1GCPA

Crystal structure of vav sh3 domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
65
structure length
65
Chain Sequence
KMEVFQEYYGIPPPPGAFGPFLRLNPGDIVELTKAEAEHNWWEGRNTATNEVGWFPCNRVHPYVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VAV PROTO-ONCOGENE
publication title Novel recognition mode between Vav and Grb2 SH3 domains.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 9
structure length 65
sequence length 65
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gcpA00
2HSPA 1BU1A 5IHKA 3VS5A 1QWEA 1AOJA 2XMFA 1UECA 4JJBA 1QKWA 1U3OA 3O5ZA 2YUOA 1H8KA 1NM7A 1B3QA 4RTYA 1JO8A 1M3AA 1PNJA 5GJWB 2RQWA 1WFWA 1YP5A 1GFDA 1GFCA 2W10A 2NUZA 1YNZA 1UFFA 5IHNA 3EG3A 2LZ6B 2ABLA 2NWMA 4R0KA 1NLOC 4F17A 2KT1A 2M0YA 1W1FA 2MCNA 1NG2A 3RBBB 2J6OA 1PHTA 1UDLA 2LJ1A 2DBMA 2GGRA 5IHIA 1UTIA 2CSIA 1KJWA 1T3SA 2IIMA 4E6RA 1GBRA 1YN8A 2CH4A 2CUDA 2EYZA 2JM9A 2DL5A 4HVVA 4OMMA 1QKXA 2VVKA 4QT7A 1KIKA 1JU5C 1UE9A 2EGEA 1U5SA 1VA7A 1XOVA 3EG2A 2A28A 1I0CA 4AFUC 1W70A 1SEMA 4HVUA 1K4US 1X2KA 4OMPA 2LJ3A 3VS4A 3GBQA 2D0NA 3I35A 2YUNA 2LNHB 1NEBA 4DEYA 4FSSA 1B07A 2LP5A 4J9BA 1EFNA 3H0IA 4OMNA 2FPEA 1G83A 2O9VA 2L3PA 1ABOA 4AFQC 2RPNA 2C0OA 2CDTA 2DYBA 2PTKA 1NYGA 3M0SA 2RQRA 2OAWA 4JZ4A 5ECAA 1H92A 2J6FA 2A36A 1WXUA 2AZVA 2J6KA 1ZSGA 2ROLA 2RF0A 1WA7A 3NHNA 3TSWA 2J7IA 1UG1A 5L23A 1OPKA 2FEIA 2ED0A 1WYXA 2C0TA 1ZX6A 2OJ2A 2MOXA 3KFVA 1GCQA 3LH5A 2MIOA 4J9EA 3VS0A 4CC7A 1AEYA 3H0HA 2CREA 1X2QA 5EC7A 1K0SA 3M0QA 2FG0A 1X6BA 5FW9A 1I1JA 2KEAA 4JPBW 4LN2A 4Z89A 2L3SA 3UA6A 1K9AA 1UUEA 4EIKA 1G2BA 2FRWA 4AG2C 1E6HA 2DJQA 2YDLA 1M3BA 2DNUA 2VWFA 1BB9A 4RTVA 2DX1A 2ESWA 1AWXA 4F16A 2KT8A 1SRLA 4CC2A 2DL4A 3VS2A 5IXFA 1Y57A 1GRIA 1QWFA 2BZYA 2KGTA 1K0XA 2CH4W 2KXCA 3VS1A 1N5ZA 3VRYA 2J06A 2KRMA 3I9QA 2LQNA 2DL7A 1BBZA 1K1ZA 3A98A 4AFSC 1TUCA 2AKLA 1OPLA 2EGCA 4WCIA 2P4RA 4RTXA 2C0IA 1HD3A 2DVJA 2BZXA 1T0HA 4J9GA 2K79A 4RUGA 2CT4A 1RI9A 4J9HA 2KYBA 4K11A 3REBB 4HCKA 1M3CA 2G6FX 3U23A 2OI3A 1SPKA 3EG0A 2FO0A 2DLPA 4OMOA 3UF4A 1HJDA 2EYYA 4J9IA 2GTOA 2DILA 4Y92A 2DRKA 2RNAA 2JMAA 2YT6A 4X1VA 2X3XD 5IXBA 1Z9QA 2ECZA 1X27A 2O88A 2KR3A 4DEXA 3TSZA 2PNIA 2L0AA 4J9DA 2B86A 2J05A 1WIEA 1ZUKA 1NLPC 1MV0B 1NYFA 3PVQA 4Z88A 3PVLA 2JMCA 1K76A 1PRLC 2DL8A 4LUDA 4OMLA 1E6GA 1A0NB 3ULRB 2EQIA 4JJDA 1UHFA 1AWJA 1VYVA 3VS6A 1QCFA 3ZL7C 3H41A 2AZSA 4RTZA 4J9CA 3I5RA 2JTEA 1GL5A 1IO6A 4GLMA 2HCKA 2KROA 1ZLMA 2V1RA 4Z8AA 1X6GA 1CSKA 1MV3A 5FWCA 2O2OA 1TG0A 1UGVA 1WLPB 2DMOA 1PWTA 1NEGA 4JJCA 5HCKA 2F2XA 1YWPA 2BTTA 3VS3A 2KNBB 2DA9A 2PZ1A 2E5KA 2L3QA 4AFZC 1AZEA 1TUDA 1WX6A 1KSWA 2YUQA 1M27C 2QDLA 1SHGA 3IQLA 4JZ3A 4HVWA 3NGPA 1KFZA 4IIMA 2KE9A 2RMOA 1HSQA 1JXOA 1X43A 1Y0MA 2JT4A 1FMKA 4LNPA 1PKTA 1VYTA 4ESRA 5I11A 1GCPA 2A08A 2L2PA 1FYNA 4RTWA 4KRTA 2ENMA 2V1QA 3UA7A 2EPDA 4CC3A 2DM1A 2GNCA 2JS2A 1CKAA 1AWWA 4LUEA 2RQVA 4A63B 3M0UA 2GBQA 2CUBA 2K3BA 3M0TA 3VRZA 2SEMA 1ZUYA 2EYXA 1SRMA 2KYMA 2JM8A 4AG1C 2M51A 1V1CA 1ARKA 4OMQA 1VYUA 3QWXX 4D8KA 2FRYA 3CQTA 3JV3A 2YUPA 3REAB 2D8HA 2GQIA 3NMZC 2JXBA 2HBWA 2D8JA 2KBTA 4J9FA 1Z9ZA 1RLPC 3SEMA 3C0CA 1YWOA 2EBPA 2K6DA 3TVTA 1LCKA 1W6XA 3THKA 2DF6A 2YSQA 3RNJA 1QLYA 1PKSA 2VKNA 1AD5A 1WI7A 2HDAA 2F2VA 1CKBA 4HXJA 2KRNA 4CC4B 2FPFA 1WDXA 2EYWA 3NPFA 2BZ8A 5GJVB 3PE0A 1OOTA 3EG1A 2F2WA 2FPDA 1JQQA 2SRCA 2RQUA 1UHCA 1SHFA 5I22A 1OV3A 2EVRA 2LCSA 2I0NA 2LX7A 1UJYA 2DBKA 2RQTA 2X3WD 2LJ0A 1RUWA 1H3HA 1AVZC 2EKHA 1JXMA 1ZBJA 2K9GA 1SSHA 1ZUUA 1U06A 2KRSA 2GTJA 1I07A 1ABQA 2AKKA 3H0FA 1JEGA 2ROTA 3EHQA 1E7OA 2DL3A 2K2MA 5IH2A 2A37A 2HEQA 1GBQA 2EGAA 2K7AA 4ZNXA 3M0RA 1AZGB 2D1XA 2O31A 2ED1A 2JS0A 4IIOA 4ORZA 2JW4A 2LMJA 2O9SA 1J3TA 3M0PA 2CSQA 3EGUA 1X69A 3I5SA 3SHWA 1M30A 3R6NA 4M4ZA 2W0ZA 1AWOA 1M8MA 2DRMA 2LQWA 4GBQA 2H8HA 3EHRA 1GCQC 1T0JA 3QWYA 1WXTA 1YCSB 4D8DA 2RN8A 1WXBA 1MUZA 2KXDA 1BK2A 2CT3A 4F14A 2EW3A 1OEBA 1RLQC 1S1NA 3VS7A 2DE0X 1UJ0A 4RTUA 2AK5A 1PRMC 1T3LA 5FWBA 3FJ5A 4LE9A 4RTTA 3UATA
chains in the Genus database with same CATH superfamily
4OB0B 3CC2Q 5CKFA 5IHKA 3VS5A 3EGDB 3CCET 4QQDA 1UECA 4JJBA 1U3OA 4CI0C 2YUOA 1NM7A 1MGQA 3L42A 2EAYA 1YIJQ 5GJWB 7AT1B 2NUZA 1IRXA 5KYNA 4ZTJA 1UFFA 3CBOA 2LZ6B 2ABLA 3EG3A 4F17A 2M0YA 3X20B 2DBMA 2CSIA 5GAOr 4N0AC 3CPWP 2VB6A 2CGHA 4E7HA 2CH4A 2CUDA 1VQ8A 4P5NA 2E4HA 4OMMA 2VVKA 2AIRB 1VQ4T 2EGEA 1VA7A 2BKDN 4RG8A 2A28A 4BI3A 2DD5A 4C92A 4ELYC 4C8QF 3JAME 2XK0A 2LJ3A 4A4KA 3GBQA 1G3TA 5GAOm 2QXFA 2RI2A 2LNHB 1NEBA 4DEYA 2MI6A 3NFCA 3O8VA 4OMNA 5IN1A 2FPEA 2FZKB 2L3PA 2DYBA 3JB9I 3JCMX 1NYGA 3M0SA 2KY9A 3QKJA 4MZPA 1ZSZA 3E9GA 3JCMJ 1UB4A 1MMNA 3EH1A 5KYWA 2RHYA 4II1A 1F1BB 2QI2A 3E9FA 1RAHB 2FEIA 5L23A 1VIEA 4KGZB 2C0TA 1NE8A 3FB9A 1VQKA 1GCQA 4J9EA 4JRQA 2OTLT 1AEYA 1QP3A 3H0HA 4F7UF 5EC7A 3M0QA 1I1JA 3QO3A 2R58A 3MEVA 4LN2A 1RADB 1I4K1 4BB7A 1E6HA 1M3BA 3FRNA 4OB1B 2VWFA 5FU6B 1BB9A 1C6VX 2DX1A 2ESWA 2V8KA 2EQJA 1RL2A 2HQEA 4XAXB 3ZFJA 2KT8A 4OB3B 5GAN2 3LWHA 2DL4A 3KXTA 3A8MB 1Q82U 4IUPA 1QWFA 3FDRA 1KC8R 3RESA 2KGTA 3CMEQ 1K0XA 2D0QB 5I2SA 1N5ZA 1I5LA 3VRYA 1IZ6A 1G3SA 2LRQA 1K1ZA 1KQSS 4AFSC 2XD0A 3RIRA 2XDBA 5HY6A 5KE3A 1EZZB 1VQLT 1H3ZA 5D6WA 5J26A 1YHQA 1WHLA 2P4RA 4N4IA 4RTXA 2C0IA 1HD3A 2HZYA 1QQJA 4A53A 4J9GA 3CXCS 5GMKl 3QJYA 4K11A 5CKDA 2CP3A 2G6FX 4FM4B 3CCST 3OSVA 2M02A 3EG0A 1YHQQ 4M7DE 2DLPA 3UF4A 1BIAA 2EQKA 2RNAA 2COZA 3G71T 2ECZA 1VQPA 1MHNA 1XNIA 1QCOA 4DBQA 2O88A 3G1JA 4V2SA 2O4XA 1WQ7A 3CCVA 3M5AA 2QASA 3GP8A 3R6OA 3UT1A 1YJWA 1AT1B 2E6ZA 2DERA 3PVLA 1VQPQ 2QG9B 2Y4YA 2JMCA 5C6SA 2IVWA 4LUDA 4C8QB 1YBYA 4OMLA 2IG0A 1VQMA 5GMKj 3CCVQ 1A0NB 2EQIA 1VYVA 3H9NA 3BFMA 4E7KA 1YJWQ 3H41A 4RTZA 3UWNA 4J9CA 4B9XA 1ZHIA 3I5RA 4XTUA 2E5QA 3QDRB 1VQ9A 4M7DC 2KROA 1TWBA 2K4YA 2MK5A 1MV3A 3CCMQ 2M1HA 5CKBA 1TG0A 1UGVA 1WPYA 1Y96B 1WLPB 2DMOA 3P8HA 4QVCA 5GMKh 2RI3A 1WHJA 1NEGA 2P4TA 2RHZA 4M7DD 5HCKA 2XDPA 3EFOB 3VS3A 2L3QA 4ME7A 3CCLA 1VQOA 4LDWA 2QDLA 1SHGA 3EFRA 4EMKA 2JVVA 4IIMA 2RMOA 3CCJA 1HSQA 4F7UB 1FMKA 1VQ5T 4OB2B 2WSEE 5I11A 4JRIA 2HQHA 2A08A 2L2PA 4RTWA 4FYWB 1YCYA 2V1QA 1S72A 4MMKA 3VJPA 4CC3A 2DM1A 2GNCA 3OYFA 5GAN4 4DA4A 5LJ5f 3OS0A 4OVAA 1WJSA 3M0TA 3VRZA 1ZUYA 4PJLA 2BUDA 4M78B 3PT9A 4AG1C 3VUZA 3OBYA 3CC2T 3V8JA 4MMLA 4BI8B 3NTIA 4HKEA 1X01A 1FWZA 4XK8E 5I21A 3NMZC 4C92E 5AT1B 1GXIE 2D8JA 2KBTA 2X35A 2E41A 2QQBA 3C0CA 3QZ9B 3OYBA 1U8RA 2K6DA 3TVTA 3EGXA 4BUGA 5CKHA 1K9MU 3GNFB 2VKNA 4HT8A 2RM4A 1R8OB 4MZTA 1Y7XA 3BY7A 2F2VA 3C95A 3QG1A 4CC4B 1NBEB 2BE9B 4M7AF 3CD6A 5GJVB 1KQ1A 2JUFA 4Z02A 5A0GA 1UHCA 4XTVA 1OV3A 1IHVA 4FT4A 2LCSA 2LT4A 5GAMf 3TQ7P 4C92C 2RQTA 4BI4A 1Q81C 2FZGB 4FW1A 1VQNA 2NUPB 4RCBA 2LJ0A 2LQKA 2EJFA 2EKHA 1ZBJA 4O6JA 2CP2A 1YJNA 1NZ9A 1I81A 1TH7A 5DLQE 1ABQA 2DO3A 4C92D 2LC4A 4PJOF 2P0KA 3OW2S 2DZ9A 1VQNQ 2A37A 2X4YA 3FLGA 4M77A 2V8JA 1YJNQ 4C5HA 2EGAA 4F04B 1PD0A 5KYYB 4JS4A 2AT1B 2X4WA 2KI7A 2O31A 4FSXA 2DK3A 1ZSZC 2JS0A 2KAFA 2JW4A 4ELZC 2JZ2A 2LMJA 2O9SA 3DKMA 3M0PA 2CSQA 2QAZA 5LJ3f 4X9CA 2K5LA 3R6NA 4ZGEB 1AWOA 9ATCB 4GBQA 3OS5A 1GCQC 4A4FA 2L3RA 1RLQC 2DE0X 2AK5A 1T3LA 1NJIU 2XI9A 3FJ5A 1RAEB 4RTTA 2XICA 2DFUA 2ZCFB 3LH0A 1QVGP 1EX4A 1D3BA 3LWIA 1AOJA 1QKWA 3O5ZA 2QA4T 1M90R 3OYGA 4QVZA 4IUVA 4RTYA 1JO8A 2M16A 5LL6S 1YP5A 1GFDA 2W10A 2QGFB 1YNZA 2NWMA 3I56A 4R0KA 3CMET 3M55A 3CC7A 1RAIB 4R56A 1W1FA 2E65A 2MCNA 3RBBB 1WNLA 3OYHA 1PSEA 5IHIA 2R5MA 1KJWA 2Y4XA 4E7IA 4E6RA 1QP2A 1G3YA 2FHDA 3CCRA 3EGDA 3LW5E 3JB9D 4KGVB 4XTYA 4QT7A 1KIKA 1FMWA 1JU5C 4FU6A 1I5OB 1HXDA 1U5SA 2RHUA 3PIOA 2X51A 1MMAA 2OX7A 3RKYA 1Q7YU 4OMPA 2NYSA 4PKCC 2D0NA 3JB9G 3FJPA 1O9SA 3I35A 2YUNA 1N8RU 3H0IA 4KULA 3MP6A 4LD6A 5GMKm 2VYTA 4AFQC 3SWNB 2PTKA 4M7AB 1D1CA 4N4HA 2QQRA 1UGSB 4F7UG 2E64A 4C0DC 3X25B 5LJ5d 4VUBA 1ZQ1A 2RQRA 2OAWA 3QJ6A 2R5AA 4RMOA 5I2MA 4DOVA 5ECAA 3E2UA 2CP6A 2J6FA 4ZGDB 1WXUA 2AZVA 2J6KA 1VQ6A 1YJ9T 1YI2A 1WA7A 2COWA 3NHNA 1WJQA 1UG1A 1OPKA 1WYXA 3G6EA 3AHUA 2E12A 4M75F 3KFVA 3JCMb 3LH5A 2MIOA 3HRUA 4CC7A 3UPUA 1JJ2P 2X4JA 4JDSA 2CREA 1SSFA 1OX8A 2XHCA 4JLGA 3OYKA 1K0SA 1VQ6Q 5LJ5j 2FG0A 2LVMA 5CVIA 3CCMT 1X6BA 3J81E 5FW9A 4PJOB 2KEAA 3ZEHA 1YI2Q 1O75A 3HL8A 4XU3A 2L3SA 3G6EQ 3UA6A 2FRWA 2YDLA 2RI5A 3SD4A 3OYCA 5FROA 1D1AA 4ZN1A 3PMTA 2HMAA 1PG5B 3BE3A 5LJ5h 5GANf 1RAAB 2OTJA 1SRLA 2BE7D 4KH0B 2AHJB 3QYGB 2MYSA 1GRIA 4EMKC 1X6OA 1V76A 3TU4K 3CPWS 2CH4W 2KXCA 5GAMd 2RK1A 4MZMA 4EMGA 1K8AU 2OTJQ 3OQ5A 2HAXA 5LJ5g 1WHMA 4E47A 2QEXT 3EFSA 5GAN6 1OPLA 3F70A 2YRCA 1UEBA 3HRTA 2BZXA 1T0HA 1Q82C 1QMCA 3REBB 1M3CA 4ANJA 5GAMj 2YLBA 3QSUA 1SPKA 3A8LB 3ER0A 4OMOA 1HJDA 1SF9A 1VQ8Q 2YRVA 5CIUA 4J9IA 2GTOA 2DRKA 2YT6A 2JMAA 5IXBA 2XG8D 5KYUB 2R57A 1Z9QA 1M1KU 1KHCA 2RJCA 5LJ3d 2B86A 5GAMh 3DLMA 2J05A 5A2QE 1ZUKA 3S3NA 4DOWA 3V7SA 1NLPC 1MV0B 3TCJA 2QTVA 4Z88A 3DB4A 4L6V5 4BDZA 1K76A 1VQ7T 2VXFA 3M54A 4M77E 3QUIA 1E6GA 1OYXA 1KD1U 3QZ5B 4JJDA 4MDWA 3CC4A 1QCFA 5GAMg 5LJ3j 1IO6A 1KQSA 3OBWA 1K73U 2FL7A 2EQMA 2FYKA 4PJNA 1JB0E 3G4SA 4PFPA 3HFOA 5FWCA 4QW2A 4BY6C 2O2OA 3V8KA 2DIGA 5GAN3 1PWTA 2LNVA 4C8QA 3CXCA 3G4SQ 5LJ3h 1QVFA 1ZA1B 4J6WA 2DA9A 1VQKQ 5GAMe 3EG9B 2YUQA 3OSSC 1M27C 3RMQA 3IQLA 4M77C 4HVWA 3NGPA 1OI1A 1KFZA 2DJZA 4M75B 2XDDA 3ME9A 1VOMA 4M78F 5LJ3g 3JCMd 4A4HA 1Y96A 1ACMB 2DPPB 1TOVA 4ESRA 4M77D 1R0CB 3EFOA 2CZ7B 2KDSA 2JS2A 1AWWA 2K3XA 5CQXA 1YITT 4JRPA 4A63B 2ZPIB 3RKXA 2QK0A 3RERA 2SEMA 4M77G 3KUFA 2EYXA 4ZTFA 2EJGA 2DKGA 4F7UA 2F5KA 1Q86U 5LJ3e 4R55A 1D1BA 2HKNA 3QWXX 2XIDA 2DEUA 1R0BG 5J39A 2HL3A 1QVFS 4LDUA 1Z9ZA 3OS1A 4J7IA 1I8FA 2DAQA 3S3OA 3C12A 1M2OA 2QQAA 4OGEA 1LCKA 3JCMh 1QLYA 2M9UA 1G8XA 5FRNA 4M78A 3AT1B 1WI7A 2VXEA 1PC0A 3S3MA 3I55A 1OU9A 4HXJA 2KRNA 2K3YA 4KUIA 4FIBA 1KG1A 1WDXA 3NPFA 1TXQA 1VUBA 3JCMg 3PE0A 4OMFB 2F2WA 2FPDA 4E7SA 1JQQA 3X28B 3JSCA 2RQUA 3HTRA 4YTLA 5FU7B 3CCQA 5GANd 3I55Q 4X9DA 2CS7A 3HFNA 2F1LA 1UJYA 3JCMW 2DD4A 2L89A 2X3WD 2CZ0B 1B34B 4B9WA 4ATOA 1AVZC 1M4ZA 4HCBA 2K9GA 1SSHA 1VQMQ 1C1AA 2AKKA 3H0FA 1TTHB 2ROTA 1JEGA 2DXBA 3EHQA 5DY9A 1WGSA 2DIQA 2DL3A 3JCMe 2K2MA 3RMSA 5IH2A 2HEQA 1W4SA 5GANj 1VQ9Q 2V8IA 1GBQA 3LYIA 1N9RA 3P8BB 4J7FA 1Q81R 3EH2A 2F69A 4RKUE 3M0RA 4BD3A 1AZGB 2D1XA 2NUPA 1M1GA 3JCMQ 2KQWA 3LX7A 1J3TA 3EGUA 1M9SA 2QQ9A 5GANh 2KSSA 1X69A 3I5SA 3SHWA 5D6XA 3CCEA 3RR6A 3CCLQ 1QCNA 2LQWA 1VQOQ 2H8HA 3CMAT 1RI0A 1VQ6T 1MMGA 1TS9A 1WXTA 3RUXA 4D8DA 3CCUA 1WXBA 3MHXA 1MUZA 3G6ET 4Y91A 5GAOq 1BK2A 2CT3A 3QIIA 3VS7A 1OEBA 4F14A 1S1NA 3CCJQ 2K2VA 2PQWA 1PRMC 5KYYA 3PGGA 4LE9A 3CCEQ 4PJJA 3L2ZA 3UATA 3GIBA 5GANg 2HSPA 1U1SA 4BE0A 5GMKe 3MCAB 3CCUQ 1S72Q 2HNIA 1B3QA 2RQWA 1GFCA 4KGXB 1VQ4A 4GY5A 3L2RA 3C94A 3OB9A 5IHNA 1EIFA 4J6YA 1NLOC 3OW2A 1YIJT 2KT1A 1PHTA 1BCMA 1UDLA 4OF1A 2LJ1A 5GAOl 1NJIC 3ZBDA 5GANe 2GQVA 2IIMA 2NUTB 1VQ4Q 3N5BB 1GBRA 1YN8A 2EYZA 1XQHA 2DL5A 5KCHA 4HVVA 2V26A 2B8AA 5FU6C 3A8OB 2JTMA 2CZ6B 3OYDA 1PD1A 2HL5C 4HVUA 2JOYA 1K4US 5DLOA 3L1AA 5CCAA 3X24B 3JCMP 1VQ8T 3GLXA 1ZBXA 3CD6Q 1EFNA 1WZOA 3GPLA 1G83A 1ABOA 4C5GA 2A3LA 4QQGA 1W2BA 2C0OA 2CDTA 4M75G 1IXDA 2OTLA 4IURA 1BI3A 2KMTA 4C8QE 2Z0WA 1RAFB 1KC8U 1M5Q1 4E7JA 5HK3A 3M53A 5GMKi 3LLRA 1ZSGA 2MAMA 5KYXB 5KCOA 1RACB 2MMPA 2LCLA 2FB7A 3M57A 1ZX6A 2MOXA 3C4SA 2MPXC 2WSFE 3MKDA 3SWNA 2LCCA 4M7AA 3MO8A 2ZAEA 3JCMV 1LJOA 3Q1JA 4Z89A 3NTHA 3GF5A 1UUEA 4EIKA 4IUQA 4AG2C 2DJQA 2MWPA 1IGUA 3OYJA 4C8QC 1VQKT 5M9OA 1MNDA 2G3RA 1FXXA 3HHTB 1AWXA 2XKOC 4F16A 4F7UE 3L2VA 1W2BS 4A54A 1VQLA 4FYYB 5IXFA 1HK9A 4C8QD 3GOXA 4PJOA 4E7ZA 2KRMA 3I9QA 4M7DF 3CCSA 3A8HB 2DL7A 1BBZA 1SKUB 1VQLQ 4XU1A 2JTFA 2H3EB 4C8QG 3OYAA 1DJ7B 2QQSA 2ZPEB 4A4GA 3G71A 1IGQA 4FT2A 3J80E 3I56Q 3UDCA 2QTXA 3CC7Q 2K79A 2EQUA 4RUGA 2CT4A 4J9HA 2KYBA 2ZGWA 2OI3A 1KQ2A 2NLUA 2YLCA 2JNGA 4QVDA 4WTOB 1Y71A 2PVDB 5FLXE 1WHHA 3CCRQ 1K8AC 2DILA 4Y92A 2X3XD 4J8OA 1IHWA 1X27A 1YHQT 4XTWA 2E6NA 3V7RA 2VV5A 3GNGA 1LNXA 2KR3A 3TSZA 2JJ9A 4J9DA 1Q82R 3OS2A 1WIEA 3SDZA 3L2QA 8ATCB 4LDXA 3QBYA 2RHXA 4M78C 1PRLC 4AT1B 1VQPT 2ZZDA 3ULRB 3CPWA 3M56A 4OGCA 1AWJA 5KYUA 3BDLA 3VS6A 2Y90A 3ZL7C 2AZSA 3CCVT 2JTEA 4M78D 1M1KC 5D6YA 2PVOB 2PUOB 2V1RA 1ZLMA 4C5IA 5A0DA 3PFSA 1YJWT 1HYOA 3A1PA 4Z8AA 1CSKA 4JS5A 2I2LA 2RH2A 4ZN3A 1VQMT 3VYHB 4M78G 1VQ5A 3OMGA 4JJCA 1YWPA 1M2VB 4FL6A 2BTTA 2KNBB 2PZ1A 1KD1C 1AZEA 4AFZC 1WX6A 1VQ9T 1KSWA 4J83A 3OYNA 3NTKA 3MJXA 4JZ3A 1YFNA 4C5EA 1VQ5Q 1K73C 4XU2A 2PU9B 4E2FB 3HRSA 1X43A 1Y0MA 2JT4A 1N9SA 5CQYA 1FYNA 3VU3C 1X75C 4C92F 3CCLT 1VQOT 4X34A 5IAYA 4IKFA 3EG9A 3X26B 3V7CA 4BDYA 2GBQA 2EKOA 2CUBA 3CCJT 4M75A 1WHKA 2H3JA 4BE1A 4LDVA 2KYMA 5IT9E 1V1CA 5EG2A 1VYUA 2FRYA 3JV3A 2ZPHB 3CCUT 1S72T 2YUPA 3D7SB 2GFAA 4GLKA 2CP5A 2JXBA 4UC4A 3SEMA 4M7DB 1YWOA 2RD1A 3VUBA 3SFMA 4DBRA 3VV0A 3H8ZA 5LJ5e 1W6XA 2E3HA 1U1TA 2DF6A 2YSQA 3JRZA 3RNJA 1PKSA 1TUGB 3MPUB 4PLLA 3EAEA 1AD5A 2CP7A 3LGLA 4MDXA 4B6MA 5D7UA 3CPFA 2A7YA 1NPRA 1Q86C 2OAUA 3VYGA 3E1SA 4N4GA 2FPFA 1BCOA 4PNOA 2C06A 2X9HA 3HSBA 2BZ8A 2CYZB 2DVEA 2P0PA 5GAOn 1OOTA 2FVUA 2SRCA 2P0QA 3MEWA 5I22A 4FYXB 2DTOA 1MMDA 2LX7A 2E3IA 2DBKA 5CO7A 5CR2A 3CBPA 2QYZA 3OMCA 1BIBA 2PVGB 3CD6T 2RJDA 5CK9A 2KRSA 4M7AE 3CC4Q 1UGQB 1M90U 1E7OA 4EDUA 3JB9F 4DBHA 2DTHA 1Q95G 1R77A 1VQNT 1KHIA 1K9MR 2DZCA 5KH6A 1YJNT 3DB3A 1B34A 4IIOA 4ORZA 3META 4PJMA 4XU0A 2RJFA 1IB8A 5AYFA 4PJOE 4M4ZA 2L8DA 1M8MA 3M9QA 4HT9A 2QA4A 4QQ6A 1T0JA 4AMCA 2K57A 3E19A 1YCSB 3SWNC 3JCMc 2DXTA 4M7AC 1MNEA 3PMIA 3A8GB 3CMEA 5FWBA 3M4YA 2RO0A 2QA4Q 2EFIA 1OZ3A 1BU1A 4Q5WA 4M7AD 1QWEA 2XMFA 2E70A 2HKQB 1H8KA 4C0GA 1M3AA 1PNJA 3MP8A 3WVEB 1WFWA 4C92B 2GCXA 3T9NA 1SG5A 4M7AG 2CKKA 1NG2A 3FIFA 2HBPA 2J6OA 3L2WA 1PSFA 4PJOC 4A4EA 2GGRA 1UTIA 1BKBA 1T3SA 4JUVA 2HSEB 2JM9A 1BYMA 3ASKA 4PJOD 1QKXA 1KQSP 2JN0A 3P8DA 2X4XA 2RA2A 5HKCA 1UE9A 3I56T 1XOVA 3EG2A 1NPPA 4AFUC 1I0CA 3CC7T 1W70A 1SEMA 1X2KA 2KK4A 1ZSZB 3VS4A 1M1FA 4PJOG 1NJIR 5KYWB 3M59A 2RHIA 4HCCA 3CXCP 1JRIA 5GAN8 4FSSA 1B07A 2LP5A 3CCRT 1QVFP 2NUTA 4J9BA 1TU0B 2MF2A 1YJ9A 2DEQA 1K9MC 2O9VA 4XTZA 2RPNA 3OY9A 3CCQQ 3PNWC 5CKEA 1M8VA 2MWOA 3CCMA 1YJ9Q 4JZ4A 4PK4A 1OZ2A 1H92A 2A36A 4D6WA 2ROLA 2RF0A 2VGMA 1FX7A 3TSWA 5DM7R 2J7IA 4PLIA 2ED0A 1G5VA 2OJ2A 3VS0A 4L5GA 3WVDB 1X2QA 4C0FA 4JLIA 1LVKA 3M58A 1Q7YR 4JPBW 1K9AA 2ZPBB 1KC8C 1G2BA 2E1HA 1YI2T 5KE2A 3MP1A 1N8RR 3QHSA 2DNUA 4M7DG 5KYXA 4LXCA 3TREA 4RTVA 4M75E 1D09B 3HP9A 3HPWA 2QEXA 4CC2A 3VS2A 1Y57A 2BZYA 1RABB 1LOJA 4NS5A 3RDVA 3TEEA 2WACA 3SB2A 4RCCA 4N0AA 2K5IA 2CP0A 3VS1A 3OYLA 2J06A 2QEXQ 2LQNA 5FRMA 5A0LA 1RAGB 3A98A 4IUTA 1TUCA 2AKLA 2OTJT 2VASA 1BI2A 2EGCA 2O4XB 4KBMB 4C0DB 4WCIA 4CRIA 2EJ9A 2HQXA 2DVJA 1IREB 1RI9A 1FMVA 4HCKA 4M75C 3U23A 3LGFA 2ATCB 1BI1A 4KT0E 2DXCA 2FO0A 2D9TA 4M77F 2YHTA 1VQ7A 1QW1A 2EYYA 2RB6A 4OP0A 3OYEA 3BW1A 4X1VA 1QVGA 1H641 2LDMA 4M75D 3M4GA 4BE2A 4NOYA 4DEXA 3PTAA 1BI0A 2PNIA 2L0AA 2YXYA 2QGGA 2DXUA 1VQ7Q 2VUBA 2CZ1B 1ZA2B 1NYFA 3PVQA 4IUUA 2DETA 2DL8A 4NL2A 1K8AR 3PIPA 1V29B 2VC8A 2EIFA 5GAN7 1UHFA 1XJWB 1Q7YC 4FCYA 4NL3A 2OTLQ 4GLMA 1GL5A 4EMKB 2HCKA 3VKIA 2WSCE 1N8RC 1X6GA 3RKWA 3H6ZA 3QYHB 1D0XA 2RJEA 4DQ2A 3CBMA 4ZGJB 3CC4T 2F2XA 2K5FA 1G3WA 2GFUA 1QVGS 2E5KA 1M1KR 1TUDA 4FYVB 4C92G 3G4ST 5C0MA 1OU8A 1QVPA 3OW2P 3MEUA 1YITA 1WJRA 2ZPFB 5FU7C 2KE9A 4L59A 1JXOA 1OQKA 4LNPA 4KUDK 1PKTA 1VYTA 4XTXA 3L2UA 2IPOB 1GCPA 1YITQ 4PFZA 4KRTA 2ENMA 3FEOA 1M2VA 1KD1R 4PFOA 3UA7A 1PCXA 2EPDA 2LX9A 3V8LA 1CKAA 3J7AF 4LUEA 1JBMA 3INZA 4C0ZA 2RQVA 1K73R 1JJ2A 3M0UA 4LDYA 3EGXB 2K3BA 4J6XA 2PUKB 3KBGA 4Y28E 1OX9A 2A0FB 4JRKA 1SRMA 3WXMB 2JM8A 2M51A 4M78E 1ARKA 4OMQA 1WHGA 4D8KA 3FC3A 3CQTA 3CCSQ 3REAB 2O01E 6AT1B 2D8HA 2GQIA 2LTOA 1PM3A 2HBWA 2D6FA 2YRDA 1W2BP 2BIVA 4J9FA 1RLPC 2KVQG 3G71Q 5CAIA 5J3BA 2EBPA 1XTDA 1TSFA 3THKA 4HA8A 1Q81U 4BY6B 1OULA 3OYIA 2COYA 1UGPB 2YWWA 4DBFA 2HDAA 1CKBA 2P84A 1AHJB 2EYWA 3JCMf 3CEYA 1P92A 3EG1A 4M77B 4LD9K 4M7DA 5GAN5 3QDFA 2L5QA 1SHFA 1JJ2S 2VGNA 1LPLA 2EVRA 2I0NA 4XQ3A 2EWNA 3DLLA 2QDYB 3QXEB 3URGA 3G7ZA 2HD0A 1C0MA 2EYQA 3HKSA 8AT1B 4BACA 3I55T 1RUWA 1Q86R 1H3HA 1JXMA 4FW2A 1N27A 1ZUUA 1U06A 2GTJA 1I07A 5L8RE 3BDUA 3S6WA 2XU8A 3OYYA 4QKUA 4WF2A 1D0YA 3CCQT 2LT1A 1UGRB 5GAOp 3CMAA 2DTIA 4TVRA 4RG2A 1Y07A 4J5YA 2K7AA 3OA6A 4ZNXA 1KK7A 2M0OA 1B7TA 3OYMA 3JB9H 2ED1A 1N6AA 1D0ZA 2DYIA 1WQWA 1D3BB 5HK0A 4PL6A 4EMHA 2FZCB 3QPHA 3CMAQ 2ZPGB 2RK2A 4HCZA 2GF7A 1M30A 2LQ8A 2W0ZA 2DRMA 3A5ZB 1M90C 3EHRA 4JJNK 2E10A 4KH1B 4E7LA 3QWYA 1VIFA 3CC2A 3JB9J 3MEAA 2RN8A 2KXDA 2F5TX 2EW3A 4O5VA 1UJ0A 4RTUA 1YIJA 4EPCA
chains in the Genus database with same CATH topology
2HSPA 1BU1A 5IHKA 3VS5A 1QWEA 1AOJA 2XMFA 1UECA 4JJBA 1QKWA 1U3OA 3O5ZA 2YUOA 1H8KA 1NM7A 1B3QA 4RTYA 1JO8A 1M3AA 1PNJA 5GJWB 2RQWA 1WFWA 1YP5A 1GFDA 1GFCA 2W10A 2NUZA 1YNZA 1UFFA 5IHNA 3EG3A 2LZ6B 2ABLA 2NWMA 4R0KA 1NLOC 4F17A 2KT1A 2M0YA 1W1FA 2MCNA 1NG2A 3RBBB 2J6OA 1PHTA 1UDLA 2LJ1A 2DBMA 2GGRA 5IHIA 1UTIA 2CSIA 1KJWA 1T3SA 2IIMA 4E6RA 1GBRA 1YN8A 2CH4A 2CUDA 2EYZA 2JM9A 2DL5A 4HVVA 4OMMA 1QKXA 2VVKA 4QT7A 1KIKA 1JU5C 1UE9A 2EGEA 1U5SA 1VA7A 1XOVA 3EG2A 2A28A 1I0CA 4AFUC 1W70A 1SEMA 4HVUA 1K4US 1X2KA 4OMPA 2LJ3A 3VS4A 3GBQA 2D0NA 3I35A 2YUNA 2LNHB 1NEBA 4DEYA 4FSSA 1B07A 2LP5A 4J9BA 1EFNA 3H0IA 4OMNA 2FPEA 1G83A 2O9VA 2L3PA 1ABOA 4AFQC 2RPNA 2C0OA 2CDTA 2DYBA 2PTKA 1NYGA 3M0SA 2RQRA 2OAWA 4JZ4A 5ECAA 1H92A 2J6FA 2A36A 1WXUA 2AZVA 2J6KA 1ZSGA 2ROLA 2RF0A 1WA7A 3NHNA 3TSWA 2J7IA 1UG1A 5L23A 1OPKA 2FEIA 2ED0A 1WYXA 2C0TA 1ZX6A 2OJ2A 2MOXA 3KFVA 1GCQA 3LH5A 2MIOA 4J9EA 3VS0A 4CC7A 1AEYA 3H0HA 2CREA 1X2QA 5EC7A 1K0SA 3M0QA 2FG0A 1X6BA 5FW9A 1I1JA 2KEAA 4JPBW 4LN2A 4Z89A 2L3SA 3UA6A 1K9AA 1UUEA 4EIKA 1G2BA 2FRWA 4AG2C 1E6HA 2DJQA 2YDLA 1M3BA 2DNUA 2VWFA 1BB9A 4RTVA 2DX1A 2ESWA 1AWXA 4F16A 2KT8A 1SRLA 4CC2A 2DL4A 3VS2A 5IXFA 1Y57A 1GRIA 1QWFA 2BZYA 2KGTA 1K0XA 2CH4W 2KXCA 3VS1A 1N5ZA 3VRYA 2J06A 2KRMA 3I9QA 2LQNA 2DL7A 1BBZA 1K1ZA 3A98A 4AFSC 1TUCA 2AKLA 1OPLA 2EGCA 4WCIA 2P4RA 4RTXA 2C0IA 1HD3A 2DVJA 2BZXA 1T0HA 4J9GA 2K79A 4RUGA 2CT4A 1RI9A 4J9HA 2KYBA 4K11A 3REBB 4HCKA 1M3CA 2G6FX 3U23A 2OI3A 1SPKA 3EG0A 2FO0A 2DLPA 4OMOA 3UF4A 1HJDA 2EYYA 4J9IA 2GTOA 2DILA 4Y92A 2DRKA 2RNAA 2JMAA 2YT6A 4X1VA 2X3XD 5IXBA 1Z9QA 2ECZA 1X27A 2O88A 2KR3A 4DEXA 3TSZA 2PNIA 2L0AA 4J9DA 2B86A 2J05A 1WIEA 1ZUKA 1NLPC 1MV0B 1NYFA 3PVQA 4Z88A 3PVLA 2JMCA 1K76A 1PRLC 2DL8A 4LUDA 4OMLA 1E6GA 1A0NB 3ULRB 2EQIA 4JJDA 1UHFA 1AWJA 1VYVA 3VS6A 1QCFA 3ZL7C 3H41A 2AZSA 4RTZA 4J9CA 3I5RA 2JTEA 1GL5A 1IO6A 4GLMA 2HCKA 2KROA 1ZLMA 2V1RA 4Z8AA 1X6GA 1CSKA 1MV3A 5FWCA 2O2OA 1TG0A 1UGVA 1WLPB 2DMOA 1PWTA 1NEGA 4JJCA 5HCKA 2F2XA 1YWPA 2BTTA 3VS3A 2KNBB 2DA9A 2PZ1A 2E5KA 2L3QA 4AFZC 1AZEA 1TUDA 1WX6A 1KSWA 2YUQA 1M27C 2QDLA 1SHGA 3IQLA 4JZ3A 4HVWA 3NGPA 1KFZA 4IIMA 2KE9A 2RMOA 1HSQA 1JXOA 1X43A 1Y0MA 2JT4A 1FMKA 4LNPA 1PKTA 1VYTA 4ESRA 5I11A 1GCPA 2A08A 2L2PA 1FYNA 4RTWA 4KRTA 2ENMA 2V1QA 3UA7A 2EPDA 4CC3A 2DM1A 2GNCA 2JS2A 1CKAA 1AWWA 4LUEA 2RQVA 4A63B 3M0UA 2GBQA 2CUBA 2K3BA 3M0TA 3VRZA 2SEMA 1ZUYA 2EYXA 1SRMA 2KYMA 2JM8A 4AG1C 2M51A 1V1CA 1ARKA 4OMQA 1VYUA 3QWXX 4D8KA 2FRYA 3CQTA 3JV3A 2YUPA 3REAB 2D8HA 2GQIA 3NMZC 2JXBA 2HBWA 2D8JA 2KBTA 4J9FA 1Z9ZA 1RLPC 3SEMA 3C0CA 1YWOA 2EBPA 2K6DA 3TVTA 1LCKA 1W6XA 3THKA 2DF6A 2YSQA 3RNJA 1QLYA 1PKSA 2VKNA 1AD5A 1WI7A 2HDAA 2F2VA 1CKBA 4HXJA 2KRNA 4CC4B 2FPFA 1WDXA 2EYWA 3NPFA 2BZ8A 5GJVB 3PE0A 1OOTA 3EG1A 2F2WA 2FPDA 1JQQA 2SRCA 2RQUA 1UHCA 1SHFA 5I22A 1OV3A 2EVRA 2LCSA 2I0NA 2LX7A 1UJYA 2DBKA 2RQTA 2X3WD 2LJ0A 1RUWA 1H3HA 1AVZC 2EKHA 1JXMA 1ZBJA 2K9GA 1SSHA 1ZUUA 1U06A 2KRSA 2GTJA 1I07A 1ABQA 2AKKA 3H0FA 1JEGA 2ROTA 3EHQA 1E7OA 2DL3A 2K2MA 5IH2A 2A37A 2HEQA 1GBQA 2EGAA 2K7AA 4ZNXA 3M0RA 1AZGB 2D1XA 2O31A 2ED1A 2JS0A 4IIOA 4ORZA 2JW4A 2LMJA 2O9SA 1J3TA 3M0PA 2CSQA 3EGUA 1X69A 3I5SA 3SHWA 1M30A 3R6NA 4M4ZA 2W0ZA 1AWOA 1M8MA 2DRMA 2LQWA 4GBQA 2H8HA 3EHRA 1GCQC 1T0JA 3QWYA 1WXTA 1YCSB 4D8DA 2RN8A 1WXBA 1MUZA 2KXDA 1BK2A 2CT3A 4F14A 2EW3A 1OEBA 1RLQC 1S1NA 3VS7A 2DE0X 1UJ0A 4RTUA 2AK5A 1PRMC 1T3LA 5FWBA 3FJ5A 4LE9A 4RTTA 3UATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HSP A;  1BU1 A;  5IHK A;  3VS5 A;  1QWE A;  1AOJ A;  2XMF A;  1UEC A;  4JJB A;  1QKW A;  1U3O A;  3O5Z A;  2YUO A;  1H8K A;  1NM7 A;  1B3Q A;  4RTY A;  1JO8 A;  1M3A A;  1PNJ A;  5GJW B;  2RQW A;  1WFW A;  1YP5 A;  1GFD A;  1GFC A;  2W10 A;  2NUZ A;  1YNZ A;  1UFF A;  5IHN A;  3EG3 A;  2LZ6 B;  2ABL A;  2NWM A;  4R0K A;  1NLO C;  4F17 A;  2KT1 A;  2M0Y A;  1W1F A;  2MCN A;  1NG2 A;  3RBB B;  2J6O A;  1PHT A;  1UDL A;  2LJ1 A;  2DBM A;  2GGR A;  5IHI A;  1UTI A;  2CSI A;  1KJW A;  1T3S A;  2IIM A;  4E6R A;  1GBR A;  1YN8 A;  2CH4 A;  2CUD A;  2EYZ A;  2JM9 A;  2DL5 A;  4HVV A;  4OMM A;  1QKX A;  2VVK A;  4QT7 A;  1KIK A;  1JU5 C;  1UE9 A;  2EGE A;  1U5S A;  1VA7 A;  1XOV A;  3EG2 A;  2A28 A;  1I0C A;  4AFU C;  1W70 A;  1SEM A;  4HVU A;  1K4U S;  1X2K A;  4OMP A;  2LJ3 A;  3VS4 A;  3GBQ A;  2D0N A;  3I35 A;  2YUN A;  2LNH B;  1NEB A;  4DEY A;  4FSS A;  1B07 A;  2LP5 A;  4J9B A;  1EFN A;  3H0I A;  4OMN A;  2FPE A;  1G83 A;  2O9V A;  2L3P A;  1ABO A;  4AFQ C;  2RPN A;  2C0O A;  2CDT A;  2DYB A;  2PTK A;  1NYG A;  3M0S A;  2RQR A;  2OAW A;  4JZ4 A;  5ECA A;  1H92 A;  2J6F A;  2A36 A;  1WXU A;  2AZV A;  2J6K A;  1ZSG A;  2ROL A;  2RF0 A;  1WA7 A;  3NHN A;  3TSW A;  2J7I A;  1UG1 A;  5L23 A;  1OPK A;  2FEI A;  2ED0 A;  1WYX A;  2C0T A;  1ZX6 A;  2OJ2 A;  2MOX A;  3KFV A;  1GCQ A;  3LH5 A;  2MIO A;  4J9E A;  3VS0 A;  4CC7 A;  1AEY A;  3H0H A;  2CRE A;  1X2Q A;  5EC7 A;  1K0S A;  3M0Q A;  2FG0 A;  1X6B A;  5FW9 A;  1I1J A;  2KEA A;  4JPB W;  4LN2 A;  4Z89 A;  2L3S A;  3UA6 A;  1K9A A;  1UUE A;  4EIK A;  1G2B A;  2FRW A;  4AG2 C;  1E6H A;  2DJQ A;  2YDL A;  1M3B A;  2DNU A;  2VWF A;  1BB9 A;  4RTV A;  2DX1 A;  2ESW A;  1AWX A;  4F16 A;  2KT8 A;  1SRL A;  4CC2 A;  2DL4 A;  3VS2 A;  5IXF A;  1Y57 A;  1GRI A;  1QWF A;  2BZY A;  2KGT A;  1K0X A;  2CH4 W;  2KXC A;  3VS1 A;  1N5Z A;  3VRY A;  2J06 A;  2KRM A;  3I9Q A;  2LQN A;  2DL7 A;  1BBZ A;  1K1Z A;  3A98 A;  4AFS C;  1TUC A;  2AKL A;  1OPL A;  2EGC A;  4WCI A;  2P4R A;  4RTX A;  2C0I A;  1HD3 A;  2DVJ A;  2BZX A;  1T0H A;  4J9G A;  2K79 A;  4RUG A;  2CT4 A;  1RI9 A;  4J9H A;  2KYB A;  4K11 A;  3REB B;  4HCK A;  1M3C A;  2G6F X;  3U23 A;  2OI3 A;  1SPK A;  3EG0 A;  2FO0 A;  2DLP A;  4OMO A;  3UF4 A;  1HJD A;  2EYY A;  4J9I A;  2GTO A;  2DIL A;  4Y92 A;  2DRK A;  2RNA A;  2JMA A;  2YT6 A;  4X1V A;  2X3X D;  5IXB A;  1Z9Q A;  2ECZ A;  1X27 A;  2O88 A;  2KR3 A;  4DEX A;  3TSZ A;  2PNI A;  2L0A A;  4J9D A;  2B86 A;  2J05 A;  1WIE A;  1ZUK A;  1NLP C;  1MV0 B;  1NYF A;  3PVQ A;  4Z88 A;  3PVL A;  2JMC A;  1K76 A;  1PRL C;  2DL8 A;  4LUD A;  4OML A;  1E6G A;  1A0N B;  3ULR B;  2EQI A;  4JJD A;  1UHF A;  1AWJ A;  1VYV A;  3VS6 A;  1QCF A;  3ZL7 C;  3H41 A;  2AZS A;  4RTZ A;  4J9C A;  3I5R A;  2JTE A;  1GL5 A;  1IO6 A;  4GLM A;  2HCK A;  2KRO A;  1ZLM A;  2V1R A;  4Z8A A;  1X6G A;  1CSK A;  1MV3 A;  5FWC A;  2O2O A;  1TG0 A;  1UGV A;  1WLP B;  2DMO A;  1PWT A;  1NEG A;  4JJC A;  5HCK A;  2F2X A;  1YWP A;  2BTT A;  3VS3 A;  2KNB B;  2DA9 A;  2PZ1 A;  2E5K A;  2L3Q A;  4AFZ C;  1AZE A;  1TUD A;  1WX6 A;  1KSW A;  2YUQ A;  1M27 C;  2QDL A;  1SHG A;  3IQL A;  4JZ3 A;  4HVW A;  3NGP A;  1KFZ A;  4IIM A;  2KE9 A;  2RMO A;  1HSQ A;  1JXO A;  1X43 A;  1Y0M A;  2JT4 A;  1FMK A;  4LNP A;  1PKT A;  1VYT A;  4ESR A;  5I11 A;  1GCP A;  2A08 A;  2L2P A;  1FYN A;  4RTW A;  4KRT A;  2ENM A;  2V1Q A;  3UA7 A;  2EPD A;  4CC3 A;  2DM1 A;  2GNC A;  2JS2 A;  1CKA A;  1AWW A;  4LUE A;  2RQV A;  4A63 B;  3M0U A;  2GBQ A;  2CUB A;  2K3B A;  3M0T A;  3VRZ A;  2SEM A;  1ZUY A;  2EYX A;  1SRM A;  2KYM A;  2JM8 A;  4AG1 C;  2M51 A;  1V1C A;  1ARK A;  4OMQ A;  1VYU A;  3QWX X;  4D8K A;  2FRY A;  3CQT A;  3JV3 A;  2YUP A;  3REA B;  2D8H A;  2GQI A;  3NMZ C;  2JXB A;  2HBW A;  2D8J A;  2KBT A;  4J9F A;  1Z9Z A;  1RLP C;  3SEM A;  3C0C A;  1YWO A;  2EBP A;  2K6D A;  3TVT A;  1LCK A;  1W6X A;  3THK A;  2DF6 A;  2YSQ A;  3RNJ A;  1QLY A;  1PKS A;  2VKN A;  1AD5 A;  1WI7 A;  2HDA A;  2F2V A;  1CKB A;  4HXJ A;  2KRN A;  4CC4 B;  2FPF A;  1WDX A;  2EYW A;  3NPF A;  2BZ8 A;  5GJV B;  3PE0 A;  1OOT A;  3EG1 A;  2F2W A;  2FPD A;  1JQQ A;  2SRC A;  2RQU A;  1UHC A;  1SHF A;  5I22 A;  1OV3 A;  2EVR A;  2LCS A;  2I0N A;  2LX7 A;  1UJY A;  2DBK A;  2RQT A;  2X3W D;  2LJ0 A;  1RUW A;  1H3H A;  1AVZ C;  2EKH A;  1JXM A;  1ZBJ A;  2K9G A;  1SSH A;  1ZUU A;  1U06 A;  2KRS A;  2GTJ A;  1I07 A;  1ABQ A;  2AKK A;  3H0F A;  1JEG A;  2ROT A;  3EHQ A;  1E7O A;  2DL3 A;  2K2M A;  5IH2 A;  2A37 A;  2HEQ A;  1GBQ A;  2EGA A;  2K7A A;  4ZNX A;  3M0R A;  1AZG B;  2D1X A;  2O31 A;  2ED1 A;  2JS0 A;  4IIO A;  4ORZ A;  2JW4 A;  2LMJ A;  2O9S A;  1J3T A;  3M0P A;  2CSQ A;  3EGU A;  1X69 A;  3I5S A;  3SHW A;  1M30 A;  3R6N A;  4M4Z A;  2W0Z A;  1AWO A;  1M8M A;  2DRM A;  2LQW A;  4GBQ A;  2H8H A;  3EHR A;  1GCQ C;  1T0J A;  3QWY A;  1WXT A;  1YCS B;  4D8D A;  2RN8 A;  1WXB A;  1MUZ A;  2KXD A;  1BK2 A;  2CT3 A;  4F14 A;  2EW3 A;  1OEB A;  1RLQ C;  1S1N A;  3VS7 A;  2DE0 X;  1UJ0 A;  4RTU A;  2AK5 A;  1PRM C;  1T3L A;  5FWB A;  3FJ5 A;  4LE9 A;  4RTT A;  3UAT A; 
#chains in the Genus database with same CATH topology
 4OB0 B;  3CC2 Q;  5CKF A;  5IHK A;  3VS5 A;  3EGD B;  3CCE T;  4QQD A;  1UEC A;  4JJB A;  1U3O A;  4CI0 C;  2YUO A;  1NM7 A;  1MGQ A;  3L42 A;  2EAY A;  1YIJ Q;  5GJW B;  7AT1 B;  2NUZ A;  1IRX A;  5KYN A;  4ZTJ A;  1UFF A;  3CBO A;  2LZ6 B;  2ABL A;  3EG3 A;  4F17 A;  2M0Y A;  3X20 B;  2DBM A;  2CSI A;  5GAO r;  4N0A C;  3CPW P;  2VB6 A;  2CGH A;  4E7H A;  2CH4 A;  2CUD A;  1VQ8 A;  4P5N A;  2E4H A;  4OMM A;  2VVK A;  2AIR B;  1VQ4 T;  2EGE A;  1VA7 A;  2BKD N;  4RG8 A;  2A28 A;  4BI3 A;  2DD5 A;  4C92 A;  4ELY C;  4C8Q F;  3JAM E;  2XK0 A;  2LJ3 A;  4A4K A;  3GBQ A;  1G3T A;  5GAO m;  2QXF A;  2RI2 A;  2LNH B;  1NEB A;  4DEY A;  2MI6 A;  3NFC A;  3O8V A;  4OMN A;  5IN1 A;  2FPE A;  2FZK B;  2L3P A;  2DYB A;  3JB9 I;  3JCM X;  1NYG A;  3M0S A;  2KY9 A;  3QKJ A;  4MZP A;  1ZSZ A;  3E9G A;  3JCM J;  1UB4 A;  1MMN A;  3EH1 A;  5KYW A;  2RHY A;  4II1 A;  1F1B B;  2QI2 A;  3E9F A;  1RAH B;  2FEI A;  5L23 A;  1VIE A;  4KGZ B;  2C0T A;  1NE8 A;  3FB9 A;  1VQK A;  1GCQ A;  4J9E A;  4JRQ A;  2OTL T;  1AEY A;  1QP3 A;  3H0H A;  4F7U F;  5EC7 A;  3M0Q A;  1I1J A;  3QO3 A;  2R58 A;  3MEV A;  4LN2 A;  1RAD B;  1I4K 1;  4BB7 A;  1E6H A;  1M3B A;  3FRN A;  4OB1 B;  2VWF A;  5FU6 B;  1BB9 A;  1C6V X;  2DX1 A;  2ESW A;  2V8K A;  2EQJ A;  1RL2 A;  2HQE A;  4XAX B;  3ZFJ A;  2KT8 A;  4OB3 B;  5GAN 2;  3LWH A;  2DL4 A;  3KXT A;  3A8M B;  1Q82 U;  4IUP A;  1QWF A;  3FDR A;  1KC8 R;  3RES A;  2KGT A;  3CME Q;  1K0X A;  2D0Q B;  5I2S A;  1N5Z A;  1I5L A;  3VRY A;  1IZ6 A;  1G3S A;  2LRQ A;  1K1Z A;  1KQS S;  4AFS C;  2XD0 A;  3RIR A;  2XDB A;  5HY6 A;  5KE3 A;  1EZZ B;  1VQL T;  1H3Z A;  5D6W A;  5J26 A;  1YHQ A;  1WHL A;  2P4R A;  4N4I A;  4RTX A;  2C0I A;  1HD3 A;  2HZY A;  1QQJ A;  4A53 A;  4J9G A;  3CXC S;  5GMK l;  3QJY A;  4K11 A;  5CKD A;  2CP3 A;  2G6F X;  4FM4 B;  3CCS T;  3OSV A;  2M02 A;  3EG0 A;  1YHQ Q;  4M7D E;  2DLP A;  3UF4 A;  1BIA A;  2EQK A;  2RNA A;  2COZ A;  3G71 T;  2ECZ A;  1VQP A;  1MHN A;  1XNI A;  1QCO A;  4DBQ A;  2O88 A;  3G1J A;  4V2S A;  2O4X A;  1WQ7 A;  3CCV A;  3M5A A;  2QAS A;  3GP8 A;  3R6O A;  3UT1 A;  1YJW A;  1AT1 B;  2E6Z A;  2DER A;  3PVL A;  1VQP Q;  2QG9 B;  2Y4Y A;  2JMC A;  5C6S A;  2IVW A;  4LUD A;  4C8Q B;  1YBY A;  4OML A;  2IG0 A;  1VQM A;  5GMK j;  3CCV Q;  1A0N B;  2EQI A;  1VYV A;  3H9N A;  3BFM A;  4E7K A;  1YJW Q;  3H41 A;  4RTZ A;  3UWN A;  4J9C A;  4B9X A;  1ZHI A;  3I5R A;  4XTU A;  2E5Q A;  3QDR B;  1VQ9 A;  4M7D C;  2KRO A;  1TWB A;  2K4Y A;  2MK5 A;  1MV3 A;  3CCM Q;  2M1H A;  5CKB A;  1TG0 A;  1UGV A;  1WPY A;  1Y96 B;  1WLP B;  2DMO A;  3P8H A;  4QVC A;  5GMK h;  2RI3 A;  1WHJ A;  1NEG A;  2P4T A;  2RHZ A;  4M7D D;  5HCK A;  2XDP A;  3EFO B;  3VS3 A;  2L3Q A;  4ME7 A;  3CCL A;  1VQO A;  4LDW A;  2QDL A;  1SHG A;  3EFR A;  4EMK A;  2JVV A;  4IIM A;  2RMO A;  3CCJ A;  1HSQ A;  4F7U B;  1FMK A;  1VQ5 T;  4OB2 B;  2WSE E;  5I11 A;  4JRI A;  2HQH A;  2A08 A;  2L2P A;  4RTW A;  4FYW B;  1YCY A;  2V1Q A;  1S72 A;  4MMK A;  3VJP A;  4CC3 A;  2DM1 A;  2GNC A;  3OYF A;  5GAN 4;  4DA4 A;  5LJ5 f;  3OS0 A;  4OVA A;  1WJS A;  3M0T A;  3VRZ A;  1ZUY A;  4PJL A;  2BUD A;  4M78 B;  3PT9 A;  4AG1 C;  3VUZ A;  3OBY A;  3CC2 T;  3V8J A;  4MML A;  4BI8 B;  3NTI A;  4HKE A;  1X01 A;  1FWZ A;  4XK8 E;  5I21 A;  3NMZ C;  4C92 E;  5AT1 B;  1GXI E;  2D8J A;  2KBT A;  2X35 A;  2E41 A;  2QQB A;  3C0C A;  3QZ9 B;  3OYB A;  1U8R A;  2K6D A;  3TVT A;  3EGX A;  4BUG A;  5CKH A;  1K9M U;  3GNF B;  2VKN A;  4HT8 A;  2RM4 A;  1R8O B;  4MZT A;  1Y7X A;  3BY7 A;  2F2V A;  3C95 A;  3QG1 A;  4CC4 B;  1NBE B;  2BE9 B;  4M7A F;  3CD6 A;  5GJV B;  1KQ1 A;  2JUF A;  4Z02 A;  5A0G A;  1UHC A;  4XTV A;  1OV3 A;  1IHV A;  4FT4 A;  2LCS A;  2LT4 A;  5GAM f;  3TQ7 P;  4C92 C;  2RQT A;  4BI4 A;  1Q81 C;  2FZG B;  4FW1 A;  1VQN A;  2NUP B;  4RCB A;  2LJ0 A;  2LQK A;  2EJF A;  2EKH A;  1ZBJ A;  4O6J A;  2CP2 A;  1YJN A;  1NZ9 A;  1I81 A;  1TH7 A;  5DLQ E;  1ABQ A;  2DO3 A;  4C92 D;  2LC4 A;  4PJO F;  2P0K A;  3OW2 S;  2DZ9 A;  1VQN Q;  2A37 A;  2X4Y A;  3FLG A;  4M77 A;  2V8J A;  1YJN Q;  4C5H A;  2EGA A;  4F04 B;  1PD0 A;  5KYY B;  4JS4 A;  2AT1 B;  2X4W A;  2KI7 A;  2O31 A;  4FSX A;  2DK3 A;  1ZSZ C;  2JS0 A;  2KAF A;  2JW4 A;  4ELZ C;  2JZ2 A;  2LMJ A;  2O9S A;  3DKM A;  3M0P A;  2CSQ A;  2QAZ A;  5LJ3 f;  4X9C A;  2K5L A;  3R6N A;  4ZGE B;  1AWO A;  9ATC B;  4GBQ A;  3OS5 A;  1GCQ C;  4A4F A;  2L3R A;  1RLQ C;  2DE0 X;  2AK5 A;  1T3L A;  1NJI U;  2XI9 A;  3FJ5 A;  1RAE B;  4RTT A;  2XIC A;  2DFU A;  2ZCF B;  3LH0 A;  1QVG P;  1EX4 A;  1D3B A;  3LWI A;  1AOJ A;  1QKW A;  3O5Z A;  2QA4 T;  1M90 R;  3OYG A;  4QVZ A;  4IUV A;  4RTY A;  1JO8 A;  2M16 A;  5LL6 S;  1YP5 A;  1GFD A;  2W10 A;  2QGF B;  1YNZ A;  2NWM A;  3I56 A;  4R0K A;  3CME T;  3M55 A;  3CC7 A;  1RAI B;  4R56 A;  1W1F A;  2E65 A;  2MCN A;  3RBB B;  1WNL A;  3OYH A;  1PSE A;  5IHI A;  2R5M A;  1KJW A;  2Y4X A;  4E7I A;  4E6R A;  1QP2 A;  1G3Y A;  2FHD A;  3CCR A;  3EGD A;  3LW5 E;  3JB9 D;  4KGV B;  4XTY A;  4QT7 A;  1KIK A;  1FMW A;  1JU5 C;  4FU6 A;  1I5O B;  1HXD A;  1U5S A;  2RHU A;  3PIO A;  2X51 A;  1MMA A;  2OX7 A;  3RKY A;  1Q7Y U;  4OMP A;  2NYS A;  4PKC C;  2D0N A;  3JB9 G;  3FJP A;  1O9S A;  3I35 A;  2YUN A;  1N8R U;  3H0I A;  4KUL A;  3MP6 A;  4LD6 A;  5GMK m;  2VYT A;  4AFQ C;  3SWN B;  2PTK A;  4M7A B;  1D1C A;  4N4H A;  2QQR A;  1UGS B;  4F7U G;  2E64 A;  4C0D C;  3X25 B;  5LJ5 d;  4VUB A;  1ZQ1 A;  2RQR A;  2OAW A;  3QJ6 A;  2R5A A;  4RMO A;  5I2M A;  4DOV A;  5ECA A;  3E2U A;  2CP6 A;  2J6F A;  4ZGD B;  1WXU A;  2AZV A;  2J6K A;  1VQ6 A;  1YJ9 T;  1YI2 A;  1WA7 A;  2COW A;  3NHN A;  1WJQ A;  1UG1 A;  1OPK A;  1WYX A;  3G6E A;  3AHU A;  2E12 A;  4M75 F;  3KFV A;  3JCM b;  3LH5 A;  2MIO A;  3HRU A;  4CC7 A;  3UPU A;  1JJ2 P;  2X4J A;  4JDS A;  2CRE A;  1SSF A;  1OX8 A;  2XHC A;  4JLG A;  3OYK A;  1K0S A;  1VQ6 Q;  5LJ5 j;  2FG0 A;  2LVM A;  5CVI A;  3CCM T;  1X6B A;  3J81 E;  5FW9 A;  4PJO B;  2KEA A;  3ZEH A;  1YI2 Q;  1O75 A;  3HL8 A;  4XU3 A;  2L3S A;  3G6E Q;  3UA6 A;  2FRW A;  2YDL A;  2RI5 A;  3SD4 A;  3OYC A;  5FRO A;  1D1A A;  4ZN1 A;  3PMT A;  2HMA A;  1PG5 B;  3BE3 A;  5LJ5 h;  5GAN f;  1RAA B;  2OTJ A;  1SRL A;  2BE7 D;  4KH0 B;  2AHJ B;  3QYG B;  2MYS A;  1GRI A;  4EMK C;  1X6O A;  1V76 A;  3TU4 K;  3CPW S;  2CH4 W;  2KXC A;  5GAM d;  2RK1 A;  4MZM A;  4EMG A;  1K8A U;  2OTJ Q;  3OQ5 A;  2HAX A;  5LJ5 g;  1WHM A;  4E47 A;  2QEX T;  3EFS A;  5GAN 6;  1OPL A;  3F70 A;  2YRC A;  1UEB A;  3HRT A;  2BZX A;  1T0H A;  1Q82 C;  1QMC A;  3REB B;  1M3C A;  4ANJ A;  5GAM j;  2YLB A;  3QSU A;  1SPK A;  3A8L B;  3ER0 A;  4OMO A;  1HJD A;  1SF9 A;  1VQ8 Q;  2YRV A;  5CIU A;  4J9I A;  2GTO A;  2DRK A;  2YT6 A;  2JMA A;  5IXB A;  2XG8 D;  5KYU B;  2R57 A;  1Z9Q A;  1M1K U;  1KHC A;  2RJC A;  5LJ3 d;  2B86 A;  5GAM h;  3DLM A;  2J05 A;  5A2Q E;  1ZUK A;  3S3N A;  4DOW A;  3V7S A;  1NLP C;  1MV0 B;  3TCJ A;  2QTV A;  4Z88 A;  3DB4 A;  4L6V 5;  4BDZ A;  1K76 A;  1VQ7 T;  2VXF A;  3M54 A;  4M77 E;  3QUI A;  1E6G A;  1OYX A;  1KD1 U;  3QZ5 B;  4JJD A;  4MDW A;  3CC4 A;  1QCF A;  5GAM g;  5LJ3 j;  1IO6 A;  1KQS A;  3OBW A;  1K73 U;  2FL7 A;  2EQM A;  2FYK A;  4PJN A;  1JB0 E;  3G4S A;  4PFP A;  3HFO A;  5FWC A;  4QW2 A;  4BY6 C;  2O2O A;  3V8K A;  2DIG A;  5GAN 3;  1PWT A;  2LNV A;  4C8Q A;  3CXC A;  3G4S Q;  5LJ3 h;  1QVF A;  1ZA1 B;  4J6W A;  2DA9 A;  1VQK Q;  5GAM e;  3EG9 B;  2YUQ A;  3OSS C;  1M27 C;  3RMQ A;  3IQL A;  4M77 C;  4HVW A;  3NGP A;  1OI1 A;  1KFZ A;  2DJZ A;  4M75 B;  2XDD A;  3ME9 A;  1VOM A;  4M78 F;  5LJ3 g;  3JCM d;  4A4H A;  1Y96 A;  1ACM B;  2DPP B;  1TOV A;  4ESR A;  4M77 D;  1R0C B;  3EFO A;  2CZ7 B;  2KDS A;  2JS2 A;  1AWW A;  2K3X A;  5CQX A;  1YIT T;  4JRP A;  4A63 B;  2ZPI B;  3RKX A;  2QK0 A;  3RER A;  2SEM A;  4M77 G;  3KUF A;  2EYX A;  4ZTF A;  2EJG A;  2DKG A;  4F7U A;  2F5K A;  1Q86 U;  5LJ3 e;  4R55 A;  1D1B A;  2HKN A;  3QWX X;  2XID A;  2DEU A;  1R0B G;  5J39 A;  2HL3 A;  1QVF S;  4LDU A;  1Z9Z A;  3OS1 A;  4J7I A;  1I8F A;  2DAQ A;  3S3O A;  3C12 A;  1M2O A;  2QQA A;  4OGE A;  1LCK A;  3JCM h;  1QLY A;  2M9U A;  1G8X A;  5FRN A;  4M78 A;  3AT1 B;  1WI7 A;  2VXE A;  1PC0 A;  3S3M A;  3I55 A;  1OU9 A;  4HXJ A;  2KRN A;  2K3Y A;  4KUI A;  4FIB A;  1KG1 A;  1WDX A;  3NPF A;  1TXQ A;  1VUB A;  3JCM g;  3PE0 A;  4OMF B;  2F2W A;  2FPD A;  4E7S A;  1JQQ A;  3X28 B;  3JSC A;  2RQU A;  3HTR A;  4YTL A;  5FU7 B;  3CCQ A;  5GAN d;  3I55 Q;  4X9D A;  2CS7 A;  3HFN A;  2F1L A;  1UJY A;  3JCM W;  2DD4 A;  2L89 A;  2X3W D;  2CZ0 B;  1B34 B;  4B9W A;  4ATO A;  1AVZ C;  1M4Z A;  4HCB A;  2K9G A;  1SSH A;  1VQM Q;  1C1A A;  2AKK A;  3H0F A;  1TTH B;  2ROT A;  1JEG A;  2DXB A;  3EHQ A;  5DY9 A;  1WGS A;  2DIQ A;  2DL3 A;  3JCM e;  2K2M A;  3RMS A;  5IH2 A;  2HEQ A;  1W4S A;  5GAN j;  1VQ9 Q;  2V8I A;  1GBQ A;  3LYI A;  1N9R A;  3P8B B;  4J7F A;  1Q81 R;  3EH2 A;  2F69 A;  4RKU E;  3M0R A;  4BD3 A;  1AZG B;  2D1X A;  2NUP A;  1M1G A;  3JCM Q;  2KQW A;  3LX7 A;  1J3T A;  3EGU A;  1M9S A;  2QQ9 A;  5GAN h;  2KSS A;  1X69 A;  3I5S A;  3SHW A;  5D6X A;  3CCE A;  3RR6 A;  3CCL Q;  1QCN A;  2LQW A;  1VQO Q;  2H8H A;  3CMA T;  1RI0 A;  1VQ6 T;  1MMG A;  1TS9 A;  1WXT A;  3RUX A;  4D8D A;  3CCU A;  1WXB A;  3MHX A;  1MUZ A;  3G6E T;  4Y91 A;  5GAO q;  1BK2 A;  2CT3 A;  3QII A;  3VS7 A;  1OEB A;  4F14 A;  1S1N A;  3CCJ Q;  2K2V A;  2PQW A;  1PRM C;  5KYY A;  3PGG A;  4LE9 A;  3CCE Q;  4PJJ A;  3L2Z A;  3UAT A;  3GIB A;  5GAN g;  2HSP A;  1U1S A;  4BE0 A;  5GMK e;  3MCA B;  3CCU Q;  1S72 Q;  2HNI A;  1B3Q A;  2RQW A;  1GFC A;  4KGX B;  1VQ4 A;  4GY5 A;  3L2R A;  3C94 A;  3OB9 A;  5IHN A;  1EIF A;  4J6Y A;  1NLO C;  3OW2 A;  1YIJ T;  2KT1 A;  1PHT A;  1BCM A;  1UDL A;  4OF1 A;  2LJ1 A;  5GAO l;  1NJI C;  3ZBD A;  5GAN e;  2GQV A;  2IIM A;  2NUT B;  1VQ4 Q;  3N5B B;  1GBR A;  1YN8 A;  2EYZ A;  1XQH A;  2DL5 A;  5KCH A;  4HVV A;  2V26 A;  2B8A A;  5FU6 C;  3A8O B;  2JTM A;  2CZ6 B;  3OYD A;  1PD1 A;  2HL5 C;  4HVU A;  2JOY A;  1K4U S;  5DLO A;  3L1A A;  5CCA A;  3X24 B;  3JCM P;  1VQ8 T;  3GLX A;  1ZBX A;  3CD6 Q;  1EFN A;  1WZO A;  3GPL A;  1G83 A;  1ABO A;  4C5G A;  2A3L A;  4QQG A;  1W2B A;  2C0O A;  2CDT A;  4M75 G;  1IXD A;  2OTL A;  4IUR A;  1BI3 A;  2KMT A;  4C8Q E;  2Z0W A;  1RAF B;  1KC8 U;  1M5Q 1;  4E7J A;  5HK3 A;  3M53 A;  5GMK i;  3LLR A;  1ZSG A;  2MAM A;  5KYX B;  5KCO A;  1RAC B;  2MMP A;  2LCL A;  2FB7 A;  3M57 A;  1ZX6 A;  2MOX A;  3C4S A;  2MPX C;  2WSF E;  3MKD A;  3SWN A;  2LCC A;  4M7A A;  3MO8 A;  2ZAE A;  3JCM V;  1LJO A;  3Q1J A;  4Z89 A;  3NTH A;  3GF5 A;  1UUE A;  4EIK A;  4IUQ A;  4AG2 C;  2DJQ A;  2MWP A;  1IGU A;  3OYJ A;  4C8Q C;  1VQK T;  5M9O A;  1MND A;  2G3R A;  1FXX A;  3HHT B;  1AWX A;  2XKO C;  4F16 A;  4F7U E;  3L2V A;  1W2B S;  4A54 A;  1VQL A;  4FYY B;  5IXF A;  1HK9 A;  4C8Q D;  3GOX A;  4PJO A;  4E7Z A;  2KRM A;  3I9Q A;  4M7D F;  3CCS A;  3A8H B;  2DL7 A;  1BBZ A;  1SKU B;  1VQL Q;  4XU1 A;  2JTF A;  2H3E B;  4C8Q G;  3OYA A;  1DJ7 B;  2QQS A;  2ZPE B;  4A4G A;  3G71 A;  1IGQ A;  4FT2 A;  3J80 E;  3I56 Q;  3UDC A;  2QTX A;  3CC7 Q;  2K79 A;  2EQU A;  4RUG A;  2CT4 A;  4J9H A;  2KYB A;  2ZGW A;  2OI3 A;  1KQ2 A;  2NLU A;  2YLC A;  2JNG A;  4QVD A;  4WTO B;  1Y71 A;  2PVD B;  5FLX E;  1WHH A;  3CCR Q;  1K8A C;  2DIL A;  4Y92 A;  2X3X D;  4J8O A;  1IHW A;  1X27 A;  1YHQ T;  4XTW A;  2E6N A;  3V7R A;  2VV5 A;  3GNG A;  1LNX A;  2KR3 A;  3TSZ A;  2JJ9 A;  4J9D A;  1Q82 R;  3OS2 A;  1WIE A;  3SDZ A;  3L2Q A;  8ATC B;  4LDX A;  3QBY A;  2RHX A;  4M78 C;  1PRL C;  4AT1 B;  1VQP T;  2ZZD A;  3ULR B;  3CPW A;  3M56 A;  4OGC A;  1AWJ A;  5KYU A;  3BDL A;  3VS6 A;  2Y90 A;  3ZL7 C;  2AZS A;  3CCV T;  2JTE A;  4M78 D;  1M1K C;  5D6Y A;  2PVO B;  2PUO B;  2V1R A;  1ZLM A;  4C5I A;  5A0D A;  3PFS A;  1YJW T;  1HYO A;  3A1P A;  4Z8A A;  1CSK A;  4JS5 A;  2I2L A;  2RH2 A;  4ZN3 A;  1VQM T;  3VYH B;  4M78 G;  1VQ5 A;  3OMG A;  4JJC A;  1YWP A;  1M2V B;  4FL6 A;  2BTT A;  2KNB B;  2PZ1 A;  1KD1 C;  1AZE A;  4AFZ C;  1WX6 A;  1VQ9 T;  1KSW A;  4J83 A;  3OYN A;  3NTK A;  3MJX A;  4JZ3 A;  1YFN A;  4C5E A;  1VQ5 Q;  1K73 C;  4XU2 A;  2PU9 B;  4E2F B;  3HRS A;  1X43 A;  1Y0M A;  2JT4 A;  1N9S A;  5CQY A;  1FYN A;  3VU3 C;  1X75 C;  4C92 F;  3CCL T;  1VQO T;  4X34 A;  5IAY A;  4IKF A;  3EG9 A;  3X26 B;  3V7C A;  4BDY A;  2GBQ A;  2EKO A;  2CUB A;  3CCJ T;  4M75 A;  1WHK A;  2H3J A;  4BE1 A;  4LDV A;  2KYM A;  5IT9 E;  1V1C A;  5EG2 A;  1VYU A;  2FRY A;  3JV3 A;  2ZPH B;  3CCU T;  1S72 T;  2YUP A;  3D7S B;  2GFA A;  4GLK A;  2CP5 A;  2JXB A;  4UC4 A;  3SEM A;  4M7D B;  1YWO A;  2RD1 A;  3VUB A;  3SFM A;  4DBR A;  3VV0 A;  3H8Z A;  5LJ5 e;  1W6X A;  2E3H A;  1U1T A;  2DF6 A;  2YSQ A;  3JRZ A;  3RNJ A;  1PKS A;  1TUG B;  3MPU B;  4PLL A;  3EAE A;  1AD5 A;  2CP7 A;  3LGL A;  4MDX A;  4B6M A;  5D7U A;  3CPF A;  2A7Y A;  1NPR A;  1Q86 C;  2OAU A;  3VYG A;  3E1S A;  4N4G A;  2FPF A;  1BCO A;  4PNO A;  2C06 A;  2X9H A;  3HSB A;  2BZ8 A;  2CYZ B;  2DVE A;  2P0P A;  5GAO n;  1OOT A;  2FVU A;  2SRC A;  2P0Q A;  3MEW A;  5I22 A;  4FYX B;  2DTO A;  1MMD A;  2LX7 A;  2E3I A;  2DBK A;  5CO7 A;  5CR2 A;  3CBP A;  2QYZ A;  3OMC A;  1BIB A;  2PVG B;  3CD6 T;  2RJD A;  5CK9 A;  2KRS A;  4M7A E;  3CC4 Q;  1UGQ B;  1M90 U;  1E7O A;  4EDU A;  3JB9 F;  4DBH A;  2DTH A;  1Q95 G;  1R77 A;  1VQN T;  1KHI A;  1K9M R;  2DZC A;  5KH6 A;  1YJN T;  3DB3 A;  1B34 A;  4IIO A;  4ORZ A;  3MET A;  4PJM A;  4XU0 A;  2RJF A;  1IB8 A;  5AYF A;  4PJO E;  4M4Z A;  2L8D A;  1M8M A;  3M9Q A;  4HT9 A;  2QA4 A;  4QQ6 A;  1T0J A;  4AMC A;  2K57 A;  3E19 A;  1YCS B;  3SWN C;  3JCM c;  2DXT A;  4M7A C;  1MNE A;  3PMI A;  3A8G B;  3CME A;  5FWB A;  3M4Y A;  2RO0 A;  2QA4 Q;  2EFI A;  1OZ3 A;  1BU1 A;  4Q5W A;  4M7A D;  1QWE A;  2XMF A;  2E70 A;  2HKQ B;  1H8K A;  4C0G A;  1M3A A;  1PNJ A;  3MP8 A;  3WVE B;  1WFW A;  4C92 B;  2GCX A;  3T9N A;  1SG5 A;  4M7A G;  2CKK A;  1NG2 A;  3FIF A;  2HBP A;  2J6O A;  3L2W A;  1PSF A;  4PJO C;  4A4E A;  2GGR A;  1UTI A;  1BKB A;  1T3S A;  4JUV A;  2HSE B;  2JM9 A;  1BYM A;  3ASK A;  4PJO D;  1QKX A;  1KQS P;  2JN0 A;  3P8D A;  2X4X A;  2RA2 A;  5HKC A;  1UE9 A;  3I56 T;  1XOV A;  3EG2 A;  1NPP A;  4AFU C;  1I0C A;  3CC7 T;  1W70 A;  1SEM A;  1X2K A;  2KK4 A;  1ZSZ B;  3VS4 A;  1M1F A;  4PJO G;  1NJI R;  5KYW B;  3M59 A;  2RHI A;  4HCC A;  3CXC P;  1JRI A;  5GAN 8;  4FSS A;  1B07 A;  2LP5 A;  3CCR T;  1QVF P;  2NUT A;  4J9B A;  1TU0 B;  2MF2 A;  1YJ9 A;  2DEQ A;  1K9M C;  2O9V A;  4XTZ A;  2RPN A;  3OY9 A;  3CCQ Q;  3PNW C;  5CKE A;  1M8V A;  2MWO A;  3CCM A;  1YJ9 Q;  4JZ4 A;  4PK4 A;  1OZ2 A;  1H92 A;  2A36 A;  4D6W A;  2ROL A;  2RF0 A;  2VGM A;  1FX7 A;  3TSW A;  5DM7 R;  2J7I A;  4PLI A;  2ED0 A;  1G5V A;  2OJ2 A;  3VS0 A;  4L5G A;  3WVD B;  1X2Q A;  4C0F A;  4JLI A;  1LVK A;  3M58 A;  1Q7Y R;  4JPB W;  1K9A A;  2ZPB B;  1KC8 C;  1G2B A;  2E1H A;  1YI2 T;  5KE2 A;  3MP1 A;  1N8R R;  3QHS A;  2DNU A;  4M7D G;  5KYX A;  4LXC A;  3TRE A;  4RTV A;  4M75 E;  1D09 B;  3HP9 A;  3HPW A;  2QEX A;  4CC2 A;  3VS2 A;  1Y57 A;  2BZY A;  1RAB B;  1LOJ A;  4NS5 A;  3RDV A;  3TEE A;  2WAC A;  3SB2 A;  4RCC A;  4N0A A;  2K5I A;  2CP0 A;  3VS1 A;  3OYL A;  2J06 A;  2QEX Q;  2LQN A;  5FRM A;  5A0L A;  1RAG B;  3A98 A;  4IUT A;  1TUC A;  2AKL A;  2OTJ T;  2VAS A;  1BI2 A;  2EGC A;  2O4X B;  4KBM B;  4C0D B;  4WCI A;  4CRI A;  2EJ9 A;  2HQX A;  2DVJ A;  1IRE B;  1RI9 A;  1FMV A;  4HCK A;  4M75 C;  3U23 A;  3LGF A;  2ATC B;  1BI1 A;  4KT0 E;  2DXC A;  2FO0 A;  2D9T A;  4M77 F;  2YHT A;  1VQ7 A;  1QW1 A;  2EYY A;  2RB6 A;  4OP0 A;  3OYE A;  3BW1 A;  4X1V A;  1QVG A;  1H64 1;  2LDM A;  4M75 D;  3M4G A;  4BE2 A;  4NOY A;  4DEX A;  3PTA A;  1BI0 A;  2PNI A;  2L0A A;  2YXY A;  2QGG A;  2DXU A;  1VQ7 Q;  2VUB A;  2CZ1 B;  1ZA2 B;  1NYF A;  3PVQ A;  4IUU A;  2DET A;  2DL8 A;  4NL2 A;  1K8A R;  3PIP A;  1V29 B;  2VC8 A;  2EIF A;  5GAN 7;  1UHF A;  1XJW B;  1Q7Y C;  4FCY A;  4NL3 A;  2OTL Q;  4GLM A;  1GL5 A;  4EMK B;  2HCK A;  3VKI A;  2WSC E;  1N8R C;  1X6G A;  3RKW A;  3H6Z A;  3QYH B;  1D0X A;  2RJE A;  4DQ2 A;  3CBM A;  4ZGJ B;  3CC4 T;  2F2X A;  2K5F A;  1G3W A;  2GFU A;  1QVG S;  2E5K A;  1M1K R;  1TUD A;  4FYV B;  4C92 G;  3G4S T;  5C0M A;  1OU8 A;  1QVP A;  3OW2 P;  3MEU A;  1YIT A;  1WJR A;  2ZPF B;  5FU7 C;  2KE9 A;  4L59 A;  1JXO A;  1OQK A;  4LNP A;  4KUD K;  1PKT A;  1VYT A;  4XTX A;  3L2U A;  2IPO B;  1GCP A;  1YIT Q;  4PFZ A;  4KRT A;  2ENM A;  3FEO A;  1M2V A;  1KD1 R;  4PFO A;  3UA7 A;  1PCX A;  2EPD A;  2LX9 A;  3V8L A;  1CKA A;  3J7A F;  4LUE A;  1JBM A;  3INZ A;  4C0Z A;  2RQV A;  1K73 R;  1JJ2 A;  3M0U A;  4LDY A;  3EGX B;  2K3B A;  4J6X A;  2PUK B;  3KBG A;  4Y28 E;  1OX9 A;  2A0F B;  4JRK A;  1SRM A;  3WXM B;  2JM8 A;  2M51 A;  4M78 E;  1ARK A;  4OMQ A;  1WHG A;  4D8K A;  3FC3 A;  3CQT A;  3CCS Q;  3REA B;  2O01 E;  6AT1 B;  2D8H A;  2GQI A;  2LTO A;  1PM3 A;  2HBW A;  2D6F A;  2YRD A;  1W2B P;  2BIV A;  4J9F A;  1RLP C;  2KVQ G;  3G71 Q;  5CAI A;  5J3B A;  2EBP A;  1XTD A;  1TSF A;  3THK A;  4HA8 A;  1Q81 U;  4BY6 B;  1OUL A;  3OYI A;  2COY A;  1UGP B;  2YWW A;  4DBF A;  2HDA A;  1CKB A;  2P84 A;  1AHJ B;  2EYW A;  3JCM f;  3CEY A;  1P92 A;  3EG1 A;  4M77 B;  4LD9 K;  4M7D A;  5GAN 5;  3QDF A;  2L5Q A;  1SHF A;  1JJ2 S;  2VGN A;  1LPL A;  2EVR A;  2I0N A;  4XQ3 A;  2EWN A;  3DLL A;  2QDY B;  3QXE B;  3URG A;  3G7Z A;  2HD0 A;  1C0M A;  2EYQ A;  3HKS A;  8AT1 B;  4BAC A;  3I55 T;  1RUW A;  1Q86 R;  1H3H A;  1JXM A;  4FW2 A;  1N27 A;  1ZUU A;  1U06 A;  2GTJ A;  1I07 A;  5L8R E;  3BDU A;  3S6W A;  2XU8 A;  3OYY A;  4QKU A;  4WF2 A;  1D0Y A;  3CCQ T;  2LT1 A;  1UGR B;  5GAO p;  3CMA A;  2DTI A;  4TVR A;  4RG2 A;  1Y07 A;  4J5Y A;  2K7A A;  3OA6 A;  4ZNX A;  1KK7 A;  2M0O A;  1B7T A;  3OYM A;  3JB9 H;  2ED1 A;  1N6A A;  1D0Z A;  2DYI A;  1WQW A;  1D3B B;  5HK0 A;  4PL6 A;  4EMH A;  2FZC B;  3QPH A;  3CMA Q;  2ZPG B;  2RK2 A;  4HCZ A;  2GF7 A;  1M30 A;  2LQ8 A;  2W0Z A;  2DRM A;  3A5Z B;  1M90 C;  3EHR A;  4JJN K;  2E10 A;  4KH1 B;  4E7L A;  3QWY A;  1VIF A;  3CC2 A;  3JB9 J;  3MEA A;  2RN8 A;  2KXD A;  2F5T X;  2EW3 A;  4O5V A;  1UJ0 A;  4RTU A;  1YIJ A;  4EPC A; 
#chains in the Genus database with same CATH homology
 2HSP A;  1BU1 A;  5IHK A;  3VS5 A;  1QWE A;  1AOJ A;  2XMF A;  1UEC A;  4JJB A;  1QKW A;  1U3O A;  3O5Z A;  2YUO A;  1H8K A;  1NM7 A;  1B3Q A;  4RTY A;  1JO8 A;  1M3A A;  1PNJ A;  5GJW B;  2RQW A;  1WFW A;  1YP5 A;  1GFD A;  1GFC A;  2W10 A;  2NUZ A;  1YNZ A;  1UFF A;  5IHN A;  3EG3 A;  2LZ6 B;  2ABL A;  2NWM A;  4R0K A;  1NLO C;  4F17 A;  2KT1 A;  2M0Y A;  1W1F A;  2MCN A;  1NG2 A;  3RBB B;  2J6O A;  1PHT A;  1UDL A;  2LJ1 A;  2DBM A;  2GGR A;  5IHI A;  1UTI A;  2CSI A;  1KJW A;  1T3S A;  2IIM A;  4E6R A;  1GBR A;  1YN8 A;  2CH4 A;  2CUD A;  2EYZ A;  2JM9 A;  2DL5 A;  4HVV A;  4OMM A;  1QKX A;  2VVK A;  4QT7 A;  1KIK A;  1JU5 C;  1UE9 A;  2EGE A;  1U5S A;  1VA7 A;  1XOV A;  3EG2 A;  2A28 A;  1I0C A;  4AFU C;  1W70 A;  1SEM A;  4HVU A;  1K4U S;  1X2K A;  4OMP A;  2LJ3 A;  3VS4 A;  3GBQ A;  2D0N A;  3I35 A;  2YUN A;  2LNH B;  1NEB A;  4DEY A;  4FSS A;  1B07 A;  2LP5 A;  4J9B A;  1EFN A;  3H0I A;  4OMN A;  2FPE A;  1G83 A;  2O9V A;  2L3P A;  1ABO A;  4AFQ C;  2RPN A;  2C0O A;  2CDT A;  2DYB A;  2PTK A;  1NYG A;  3M0S A;  2RQR A;  2OAW A;  4JZ4 A;  5ECA A;  1H92 A;  2J6F A;  2A36 A;  1WXU A;  2AZV A;  2J6K A;  1ZSG A;  2ROL A;  2RF0 A;  1WA7 A;  3NHN A;  3TSW A;  2J7I A;  1UG1 A;  5L23 A;  1OPK A;  2FEI A;  2ED0 A;  1WYX A;  2C0T A;  1ZX6 A;  2OJ2 A;  2MOX A;  3KFV A;  1GCQ A;  3LH5 A;  2MIO A;  4J9E A;  3VS0 A;  4CC7 A;  1AEY A;  3H0H A;  2CRE A;  1X2Q A;  5EC7 A;  1K0S A;  3M0Q A;  2FG0 A;  1X6B A;  5FW9 A;  1I1J A;  2KEA A;  4JPB W;  4LN2 A;  4Z89 A;  2L3S A;  3UA6 A;  1K9A A;  1UUE A;  4EIK A;  1G2B A;  2FRW A;  4AG2 C;  1E6H A;  2DJQ A;  2YDL A;  1M3B A;  2DNU A;  2VWF A;  1BB9 A;  4RTV A;  2DX1 A;  2ESW A;  1AWX A;  4F16 A;  2KT8 A;  1SRL A;  4CC2 A;  2DL4 A;  3VS2 A;  5IXF A;  1Y57 A;  1GRI A;  1QWF A;  2BZY A;  2KGT A;  1K0X A;  2CH4 W;  2KXC A;  3VS1 A;  1N5Z A;  3VRY A;  2J06 A;  2KRM A;  3I9Q A;  2LQN A;  2DL7 A;  1BBZ A;  1K1Z A;  3A98 A;  4AFS C;  1TUC A;  2AKL A;  1OPL A;  2EGC A;  4WCI A;  2P4R A;  4RTX A;  2C0I A;  1HD3 A;  2DVJ A;  2BZX A;  1T0H A;  4J9G A;  2K79 A;  4RUG A;  2CT4 A;  1RI9 A;  4J9H A;  2KYB A;  4K11 A;  3REB B;  4HCK A;  1M3C A;  2G6F X;  3U23 A;  2OI3 A;  1SPK A;  3EG0 A;  2FO0 A;  2DLP A;  4OMO A;  3UF4 A;  1HJD A;  2EYY A;  4J9I A;  2GTO A;  2DIL A;  4Y92 A;  2DRK A;  2RNA A;  2JMA A;  2YT6 A;  4X1V A;  2X3X D;  5IXB A;  1Z9Q A;  2ECZ A;  1X27 A;  2O88 A;  2KR3 A;  4DEX A;  3TSZ A;  2PNI A;  2L0A A;  4J9D A;  2B86 A;  2J05 A;  1WIE A;  1ZUK A;  1NLP C;  1MV0 B;  1NYF A;  3PVQ A;  4Z88 A;  3PVL A;  2JMC A;  1K76 A;  1PRL C;  2DL8 A;  4LUD A;  4OML A;  1E6G A;  1A0N B;  3ULR B;  2EQI A;  4JJD A;  1UHF A;  1AWJ A;  1VYV A;  3VS6 A;  1QCF A;  3ZL7 C;  3H41 A;  2AZS A;  4RTZ A;  4J9C A;  3I5R A;  2JTE A;  1GL5 A;  1IO6 A;  4GLM A;  2HCK A;  2KRO A;  1ZLM A;  2V1R A;  4Z8A A;  1X6G A;  1CSK A;  1MV3 A;  5FWC A;  2O2O A;  1TG0 A;  1UGV A;  1WLP B;  2DMO A;  1PWT A;  1NEG A;  4JJC A;  5HCK A;  2F2X A;  1YWP A;  2BTT A;  3VS3 A;  2KNB B;  2DA9 A;  2PZ1 A;  2E5K A;  2L3Q A;  4AFZ C;  1AZE A;  1TUD A;  1WX6 A;  1KSW A;  2YUQ A;  1M27 C;  2QDL A;  1SHG A;  3IQL A;  4JZ3 A;  4HVW A;  3NGP A;  1KFZ A;  4IIM A;  2KE9 A;  2RMO A;  1HSQ A;  1JXO A;  1X43 A;  1Y0M A;  2JT4 A;  1FMK A;  4LNP A;  1PKT A;  1VYT A;  4ESR A;  5I11 A;  1GCP A;  2A08 A;  2L2P A;  1FYN A;  4RTW A;  4KRT A;  2ENM A;  2V1Q A;  3UA7 A;  2EPD A;  4CC3 A;  2DM1 A;  2GNC A;  2JS2 A;  1CKA A;  1AWW A;  4LUE A;  2RQV A;  4A63 B;  3M0U A;  2GBQ A;  2CUB A;  2K3B A;  3M0T A;  3VRZ A;  2SEM A;  1ZUY A;  2EYX A;  1SRM A;  2KYM A;  2JM8 A;  4AG1 C;  2M51 A;  1V1C A;  1ARK A;  4OMQ A;  1VYU A;  3QWX X;  4D8K A;  2FRY A;  3CQT A;  3JV3 A;  2YUP A;  3REA B;  2D8H A;  2GQI A;  3NMZ C;  2JXB A;  2HBW A;  2D8J A;  2KBT A;  4J9F A;  1Z9Z A;  1RLP C;  3SEM A;  3C0C A;  1YWO A;  2EBP A;  2K6D A;  3TVT A;  1LCK A;  1W6X A;  3THK A;  2DF6 A;  2YSQ A;  3RNJ A;  1QLY A;  1PKS A;  2VKN A;  1AD5 A;  1WI7 A;  2HDA A;  2F2V A;  1CKB A;  4HXJ A;  2KRN A;  4CC4 B;  2FPF A;  1WDX A;  2EYW A;  3NPF A;  2BZ8 A;  5GJV B;  3PE0 A;  1OOT A;  3EG1 A;  2F2W A;  2FPD A;  1JQQ A;  2SRC A;  2RQU A;  1UHC A;  1SHF A;  5I22 A;  1OV3 A;  2EVR A;  2LCS A;  2I0N A;  2LX7 A;  1UJY A;  2DBK A;  2RQT A;  2X3W D;  2LJ0 A;  1RUW A;  1H3H A;  1AVZ C;  2EKH A;  1JXM A;  1ZBJ A;  2K9G A;  1SSH A;  1ZUU A;  1U06 A;  2KRS A;  2GTJ A;  1I07 A;  1ABQ A;  2AKK A;  3H0F A;  1JEG A;  2ROT A;  3EHQ A;  1E7O A;  2DL3 A;  2K2M A;  5IH2 A;  2A37 A;  2HEQ A;  1GBQ A;  2EGA A;  2K7A A;  4ZNX A;  3M0R A;  1AZG B;  2D1X A;  2O31 A;  2ED1 A;  2JS0 A;  4IIO A;  4ORZ A;  2JW4 A;  2LMJ A;  2O9S A;  1J3T A;  3M0P A;  2CSQ A;  3EGU A;  1X69 A;  3I5S A;  3SHW A;  1M30 A;  3R6N A;  4M4Z A;  2W0Z A;  1AWO A;  1M8M A;  2DRM A;  2LQW A;  4GBQ A;  2H8H A;  3EHR A;  1GCQ C;  1T0J A;  3QWY A;  1WXT A;  1YCS B;  4D8D A;  2RN8 A;  1WXB A;  1MUZ A;  2KXD A;  1BK2 A;  2CT3 A;  4F14 A;  2EW3 A;  1OEB A;  1RLQ C;  1S1N A;  3VS7 A;  2DE0 X;  1UJ0 A;  4RTU A;  2AK5 A;  1PRM C;  1T3L A;  5FWB A;  3FJ5 A;  4LE9 A;  4RTT A;  3UAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...