 4X5WA 1YNLL 5IB2A 4IDLA 4C57C 3RVXD 4KQ3L 3VXUE 5DJ0A 5SWZE 5D96B 5IW6B 1I8MB 1B90A 3KPMA 4N1EA 3ULUD 4JPKH 4KAQH 5J06A 2FDBP 5GISH 4JKMA 4G9DA 1JE6A 3GGWA 3SDYL 4KI5F 4P2OD 3QB7C 5T1KD 2VXTH 1ZA3A 4I18A 1O7VA 3IU4H 5IESH 4X98B 5MHSE 1EBPA 4YHML 5IQ9B 3VXUB 1MJ7L 3BT2L 1I7RA 3QO0A 5GGRY 5IROC 3SO3C 1NGWB 3V7AG 5HHOE 3IFOA 3W2DL 4C56A 1AC6A 1BF2A 3HAEB 5MEPA 1DBKL 4EIGB 4ZAKB 1U8MA 1VB9A 3DXAA 4IRSC 3S5LB 3T4YB 3PV6A 3WD5H 4F57H 1FZMB 4IRJC 5SWQA 2VDQH 1CIDA 1DBJL 2X2YA 4MNGE 3BKCL 5MENB 5E8NA 2JELH 4QHNA 2H3NB 1BECA 5D7JA 5DEGB 5DLMH 4YHLL 4CVZA 4G6JH 5KN5A 4NQEA 4OD3H 1HH9B 1EDQA 4AQ1B 3U0WH 4GRLA 5GSVA 2OBGA 1K5NA 1JWMA 3D85A 3GMMA 3MLWH 4Z95H 4RAVA 3RWEA 3O3DB 1OD7A 3KPPB 1MCQA 3HI1B 4N5ED 2QKIB 1F2QA 3O6MH 3TC9A 3M1BA 3MO1A 5AYQA 4Y4HA 3QUXC 3ROLA 5E2WL 3T65B 3TT3L 2KKQA 4HUNB 2W9LA 3FRPA 4XVJH 3C5ZB 2DIAA 5BO1H 2WWMC 1TVHA 1WJ3A 5F3BA 5FCSH 3D25B 3OAYH 5F7EL 1KV3A 3NZ8A 4ODSL 2EDDA 1A6WL 3FRPG 1HZHH 4ONFH 1HKLH 1Z3GL 3V6ZB 2A73B 3CC5A 3U9PH 1QSZA 3KLAA 2BCKB 3EO1B 3E0GA 2B39A 4PJ7E 4WI4A 2ZG1A 5E9DA 2HKFL 2GJZA 2Q20A 2ARJA 3OV6A 4PTUB 4Y19E 1BFVH 5EBGA 2OR9L 4G43A 2X4OA 4HMCA 5CAYB 2QBWA 2FH6A 3NA9L 1AGDB 1NLDL 4X6BA 2HVKB 1ZKAA 4Y4FD 4RGND 1WC7B 4PJCA 3MGAA 3QRGL 2P8MB 2R2EB 3SPVB 2XRAL 3T1FB 4K8RH 3UTSE 3OAUL 5E5UB 2Y5TA 3CUPA 2AS5M 4RA3A 4OM1L 2VITA 1CT8B 4AENA 2V5YA 2NY6B 4OQTA 1A3RL 1R3LB 3ILPA 1MUJB 4YK4B 3ZDXF 1KNOB 1LO4L 3FQNB 4ZODA 4XCEB 4P2OC 5IQ9A 2Y07H 1NGQL 3O9WD 3OKNB 3FRUB 4MXQD 2FL5A 3N1QC 3VGGA 1IRAY 5IJVB 4WU5A 1NBVL 1I1AD 1QKZL 2ZUXA 4ZXBC 1KBGL 1QSVA 2YN5A 1P7QB 2OJEB 1ZLVK 3TVMA 4UINL 1OP5K 1KPVA 1RMFL 3MNWB 2CDEB 1IAKB 3AUVA 4JKPH 2G75B 4G6AD 3P0YH 2VR5A 1Q1JH 3KHQA 2CDFB 4YGVB 3U82B 4HXBH 2BP3A 4NO5B 5D7IA 5KS9F 4Y4KB 3GSNB 2VZOA 3C6LC 3SDAB 1CDUA 4HUXA 1I1FA 2HKHL 1JL8A 2PO6C 5IR1A 1U41A 1KIRB 3O4LD 3AB0B 1IFHL 4J8RA 2Q6WA 4X8JB 5DQJA 3ZL4H 4EDXA 4K3EL 3REWA 2IQAB 2BMKB 3O3DA 3BZ4A 1AXSA 1JNNH 4P3CH 1HQ4A 4LP4A 3TA3D 1QSFD 2GY5A 5J6GA 3SKOB 1IFHH 2R4RH 4JANB 1SHMA 2P24B 5CIPB 1QVOB 3B9VA 3QP3A 2XPGB 4X6EB 1KOAA 3GMQA 3V6FA 3V4VH 3NA4A 2GEEA 1GZQB 2IPKA 1R6VA 3LEVH 3MYJB 5DJ6B 3DVGB 4XTRD 3M1BB 4N1CA 5D6CA 4PRNA 5DK0B 5ACLA 2R0LH 2VZ1A 4JRYA 4U2YA 4DFHA 3VMNA 3KPRD 3BGAA 4OGZA 1MFCL 4FZ8L 3Q3GB 1KPRB 3FB8A 3BP4B 2ZPKH 4PV8A 2VDRH 3X12A 4G8GA 1M7IB 1UFUA 3CC5B 4NZUL 5DWUH 1PKQE 3JVGA 1QQDB 1HCFX 3R1GH 3OHXB 1N5AB 3OAZK 1NC2D 4MJ6B 3VWJA 4WV1A 1YEIH 4O2EB 1CFSB 4MJ2A 5LBSL 5L8KB 2Z4QA 3CGTA 4N9GA 1JZ8A 4OGAC 1Q0YH 3MROB 4OB5H 3F12A 1QRNE 3C6LA 4V2CB 1HH6B 4XPHL 4JY4B 5HGHA 4HG4K 5JW4M 2I25N 4YXKL 3MV7B 4W70A 1UC6A 3BIKA 1AQDB 5EWIL 4TNWF 4Z77A 3AXLA 2OX5A 1EMTH 3VWKC 3L3DB 3HE7A 4JM2C 4WUKH 3X3FL 3OL2A 4JLRB 5ISZE 4ELMA 3P9MB 2YWYA 3WFEL 2B1AL 3HB3D 5BRZD 3X3GH 1RK0B 1N64H 5KVMC 4LLMB 5BV7C 3EJZD 3VFVA 4YXHH 4KJYA 4DAGH 5T1DL 2CO6B 4XNZC 4YHKH 2BRRH 3WFHA 2FBJL 3NCFB 4ZFZA 1XGUA 2YPKA 1ZE3C 1XF4B 5BVJB 3OXSB 2ZJSH 2HLAA 3BE1L 3KGRA 3LZFL 3QWRA 4WO4A 5EUKB 1KYOK 2XZCH 3WO3B 4JGUA 4XPBL 3SGEI 3SDDD 1FE8L 2FHBA 4C55A 1BD2B 2EDWA 5KSVB 4OLWL 3GI9H 3TBSB 4S1RH 4NN7C 3UX9B 3MJ9A 3QUXA 2H2PC 1N59A 2YOCA 4NWUH 5SWSB 3N9GH 1YMMB 2M2DA 1YY8A 4NQCB 3FO9A 5C08A 2GK0B 3V0VA 5EU4A 5DVOA 4P0DA 3W0WB 4LCWA 1JPTH 1A1OA 3C6SB 2H1PH 3TYGH 5CHNA 3UJJL 2XTLA 4XVUC 2CK2A 3ZE1F 3DPBA 3MLTB 3HKFA 5CGMA 1AGEB 4L9LB 2ITDA 2CRZA 4H26A 5JW3L 2XRAH 5JHDB 2AV7B 1QTYT 3VG9C 2X1XR 3HE7C 3CSYA 4HK3J 4XT1C 2R2EA 3SPVA 3LKRA 4KK8D 5GJTL 4ZPTB 4LCUB 3DX9B 1C7SA 2XICA 1U8OA 5CLWA 5FF6A 1Q9OA 1DBML 2OI9B 4YDLC 2YD8A 4CDGC 5DJ2A 2W65B 4L4VA 4LCIL 1IC1A 5CIPH 4BZ2L 3LSOA 3EHBD 5C86A 1JZ6A 3ZO0A 4ZSOE 5A43C 5ESAB 1Q0XH 1T5XA 2NR6C 3KJ6H 3OPZL 4QRSA 4J3VA 5C0AD 4QT5A 1XGQB 5J1SC 4OZGA 4ZOCA 1MIEL 4CN6A 4G8EA 1A3QA 1QRKA 4M7LL 1ZTXL 3BOVA 3QCTH 5GS0C 4HEME 3JV4B 4ODWA 2NX5A 1IQDB 1H3GA 1IC7H 4NO0A 1M05B 5LGJB 3SY0B 5C2UB 1S7WA 1ES0A 4XXDB 5E8OB 4OD2A 4N8CH 1C08A 5C0ND 4WW2F 4P49A 2VLRB 3CFDB 1XAUA 3GRWA 3CVIL 4TUJA 3ZTNL 3NCYP 4WTWA 3BJLA 3F7RA 2AQ1A 2IC2A 1UJ3A 4ZFFA 4RMVA 4JFOB 4HWEH 1NAMA 3PQYD 4M7JL 3FN9A 1X6NA 1LD9A 2BNQE 4NOBA 5GJTH 2EDRA 1IAMA 1R5VB 3H3PH 3KYMB 3TBWA 1UVQA 1CK0L 4GKOA 2VLKD 1MRFL 5HJ3B 1HNGA 2YPKB 1DJSA 5LWYH 3AAZB 2BHUA 2FX9H 4QXTB 3U2SA 2LFGA 1Q9OB 2AERT 1GAFL 4LBEB 3QUKA 4NT6B 1WZ1L 2WBJC 1A6ZB 2XWJB 1W0WB 4NQCA 4S2SB 1QFHA 1CR9H 1LK2B 2HFGL 2UWEA 2EICA 1S3KL 1NKOA 1G7HB 3QXWA 2CLRB 5J13B 1U8PA 5E2VH 4CU6A 1ZVSA 4OCXH 3QH3A 1AGEA 3RPIA 3Q6FB 1CG9A 1UWXK 4M8VA 1ODAA 5DHVH 1CICD 4PPTA 4MB4A 3EBAA 3ESUF 4RFEA 4N8VB 4B7LA 4XVSL 3OB8A 3C60B 4UU9A 5I1IH 3KG5A 2X70B 4LQ1A 1FAKT 4OFPA 4V1DB 5HY9B 4WUUA 2F8XC 1EHAA 4O9HH 4WGVB 3H9ZA 5KTEH 1RIVL 1FAIH 3HNVL 3RA7H 2FSEA 4BFEA 5D5MB 3SE3A 1JGUH 3MACH 3AY4C 3ZE2F 3DTXA 2AEWA 3TBTA 3VWKA 4YHOL 4NM8L 5I71C 1H3PL 1YY9C 2CQVA 5J0BA 4HQQH 3U0PB 3RWCA 5GS3A 3ZSSA 3O3BA 4CGTA 2NY0D 4LPVA 4P3WA 1JTPA 2R0WL 4PRPB 1FH5L 4L8SC 4GMTL 1Z0MA 4QF1B 3ZKQD 2CO7B 1IZJA 3BP7B 4Q6IC 5FB8A 3UTSD 4XPAH 4KKCD 4NKMB 4NDMA 4M1GH 4F7TB 1X7QB 1ETZA 5DC9B 3ZHDA 5JW5A 1MWAA 4NQEB 3C2AH 5C8JB 3T3ME 5CEZD 2DLEA 4PRPD 2AJXH 4RISH 4N0UB 1LGVA 1RIUH 1CDGA 1J86A 2X4TB 5KVDH 2VLKE 1EZVX 4PJ8A 5EU5A 4ERSL 1GVIA 4ZSOB 3D18A 3L3GB 4ZAKA 4WHYG 1I3UA 4NQSA 1I3VA 2XTJB 4U31A 5F3BB 5GJSL 1Y6KR 3H3KA 3HI6L 4LPYA 5CZXD 4G6FD 2APWA 2AK4A 4BK4A 4QHNB 4OCWH 1IGMH 1RIVH 2NTFA 3I85A 1OB1A 4CMHC 4F7PA 2OYPA 1DQQB 35C8L 3S88L 1G9NL 2PNDA 3RTQC 1R5IA 4KKBD 3QA3A 5FEBA 1ACZA 3NCBB 3M8OH 3SN6N 5MERB 1KJ2L 2MMXA 1FVCB 4D9LH 2F53E 5CGTA 2D31A 2QQNH 2VN4A 5I8KH 1VFOA 1A9BB 2P5WD 2Q86A 5DUPL 5T3XL 3RWCB 4UAOC 1E4XI 4C59B 1OHQA 1OTUD 4GMTH 2IPTL 3S8WA 3OKOB 3QWOB 1U8JA 1KGCE 2Y7QB 4FP8L 3TBVA 2BY0A 4M3KB 2QV2A 2W9EL 1AIFA 4PIRF 4TNVK 2ADGA 5KANI 4K3EH 3H7LA 3RPIB 3A67L 4NC0B 1B4JL 2HJFA 2R1YA 5TDOB 1B0GA 1CTOA 3ARQA 5DS8A 2A9ML 4JFEB 4MD0A 2BCKA 3EO1A 1JI1A 4NZUH 4LEXH 4FFZL 2HTKC 4I2XB 4X6DB 3IT8D 5E00A 3CDGB 3CFEB 3QZWA 1LWRA 1R3KB 3GHEL 4N0FB 3O4OB 2NW2B 3L95A 2YXFA 5TH2A 4L5FL 5J6HB 3MXWL 3SEPA 3MSPA 1RZ8B 1UM4L 4HGWA 3O3BB 3WKNA 4JEGB 5GRXG 4NQXB 5IKCA 2BHYA 4HWNA 5DHVA 3V4UL 4UILH 3LKSB 3WUWG 5D5MA 4HLJA 5GGQH 1G6VK 3V4PL 2DQIH 3D0VB 3DETC 3G5VA 3H9HB 4LLAA 1PLGL 2AJSH 1EERB 3CVIH 3I75B 1IC4L 3BQUB 4HWUA 3ZTJH 3ZT5A 1QNZH 1T1YB 1JYWA 3WS3B 1I1AA 3MV8B 3Q6GH 2CKBB 5GSRA 4HUWA 2FHFA 5IVOA 5T3XE 5JLZB 2VIRB 4CVXB 3CXDH 1S78D 1F3JB 1NC4D 1IGCH 2XYCA 4JPIA 4Z7UA 3KPNB 2ZNXA 5F7MC 1T7VA 3S7GA 5E8EB 2F54A 3DX8B 1TQBB 2FJFA 1I9RL 1IEAB 1LILA 4EI5C 4NP4L 3LDBC 2R8SL 3TFKD 1NFIA 2ZJSL 3RNKB 4TN9A 1A1NB 4H0IA 5F1KC 1G7QA 5CJXA 4MYWB 5EOTA 4LVEA 4KI5C 3TJHD 3MJ8B 1MPAL 3ARSA 1UKTA 3MV11 1DQQA 1JGEB 1HYSC 5KOMC 5F7YC 3P77B 1KPUA 1BBJB 3HPJA 2OZ4A 3RVWC 5I0ZA 4PRID 5JUEH 1A64A 3MRDA 3TPUB 3D0LA 4HKJA 5DRZB 1U91B 2Q86B 1KC5H 2KQMA 4YUEH 5B39A 1G7PA 1MFBH 4EI5B 1MFAL 1TVBB 3OMZA 3QEQB 1U3HA 5T3XH 1ZHNB 1GGIL 4HWZB 4GXUM 2FYYB 2N1KA 1FN4B 5HY9A 4C56D 4F7EB 2YUWA 3HI5H 3L7EB 1W72L 1HKFA 4ZNEE 1MCPL 3C2SA 5HDBF 2WIMA 3W39A 1G9ML 5DMKB 1U8NB 1ORSA 1CFQA 3TT1L 1FQ9C 3TVMD 2XZCL 3MZGB 3KYOB 1BZ7A 32C2A 3R1GL 1S9WA 5F97E 5LGKA 3VD9A 5A2JH 1HQRA 3CFBA 4OV6F 5CS7A 1HWHB 2APVA 3T0DA 4HH9B 1JHKH 3K7UA 3KVQA 1HZHL 1GC1L 2QJDA 1PZ5B 3NH7H 3QI9D 1KJ2A 4Y4HC 3LN5B 4UUJA 3IKCB 3N9GL 4KMLB 2NZ9D 4RMSA 4NKIL 2AJXL 3TA3A 2H1PL 3DX7B 4CVUA 2LQRA 2C7UA 2GIYA 2ORBL 1PBYA 1T3FB 4ZDHB 2FX7L 3VXPB 4EN3B 3FQUA 2MPAL 2A6DA 2HN7B 3OKMA 4P23A 1LEIA 4BSJA 3QRFM 3T2NH 1ERNA 5E4IA 4Y2DC 4HG4J 3D3VB 5ACZA 1MCDA 4KKLC 4ELMB 1ZHKA 1FZJB 2Y1VA 5E70A 3MRKB 1L6XA 2WINB 5BZDB 2WLYA 3F65A 2LABA 2F53B 3MO1B 4HK0B 3KJ6L 3NPSC 4QHUB 4YGAB 4F7CB 4LLQB 1LDPL 3W0WA 3WD5L 3F7VB 3MODH 3X13B 5JNYB 1DBKH 3HE6A 5IHLB 5KS9B 4M6OH 1VACB 4J3OC 2Q76B 1D6VH 2NY3B 1NC2A 3MRPA 4I5BA 2ICWJ 4FQ1L 5DJ2B 4MHHG 5IBTL 1UWXH 1XCQA 5A2KH 4MZ2A 5C2BH 3KPRB 1HOCB 4OZFA 4KZDH 4DEPB 3DX9A 2E27L 1JGEA 2MCPH 2NNAA 4DOHB 3F8UB 1PAMA 4CNIB 3UPCA 1UQSB 3UAJD 1IGFH 2ZCLH 4HEPG 4OUUB 5HI4D 1OQOA 4HUUB 2EDFA 5FOBA 3VD4A 5DJYA 3MZTA 4PJ9C 5F72S 5SWSA 4Y2OA 3S35L 1HI6B 2CUMA 1EO5A 1K8IB 4Y5YB 4YDVA 5D70L 3SDCA 4BH8B 1NFDA 4H0GA 5DEZA 4BQ8A 1VERA 1L6ZA 3PWPB 1ES0B 1DQJA 1WWAX 3IB4A 1FYHB 5C0BD 3RGVB 5GGVL 5F21B 1WFUA 1ZWIA 3B2UD 1J0HA 4BKLA 3RGHA 3DSNA 4R2GD 1ZHKB 1X5HA 3B9DA 4UDUB 1OAXH 1BF8A 3TNMB 1KELL 5GGRA 5HDOA 3GJFH 4X9GA 2HT3C 2X10A 2DQGL 3HAEG 1SJXA 1BZ7B 4LLQA 2FLRT 4P57A 1EH9A 2ZUQC 3OJVC 3MRJA 4LDLB 4FQJH 4X9HA 4AEHH 4M7LT 2D2OA 3LSOB 3L5WA 4OIIL 3BMVA 1DN0A 3JUYA 2NZ9C 3G04A 3EW3B 3ECBB 4TULL 3MBXH 3NIFE 1MLBA 4GXUN 4Q7DA 2CDFA 1WVZA 3FO0L 5IG7A 3VMPA 4ODXB 4UNVA 3GB7A 5KZCB 2VLMD 1GGCL 4MNHA 2F8VA 5AAWA 2ADJB 3TM6A 2R2HA 3RGVC 5C0FA 4WFFE 3STLA 5HGBA 4WJ5B 4QY8B 4XXDA 2ED9A 4MVBD 5TQ0L 3ARFD 3MJ7A 2B1HL 2D7NA 3QO1A 1CXFA 4LCYB 1NGZB 2H32A 4R7NB 3VFTB 4Y5YC 2VB5A 1A7OL 4L29A 3TZVB 3GMQB 1JRHH 2VL5B 2ICWA 4GUPB 3K8MA 1GZQA 1Q1JL 2FATL 1ZHBB 4JG0L 1DEEB 2K7QA 1RMFH 4M6OL 4WWID 5A2LH 1WTGT 4C4KT 2YPVH 4JRYB 4OZIB 5CMAB 4BQ9A 2C5DC 3MGTA 3H9SE 3JTSB 1QRND 4TPRH 1U9KA 1T89A 3T4AA 4KTEL 2Y36L 1AO7D 1H3XA 2YEZA 2FWOA 4LVNC 4IOFD 5EA0L 1ZT7B 3KLHC 4KK5D 5JOPE 2IGFL 3IETB 4P2RB 3E3QE 5C0AA 1II4E 2GTZA 1JFQL 3IXAB 3SE8L 1V3KA 2Y5EA 5HGAB 1AD9A 4NUJB 3D6GA 1F4XL 1L4IA 4OFDA 4FQXB 4PUBH 3RDTD 2RFXA 4J4PA 4ZYKB 3LRSB 3PWNB 5E8PA 5BRZA 5BZWA 1CWVA 3ARWA 4FQXD 4PBXA 5C0DB 1MNUL 3DV4B 3GJEB 5GS0H 3H0TA 4JVPA 3QUMA 4CMMB 3FKUS 3K2UL 3AU1A 4HBCH 3CH8A 3GKWL 2BDNL 4TSAH 3UROR 2DLFL 1DQJB 5HGDA 3GSWA 2OL3L 3ZDYF 3L3GA 3OKDA 2YPLA 3RIAK 1S7VB 1FNSH 5DRNA 3QCUH 5E7BA 3BKJH 3ZKMC 4H1LB 2N7AA 2P49B 4Y8AA 1INEH 1MHHA 4FFWC 4TUKL 2AEQL 1FYTA 2VQ1A 4WNQA 1LE5B 3KJ4B 2NY7H 3THMH 3NH7L 2UVFA 1MEXL 5IG7B 1G7IB 1KCVL 5CP3A 1KEGL 4MQXC 2H9GA 2B7DT 3VXUD 3C8DA 4M62L 1QZ1A 4TVPE 3VDCA 3I50L 4G8GE 3U83A 4E5XB 1E27B 1UWEL 4FQCL 5C0JA 2NXYD 4UDTA 3FT3A 3T2OA 1E4WH 4PP1D 1FPTL 1Z2KA 1U2HA 4PREA 2R4SH 4IRZL 1U42A 3W11C 1EHNA 5AWNH 2OCFD 2BSSB 3WL9B 4R7NA 3VFTA 4OZGE 5GZOD 1KTLB 2FLBT 1RUMH 5EC2A 4AQOA 5DJ6A 4RBPK 4KMQA 4L8DB 1OVZA 3X12B 1JNLL 3R8BB 3LQMA 1KB5A 3GJEA 2J4WH 5DURB 5ESQA 1MPAH 1F58L 3Q3GA 3LPFA 1YYML 1J1PL 3QZWB 2P5EA 4GUPA 4NZDA 1PW3A 4FMKA 2A9NH 2A6JA 5EZIH 4BZ1L 2VZTA 1PSKH 4JFEA 1A3LH 4TVPH 1YYMH 4ETQB 4OIAA 2FZ3B 5DI8A 1NAKL 2KQNA 3QHZL 3H3PL 4NQXA 1MCOL 3HZVA 2NLJA 2NXZD 1NFKA 2X9YA 4JO3L 4M7JH 4M1CC 2C1OA 5SV4A 3WXVH 4KZEL 1INDH 2DKMA 2H32H 1K6QH 3SDDC 2H2SD 1T4KB 2R8SH 4LSUL 1FORL 1KFAH 1CU4H 3LKNB 5CD5C 4RA0C 1HH6A 3HHRB 4WEBL 3ABZA 3VRJA 4S11A 4OD1H 1QSEE 5J12B 1Q38A 4WU7A 1E4WL 3DUUA 3D69A 3NIDF 3KDMB 3MV9D 4CVZB 4I77L 3HLAA 5DO2C 2UZXB 1VHPA 2YD7A 2NW3A 1A0QL 5JW4Q 3ARGD 3LH2L 4JRXD 3O6FC 3WL9A 1VESA 2OP4H 3H0TB 4FXKA 4LAJH 3JSSA 4Y4HB 5E1HB 5GRJH 4BSWA 4QGTA 5I66A 5KSAC 3QHTC 5I9QB 2H9GB 1PKQB 4GKSB 3AGVA 1V7NH 4LASL 1U3ZA 4ETYA 2J6EL 5FECB 3RA7L 2DTML 2DLTA 1NDGA 3UTQB 1J7VR 1YEGL 3WSQL 1IAIH 4YHPA 2PW2A 1L0QA 2VABA 1FGVL 1EK3A 1MQ8A 1JUFA 2W92A 1KJMA 1T04A 4YHZL 4Z7UE 2DIJA 4JO2L 5I1AA 3RWEB 1F3DJ 3MRLB 1CTNA 1AGDA 2XQYG 4L8DA 1RUML 4OZHB 4NNYA 2HLFD 1UB6B 5EN2B 1DUYB 2IQ9L 1H3UA 3L6FB 5KSBE 1MJUH 3EYSH 1NMCC 4U6VL 4OKVA 5C09D 4YNYA 4MQ7B 1U8OB 4ELMF 1RZKC 3RY6C 5FGCE 4PS4H 5I1DA 1I1AC 2VDOL 3Q48A 3Q6FA 1DANU 3BH9B 5FKAA 3NABL 2YA1A 1HIMH 1MVUB 2LU3A 1Z5LA 2QQQA 3ARXA 1G0XA 4YPGB 4OF0A 5GRYA 1ITCA 1FLRH 1SMAA 2XQYK 4R9HA 2IAMA 3MMEA 4XCFL 4XBPA 4LVOB 2X4OB 1Q8MA 2YN3A 4HDIA 3QQ4A 4G8EB 4FQ2L 5IR1B 4L3EB 4E42B 2NLJB 4KY1H 4P4KC 1DFBL 3HPLA 4XMKL 4L8BA 5ADPL 4JRXE 1KB5H 4IRJB 3TO2A 4D9RE 3KPLB 5DT1H 4ZAKC 1W0YT 5T1MA 4OZGB 4ZFOB 1LO3H 3SKOA 2B4CH 1KB5L 4Y1AA 3PGFH 4UIMB 4O5LH 2BC4A 3O8XA 4P2OB 3W39B 2A2QT 4NYLA 4XC1H 4YX2H 5H37G 5GRUH 5I9QC 5KSAB 1U58A 4KJQD 1A6UH 4PGDB 1MJJA 3E6FA 3P4NA 4PJCE 1TZHB 1SY6H 2V17L 4HJGB 3D85B 5D7IE 1NLBL 4M4PA 5D1ZC 4HFWA 3WJJA 3MNVA 3VFUA 4LBEA 3QNXA 5IW3A 5HPOA 4F7MA 1XIWC 3K2MC 3F6IA 1EEZA 4Z7NE 3IAGC 1OAQH 2JJWA 4URTB 3MREB 3RTQA 1N5AA 3OHXA 3IXTB 3TGXA 1TFHA 5J12C 3TN0D 4MB5A 4IDJH 2DI7A 5TJWK 1MI5D 2DM7A 3RVTD 2IBZY 4OGAD 1AP2B 5I1AB 5IW1A 4XBPB 3TNNA 2Q7YA 3V8CA 4EN3A 5CEXB 2AK4B 2APBA 1OT2A 1LEIB 1K8IA 2PW2B 3C60C 2V5SA 3RDTC 4Y5XA 4E42A 1NMBH 4Z8FL 3BQUD 3FQWA 4O2EA 1IM9B 4YNYB 4JKLA 1G7JA 4TUOB 3BSZL 3QNYA 5F93C 3Q6GL 3BUTA 1NDMA 4M7ZB 3QRGH 4LLUB 4LSPH 2J88L 4OGYH 4X4ME 3UZEA 3Q1SH 4GG6A 3SDDA 1F11B 4JZJB 1A4JB 4XC1L 4YX2L 2A1WH 5BW7A 4HS6A 1UYWH 2WBJB 1CGXA 1HHHB 4JQIH 5I1DB 1JPFB 2MWCA 3P0YL 4LSQL 1LP9A 3QNZB 1MJJB 3P4NB 5EU3A 35C8H 4PRPA 3UJIL 3KPRA 5IJKA 2FNBA 2VN7A 3NCCB 5LGHH 4LSVL 5JO5B 1YUHA 3O6FA 3U9UB 3HN3A 3ULVL 4L8CB 4PBVC 3VFSA 2IADB 4F7MB 4KY1L 5IB3B 4TRPH 3L95B 4JDTH 4NHCH 5D2NA 5FYKL 4F9PA 2QR0A 1MWAB 4AK1A 5EG6C 3O9WB 1GGBL 1QACA 4JY4A 2B2XH 2FJGB 1MAMH 4OBRA 1MNUH 2DS4A 3Q2CA 4WHTB 4QNPF 4I0PD 4EQ3A 2VQTA 4JFHD 5IB5B 4U7SA 4GBXC 2BFVL 3MRHB 2NXYB 5BMFH 5DFVC 1JGLH 4M48L 3BFOA 2OS7A 1FH5H 4EVNA 5E2TH 4BZ2H 5SWZB 1X5JA 1IM9A 2W9DL 5A2FA 2I60L 4P46B 4DGIH 4KUCD 1KTKE 4Y7MA 5CINH 1YYLH 3CZFB 4M6MH 5JLZA 3PF2A 2NCMA 1I1RA 1IGJB 4PUBL 4L1HA 2GYSA 4YDIL 1IGIL 2E7HA 4NBYB 4QCIA 5J1TC 5IMKA 1F4WH 1ACYL 1F97A 3IDIB 3VA6A 2CPCA 3IFNL 1QR4A 4FOMA 2FJFB 3N85L 1OAQL 3CJJA 2P8LB 3I02A 4U1LB 4E41B 5JZ7C 2IPKB 3BP5A 3EYVB 4PG2C 1JCKA 3ARED 5D7SH 4P2RA 2Y06H 2LAGB 2X4NB 4NNYB 2A9MH 3M45A 3UO1H 3K3QA 2IBGA 3QEUA 3L3OA 4X4MA 4U6XB 5H35B 4FG6C 2R2HB 1DQDL 3FO1A 4LHJB 2RFXB 4Y19D 4MNQE 4I3SH 3TO4B 5D5MF 3C8HA 4PJEE 5DYOA 4UTBH 5IFJA 3IXAA 5B39B 4XVTL 1HSAB 4PJDB 43C9A 4RIRA 1D5ZB 1RURL 4LAQL 5DJAB 3RWDB 4HIHB 4K3GA 4GG6B 4NWTL 2R1WB 2B0SL 4MSWA 5HYSB 3TZVA 3LD8C 1D5BA 1BX2B 4IS6A 1F6FB 4NC2B 2BFVH 2P8PB 1PG7L 4JDZB 4JHWL 3B2UC 5I6XB 4R2GC 4TTDC 5TE7H 4XCCH 1YEFH 4MAYA 5DZNA 4EI5D 1S9KC 1GHFL 3KPRE 5CWSA 4Y8DC 3T4YA 1I7UA 4MDJB 1KEGH 2VLLA 4G5ZL 4GT7A 3HC0B 5JPNB 1KTDB 3LRGA 4LRIC 1QO3A 1KB9J 2BVYA 2OR9H 2N56A 2Z31C 1G7LB 3B8YA 3RUGA 4TRPL 4Z0XB 3DMMD 3VXSA 2DWEA 2H3NA 3BE1H 3WO4C 5D7JB 4MCZB 4K3DL 5C0EA 3P73A 4Y4FA 5LGHL 5KG9A 1K2DB 2X1OA 2EE2A 2O5XL 3AS3A 4WW2B 5K9QI 3AS2A 4LRNH 4OFYD 4HD9A 3AAZA 1KCUH 1MHHB 3L3KB 5FM4A 3GHEH 4FQXA 3OZ9L 4EOWL 3FT3B 4P23C 5FM5M 5HVWA 1LD9B 4F58L 3I6KB 2DL9A 1QP1A 2BOCA 3I75A 3SGEH 1F4YL 2HA1A 3TO4D 3WKMH 3O9WA 5ISZA 3QAZB 5EZIL 2NY5C 3MNZB 1R0AL 3QDJA 5ITBH 2F19H 4WUUE 3HE6D 3GKZA 2HLAB 1PKOA 5GISL 4JPKL 1CG9B 3O0RH 1KCKA 1PY9A 4HLZH 4XNQB 5F7DA 1XGRA 3L5XL 4K7PH 5DJAA 3I6LE 1SEBB 1DDHB 1L9MA 2GJZB 1QSFB 2OLDA 2C3XA 4H1LG 1K6QL 1QOKA 5F1OB 4LLDA 4KGLA 4J12A 1EHLL 3N85H 1LE9B 2BY2A 3D0LB 4HKJB 3DX6B 1TJHH 2EIEA 1MFCH 5HI3C 3SDAD 1O5DT 1Q9WB 2COQA 1EO7A 4TVSa 5F9JA 6FABL 2Y23A 3PL6D 2ZUWA 5FHBH 1RU9H 1F6AA 2XOTA 1WEJL 5D7LA 3CFCH 3QEHB 3T3PF 2YD3A 3QNYB 4XXCA 2PR4H 2W60B 4U1KB 2OTWB 3BYYA 1A2YB 1BVLA 1JRHL 3MPCA 4OM0L 1G7MA 4PREB 4LCWE 1WIUA 5AD0B 4GRMB 4NO3A 2J8UB 4KK9D 1NKRA 3B83A 4JREB 4HK3N 3SDXE 3QI9A 2HT2C 4K2UH 5IJVA 3INUH 2X9WA 2E9WA 5ITBL 2UZYB 2P5ED 1P6AB 4XCEA 2BXYA 2X1PA 2R1WA 5D6DA 3HZKB 3CVHL 4KVNL 1FL5B 3PABA 2Q8BL 4JO4L 4PJHF 4Y5VB 3IAQA 4LHQB 3TBYA 1G84A 3H42H 5DRXA 1F3DH 3M8OL 4JB9H 4K3DH 3FCTA 4Y16D 3EIFA 5B3JE 1MRFH 3QJHB 2O5XH 4ZUTB 2A77H 2ZNWA 3AB0C 1D6EB 1I7UB 4MDJA 1SEBA 1KBGH 4PJ5E 4W68A 3K74B 5DD1H 3TNMA 4FABL 3G6AA 4L4JA 4LHUB 4LLVA 5AG8A 4WUUD 4UBDC 1LEGA 5D7IB 4TPRL 2XIDA 3WIIH 5FM8A 4M03A 4P57B 1UKSA 3OKYA 4FQQB 1JHKL 2FJHA 4JANA 5C0NC 4NN6B 2BNQA 3PWPD 1UEYA 2PR4L 3CLFH 5MERA 5C0AE 4YHIB 5JHLL 3BZ4B 2EE3A 3BP7A 3U48A 2OTWA 3OAYK 2V6HA 3VGHA 4FQPA 1S7UA 1GZPB 3L9RB 5IT2H 1PJ9A 2C3WA 2Q7NA 2VABB 3QUZC 1MFAH 3KYMA 3TBWB 2HT4D 4HIJB 5HHPA 2NX5D 1M1SA 1OGTA 5HYJE 4NWUL 5DVLA 2ICEA 4ALAH 4PJFB 5HYQA 3I02B 3MOBH 3WIFB 3DVGA 1I8KA 2CJUH 3O45A 3RHWF 4NUGL 5T1LB 3RI5K 3X11A 2KDGA 4PR5B 4RGNE 4L3EE 4MWFA 3F7VA 3K1KC 1YEKL 3RIFF 1MVFA 4P5TD 3WFCL 1TNMA 1UZ8B 1KIUA 2PYFA 1DP0A 1N8ZB 2W38A 3KYNA 3QEUB 1J1XH 1C8PA 5BCAA 1ACYH 3GSVB 3TBYB 1REIA 5E8DL 2YMXH 4S1SH 1RJYB 4GRWE 3MRIB 1AO7B 1OAKH 4X6DE 1A2YA 15C8L 4XX1E 1NDGB 3UTQA 4M1CD 2F54E 5HSFA 2VE6A 1I4FB 1NC4A 4PJIB 1MY7A 3ULVD 1HOCA 4OZFB 2HJLA 5AG9A 4NPYA 4XCNB 5FUCE 3BIAX 1ZOXA 1U93B 2DMKA 5FYKD 2NY1B 3MRBA 3PWJA 1JHLH 3MLUL 3ZKXC 2M1KA 2AK4D 1RJCA 2X42A 3HG1B 4KU1A 2OTUA 2WUBL 1HI6A 3D39B 4U7MA 4X83A 4HZLA 4MAYB 1CVSC 4CDHA 1JHTB 5BXFB 5CP3H 2HJKB 1BZ9A 2R4RL 3KWWA 5TQ0H 1A14H 1CBVL 3CNKA 2F15A 4KJPC 4KTDL 4NYLB 2NY1D 3HZKA 4N0CD 2A1WL 5CD3B 4O58L 2X7LA 3LQAL 1B0WA 4DUWA 2V9RA 4KVNH 4K9EL 1FNEA 1K2DA 5TE7L 1IARB 3C8KB 1AE6L 5GGUA 1BOYA 1A47A 4LIQL 4POYA 4TVPD 4XPTH 4AEFA 4LSVH 4LPTA 1MLBB 3AVEA 4PJ7F 1LEGB 2MKLC 1KIPA 1VADA 1VEOA 3PNWA 3E6HB 4ONGH 5EBMB 5D7JC 1FFOB 2EYRA 2VKXA 5IHZB 1MJ8H 1TETL 4ZXBB 1CFNB 3WNPA 4I3RH 4MAUL 3WEXA 4KQ4H 1IC5L 2HFEB 2WWMD 3EYUH 2ZCHL 1GH7A 5EUKA 5I1JH 2BNRD 5HPMA 5C70A 5E1AA 4WO4C 4JY6B 2CGRH 4Z7OF 4R2GB 3SKMA 1OAUH 4YEEA 2HWZL 4JAMA 4DGVH 4L4TA 1IEHA 1J9CT 1FRGL 1H3VA 4LQFL 1MFBL 1YPZF 4JN1L 1ZAGA 2ICEB 1U6AH 4MNQB 4AT6B 4A2MA 5IGXH 3GI8L 5EU6B 1I8KB 4JM2D 2AK1H 5IQ7H 1I3RB 4GRLC 5T33H 4TOYH 4X6BB 4KFZC 1RZKH 4POZC 3DI3B 3L7EA 4OD1L 1KLGB 4KDVA 5D70H 5I16B 4QRTA 4OZIA 5L9DL 5BV7H 1UZ8A 1BJMA 4IIQC 6CGTA 1VFAB 4F37K 1J0YA 3L3IB 5I1EL 4A2LA 2ZPKL 4NNPH 4MDIB 2BSTB 3EJYC 1FL3A 3UJTH 2Z9TA 3MJ6A 2EECA 3NIFF 1MI5A 1P4LA 4XI5D 4X7EC 5E6IA 2A83B 4LIQE 1CGWA 4AMKL 1NCTA 5ECJE 2FBJH 1KUMA 5GS1B 4KJWC 3T8XA 1BLNA 4G9DB 5JXAL 1VFBA 4MJ5B 2VXVH 1MJ8L 2X4SB 1QFWI 5INDA 1XIWA 4HJJH 4P4KD 2FH8A 1YECL 4ODTL 1LO0L 5BXFA 3C9NA 1XF5B 4XNUH 3IDXL 2BVTA 4RAHA 1U8KA 5J13C 1XCTB 1ZHNA 2F53D 1JK8A 2EDNA 3NFNB 3O8XD 5HHXH 2DQUH 1FLRL 2DYPA 3MYZA 1XH3B 2V7NA 3DRTA 4KTDH 4UB0H 3P40A 1NUDA 4M1DH 3WN5A 5HD8C 2F58L 3VXUA 4AEIL 5SWZA 3G9AB 4MCYB 1NCAL 4WW1B 4JFQB 4O02H 5E56A 5MEQB 3BPCB 1URLA 3VFWB 1SBSL 1Y18A 2VUYA 4XMKH 3RUGE 3P9WB 2VDQL 5I75B 4HC1A 5FO7B 4DJMA 1HQRB 1OP9A 3CFBB 3T0VA 5E7FA 1OCWL 2PETA 2HTLC 4PJ8D 1J0ZA 5B38B 1IAIM 1H3PH 2FEEI 2AJZA 5JXED 5I1CH 4XRCA 1DUZB 4LKCA 4JGJA 5AZ2H 2VLKA 4NT6A 4GS7C 4YAQB 4YO0B 5D6CB 3BWUC 4Q9QH 4L1DA 1KIPB 3PNWB 5TQ2H 5D1QA 1DVFB 2BVQA 5T1KA 5EU7C 4ZS6D 1N64L 1VACA 2OJZL 2GJ6A 2BSED 3DARA 4PJ9D 3MFFB 5C09A 4L8SB 4HUUA 4JVWA 2XZQL 1YC7A 2K7PA 4JHAL 1NGQH 3ULVF 3WXWH 2GJ6E 2VC2H 1FDLH 1KEMH 2AAVA 4N5UA 3RKPA 1CFTA 3SKMB 5F9OL 5FK9A 1CD8A 1HK6A 5GZNC 5HYSA 1N7ML 4UU9B 3GMPB 4YDIH 1CFSA 3GJFK 3LEVL 1S78C 4EJ1C 4XWOD 4K71B 3SDYH 2FGZA 1CD0A 3OR6A 3RGVA 2R9HC 3D2UA 2D7TH 3LQZA 3N1GC 4WI7A 2ICES 5ETUA 4OLWH 5HHVL 2IH1A 2J12B 2XZAH 4G3YL 1A6UL 4GLRH 4AEIH 3TPKA 2OJEA 4R96A 4XP5H 2DI9A 1EV2E 1IGYB 3SCMD 1TZIA 1BQHB 1U93A 1FSKC 1S9XB 3FOMB 5KOVC 1OAZH 1NMAH 4E41E 3MOAL 1SJEA 4AENB 4XI5C 4UQ3A 4CRPA 1QFPA 3RX7A 3U4EA 3HE7B 4GKZB 3NIGE 4Q9BA 4NBZB 1XIWB 3WMSA 3QCUL 4IIQB 5MHSD 4PJCB 1CLOL 2KUTA 2QQKL 2Q6WB 1QQDA 3ZKNC 2VLME 4L9LC 1KT2A 2IAMB 1G7LA 3RUGB 2B4CC 5FB8B 3LAFA 3MJGX 4PRBB 5TGBA 3ILPB 3MJ9L 1MCWW 3B6SB 4M00A 3K46A 3MRNB 1XF5A 3GO1H 3ROOA 3VA2C 3WNOA 1YMME 2YXMA 3EAKA 2VR4A 5K9OB 2IFFH 4M1DL 2WIIB 4MCYA 4NQDB 2AEIT 4L8SA 4WO4B 1BX2A 1FORH 1KFAL 3HFML 3LN5A 1I9JH 4IRSA 4LVHC 4WDIA 4EDWH 4XNQA 1A7BA 1BD2E 5L88H 3OB0K 2ED7A 2G9HA 3PIQA 3CXHJ 2AEPH 5FCUH 3KNBB 1MCEA 3P0GB 3VXSD 4BSVB 1F2XK 5IIEB 4LMQE 1ZK9A 1AO7E 4PJ8B 4DKEL 5I1HH 1EXUB 1OAKL 2HN7A 5C0BA 4GQPH 4Y5XC 2CIKA 1TNNA 4FHBD 3LMJL 3QIUD 3VXMB 1V3MA 1FRGH 2HYMA 1D5XB 2CUHA 5ABDE 3P11L 4R96B 4V1DD 1PG7X 2ICWI 3EO0B 4PTTB 3QA3B 2QHLA 1WGOA 4LRIA 2CMRL 5CGYD 1BFVL 3ULVC 2YA2A 1NEUA 1QHOA 4DVRH 1M7DB 5JQHC 1X5XA 3QDJD 4XMLL 1KJ3L 4XBGA 3Q5YA 3F58H 4RWYL 5EN2A 3S4SB 4E9LA 1NBVH 3OF6A 2DD8H 1BQLH 4LASH 1NJ9B 3DHMA 5C7XH 2CKBH 5I8OH 1FVCA 1L0XA 1F42A 5IW1B 3TNNB 4DZ8A 4OLZH 3U36A 4O2CA 5CEYA 2EKSA 3CLEH 5C0AB 4E41D 4Z5RA 3LKOB 3CPLA 1NGZA 2H32B 2P5WB 4D9QE 3GMPA 3HFMH 4ZTOH 3EFDL 3ARPA 3TYFA 5IHBA 1AFVH 3CFKB 5BZWB 3R06B 3CXHK 1T03H 5E24E 1CDHA 3FJTA 1B6DA 4JFDA 4HS6B 2J8UF 4DUVA 3EOBB 3EYOA 5DEGA 3BDBA 5HDBE 1SM3H 3B9KD 5J6HA 1D5XA 5K9JL 4XAKE 3RBGA 3JWOL 4QTIH 4G6KL 4ZNEA 1UJTA 4G80A 3ROOB 4PJHE 1YEFL 3HRZB 1S5IH 4DVRL 4QRPB 2OTPA 1T5XB 1VGEL 5ICXB 5C0GA 3EO9H 5SWSD 5TE4L 1U58B 4NNXA 1DQMH 2GHWB 4OF3A 1R3JA 4M7LH 4KAQL 4Z7QF 5D1XB 4RQQA 15C8H 1PEZA 3DHJA 3K8KA 2XACC 2IPTH 4POZD 4YQXL 2GTWA 1NBYB 4O02L 3BEVB 1D5MA 1H15B 4LGPB 1VSCA 4RFOH 3K4ZA 3P30H 3VXNA 4ZUTA 3WFHB 1RZFH 1CGSH 1S7VA 5EPMA 2YS4A 4HKXA 4XGZB 4Q74A 2XA8L 3BD3A 4HXBL 4MXWL 5C0IA 2O61B 2DTSA 3GIZH 4JRWA 3UPAA 1MCCA 2A6KA 4JO1H 3MV9A 4MS8C 4N8VA 1GGBH 1TJGL 5I30H 3QFDA 4Q9QL 2ARJB 3ARZA 4QXUL 1LP9E 4RNRA 2OQJA 3I6GB 4OLUL 3GSQA 5DJDA 1CT8A 4ENEC 4KRLB 2A6JB 1EVTC 3LS5L 3STZA 1A7PL 1F90H 2OTUB 2ZUSA 4JCMA 3MFGB 4KK9C 4WI9A 5F7NC 2AV7A 5ETUB 1E6OL 1WC7A 4JCLA 4EI5A 3D39D 3IU4L 4G80B 3GMOB 5E94B 1CXKA 1RV6X 1N3NB 2XY2A 3SGJC 1NCCH 3BXNB 3PWJB 5F88A 1DQML 2BVPB 4L9LA 2FCBA 4WU5B 5HYIA 2DQEH 2EIZA 3T0ED 2APTA 3QEQE 2W65A 5IUSA 1JPSL 5EU3B 2CUIA 1BGXH 1OAYH 2RGSA 1FGVH 5IB1B 5KVEH 4ZFFB 1KPVB 1ZANH 1MEXH 1F02I 4QXGL 3SE3C 1RUQH 3CDCA 2ADIA 1XGQA 4P5TB 2JK5A 3RAJL 1WCQA 3IJHB 4QTIL 1GGYA 3FZUD 4PLJD 1QRNA 3KS0J 3QUZB 2IFGA 4NPYB 4UT9H 3WJLC 1WV7T 4X8JA 5DQJB 1ZLSL 1DQDH 4OLXL 1BJ1J 3KAAA 2X4RA 4HCRH 1VKXB 5HHQB 2A6KB 3H8NA 4MCZA 2DWDA 3GSNA 5DRWA 5TFSH 3QPQD 3L3JA 3OX8A 3EGSB 2P24A 5EWIH 3X3FH 4MA1C 3QXTA 3UJTL 3LY6A 4I0KA 3NCJH 3IF1B 3QDME 5MI0C 3K4AA 3LEXB 4XVTH 5IEHA 3A6OA 4LLYA 3STZB 2JB6A 4K2UL 3WUWA 1QSEB 5TF1L 4AZ8A 3GBNH 3FQXB 4QHUA 1RZ7H 2OR8A 2HT4C 4RDQF 4G3YH 2VOTA 1DBBL 1KJVA 1BQUA 4GAGL 3LIZL 4W4OC 1OGAA 2FGWL 3FB8B 5A3IC 3WO4B 3SJVE 4O2FA 1D5MB 1JGVH 1H15A 4ODVH 4DGYL 3MA9L 4XBGB 4B5EA 3MACL 1JGUL 1IKFH 1INQA 2P47B 2VH5H 3PDDA 4JO3H 5I66B 3IDIA 2Z31D 4YFEA 3DMMC 3QULB 1FO0L 3QUYD 2ADGB 4C56E 2V2XA 5TE6L 2RBLA 4MXQC 4M3JA 3FOLA 2AJUH 4X7SL 4O2CB 5CEYB 4ZFGL 1F4YH 4JREC 3T3MF 5KJRL 3WDJA 1WFOA 4U1JB 2AW2A 4ENED 2HVJB 4YHMH 1A21A 1VA9A 3H9SD 2EEBA 3L3HB 5H37H 3TO2B 1TTGA 4R90L 3QFJD 1V7MH 2Z4QB 4N9GB 5J89A 1F5WA 4WUUB 5FFLA 3MROA 5D96C 3TYGL 1YMHA 3UC0L 3QQ4B 1HHKA 5BVPH 3BH8B 3T2NL 1K4CB 1XR8A 1ZTXH 3QCTL 3U6RB 4WW1A 5ICZB 2RIKA 4OKVB 1OP5H 3EDFA 3LKQA 3TN0A 4A6YH 1X9QA 5F1IA 4N0YL 2ERJB 1CFBA 2LV4A 5TDPB 2EDQA 2FX9L 5IMOB 4LAQH 3PG2A 1NQBA 1SMOA 2VXUL 4EXKA 2WUBH 3TCXA 1KEML 1OTTC 4Z7VF 1G9MC 3U1SH 4K71C 5F96H 2H8PB 3CFEA 3LZFH 3VW3H 1IT9L 1JNHB 3O2WH 1GCFA 1P7QD 2HG5B 5HTSA 1I85C 1B3JA 1FC2D 1AKJB 1NEZB 4MX7B 1ND0A 5I73C 2VLRE 4P2QB 1ZEAH 1IAIL 1MHCB 3RVTC 2DQTH 4X6CB 1EO8L 3FHQA 2EEAA 3MRCA 4U6YB 2IBZX 1H3TA 4FN0A 2AKRB 5C7XL 4PJBE 3IVKA 4Z7WF 5DJZA 5JA9A 3H9HA 1HHIB 5D8JH 2L4OA 2D03L 5GHWL 4Y5XB 4LF3A 4NZTL 4WW2C 1AXTH 2KZ1B 4M43L 5L6YH 4RMWA 1CYGA 3DUHA 4TSBH 2D7QA 4R26H 3ZYOA 1BHGA 5BS0E 1P84K 2P7TA 4KUCF 4QRQB 4X98A 1QA9A 3FO9B 4FS0A 4D0BA 2NTFB 4GO6B 5I75C 2G5BA 3BD5A 5CMAA 4QRRD 5D72H 3TWCL 5DD3L 1F4AA 3GIVA 3RWIB 4U0QB 4XB8A 1YEHL 4A6YL 4OCWL 2H26B 3IFOB 2WBJA 1T6WA 5D2NC 5I18L 1NFIB 5DTFB 4FQ1H 5TDPA 1UM6L 1YN7B 4Z7NF 4D3CH 4ODSH 2X89A 2D9CA 3H9SB 3UTSA 5LWYL 1GIGH 2UWEF 3GO1L 3CSBA 4EDWL 2XFXB 4NQDD 4PG9A 3OKOA 4KHTH 2QHRH 2AJSL 3K80A 4FQJL 2H8PA 3HMXA 4RX4D 4OFKA 3JTTA 5C0BE 4M7ZC 1V3JA 2BVPA 2BX5A 1XF1A 4JFFA 3QIBB 2V5TA 2DLHA 2IH3A 4DKDC 3LPWA 2A77L 4GRMA 2FJGA 4NO3B 1ZGLP 3VXTB 5F8QC 1IKNC 2NYYC 4UMGA 3RDTB 4OD3L 5ICZA 3AU1B 3SQOL 2ARJQ 5GS1C 1G9EA 4R4FH 4XPAL 4HAFA 5IVXE 3GBMH 4CVXA 5HGDB 4LEXL 1CN4A 3NGBB 1A6AB 5F6IC 4DN3L 3RNQA 2LTQC 4Z7VE 4BFIB 1IM3A 4L4VE 2EYTA 5EOCL 2UUDK 4PRAA 5EFIB 5JPMB 1E0OB 1X4YA 3MLRH 1HHHA 1SJEB 5CJQH 2WQRA 3BKML 3ARTA 1YEIL 2WSKA 2BNRE 2E7LA 3CFDA 1UWGH 1XGTA 1AHWC 2G2RA 4GRLB 5GSVB 2IWGA 5DUPH 4Q6IA 2VXSL 2XV6B 2Q3ZA 4FMFA 4P5MA 5GS2H 2WINA 1YQ2A 1OD9A 5CSGA 5E2UL 3TZVD 1SVZA 5IV2B 2HMID 1NMBL 4Z8FH 1G7IA 3VI4F 3BT2H 3ROLB 1MJ7H 2EDYA 2QHRL 3E6HA 5EBMA 1WBZB 5L0QB 2OZ4H 3MRNA 1LDSA 4NJ9L 2Y06L 5L2KA 3B3IB 3VXRD 5EO0A 4JE4B 2X4QB 2N7BA 1N2RB 4V2BA 3V52L 2XT1B 5EU6E 4HF5L 3BISA 2GJJA 5ID1B 1FJ1B 4XCYB 3TEUA 3GJFB 4JRXA 4Z7UB 1RVFL 3LKPA 4I9WE 1TTUA 3MREA 1OAYL 3ARDD 2E3VA 5DMKA 1CE1H 5EOQH 1HWGB 2ZUYA 2CLRA 2WLZA 3MRKA 1T66C 3RNKA 4OJFL 4V1DA 4X7CC 5IHUH 5DMGD 4Z7WB 3KLAB 2VLLB 1Q9KA 1V05A 4I3RL 4M7KL 3MUHL 1CDYA 1JRHI 1IM3B 3I3BA 4PJXA 5H94B 3B9EA 2LVEA 2WP3O 4GKNA 4AL8H 3MRBB 4FFYH 3F7QA 4JDZA 3L3IA 3V7AE 3BKYH 1INEL 3KPOA 3WHE0 5E5RB 5C0EB 2XXCB 1IC5H 3EYUL 5KS9E 2DD8L 4JKPL 5J11C 4BKLB 3TN0C 4Z78A 12E8H 3PGCA 2MNUA 5L7XH 3DSFH 3W81A 1K4CA 1XR8B 4PD4J 5D1QC 1KCRL 1OF2A 1XZ0A 4U7KA 1SYVA 3RKDC 4K94C 1A6WH 5T1DH 4M9PA 1FCCA 1TQBC 1B4RA 3WXVL 3KLSA 5J6GB 4KZEH 3RWGA 2EKJA 4XPTL 5DD0L 5IP4A 1KCRH 1T83C 2APFA 2CD0A 4G6AC 4AIZB 3DVFA 3L5WB 4X0KB 4ZS7H 3HRZA 2ZUUA 1AFVL 4GW1B 4HIHA 3ALWA 3BI9X 1LO3L 1UH2A 2AP2A 2VXQH 1DSFL 1CD9B 1U3YA 3VFSB 2F5AL 5KSUB 2ZSVB 3LKPB 4LSRH 4LKXB 1FFNB 5CEZH 2C4FT 1BAFH 2HAZA 2VH5L 4MJIA 3WNLA 1CQYA 3KR3L 4XNYL 3N06B 4WWKC 1XGTB 5FGRA 3RVXC 3K8LA 2E9JA 3HC0A 3AFLA 4R3SA 5JPNA 4MA8H 1P5UA 4HFUH 4YUEL 1OPGH 2Q76A 4XHQA 1A9EB 3U30B 3UBXB 5CZVL 2DI8A 3IJSA 2Q8AH 1XF3A 3VFWA 3VXRE 1U3HD 2WNGA 4XC3L 5ADOL 2OL3B 4CL7A 2DLIA 2X05A 5JOPD 4GBXD 3NZHL 4OTXH 2OZ4L 5IK3B 4Y89A 3FQTB 3G5ZB 3JWDC 5F9DC 1W8NA 2HKFH 1EEYB 5GRVL 3FN3A 3IDYC 3WEXB 1IBGH 3I3EA 5C0IB 4P5MB 3CSGA 5JUEL 1KF9B 3HRPA 3ORJA 5HPMB 3QXDB 1M4KA 4P4KB 2DJSA 3D2UD 1CE6A 1MCHA 3GB7B 1GJIA 3FQRB 1XZ0B 4W6WB 4OZHE 4KKAC 3B3IA 4PB0L 4EN3D 4IRJD 1GPOH 3CXDL 1AGFA 4PFEA 1PFCA 1KLGA 1AQKL 1YY9D 4DZBA 2EXYD 3DGGB 1GHFH 1D5IH 3U0TA 3KPMB 2ESVE 3RIFK 1A0QH 2PW1B 1ZVYA 5IHUL 4PJXB 4N8VG 4HKXB 3QI9B 3PWVB 3IGAB 4O58H 2UVEA 4I18C 5EZLB 5KSAD 3UYPA 1FFNA 4W4NA 1M71A 2QSVA 3ES6B 2VDNL 4LU5H 1OSZA 2DMCA 1CL7L 5DC4B 3MXVL 1QSED 4M5YL 2O5YL 1PDKA 2PO6A 5ID0B 4GKNB 5DFWH 5LAXA 4J6RL 3IDNB 5I8CB 5T1MB 2DYPB 1C12A 1ZLWH 2NY5H 4FABH 3ZTNH 3QJHA 3VH8G 3U4EB 3QXUA 3IJHA 4UNUA 3BQUA 1BD2A 4LCIH 4CAGA 5AD0A 2R56H 4BZ1H 4IMLB 2WQ8A 5DVKA 3WBDA 3KPLA 3CMOL 3OQ3B 1NBQA 1W2KT 1YPZA 2YMXL 3QUZD 5DK2A 2VKWA 3QO1B 5KSUA 4Q97A 3BDYH 3HZYA 1LO5A 4KI5E 4M6AA 1QPXA 2J8UE 4Y1AE 4AIZA 3BPLC 4BFBD 3QIWD 2Z91B 1SYSB 1T5WB 4Q6IB 5IBUG 1B4JH 5IMLA 2NQCA 2E7BA 2O5ZH 5EZJA 1Z9MA 3EFDH 1O7SA 3VXOA 3EZJB 1PLGH 4OUOA 3CU7A 4KROC 4FNLL 3VE0A 2OL3A 3O6LL 4HX1A 5E2TL 3MJ8A 3CSYB 1RU9L 1Q72H 5K59F 1JJUA 1N6QL 4ODUA 2XN9D 1T21B 4L5FH 5E6YA 1BQHG 1E4XH 1WT5A 3BJ91 4BQ6A 5IFAH 1D6VL 3H7BA 3X11B 3V9FA 4CW1A 5EORL 1JWUA 1B0RB 4XVUD 2VYRE 3VCLA 2B2XL 2WK2A 1K3ZA 3BGFB 2GK0A 1KGCD 1I8MA 3V0VB 3IDMA 5C6WH 2A6IA 4K7PX 1KCVH 4PTUA 5CKAA 2HTKD 2NY5L 1EJ6A 3FT2A 5DUMH 5C3LD 3BW9A 4UDTB 2BVUA 4QOKA 2NYYD 2ITDB 4G6KH 1A6PA 1B88A 3TIDB 4OCMC 2HJLB 2P8MA 4XCNA 2HVJA 4X7DC 3B9AA 3G9VA 2ENYA 4L29B 4NQUA 4G9FA 4OF6A 4I8DA 2WUCH 3C5SB 4R4BA 4WI5A 2R1XB 3K81A 4Y16B 3U36B 1YMHB 4X6CF 1EUTA 5EIIB 1FIGL 1CF8H 1YQVH 1NGXA 2J88H 2P48B 4K23H 1ZLVH 4H1LA 4FFVD 4BZYA 5FDYA 3DURA 5EO1B 4P2CG 1RULL 5HHMB 2P5EB 3CU1A 4XHJC 1NCCL 1OOAA 5KN5B 1FFOA 4HIXH 4DKFL 4X0KA 1UEMA 2IALA 12E8L 4P99A 5T3XD 3MNWA 5EORH 4JFDB 1JNHA 2D7MA 4ZYKA 4YR6A 5ILTL 4G6ML 4I3GA 3MLPA 2G9HB 2B0SH 3NFSL 2M26A 3TWCH 4NQEE 4EBQH 3BWAA 4BSVA 3REWB 5IMLB 3GSOB 5I18H 4Y4KD 4ALAL 1P1ZB 1J10A 3DO7A 4OD2B 2Q3AA 4W81A 4CKVX 2V9TA 3DRQA 4NNXB 2BOBB 1I3GL 3OJ2C 2CH8A 4KRPC 3PJSA 4HT1H 3GK8L 1RZKL 1S8DB 3PDOB 3PHQA 3A6BL 1BMGA 4Z0BH 1X5ZA 4LGRB 2HFFA 2HT3D 1C16B 4ORGA 4E5XA 5DTFA 2F53A 5B38G 1QBLL 1TXKA 4Y16A 1S7XB 4MDIA 3QFJB 5D5ME 4JG1H 5FCUL 5DGQA 2HVKA 3C5JB 3W9DA 3BPOB 2D4FA 2OI9C 3JWOH 2GITB 2WWKO 3ARFC 2BSSA 4HIJA 2NNAB 4NFCA 2YRLA 2OMBA 3T8XB 5EIQA 4GLRI 1VGEH 5HHOB 2E7MA 4G9FE 4FXGA 1TCRB 5D2LF 5J9PA 3VG9B 3ULVH 1F45A 4UT9L 2JIXA 3TO4A 3M17A 1Z5LB 2EH7H 5D2LA 1P4LB 4QEGA 3ALPA 3O81A 1HSAA 4PJDA 43C9B 4LF3B 4G8GD 4APQC 3JWDL 4U1SB 2GSIA 1IGCL 4L4TB 5B39G 2Z31B 5FHAH 2Z0BA 1TPXB 4GW5B 4HWEL 4NO2B 5FO9B 4NZJA 5H8DA 3LEYH 4L4TE 1RJZB 5JXEA 1IE5A 3WDIA 1DTUA 2MHAA 2LU7A 3EUUA 1MELA 3KPQB 4M5YH 1T89C 3KR3H 4PJIA 1S9YA 3VGFA 3ZHLA 1QO3B 1EBAA 1K9TA 4G9FB 3O6KL 3PQYE 4PS4L 3DURB 4OLZL 1WK0A 3ULUF 4IOIB 1QHPA 3VXSB 4G7VH 1UZ6F 1ED3B 1NCBL 5CJ8A 5ICYA 3RQ3A 3LIZH 1T4KA 4ZD3H 2R2BB 2X4UA 4N5EC 3RVUD 1MHEB 2X40A 4J7RA 1X6LA 1NUGA 4J2XA 2BSRA 2X7LB 3ZE2E 5FO8A 3UTTA 1CICB 4H8WH 2VLJA 5MEOA 4FTVE 5CKGA 5ISZB 3ARFB 3ZT7A 2Z35B 5E6ID 1E4KC 4JQXC 4K55A 3O41A 2JJSC 4QWWC 4PGBA 3NACH 4YPJA 3ZKMD 4DQOH 2EIBA 5J9PB 1OAZL 1F58H 1S5HA 4M5ZL 4HWBA 1KB9K 4ZSOA 1BFOA 3H2WA 3N1FC 4R7DB 1XIWD 3TIEA 3VDAA 2EDTA 3V0WH 1IL1A 2C3HA 3Q0HA 1BAFL 2DQHH 3DYPA 4YXKH 3S3JA 4QGYA 1LDPH 2OM5A 1FNGB 4HIIB 1T21A 1KC5L 4TTDD 2R29L 3SCMB 3H7BB 4HJ0C 4FZEL 1ZSDB 3A6BH 5DQDL 1EFXB 3DYOA 3QZWG 1FP5A 5C08B 2DMBA 2NXYC 2CXKA 2QSQA 2MSPA 1MWAL 1DE4B 2QADC 3L7FA 5SWZD 3BPLB 3SBWC 2XNAB 4GG6F 5DD0H 4L3AA 1HHJA 3O9WC 1J05A 1RZ8A 4J23A 1T1ZA 5L2JB 4QRTB 4S0SD 2VDKH 2EXWD 4B7IA 5CIPA 3OBAA 3DXAE 4I0PB 3GDBA 3GMOA 5DT1L 1QG3A 5JHDE 1BQHA 2GSIB 4YHOH 4PJ9B 3ARGA 4ERSH 1B9ZA 3LCYA 1ADQL 5C71A 3SGDI 4Z7OE 1JF1B 4LPXA 3MV8E 4F37F 4XXCC 3REVB 1QR1B 1MH5A 5DJCA 2HJFB 2R1YB 3BIBX 4P2YA 4MA3A 1WBYA 2BJML 1ZT1B 1I1YA 1KT2B 2DKSA 5CJBA 4R0LB 4X80H 1D5IL 1E4KA 3QO0B 4JQXA 2WM0A 5HDLA 3O6ML 2ENSA 1TJIL 2C26A 4Z6AT 4JHBA 2NXZC 5FO9A 1FNLA 1WIOA 1WAAF 2VR9A 5DQ9B 4JR9H 4JPIB 4KPHL 1ZA3B 3HTLX 4I18B 2IJ0C 3MR9B 3O6KH 4P5TA 3WFCH 1A14L 5B22A 2NY4B 4YXLL 4M02A 5CD5D 2GSGA 3G08A 2VLRD 4I3SL 1AGBB 1FZKA 4L8BB 4HFWB 1XCTA 2VZ3A 2AJ3B 2R23A 3RVUC 5C1MB 1RUPH 3RGVD 4JPWL 2DWDB 5DRWB 1SY6A 2Y25A 3FQTA 3G5ZA 4U0RC 5FO8B 1UCTA 2JKXA 4MJIE 3S36X 2LVCA 5EULV 3UTPE 3BZEA 5HD8D 1AY1H 2OXGA 2IGFH 2BC4B 1WZ1H 2AVGA 3O8XB 4NZRL 1MCNA 3S6CA 2DRUA 4PP2A 3UBXI 1CLZH 3VFNA 3VJ6A 4DVBB 2J6EH 3AXLB 3NVQA 2R0ZH 5EH1A 5IMKB 2FX8L 3V2AR 3JBG7 4OI9A 3EYFB 3TV3L 1TJGH 3T1FA 3PJSB 1U3HB 2PUQT 4LSTH 4YZFE 4YC2B 3F58L 4OZ4B 5AYUH 1CDCA 2DQCL 5D1ZB 5DUBB 3P9MA 4HCRL 2EO9A 3MLTA 5CEZL 3SO5A 1CFVL 5C0JB 1PD6A 4PBWD 2JF1A 2X1WL 3GMRB 3SKJL 2VERN 2IANA 4YK4C 5DO2D 1K3IA 3MRHA 1J88A 2DDQH 5IWLC 4MA3B 4GRWF 3LV3B 3FQRA 5B8CB 4G8FB 1NFDE 2VXUH 2IQ9H 5F3HB 3ZE0E 1GXEA 2GITA 1CZ8L 4HJGA 4WWKB 3HA0A 3FO1B 3T77B 1UCBH 4JR9L 5TF1H 3SKUD 1JPFA 4JO4H 2Q8BH 3IJSB 1A1NA 4XNXH 3V5DB 1P7KB 4G7YL 3MRQA 4XP9L 3WIHL 2YUXA 2E6QA 2X9XA 4IRZH 1PY4A 5JXEC 2P5WA 1XMWA 4JFXB 2PTTB 1QBMH 1BQSA 5CBAA 3LS4L 3V6OA 1H5BC 1DLFL 5LAXB 3CCHA 4XMPL 1X5AA 5DUML 4WEUD 1MH5B 5DJCB 2FHCA 2EIDA 1RK1A 1S7QA 4MD4B 4LNVA 3WIIL 1J5OL 3U4AA 3B8SA 3KWWB 4NKIH 3MC0A 3SDDB 4KTYA 1X3DA 3V95A 1FNAA 4H25A 5SV3A 1KLUA 3EOAB 3TN0B 3AS0A 3O2WL 1JF1A 5L2KE 1A7NL 6FABH 2VWEE 3GMLA 3VI3F 3QIBA 5TPWL 4ZUSA 1NAKH 5L9DH 5FV1L 4S1DC 4PJGE 3IDJB 4JZOB 4OCRH 4PJAF 2DQJL 4MJID 3NTCH 3RFZC 2I26N 2R9HD 5I1HL 1JNLH 1JTTA 1GRWA 4XCFH 43CAB 4ZFOL 2FO4B 5ICXA 3VWJC 1Z9LA 3RL1A 3UYOD 3W5NA 3IKCA 2AJVH 3MOBL 1YEHH 1P53A 4WFGE 2IF7A 2XY1A 4PP1C 4HHAB 2QSCH 2JCCF 3RNQB 3INUL 1OTUC 2CLZA 3E8UL 3HZMB 4U6YA 4FXLA 1A3LL 4PP2B 3KLDA 2P4AB 2W0KA 4WY7L 5FECA 1MQKL 4IRSB 4NO5A 4WDIB 3DXAD 3VFGH 1V5JA 1BFOB 1XGPB 1RSFA 4KQ3H 2J2ZA 3IDYB 1MRDH 4I4WB 1IL1B 2F5AH 1PKQA 1S7TB 2EEDA 2FX8H 1T04B 4EOWH 3VFGL 3QEGL 5C07B 4ODHL 1MCLA 4XP4L 1PG7W 4JKKA 3HI6H 3V5KA 4HK0A 1JTOA 1EO8H 4FP8H 5DK0A 5I16A 3HZYB 5HI3D 5B8CA 2IG2H 1FZJA 3C6LD 5F7HA 4QRRB 1AHWB 5HI5D 3PL6C 4YLQT 4U1KA 2MQ3A 2V5MA 3WNNA 4AM0B 4BELD 5HVFB 5C0CD 1DSFH 3O4LB 1ZLWK 4MNGA 1G0YR 1SY6L 2XN9A 1OCWH 3CH1B 5IB4A 3TA3C 4XVJL 4YPGA 4MD5A 5E6IB 1ZT4B 3O0RL 5GGVH 3X13A 3KXFA 4LMQI 2DIBA 4PJAB 4IBLT 2FBOJ 1FG9C 4P9MH 5KVDL 3JTTB 3ARGB 1G6RB 3SQOH 4WIQA 3G5YA 1FHGA 1DBAH 4K94H 5KG9B 3MV9B 2QQLH 4FQ2H 5CGYC 2RHEA 3FB5B 3LN4B 4QTHB 1I1YB 2UYLA 1BIIA 3CPLB 1JGDB 1SJVA 1NFDF 3AREB 3PXHA 1OGAD 4X7TA 1OTSC 1ETZB 1P7HL 4U1GB 4LPUA 3CAFA 2GAZB 1XH3A 2V7NB 3DRTB 2QQKH 4QWWD 4RMTA 5KVFL 4G9FD 1S7RB 4CBPA 5DWUL 1IJ9A 4U3HA 5DHVB 3N50A 4ZNCD 5AZEL 2FECI 2EYTB 2Z8RA 1M6OA 4PJBA 5HYJD 1EA9C 3HNSH 2HRPH 3RVWD 1VPOH 1J1PH 1A6AA 3C09C 3Q1SL 5J3HD 4GH7B 5F44A 3ARBD 2OSLB 3BZFA 4XB7A 4ZFZB 2CIIA 2H6PA 1EHLH 5CFHA 1UA6L 4KROD 3GSOA 3DGCR 1T20B 4QHMA 4LEOB 3MNVB 1DEEA 1JYVA 4HF5H 2FGWH 3MUGA 4MNGB 4I0PC 3MRMB 5HHOD 5JORA 3SGDH 2DQCH 4U33A 2YD4A 4S0TD 4MMZC 1R5IB 1OGAB 4GW4B 3BDYL 4X5LA 4ZMAT 3QEHA 1A7PH 1F90L 3G04B 4K3JL 3Q5TA 2PYEB 4ZQKA 4OLUH 4LHUG 4L4VB 4KKNA 5EOTB 1DQTA 1KG0B 1R0AH 2NY6D 1P2CA 1CLYL 1WAAE 2Z93B 5E9DE 2VXSH 2J8UA 1CFTB 1U8JB 4GFTB 4HJJL 3QDJB 2IPUK 3VFPB 3PHOA 1BFSA 4NQCE 4JFPB 2JCCA 3GIZL 3IJYA 5SWSE 1J87A 3I50H 3UCRA 1NCBH 5BOPA 3M17B 4H26B 3OJMB 1B0GB 2NY2C 4AEHL 1NCDL 2W9DH 3LB6D 3ZMRA 3RJQB 1QYGL 4OV5B 3QUMB 4CMMA 1EAJA 4YFLF 5LGJA 1QBAA 5CBAB 4NO2A 2OR7A 1R3KA 3FAXA 3BUYA 4M8QA 4PY7B 3QIUA 5AUMA 4JHWH 1FVDB 2LU4A 1ED3A 4X9FA 1ONQA 2F9BT 5IMOA 3V79C 1U8LB 2XZAL 4H0HB 2WAHA 2YK1H 4IJ3B 4KKCC 4X6FB 3VGEA 3HI5L 1CCZA 1ZT4A 3FB5A 2AK1L 5IQ7L 3QIBC 5F1IB 3OJDB 2HG5A 4W6YB 4IHOA 4NKOA 1U92A 3IETA 3PWNA 1FG2A 3PV6B 1HHGB 5T5NG 1T7XA 3DVNB 4PJBF 3GMMB 4WI8A 4LSTL 5ESVB 3BYTA 5HGAA 1OLLA 5IVZB 1Z9OA 5MP6L 3HNSL 2VJXA 3SGJA 4NRYB 3DNKA 1GC1H 4PRBA 1KG0A 5C0CB 3CX2A 1C12B 4AMKH 5D2NB 1KXQE 5MEND 1JZ7A 4EVNB 4UI2A 4YBQC 2R69H 4JDVA 1KTLA 4D0CA 1DBBH 1QRNB 3DMMB 2WIIA 1YNTA 4NQDA 5CILH 5C0CE 4HSQA 4QRUB 1CGYA 4PJBB 4KRPD 1FYTB 1LE5A 3PUCA 5IROA 2DQFB 3LOWA 1J1XL 3S37X 1W72H 3KPSE 4P23D 2D7TL 2H45A 2AEPL 4UOW1 2CIIB 2A0LD 1EAPB 1F8TH 5DD5H 3C08L 3U46A 3IF1A 2BY3A 1RULH 2I07A 4JO2H 3OZ9H 3QDGE 1NGPH 1EFXA 2PYEA 4NIKB 4R4FL 1U91A 3OKKB 4HXAH 2YK1L 2MCPL 4PJ5D 1VADB 1AKJA 2V9QA 1ND0B 2AXGB 5E08L 3QISA 1KCSL 4U6HA 2YPLE 3QQNA 4DKFH 4PLOB 3HR6A 2Y4SA 3HI1A 4PGZA 4DZ8B 2NY2B 4JY5L 4HUVA 1FL3B 2OMNA 4OQ1A 4YDJA 5KSBA 5JIKA 4OI7A 1UXSA 1B6UA 1U3JA 2CRIA 5IB4B 1OWWA 3EDEA 3DSFL 2UWEB 3N0PB 5M95B 1ZHLB 3DO3A 3WFBH 2UUDH 2OK0L 3THML 4YDLB 3SOBH 4OUUA 5F89B 3LB6C 1I9RH 4MNQA 4GXVH 5JW5B 3G5YB 1UYWL 3HLAB 4JRYD 1I3RA 4CN1A 1M71B 4JM2F 5GQBA 3I9GH 3JVGC 3MRRB 4HS3A 1N8ZA 5D7IF 1BEYL 5CP7A 1JK8B 5C9JB 1E4XL 2G75A 2X70A 3H42L 3O2DL 2W07A 5I8CA 4DTGH 2R1XA 3D9AH 3ULUC 1VGKB 3PWLA 3WS6C 1HHGA 1BZQK 4QXUH 3PV7A 4JHZA 4ISVA 1NUNB 1J8HA 1QBLH 4HQQL 4J8RB 3SJVB 2A74A 1PQZA 3B9KB 5CCKL 4Y4KA 1FN4A 4PGCB 3D39A 4M62H 1YA5A 2P44B 2VAAA 1XR9A 2Z8WC 4NQCD 1KJMB 3DWTA 4MZ3A 3VXTA 3VRJB 4R8WL 2X4QA 1I9EA 1OTTD 5E5MA 2X4TA 4RX4A 4WFHE 5EZJB 1QBBA 5BZDA 4LEOA 5CD3A 5AZEH 3QDMB 4FFYL 5DD6A 4PJHA 2I9LA 5HI5C 1UB6A 4NCC1 4U1GC 3C87A 5F6HI 2GI7A 5D1XA 3SBWA 3QDGD 3KLHD 2NW3B 3KYAA 1R3IH 4WFED 2P43B 5FYJL 2ADJA 3X14A 4BM7A 1NBYA 1EAPA 5F89A 2AQ2A 1RZ7L 2CDEA 3E8UH 3TCLA 3BRFA 4LNRA 5F8RC 1XGYH 2PN5A 4I0CC 5BQ7B 2Z93A 1I7RB 4AG4H 3RIAF 2YUVA 3BD4A 4JM2B 3P4MB 1QSFA 5FYKH 4MJ6A 5GS1A 4DTGL 2HFEA 3O2DH 4EDXB 1T2JA 3OPZH 3RX8A 5DJXA 3IKKA 4Z78B 1T22A 2KZWA 3C5JA 3W9DB 5EO9B 1NFDB 4ISVB 3TVMC 4BUGA 4JAMB 1T7YA 5K9JH 4RMUA 5ACZB 4UTAL 1K8DB 5J1AB 4F58H 1W72A 4P5TC 5GRJL 4JKWA 1QFWM 2MJWA 4HZAA 3BN3B 3BUYB 5AUMB 3U30C 2Q1EA 3BH9A 5D71L 4X4ZA 5CJXC 3HUJF 5HGHB 1DUYA 3IDJA 1A6TA 4F15C 4OF7A 5GRWA 3W2DH 2AI0L 5F88B 4RGNC 4DW2L 1JGVL 4ODVL 4IOSD 3KPSD 5SX4I 1DEDA 3MBEA 3V5DA 3WFEH 2J1KA 3M07A 5FGBA 5IBLD 1ULVA 1TZHA 3MCG1 4I2XA 1IEAA 4LSPL 1FLTX 3T0EB 5HHVH 1IGYA 1UM4H 3ECBA 3NZ8B 1QLFA 3VXRB 3N1MC 4Y2DD 2XWBB 4PGJA 2A74B 1JHLL 2PXYC 3MLUH 4KJPD 1LVEA 3F7YB 1MJUL 2OJZH 5D1QB 1NAMH 3B43A 4PV9B 1MCSA 1ROWA 4MLIA 4LARH 3VH8B 4JM2A 4PRHD 1UKQA 4KPHH 4FFZH 4XPBH 5ELIA 5FDWA 1M7XA 5IWLA 3HNTH 3QUXB 3HE7D 2ATKA 2GT9B 2B20A 2VXTL 3V5KB 4J1UA 2DM4A 2WV3A 1FYTD 3VXMD 4CJ1A 4QHLB 1CICA 5F1NA 4PJGB 3S97C 1MFDH 4XP1H 5F9WC 3SDAC 2AXFA 4JFFE 5E8EA 2DICA 3BP6A 4WENB 3AM8C 3IFPA 5GIRB 3HMXH 5HYQB 2PO6D 2CDGB 3D48R 1KELH 1PZUB 3IDGA 2C9AA 3ESVF 3VRLE 1H5BB 1JGLL 4ZPTA 4W6XB 3QWRD 4WO4D 1YN6B 4HBCL 3CFIC 3MFFA 3QDAA 5C09B 3O45B 2Z8SA 4PJFF 1N4XH 3BQUC 4MXVF 4NWTH 3CH1A 5CSBA 3SHSA 1J8HE 2KH2B 4O5LL 2XTJE 5DGRA 5ESQB 3MV8D 1D7FA 1T1XB 1FFRA 3SGKA 5J7CC 5DZLA 1N4XL 5DJ8A 4OZGF 2JB5L 5EB9A 1NUFA 3RWHA 3P77A 4PJXF 3UEZA 4LSUH 1DZBA 2VWEC 4OGXL 4EI6A 3J7HA 5JXAH 4BH7B 1CZ8H 1BBDH 1N59B 1GOGA 2QL1A 3BMWA 3R06A 3QXDA 4KHTL 1AC0A 2EDOA 4Z7WA 2IAMC 1EPFA 1AD0A 1JIBA 2FIKA 1NCDH 8CGTA 4YFLI 1S9YB 3D1MC 4KI5D 4G5ZH 1KJ3H 5A40E 5TDNA 4OZHF 2BY1A 1NL0H 5EZOL 4BFGA 2HRLA 5AEAA 4LL9A 4WHCA 4F7EA 4FQLH 1JZ4A 8FABA 4HUKB 3LQZB 4ELKB 5BV7L 4GKZA 1VGKA 1NCWL 2JJTA 1MWAH 1CGUA 4Z5RB 1T66D 2AJYL 3GM8A 5A2IH 1D9KD 1ZT1A 3MUZ1 5GGTL 5F6IB 5SWQB 3BPNB 3QQ9C 4HH9A 1EEQA 5D1QD 1TZIB 5EUOE 1T0MA 4G6JL 4U0RB 5DMIL 4LPCA 2I60H 1E6JL 3HC3L 3IDGB 3MTRA 5K9QG 2OSLA 2I9TA 3IU3B