1GCPA

Crystal structure of vav sh3 domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
65
structure length
65
Chain Sequence
b'KMEVFQEYYGIPPPPGAFGPFLRLNPGDIVELTKAEAEHNWWEGRNTATNEVGWFPCNRVHPYVH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VAV PROTO-ONCOGENE
molecule tags Signaling protein
source organism Mus musculus
publication title Novel recognition mode between Vav and Grb2 SH3 domains.
pubmed doi rcsb
total genus 9
structure length 65
sequence length 65
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gcpA00
2KEAA 4J9FA 1EFNA 2DF6A 3M0UA 2J6KA 2RQUA 3QWYA 2RQVA 3R6NA 2LMJA 3FJ5A 3M0SA 2SRCA 4HXJA 1ZLMA 1T3SA 2GGRA 2RMOA 5EC7A 1WFWA 4DEYA 2LQWA 4A63B 1ZUYA 2DRKA 1NLOC 2I0NA 5IHIA 1M3AA 1ABOA 2LQNA 2GTOA 2CUBA 1AD5A 1S1NA 2BTTA 4D8DA 2LCSA 1GL5A 1UJ0A 1YWPA 2EYXA 3EG3A 2K2MA 1JO8A 4LUDA 3THKA 2DBMA 1T3LA 2K7AA 1Z9QA 1VYTA 2KNBB 3QWXX 2VWFA 1H8KA 2MCNA 2L0AA 3I9QA 1K0XA 2KT8A 2NWMA 1RLPC 3VS4A 3UA6A 2A08A 2PZ1A 1SRMA 3RBBB 1B3QA 1LCKA 2DM1A 1WIEA 1BU1A 2OAWA 4JZ3A 4RTXA 2M51A 2DL7A 2KR3A 4Z88A 1OEBA 2EKHA 1K9AA 4LN2A 3I5SA 2DA9A 1WXBA 1HD3A 2YUQA 2JMCA 4GBQA 4AFSC 3NMZC 1UTIA 1JEGA 4AG2C 2HSPA 2KYMA 5FWBA 2DJQA 1K1ZA 1TUCA 1UUEA 1WYXA 2KT1A 4J9EA 4E6RA 1HSQA 2SEMA 1SEMA 2D0NA 2FPDA 2LJ1A 2J06A 3I35A 1G2BA 3EGUA 1T0JA 4F14A 1AWWA 2DL8A 2J6OA 1FMKA 2A36A 2DLPA 2VKNA 3PE0A 4OMQA 4RTYA 1K0SA 1UHCA 1VYVA 2DNUA 3M0QA 2RF0A 4RTWA 1B07A 3VS2A 1KIKA 2QDLA 2YUPA 2VVKA 1ABQA 5IXBA 3TSZA 3VRYA 2KRNA 4IIMA 4KRTA 1X27A 2KGTA 2CSIA 1X6GA 2ECZA 1Y0MA 1KJWA 2O2OA 4JPBW 2HBWA 1VA7A 1UFFA 4JJCA 2HEQA 1GRIA 1QWFA 3EG1A 3H41A 3VS5A 4K11A 4F17A 1AEYA 1BB9A 3NGPA 1VYUA 5HCKA 2CSQA 2EGAA 2EBPA 2LNHB 1PRLC 4AFZC 4GLMA 2YUOA 4AG1C 1ZUUA 2C0IA 1OPKA 1PWTA 1NLPC 3VS0A 2ESWA 2DL3A 1PKTA 3M0PA 2JS2A 1KSWA 1I0CA 4J9CA 4J9IA 3VRZA 1V1CA 1TUDA 1AOJA 1PRMC 5FWCA 1UJYA 5FW9A 2W0ZA 1MV3A 2JM9A 1QCFA 3VS6A 4CC2A 2FG0A 2JTEA 1ZSGA 2K6DA 1OPLA 2ROLA 1JU5C 1U5SA 1E6HA 1SHGA 1YCSB 2YDLA 1AWOA 1G83A 2GQIA 3LH5A 2EPDA 2A37A 1BK2A 2K79A 2ENMA 4AFUC 1UECA 5IXFA 2RQRA 4RTVA 1NM7A 3EG0A 3TVTA 3NPFA 1UDLA 4Z8AA 1M30A 3UATA 2RQWA 1SPKA 1RUWA 4J9BA 4LE9A 5ECAA 4ESRA 1WLPB 2CH4W 2FPFA 4JJBA 4LNPA 2BZ8A 1NEGA 4Z89A 1UGVA 1ZX6A 1AVZC 5IHKA 2HCKA 3O5ZA 2FRWA 4CC3A 3VS3A 3VS7A 1PHTA 4JZ4A 1J3TA 2F2VA 1GFDA 3UA7A 2DL4A 3GBQA 1AZEA 2KXDA 2CUDA 1BBZA 1NEBA 1GFCA 1YP5A 2MOXA 1PNJA 4ORZA 5IHNA 4RUGA 1T0HA 1AWXA 2LJ3A 2D8JA 4HCKA 4R0KA 2RPNA 2GBQA 2V1QA 2DBKA 4CC4B 1ZUKA 1MV0B 1XOVA 4AFQC 1ZBJA 4HVUA 2NUZA 2CREA 2EVRA 1K4US 4M4ZA 1AZGB 4DEXA 1OOTA 2J05A 1WI7A 1X6BA 2DVJA 1SHFA 3PVLA 2B86A 2CT3A 1YWOA 2ROTA 4J9GA 1Z9ZA 4OMOA 2FO0A 2EQIA 1UHFA 2RNAA 4OMNA 2YUNA 1GCPA 1JQQA 2ABLA 2PTKA 4WCIA 2RQTA 1WX6A 5I11A 2OI3A 1GBQA 2C0OA 4OMPA 2BZXA 1H3HA 5I22A 2AKKA 3JV3A 1RI9A 4ZNXA 3SHWA 2AZVA 3EG2A 3I5RA 2O9SA 2LP5A 1U06A 2G6FX 2L2PA 2FPEA 2XMFA 3H0IA 2JW4A 4X1VA 2X3WD 4IIOA 2GTJA 1GCQC 2OJ2A 2RN8A 5GJVB 2AK5A 2EGEA 5IH2A 4HVWA 2KRSA 1WDXA 4JJDA 2JS0A 2CH4A 1K76A 1WXTA 2K9GA 1E7OA 2DMOA 2E5KA 4RTTA 3ULRB 2FEIA 4LUEA 2DYBA 2DX1A 2F2XA 2YSQA 2D8HA 1CSKA 2JMAA 4QT7A 1JXOA 4HVVA 2CDTA 4RTZA 2BZYA 3H0FA 2O88A 4Y92A 1FYNA 2KE9A 2KROA 2DL5A 2O31A 1OV3A 2EW3A 1QKWA 1M3CA 2O9VA 1HJDA 3REAB 1CKAA 2LJ0A 2KXCA 3M0RA 1WA7A 1X2KA 4J9DA 3KFVA 3C0CA 1QKXA 1SSHA 4OMLA 1N5ZA 1A0NB 3RNJA 1ARKA 1NG2A 1GBRA 1M27C 2F2WA 5GJWB 2GNCA 2EYYA 1X43A 2JM8A 1GCQA 3M0TA 1NYGA 1H92A 4RTUA 1X2QA 2AKLA 2JXBA 2J7IA 3UF4A 2HDAA 1IO6A 2H8HA 1SRLA 1QLYA 4D8KA 2KBTA 3PVQA 1JXMA 5L23A 1RLQC 3SEMA 4J9HA 2CT4A 1KFZA 2J6FA 2EGCA 4OMMA 1PKSA 4EIKA 1AWJA 2JT4A 3IQLA 3VS1A 1W6XA 2AZSA 2KRMA 3TSWA 4F16A 2LZ6B 1UE9A 4FSSA 2D1XA 1E6GA 3U23A 1MUZA 1W1FA 2ED0A 2V1RA 1U3OA 3ZL7C 4CC7A 1WXUA 2K3BA 1TG0A 3REBB 2L3PA 2YT6A 2LX7A 2M0YA 1M3BA 2ED1A 3EHRA 2IIMA 1YN8A 1QWEA 3A98A 2L3SA 2MIOA 1M8MA 2DRMA 1I07A 2EYZA 1CKBA 2EYWA 2DE0X 1YNZA 2A28A 1W70A 1X69A 2C0TA 2X3XD 3NHNA 2PNIA 2DILA 1I1JA 1UG1A 3EHQA 3CQTA 1Y57A 2W10A 1NYFA 2KYBA 2P4RA 3H0HA 2FRYA 2L3QA
chains in the Genus database with same CATH superfamily
2X51A 1VQ6T 1EFNA 2DIGA 3Q1JA 1KC8C 2Y90A 3M0UA 2DXTA 3MJXA 2HQXA 2DTIA 3HTRA 3FJ5A 1WNLA 3UWNA 4ELZC 2KVQG 1LNXA 4M78G 5GAMj 1K73U 4XU2A 2E12A 1VQ8A 2RO0A 1ZUYA 2QTXA 3H9NA 1EX4A 3VU3C 3G6EA 1W2BS 5J26A 2GTOA 2CUBA 2BTTA 4D8DA 4MMKA 3CD6Q 3EG3A 2RJEA 4C8QC 4PLIA 3M5AA 3THKA 4J7FA 2K7AA 4HCCA 1VYTA 2DZ9A 2KDSA 2MCNA 2L0AA 2VYTA 1YHQA 3META 3CCQT 1VQLT 4M7DD 1K0XA 4ZN3A 2NLUA 1EIFA 5KYWB 4NL2A 1JJ2S 3X24B 1VQ4A 2DETA 1ZA2B 4AMCA 3CMAQ 2RJFA 2ATCB 3QHSA 4JZ3A 4RTXA 2M51A 3OSVA 2KR3A 2HAXA 2QG9B 3QIIA 1M1FA 1PC0A 2Z0WA 1HYOA 1G5VA 1VQPT 1UTIA 1V76A 5C0MA 2K5LA 4AG2C 1C6VX 2JZ2A 2HL5C 5FWBA 2M16A 2DJQA 3QXEB 3OW2P 1K1ZA 5CKBA 1TUCA 1UUEA 3MP8A 4XTVA 4E6RA 3DLMA 2ZGWA 3SB2A 1OULA 1BCOA 2LJ1A 5KYXB 1OZ3A 2RJDA 3L2QA 3JCMc 4C8QA 4F14A 2DL8A 2DXBA 1BI2A 4ME7A 5GAOr 1C1AA 2VKNA 2D6FA 1UHCA 1VYVA 1TSFA 4RTWA 2QDLA 1YIJA 4QVCA 1OQKA 2VVKA 3CCRQ 3I56A 3TSZA 4XU1A 2CZ1B 1H3ZA 1JBMA 2A3LA 2CSIA 2E1HA 1X6GA 4LDXA 4IUVA 3QPHA 3RKYA 2HEQA 4N4IA 5FU6B 4F17A 4AT1B 1EZZB 1NPPA 1WHGA 5HCKA 2XDBA 4C0DB 3V8KA 2K4YA 2QQ9A 5L8RE 4ZGJB 4BY6C 2E64A 3J7AF 4EMKB 1NLPC 2DAQA 3V8LA 5KYXA 1PKTA 1K9MU 1VOMA 2GFAA 2JS2A 2K5IA 2HKNA 2Y4YA 4HT8A 4C8QB 3QSUA 3SFMA 1I0CA 4JRQA 1OX9A 2YRDA 1TUDA 2XDDA 1KK7A 3CMAA 1UJYA 3JCMQ 1W4SA 5FW9A 1UB4A 2CP3A 2QAZA 2W0ZA 5GANd 2JM9A 3VS6A 3SWNC 1DJ7B 2E65A 3CCSA 4C8QD 2JTEA 2K6DA 1OPLA 2RH2A 1WHMA 4PFZA 4E7KA 4IKFA 5GAN6 1SHGA 2YDLA 5IT9E 2IG0A 1G83A 3LH5A 1G3TA 2EPDA 1BYMA 1U1SA 5LJ3j 2HBPA 4O6JA 5IXFA 1Y96B 1R77A 3EG0A 3MP1A 2DPPB 4Z8AA 3MEVA 3QYGB 4EMKA 3VYHB 5I21A 5ECAA 4ESRA 4M77B 2CH4W 3ZBDA 5DLQE 1D0ZA 4E7SA 4MMLA 3O5ZA 1YJ9T 2R58A 3VS7A 1PHTA 1N9RA 1VQLQ 2RA2A 3RKXA 5LJ5e 4M7AG 3VKIA 4E7IA 3CMAT 4F7UG 4L6V5 2D8JA 4HCKA 2GBQA 1KD1R 4CC4B 4X9DA 3M9QA 4PJMA 1MNDA 4BE2A 1XOVA 4GY5A 1YI2Q 3SWNB 4AFQC 5FLXE 4HVUA 2EJ9A 5C6SA 2LDMA 1K8AU 1AZGB 4C0GA 3HPWA 2EWNA 3A8LB 2XK0A 2L8DA 4JRKA 2J05A 2RM4A 1Q81C 2RD1A 4C92B 4MDWA 2NUTB 3SDZA 4BACA 2CT3A 1YWOA 3D7SB 4VUBA 3PIPA 3FB9A 1VQ7Q 3GIBA 1MNEA 4OMNA 1UEBA 3CCET 2ABLA 2PTKA 3OYLA 1AHJB 5I11A 4M7DB 2EJGA 5I2MA 3I56T 2LT4A 2DVEA 3CCRT 4M75B 3I5RA 2L2PA 2FPEA 3H0IA 2X3WD 4E7JA 2ZAEA 4HT9A 1G3SA 2OJ2A 3CBMA 5IH2A 2VC8A 4JJDA 6AT1B 2CH4A 5AT1B 1K8AC 2COWA 2IPOB 3HRTA 4C92A 2FEIA 3DLLA 3G71Q 4M78D 1FMWA 2DYBA 3URGA 3CPFA 2D8HA 1W2BA 2JMAA 4F7UE 1PCXA 1O9SA 3EFSA 1QP2A 1KG1A 3EFRA 3LWHA 2O88A 5CCAA 3QJYA 2XKOC 1TTHB 3MEWA 2COZA 4FM4B 2O31A 2BIVA 3G7ZA 3OA6A 2EW3A 5GAN5 2LJ0A 1UGPB 4C8QE 3C95A 3C0CA 3MO8A 1A0NB 3RNJA 3EG9B 2DZCA 4FYVB 1NZ9A 3CCJQ 3GF5A 4M7AE 1VIEA 1H92A 4RTUA 1KQ2A 4KGVB 4BE0A 2X4XA 5LJ3d 2QEXT 1K73C 3INZA 4FYYB 3RMSA 2JTFA 5GAOm 4D8KA 3L2VA 1OZ2A 3JB9D 1JXMA 5L23A 2QXFA 1RLQC 3SEMA 1KFZA 4X34A 4R55A 5GAMd 4IUUA 4BI4A 1YJ9Q 1KQSS 1QCOA 1PKSA 1Q95G 4EIKA 2A7YA 1W6XA 3KUFA 2AZSA 4XU3A 2MWOA 4IUPA 3EH1A 3JCMb 5KE2A 2AT1B 4JLIA 3TCJA 3OYMA 3OS2A 1W1FA 3ZL7C 1TG0A 3OYCA 1Y07A 2P0QA 3EHRA 3E9FA 3A98A 3EG9A 3PMTA 1WGSA 2XD0A 5CIUA 2EYZA 1D1AA 4PJOB 2EYWA 2LVMA 2DE0X 3NHNA 2QI2A 1I1JA 4XTXA 3EHQA 3FIFA 1M5Q1 3BFMA 4M7AD 2LTOA 5GAMf 1NYFA 1TH7A 3M54A 3S3OA 2KYBA 4E7HA 2JN0A 2L3QA 1SG5A 2LT1A 5EG2A 3QWYA 3CCVQ 2RQVA 3R6NA 2LMJA 2QTVA 3M0SA 4FYWB 2GGRA 5EC7A 1WFWA 4DEYA 2DTHA 2LQ8A 4E7LA 2R5MA 2DRKA 4MDXA 4Z02A 1YITQ 4B6MA 4BI3A 2YWWA 4BDZA 1X6OA 1S72T 1ABOA 2LQNA 4M7DE 4PJOA 1QVFS 1UJ0A 3CD6T 2EYXA 4FIBA 5LJ3f 1YJWA 4NL3A 2MPXC 4PJNA 1VQ6Q 3EGDB 4OF1A 2KNBB 2PU9B 2KT8A 5IAYA 1KQ1A 2E3IA 5HK3A 3I56Q 1JRIA 1B3QA 2E5QA 1MMDA 1TUGB 1BU1A 1H641 1QVGA 2F1LA 2DYIA 3M56A 1D3BB 2QYZA 3M59A 2DL7A 3GP8A 1Q86R 1K9AA 3I5SA 1HD3A 2YUQA 3FRNA 2DERA 3CMEQ 2KMTA 1TS9A 2CGHA 2H3EB 1JEGA 3J81E 1WHHA 2EJFA 1WYXA 1HSQA 3V7SA 2SEMA 4ATOA 3G1JA 2MK5A 1XJWB 3LW5E 2QEXQ 2DO3A 3EAEA 3OMGA 3CCQQ 5CQXA 3JCMX 3OYJA 3PE0A 2K3XA 5IN1A 4LXCA 1K8AR 4KH0B 3FJPA 2JJ9A 2FZKB 4JUVA 3SD4A 1YJNT 1M90C 3JCMg 3DB3A 1C0MA 2YUPA 4BE1A 1ABQA 3VRYA 1B7TA 1X27A 3PIOA 1VQKT 2O2OA 1WHJA 1VA7A 1VQKA 1GRIA 1QWFA 3VS5A 3H41A 4XK8E 2BE9B 4XTWA 3JCMh 3CCEQ 3P8BB 4QVDA 1MMGA 4IUQA 3JB9I 1N8RC 3LLRA 5GAOq 1RACB 4AG1C 1ZUUA 2C0IA 3OYBA 1WHKA 4EMHA 2OTJT 3HFOA 5KCOA 3VS0A 3MHXA 2WSFE 1PD0A 2R5AA 3OMCA 1Q81R 2QASA 4A4HA 5CVIA 4J9IA 3T9NA 3VRZA 4DBFA 5LJ5d 2DFUA 1VQLA 2QA4T 3L1AA 3CPWP 1FWZA 3OS5A 4CC2A 1UGSB 2F5KA 3NTIA 5HY6A 1ZSGA 1KD1C 4DBRA 1N6AA 3TQ7P 4PJOE 2GQIA 2YXYA 1UECA 4M7DG 2RQRA 3SWNA 1VIFA 1IGQA 1NM7A 1WZOA 2GF7A 3TVTA 4C5EA 3OY9A 1Q82R 3NPFA 2HL3A 3A5ZB 3CCQA 4J9BA 4OB3B 2EQJA 1WLPB 4RCCA 3RKWA 4JJBA 2BZ8A 1UGVA 1AVZC 2FRWA 4CC3A 5LJ3e 4M7DA 3OYDA 1N9SA 1GFDA 1YJWQ 4PJOF 1NEBA 1GFCA 1PSEA 1YP5A 5KE3A 4ORZA 2HQEA 1D1BA 2DXUA 1T0HA 2LJ3A 3M53A 2V1QA 2PVGB 1YITA 1RAFB 1ZUKA 1QCNA 5J3BA 5GMKl 8AT1B 1IHWA 5GANh 2EVRA 1IREB 3I55T 4DQ2A 4HKEA 4CI0C 3L2UA 4DEXA 3CCLA 4OB1B 1WI7A 1X6BA 4OGEA 1G8XA 1O75A 2KY9A 1BIBA 1SHFA 3PVLA 3OYGA 4KUDK 2B86A 3LYIA 1VQNA 5CKDA 5D6WA 2O01E 3RMQA 2FO0A 2E4HA 2YLCA 3PT9A 3WVDB 2RQTA 1VQOT 2OI3A 1JJ2P 2NUPB 2DEQA 1GXIE 2C0OA 4OMPA 1MHNA 1H3HA 4M78C 5I22A 1OU9A 3JV3A 2QEXA 2RHIA 2CP2A 2EYQA 3EG2A 1U06A 2G6FX 3HL8A 3VV0A 3RIRA 2JW4A 4X1VA 2AHJB 5KYNA 2E6NA 7AT1B 4O5VA 2CP0A 3HRSA 2RN8A 5GJVB 2R57A 2EGEA 2E3HA 4HVWA 1WDXA 2VUBA 2JS0A 4C8QG 2JOYA 3ULRB 2MAMA 5A2QE 3GOXA 4LUEA 3X25B 5KYYB 1PSFA 3EFOA 4QT7A 3CPWA 4ANJA 5GANg 2QQRA 1VQ5Q 4HVVA 1M2VA 1YJ9A 4RTZA 1F1BB 3TEEA 5GAN7 4Y92A 1YFNA 1VQ4T 2KE9A 1OI1A 2KROA 2DL5A 4RMOA 4MZPA 3CMEA 1M3CA 1VQKQ 5GAOl 3GPLA 1I8FA 1WA7A 1X2KA 4J9DA 2OAUA 1NG2A 1M27C 4A4GA 2OTLA 3A8HB 4J8OA 1M1KU 4J5YA 4WF2A 3M0TA 3QDRB 1Y7XA 3G71T 2EQMA 4M7DF 2ZPEB 1K9MR 1X2QA 1RABB 2RI2A 3QUIA 3UF4A 3QG1A 5HK0A 1OX8A 3PVQA 3HFNA 1M2VB 2HMAA 4JRIA 2E41A 2YLBA 2KI7A 3V7CA 4Y91A 2HZYA 2AIRB 2KSSA 4XQ3A 3NTHA 4F16A 1BI3A 3EGXB 4FSSA 1Q82C 1E6GA 5FRMA 4E2FB 2IVWA 2ZPHB 1MUZA 2P84A 2V1RA 4CC7A 3PTAA 2K3BA 1K9MC 3OBYA 2L3PA 3J80E 3DKMA 2LCCA 1YN8A 1WJSA 2L3SA 3F70A 1W2BP 1M8MA 1N8RU 2VV5A 1YNZA 5GAMg 1X69A 3I55Q 2M0OA 2PNIA 2DILA 4II1A 3CQTA 4FU6A 1ZSZB 3OW2A 2P4RA 1RAEB 2V8JA 3EGDA 4J83A 4A4KA 3GNGA 2PUKB 4M77F 2DF6A 1KQSP 2J6KA 2RQUA 4ZGEB 3M4YA 2EIFA 2L5QA 2HD0A 3ZFJA 2GCXA 1ZLMA 4M77E 2RMOA 1NJIU 1OU8A 4KT0E 2OTJQ 1D3BA 3G71A 2YRCA 4A63B 1I4K1 2XICA 2V8IA 4C0FA 2BUDA 4LDVA 3VUZA 1M3AA 5D6YA 2QA4Q 1S1NA 3CC7A 1GL5A 5LJ5f 1YWPA 2RHXA 4M77G 2K2MA 1JO8A 3LH0A 4JS5A 1R0BG 2DBMA 2EQKA 1Z9QA 2V8KA 4C8QF 2Y4XA 2VWFA 3HSBA 3MPUB 2NWMA 3VS4A 1VQOQ 3UA6A 1VQ5T 3CPWS 2PZ1A 1SRMA 4YTLA 2RHYA 1LCKA 3QZ5B 1YI2A 1VQMQ 3FLGA 4XU0A 1XQHA 2LRQA 4J6XA 4V2SA 1K73R 1JB0E 3M58A 4PL6A 4NOYA 3TREA 1OEBA 1YITT 1MMNA 3JB9G 1KD1U 1RL2A 2DA9A 3CCLQ 5HKCA 4M75F 1S72Q 3NMZC 1U1TA 1WJRA 3ASKA 3HP9A 3H6ZA 2KT1A 4J9EA 1M1GA 3L2WA 4M75E 1KHIA 1SEMA 2D0NA 1VQNT 2FPDA 4BY6B 2ZPFB 3I35A 2I2LA 4N0AA 3QDFA 3EGUA 1T0JA 3JCMf 2J6OA 1FMKA 2A36A 2B8AA 4QW2A 4OMQA 3DB4A 1M90U 2RJCA 4C92F 2PUOB 1ZHIA 4OVAA 3M0QA 2RF0A 3AT1B 3VS2A 5LJ5g 4M7AA 1QQJA 3CC4T 5IXBA 2GQVA 1PG5B 3E19A 4IIMA 2P4TA 4M75G 4KRTA 1WQWA 2H3JA 1KJWA 4JPBW 4L59A 3ME9A 4JJCA 1FX7A 3EG1A 3A8MB 2QA4A 4K11A 3NGPA 2CSQA 2EGAA 2EBPA 4OB2B 5CKFA 1FXXA 4AFZC 4GLMA 4N4GA 3OBWA 4BB7A 2CP7A 4QKUA 1PWTA 3RERA 1UGRB 2ESWA 2DL3A 3H8ZA 1KSWA 3LGLA 1WJQA 3OYYA 4C5HA 4J9CA 2DIQA 1QW1A 4N4HA 2QDYB 4LDUA 1YJNQ 4DOWA 1AOJA 1PRMC 5FWCA 1VQMA 1Q81U 3S3MA 2KQWA 4BDYA 2GFUA 1MV3A 3RR6A 1QCFA 4RG8A 2E6ZA 1I5OB 3UDCA 2HSEB 3JB9J 1RAAB 1LJOA 3C94A 1VQ7T 1JU5C 5CKHA 2E70A 1U5SA 5GANj 2A37A 1BK2A 4A53A 2K79A 2K5FA 4AFUC 3OYIA 4RTVA 3E2UA 3HKSA 1M1KC 3CCEA 1UDLA 3CBOA 4TVRA 4C0ZA 2RQWA 2JTMA 1VQPA 2VGNA 1RUWA 4LE9A 4Z89A 5IHKA 1KQSA 2HCKA 1BIAA 2M1HA 4JZ4A 2NUPA 5I2SA 1J3TA 2F2VA 1TU0B 4C0DC 3UA7A 2DL4A 3GBQA 4EMKC 1AZEA 2KXDA 1BBZA 1LVKA 2XU8A 5FU6C 2MOXA 1PNJA 4RUGA 1VQMT 1VQ9A 4DA4A 1AWXA 3C4SA 4R0KA 1M2OA 2CZ6B 4MZTA 2RPNA 1YIJT 4J6YA 1MV0B 3WXMB 4XTUA 2RHZA 3X28B 2F5TX 2RI3A 3PNWC 1ACMB 3G6ET 4FT2A 1YCYA 1I81A 4JJNK 4C92G 9ATCB 1Z9ZA 4OMOA 5KYYA 3EFOB 3HRUA 3CC2A 2RNAA 2RI5A 5CR2A 4RKUE 3CCMA 4WCIA 5FU7B 1WX6A 4PJLA 3CCJT 3OSSC 4LD9K 1RI9A 4ZNXA 3G4ST 2RK1A 3CCMQ 3X26B 2AZVA 3RUXA 1M4ZA 2O9SA 2D0QB 4C5IA 1GCQC 2LX9A 2AK5A 4QVZA 4X9CA 3VYGA 1Q7YR 3V8JA 1NBEB 1NJIC 1K76A 2EAYA 4RCBA 3M4GA 4QQGA 1YJWT 2K9GA 1E7OA 2DMOA 2XDPA 4PJOG 2E5KA 4P5NA 4RTTA 2A0FB 4ZN1A 4KH1B 3JAME 4UC4A 4HCBA 4PJOC 3CCUT 1CSKA 2WSEE 1JJ2A 2DD4A 4C92D 2C06A 3H0FA 2PQWA 5A0LA 3FC3A 2OTLQ 1IZ6A 1FYNA 1PM3A 4J7IA 4CRIA 3L2ZA 2VXFA 4M78E 2RHUA 2VGMA 2V26A 5A0GA 2K2VA 3OYEA 3EGXA 1OV3A 1QKWA 1HJDA 2O9VA 4E7ZA 3REAB 1M90R 4PK4A 5GAMh 2KXCA 3M0RA 4FCYA 1B34B 3ER0A 3KFVA 5KYUA 1SSHA 3M57A 1KC8U 2DD5A 4OMLA 4E47A 2VXEA 2CP5A 1VQOA 4XTZA 4FW1A 1ARKA 5CKEA 2F2WA 1M1KR 5GJWB 2FZGB 1BI0A 2DTOA 1NYGA 1BCMA 4HA8A 2QK0A 2QGFB 1D1CA 1ZSZA 3JRZA 2J7IA 5GMKj 2X4YA 1QLYA 3OYKA 1RADB 2KBTA 5D7UA 3QYHB 2ZPBB 2O4XA 1Q7YU 3OYAA 4JLGA 2X4WA 5GAOp 2JT4A 3X20B 3IQLA 1WQ7A 4FT4A 3VS1A 3CCUA 2KRMA 1VQ9T 3I55A 4JS4A 3UPUA 2LZ6B 1UE9A 1QVFA 3U23A 2MF2A 3LWIA 1U3OA 1VQNQ 1WXUA 2DJZA 3REBB 5GAN4 2YT6A 4IURA 2LX7A 2M0YA 1RAHB 1QWEA 1X75C 5LL6S 4EPCA 4F7UF 3HHTB 3NFCA 2DRMA 3KBGA 1I07A 2MYSA 2YRVA 2A28A 4PKCC 2X3XD 2PVDB 2XHCA 3CC4Q 1Y57A 5FROA 3G4SA 1BKBA 2W10A 4M75D 2DEUA 3H0HA 2FRYA 2KEAA 4J9FA 1IGUA 4OGCA 2O4XB 5CAIA 1XNIA 4WTOB 3JCMe 4D6WA 1AT1B 5GAN2 3V7RA 1KC8R 4OB0B 1SKUB 2VB6A 4QQ6A 3C12A 4KULA 2SRCA 3OB9A 3ZEHA 4HXJA 4ZTFA 1T3SA 3PGGA 3CCMT 2LQWA 3CCVA 2YHTA 5LJ5h 1YBYA 3CC2T 4C92E 1MMAA 2FVUA 1NLOC 2I0NA 2ZZDA 1G3YA 3RDVA 5IHIA 1VQPQ 1P92A 1VQ6A 1AD5A 4IUTA 2QQBA 1M9SA 2DXCA 4JDSA 1VQ4Q 2CP6A 2LCSA 4XTYA 3WVEB 5J39A 2LQKA 2OTJA 2LCLA 1LPLA 3JSCA 1D0XA 1WHLA 4LUDA 2X9HA 3QBYA 3JCMd 3CBPA 1T3LA 3MEAA 5GMKi 5GANf 3QWXX 1H8KA 5D6XA 3CCUQ 3I9QA 1RAIB 2EKOA 1RLPC 2A08A 4OMFB 2LC4A 4KGXB 4EDUA 1V29B 4M7AB 3RBBB 2ZPGB 2DM1A 1WIEA 4BI8B 4ZTJA 4F04B 2OAWA 2MWPA 3JCMP 1Q7YC 4M77D 4Z88A 2FHDA 2QQAA 2EKHA 4LN2A 1VQ8Q 2FL7A 2CZ0B 1WXBA 3BW1A 5GMKe 2JMCA 4GBQA 4AFSC 5LJ3h 2F69A 2HSPA 4PFOA 3E1SA 2KYMA 3CCVT 1OYXA 4Y28E 1Q82U 3EH2A 4M78B 4J6WA 2J06A 1G2BA 4KBMB 4LDWA 3P8HA 1AWWA 3MEUA 3PFSA 2DLPA 4RTYA 1K0SA 2G3RA 1ZQ1A 1YHQQ 2KK4A 4FSXA 5GMKh 2DNUA 5KYWA 3JCMV 4KUIA 1B07A 1KIKA 3QO3A 2KRNA 3NTKA 1BI1A 3TU4K 2KGTA 2ECZA 1Y0MA 2X35A 3CCST 3OS0A 2COYA 2HBWA 1UFFA 2JNGA 3CCLT 4ELYC 4A54A 2MMPA 3S6WA 2CZ7B 1AEYA 4M7AC 1BB9A 2CS7A 1VYUA 1XTDA 2D9TA 1X01A 2XI9A 2LNHB 4GLKA 1KHCA 4RG2A 1PRLC 4M7AF 2JVVA 2YUOA 3QZ9B 1HK9A 4A4FA 1WPYA 1OPKA 1M8VA 4L5GA 4M78A 1FMVA 2X4JA 3M0PA 1ZSZC 3CC7T 3LX7A 5FU7C 3OYFA 1RI0A 4MZMA 3UT1A 1V1CA 1QP3A 4C5GA 3RESA 2RB6A 3JB9H 4JRPA 2FG0A 2LNVA 1LOJA 4BUGA 4LD6A 4F7UA 1VQ9Q 2CKKA 3AHUA 4ZGDB 2ROLA 4PFPA 3BE3A 1E6HA 3CXCP 1YCSB 2OX7A 1I5LA 1AWOA 1YJNA 2ENMA 3CCJA 2FB7A 5LJ5j 1YI2T 5A0DA 2BKDN 3KXTA 1M30A 3UATA 4LDYA 1SPKA 3OW2S 3FEOA 2FPFA 4LNPA 1NEGA 1ZX6A 2FZCB 2ZCFB 5GANe 1Q86U 2QQSA 3VS3A 1HXDA 3O8VA 3OS1A 1MGQA 5CK9A 1G3WA 2CUDA 2QGGA 4F7UB 5IHNA 2NYSA 3OQ5A 3QKJA 2L89A 3JCMW 3CXCS 2DBKA 3CC2Q 5FRNA 1Y96A 4PLLA 1SSFA 1ZBJA 2CYZB 2NUZA 3BDLA 2CREA 3CC4A 1K4US 4M4ZA 2M9UA 4PJJA 3G6EQ 2HKQB 1QVFP 3BY7A 1OOTA 3VJPA 4DOVA 4FL6A 2DVJA 3GNFB 4M77A 5DLOA 3CD6A 2DKGA 3OYHA 2ROTA 3M55A 3FDRA 4J9GA 5AYFA 2EQIA 1UHFA 4FW2A 4NS5A 2PVOB 1U8RA 2YUNA 1GCPA 1JQQA 2K57A 4M78F 1Q86C 2E10A 2WACA 4N0AC 1GBQA 4DBHA 3BDUA 2BZXA 2AKKA 4KGZB 4R56A 1QVPA 3G4SQ 1VQ7A 2RK2A 3SHWA 4PNOA 2LP5A 1YIJQ 5CO7A 2XMFA 1N27A 2P0PA 2HNIA 1B34A 4IIOA 5KYUB 1VQ8T 2GTJA 1SF9A 3P8DA 2EFIA 2KRSA 1IB8A 4B9XA 5GAMe 4M77C 3PMIA 1WXTA 1VQ5A 3LGFA 3CXCA 2L3RA 2NUTA 4OP0A 2DX1A 2F2XA 2KAFA 2YSQA 1UGQB 1JXOA 1VUBA 3JCMJ 2CDTA 5LJ3g 3CEYA 2BZYA 2VASA 1YHQT 3MP6A 3QJ6A 2M02A 1NE8A 1IHVA 2OTLT 2XG8D 1S72A 2FYKA 3GLXA 5KH6A 3CCRA 3L42A 4PJOD 4M75A 4EMGA 1QVGP 3A8OB 3A8GB 3CCSQ 1CKAA 1IRXA 3S3NA 5GAN8 1QKXA 5KCHA 5GAN3 1N5ZA 4BD3A 3A1PA 4HCZA 4A4EA 1GBRA 3R6OA 4M7DC 2GNCA 1NPRA 2EYYA 1X43A 2JM8A 4XAXB 1GCQA 3JB9F 2BE7D 2HQHA 1Y71A 2P0KA 2AKLA 2JXBA 2EQUA 3CC7Q 5M9OA 2HDAA 1TXQA 1IO6A 2H8HA 2XIDA 1SRLA 8ATCB 4Q5WA 5CQYA 2JUFA 1QMCA 4J9HA 2CT4A 1N8RR 3CMET 2J6FA 2EGCA 4OMMA 3VUBA 1AWJA 1R0CB 4M75C 3TSWA 1D09B 2K3YA 2D1XA 1TOVA 1NJIR 2ED0A 1QVGS 4FYXB 3N5BB 1PD1A 1M3BA 1RAGB 2ED1A 1R8OB 4B9WA 2IIMA 1D0YA 2WSCE 1TWBA 2ZPIB 5GMKm 5DM7R 3MCAB 2MIOA 1IXDA 1CKBA 1ZBXA 1W70A 2C0TA 3MKDA 2MI6A 4C92C 5DY9A 1UG1A 3L2RA 4DBQA 3OYNA 5GAOn 3E9GA 4QQDA 1ZA1B 2DK3A
chains in the Genus database with same CATH topology
2KEAA 4J9FA 1EFNA 2DF6A 3M0UA 2J6KA 2RQUA 3QWYA 2RQVA 3R6NA 2LMJA 3FJ5A 3M0SA 2SRCA 4HXJA 1ZLMA 1T3SA 2GGRA 2RMOA 5EC7A 1WFWA 4DEYA 2LQWA 4A63B 1ZUYA 2DRKA 1NLOC 2I0NA 5IHIA 1M3AA 1ABOA 2LQNA 2GTOA 2CUBA 1AD5A 1S1NA 2BTTA 4D8DA 2LCSA 1GL5A 1UJ0A 1YWPA 2EYXA 3EG3A 2K2MA 1JO8A 4LUDA 3THKA 2DBMA 1T3LA 2K7AA 1Z9QA 1VYTA 2KNBB 3QWXX 2VWFA 1H8KA 2MCNA 2L0AA 3I9QA 1K0XA 2KT8A 2NWMA 1RLPC 3VS4A 3UA6A 2A08A 2PZ1A 1SRMA 3RBBB 1B3QA 1LCKA 2DM1A 1WIEA 1BU1A 2OAWA 4JZ3A 4RTXA 2M51A 2DL7A 2KR3A 4Z88A 1OEBA 2EKHA 1K9AA 4LN2A 3I5SA 2DA9A 1WXBA 1HD3A 2YUQA 2JMCA 4GBQA 4AFSC 3NMZC 1UTIA 1JEGA 4AG2C 2HSPA 2KYMA 5FWBA 2DJQA 1K1ZA 1TUCA 1UUEA 1WYXA 2KT1A 4J9EA 4E6RA 1HSQA 2SEMA 1SEMA 2D0NA 2FPDA 2LJ1A 2J06A 3I35A 1G2BA 3EGUA 1T0JA 4F14A 1AWWA 2DL8A 2J6OA 1FMKA 2A36A 2DLPA 2VKNA 3PE0A 4OMQA 4RTYA 1K0SA 1UHCA 1VYVA 2DNUA 3M0QA 2RF0A 4RTWA 1B07A 3VS2A 1KIKA 2QDLA 2YUPA 2VVKA 1ABQA 5IXBA 3TSZA 3VRYA 2KRNA 4IIMA 4KRTA 1X27A 2KGTA 2CSIA 1X6GA 2ECZA 1Y0MA 1KJWA 2O2OA 4JPBW 2HBWA 1VA7A 1UFFA 4JJCA 2HEQA 1GRIA 1QWFA 3EG1A 3H41A 3VS5A 4K11A 4F17A 1AEYA 1BB9A 3NGPA 1VYUA 5HCKA 2CSQA 2EGAA 2EBPA 2LNHB 1PRLC 4AFZC 4GLMA 2YUOA 4AG1C 1ZUUA 2C0IA 1OPKA 1PWTA 1NLPC 3VS0A 2ESWA 2DL3A 1PKTA 3M0PA 2JS2A 1KSWA 1I0CA 4J9CA 4J9IA 3VRZA 1V1CA 1TUDA 1AOJA 1PRMC 5FWCA 1UJYA 5FW9A 2W0ZA 1MV3A 2JM9A 1QCFA 3VS6A 4CC2A 2FG0A 2JTEA 1ZSGA 2K6DA 1OPLA 2ROLA 1JU5C 1U5SA 1E6HA 1SHGA 1YCSB 2YDLA 1AWOA 1G83A 2GQIA 3LH5A 2EPDA 2A37A 1BK2A 2K79A 2ENMA 4AFUC 1UECA 5IXFA 2RQRA 4RTVA 1NM7A 3EG0A 3TVTA 3NPFA 1UDLA 4Z8AA 1M30A 3UATA 2RQWA 1SPKA 1RUWA 4J9BA 4LE9A 5ECAA 4ESRA 1WLPB 2CH4W 2FPFA 4JJBA 4LNPA 2BZ8A 1NEGA 4Z89A 1UGVA 1ZX6A 1AVZC 5IHKA 2HCKA 3O5ZA 2FRWA 4CC3A 3VS3A 3VS7A 1PHTA 4JZ4A 1J3TA 2F2VA 1GFDA 3UA7A 2DL4A 3GBQA 1AZEA 2KXDA 2CUDA 1BBZA 1NEBA 1GFCA 1YP5A 2MOXA 1PNJA 4ORZA 5IHNA 4RUGA 1T0HA 1AWXA 2LJ3A 2D8JA 4HCKA 4R0KA 2RPNA 2GBQA 2V1QA 2DBKA 4CC4B 1ZUKA 1MV0B 1XOVA 4AFQC 1ZBJA 4HVUA 2NUZA 2CREA 2EVRA 1K4US 4M4ZA 1AZGB 4DEXA 1OOTA 2J05A 1WI7A 1X6BA 2DVJA 1SHFA 3PVLA 2B86A 2CT3A 1YWOA 2ROTA 4J9GA 1Z9ZA 4OMOA 2FO0A 2EQIA 1UHFA 2RNAA 4OMNA 2YUNA 1GCPA 1JQQA 2ABLA 2PTKA 4WCIA 2RQTA 1WX6A 5I11A 2OI3A 1GBQA 2C0OA 4OMPA 2BZXA 1H3HA 5I22A 2AKKA 3JV3A 1RI9A 4ZNXA 3SHWA 2AZVA 3EG2A 3I5RA 2O9SA 2LP5A 1U06A 2G6FX 2L2PA 2FPEA 2XMFA 3H0IA 2JW4A 4X1VA 2X3WD 4IIOA 2GTJA 1GCQC 2OJ2A 2RN8A 5GJVB 2AK5A 2EGEA 5IH2A 4HVWA 2KRSA 1WDXA 4JJDA 2JS0A 2CH4A 1K76A 1WXTA 2K9GA 1E7OA 2DMOA 2E5KA 4RTTA 3ULRB 2FEIA 4LUEA 2DYBA 2DX1A 2F2XA 2YSQA 2D8HA 1CSKA 2JMAA 4QT7A 1JXOA 4HVVA 2CDTA 4RTZA 2BZYA 3H0FA 2O88A 4Y92A 1FYNA 2KE9A 2KROA 2DL5A 2O31A 1OV3A 2EW3A 1QKWA 1M3CA 2O9VA 1HJDA 3REAB 1CKAA 2LJ0A 2KXCA 3M0RA 1WA7A 1X2KA 4J9DA 3KFVA 3C0CA 1QKXA 1SSHA 4OMLA 1N5ZA 1A0NB 3RNJA 1ARKA 1NG2A 1GBRA 1M27C 2F2WA 5GJWB 2GNCA 2EYYA 1X43A 2JM8A 1GCQA 3M0TA 1NYGA 1H92A 4RTUA 1X2QA 2AKLA 2JXBA 2J7IA 3UF4A 2HDAA 1IO6A 2H8HA 1SRLA 1QLYA 4D8KA 2KBTA 3PVQA 1JXMA 5L23A 1RLQC 3SEMA 4J9HA 2CT4A 1KFZA 2J6FA 2EGCA 4OMMA 1PKSA 4EIKA 1AWJA 2JT4A 3IQLA 3VS1A 1W6XA 2AZSA 2KRMA 3TSWA 4F16A 2LZ6B 1UE9A 4FSSA 2D1XA 1E6GA 3U23A 1MUZA 1W1FA 2ED0A 2V1RA 1U3OA 3ZL7C 4CC7A 1WXUA 2K3BA 1TG0A 3REBB 2L3PA 2YT6A 2LX7A 2M0YA 1M3BA 2ED1A 3EHRA 2IIMA 1YN8A 1QWEA 3A98A 2L3SA 2MIOA 1M8MA 2DRMA 1I07A 2EYZA 1CKBA 2EYWA 2DE0X 1YNZA 2A28A 1W70A 1X69A 2C0TA 2X3XD 3NHNA 2PNIA 2DILA 1I1JA 1UG1A 3EHQA 3CQTA 1Y57A 2W10A 1NYFA 2KYBA 2P4RA 3H0HA 2FRYA 2L3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KEA A;  4J9F A;  1EFN A;  2DF6 A;  3M0U A;  2J6K A;  2RQU A;  3QWY A;  2RQV A;  3R6N A;  2LMJ A;  3FJ5 A;  3M0S A;  2SRC A;  4HXJ A;  1ZLM A;  1T3S A;  2GGR A;  2RMO A;  5EC7 A;  1WFW A;  4DEY A;  2LQW A;  4A63 B;  1ZUY A;  2DRK A;  1NLO C;  2I0N A;  5IHI A;  1M3A A;  1ABO A;  2LQN A;  2GTO A;  2CUB A;  1AD5 A;  1S1N A;  2BTT A;  4D8D A;  2LCS A;  1GL5 A;  1UJ0 A;  1YWP A;  2EYX A;  3EG3 A;  2K2M A;  1JO8 A;  4LUD A;  3THK A;  2DBM A;  1T3L A;  2K7A A;  1Z9Q A;  1VYT A;  2KNB B;  3QWX X;  2VWF A;  1H8K A;  2MCN A;  2L0A A;  3I9Q A;  1K0X A;  2KT8 A;  2NWM A;  1RLP C;  3VS4 A;  3UA6 A;  2A08 A;  2PZ1 A;  1SRM A;  3RBB B;  1B3Q A;  1LCK A;  2DM1 A;  1WIE A;  1BU1 A;  2OAW A;  4JZ3 A;  4RTX A;  2M51 A;  2DL7 A;  2KR3 A;  4Z88 A;  1OEB A;  2EKH A;  1K9A A;  4LN2 A;  3I5S A;  2DA9 A;  1WXB A;  1HD3 A;  2YUQ A;  2JMC A;  4GBQ A;  4AFS C;  3NMZ C;  1UTI A;  1JEG A;  4AG2 C;  2HSP A;  2KYM A;  5FWB A;  2DJQ A;  1K1Z A;  1TUC A;  1UUE A;  1WYX A;  2KT1 A;  4J9E A;  4E6R A;  1HSQ A;  2SEM A;  1SEM A;  2D0N A;  2FPD A;  2LJ1 A;  2J06 A;  3I35 A;  1G2B A;  3EGU A;  1T0J A;  4F14 A;  1AWW A;  2DL8 A;  2J6O A;  1FMK A;  2A36 A;  2DLP A;  2VKN A;  3PE0 A;  4OMQ A;  4RTY A;  1K0S A;  1UHC A;  1VYV A;  2DNU A;  3M0Q A;  2RF0 A;  4RTW A;  1B07 A;  3VS2 A;  1KIK A;  2QDL A;  2YUP A;  2VVK A;  1ABQ A;  5IXB A;  3TSZ A;  3VRY A;  2KRN A;  4IIM A;  4KRT A;  1X27 A;  2KGT A;  2CSI A;  1X6G A;  2ECZ A;  1Y0M A;  1KJW A;  2O2O A;  4JPB W;  2HBW A;  1VA7 A;  1UFF A;  4JJC A;  2HEQ A;  1GRI A;  1QWF A;  3EG1 A;  3H41 A;  3VS5 A;  4K11 A;  4F17 A;  1AEY A;  1BB9 A;  3NGP A;  1VYU A;  5HCK A;  2CSQ A;  2EGA A;  2EBP A;  2LNH B;  1PRL C;  4AFZ C;  4GLM A;  2YUO A;  4AG1 C;  1ZUU A;  2C0I A;  1OPK A;  1PWT A;  1NLP C;  3VS0 A;  2ESW A;  2DL3 A;  1PKT A;  3M0P A;  2JS2 A;  1KSW A;  1I0C A;  4J9C A;  4J9I A;  3VRZ A;  1V1C A;  1TUD A;  1AOJ A;  1PRM C;  5FWC A;  1UJY A;  5FW9 A;  2W0Z A;  1MV3 A;  2JM9 A;  1QCF A;  3VS6 A;  4CC2 A;  2FG0 A;  2JTE A;  1ZSG A;  2K6D A;  1OPL A;  2ROL A;  1JU5 C;  1U5S A;  1E6H A;  1SHG A;  1YCS B;  2YDL A;  1AWO A;  1G83 A;  2GQI A;  3LH5 A;  2EPD A;  2A37 A;  1BK2 A;  2K79 A;  2ENM A;  4AFU C;  1UEC A;  5IXF A;  2RQR A;  4RTV A;  1NM7 A;  3EG0 A;  3TVT A;  3NPF A;  1UDL A;  4Z8A A;  1M30 A;  3UAT A;  2RQW A;  1SPK A;  1RUW A;  4J9B A;  4LE9 A;  5ECA A;  4ESR A;  1WLP B;  2CH4 W;  2FPF A;  4JJB A;  4LNP A;  2BZ8 A;  1NEG A;  4Z89 A;  1UGV A;  1ZX6 A;  1AVZ C;  5IHK A;  2HCK A;  3O5Z A;  2FRW A;  4CC3 A;  3VS3 A;  3VS7 A;  1PHT A;  4JZ4 A;  1J3T A;  2F2V A;  1GFD A;  3UA7 A;  2DL4 A;  3GBQ A;  1AZE A;  2KXD A;  2CUD A;  1BBZ A;  1NEB A;  1GFC A;  1YP5 A;  2MOX A;  1PNJ A;  4ORZ A;  5IHN A;  4RUG A;  1T0H A;  1AWX A;  2LJ3 A;  2D8J A;  4HCK A;  4R0K A;  2RPN A;  2GBQ A;  2V1Q A;  2DBK A;  4CC4 B;  1ZUK A;  1MV0 B;  1XOV A;  4AFQ C;  1ZBJ A;  4HVU A;  2NUZ A;  2CRE A;  2EVR A;  1K4U S;  4M4Z A;  1AZG B;  4DEX A;  1OOT A;  2J05 A;  1WI7 A;  1X6B A;  2DVJ A;  1SHF A;  3PVL A;  2B86 A;  2CT3 A;  1YWO A;  2ROT A;  4J9G A;  1Z9Z A;  4OMO A;  2FO0 A;  2EQI A;  1UHF A;  2RNA A;  4OMN A;  2YUN A;  1GCP A;  1JQQ A;  2ABL A;  2PTK A;  4WCI A;  2RQT A;  1WX6 A;  5I11 A;  2OI3 A;  1GBQ A;  2C0O A;  4OMP A;  2BZX A;  1H3H A;  5I22 A;  2AKK A;  3JV3 A;  1RI9 A;  4ZNX A;  3SHW A;  2AZV A;  3EG2 A;  3I5R A;  2O9S A;  2LP5 A;  1U06 A;  2G6F X;  2L2P A;  2FPE A;  2XMF A;  3H0I A;  2JW4 A;  4X1V A;  2X3W D;  4IIO A;  2GTJ A;  1GCQ C;  2OJ2 A;  2RN8 A;  5GJV B;  2AK5 A;  2EGE A;  5IH2 A;  4HVW A;  2KRS A;  1WDX A;  4JJD A;  2JS0 A;  2CH4 A;  1K76 A;  1WXT A;  2K9G A;  1E7O A;  2DMO A;  2E5K A;  4RTT A;  3ULR B;  2FEI A;  4LUE A;  2DYB A;  2DX1 A;  2F2X A;  2YSQ A;  2D8H A;  1CSK A;  2JMA A;  4QT7 A;  1JXO A;  4HVV A;  2CDT A;  4RTZ A;  2BZY A;  3H0F A;  2O88 A;  4Y92 A;  1FYN A;  2KE9 A;  2KRO A;  2DL5 A;  2O31 A;  1OV3 A;  2EW3 A;  1QKW A;  1M3C A;  2O9V A;  1HJD A;  3REA B;  1CKA A;  2LJ0 A;  2KXC A;  3M0R A;  1WA7 A;  1X2K A;  4J9D A;  3KFV A;  3C0C A;  1QKX A;  1SSH A;  4OML A;  1N5Z A;  1A0N B;  3RNJ A;  1ARK A;  1NG2 A;  1GBR A;  1M27 C;  2F2W A;  5GJW B;  2GNC A;  2EYY A;  1X43 A;  2JM8 A;  1GCQ A;  3M0T A;  1NYG A;  1H92 A;  4RTU A;  1X2Q A;  2AKL A;  2JXB A;  2J7I A;  3UF4 A;  2HDA A;  1IO6 A;  2H8H A;  1SRL A;  1QLY A;  4D8K A;  2KBT A;  3PVQ A;  1JXM A;  5L23 A;  1RLQ C;  3SEM A;  4J9H A;  2CT4 A;  1KFZ A;  2J6F A;  2EGC A;  4OMM A;  1PKS A;  4EIK A;  1AWJ A;  2JT4 A;  3IQL A;  3VS1 A;  1W6X A;  2AZS A;  2KRM A;  3TSW A;  4F16 A;  2LZ6 B;  1UE9 A;  4FSS A;  2D1X A;  1E6G A;  3U23 A;  1MUZ A;  1W1F A;  2ED0 A;  2V1R A;  1U3O A;  3ZL7 C;  4CC7 A;  1WXU A;  2K3B A;  1TG0 A;  3REB B;  2L3P A;  2YT6 A;  2LX7 A;  2M0Y A;  1M3B A;  2ED1 A;  3EHR A;  2IIM A;  1YN8 A;  1QWE A;  3A98 A;  2L3S A;  2MIO A;  1M8M A;  2DRM A;  1I07 A;  2EYZ A;  1CKB A;  2EYW A;  2DE0 X;  1YNZ A;  2A28 A;  1W70 A;  1X69 A;  2C0T A;  2X3X D;  3NHN A;  2PNI A;  2DIL A;  1I1J A;  1UG1 A;  3EHQ A;  3CQT A;  1Y57 A;  2W10 A;  1NYF A;  2KYB A;  2P4R A;  3H0H A;  2FRY A;  2L3Q A; 
#chains in the Genus database with same CATH topology
 2X51 A;  1VQ6 T;  1EFN A;  2DIG A;  3Q1J A;  1KC8 C;  2Y90 A;  3M0U A;  2DXT A;  3MJX A;  2HQX A;  2DTI A;  3HTR A;  3FJ5 A;  1WNL A;  3UWN A;  4ELZ C;  2KVQ G;  1LNX A;  4M78 G;  5GAM j;  1K73 U;  4XU2 A;  2E12 A;  1VQ8 A;  2RO0 A;  1ZUY A;  2QTX A;  3H9N A;  1EX4 A;  3VU3 C;  3G6E A;  1W2B S;  5J26 A;  2GTO A;  2CUB A;  2BTT A;  4D8D A;  4MMK A;  3CD6 Q;  3EG3 A;  2RJE A;  4C8Q C;  4PLI A;  3M5A A;  3THK A;  4J7F A;  2K7A A;  4HCC A;  1VYT A;  2DZ9 A;  2KDS A;  2MCN A;  2L0A A;  2VYT A;  1YHQ A;  3MET A;  3CCQ T;  1VQL T;  4M7D D;  1K0X A;  4ZN3 A;  2NLU A;  1EIF A;  5KYW B;  4NL2 A;  1JJ2 S;  3X24 B;  1VQ4 A;  2DET A;  1ZA2 B;  4AMC A;  3CMA Q;  2RJF A;  2ATC B;  3QHS A;  4JZ3 A;  4RTX A;  2M51 A;  3OSV A;  2KR3 A;  2HAX A;  2QG9 B;  3QII A;  1M1F A;  1PC0 A;  2Z0W A;  1HYO A;  1G5V A;  1VQP T;  1UTI A;  1V76 A;  5C0M A;  2K5L A;  4AG2 C;  1C6V X;  2JZ2 A;  2HL5 C;  5FWB A;  2M16 A;  2DJQ A;  3QXE B;  3OW2 P;  1K1Z A;  5CKB A;  1TUC A;  1UUE A;  3MP8 A;  4XTV A;  4E6R A;  3DLM A;  2ZGW A;  3SB2 A;  1OUL A;  1BCO A;  2LJ1 A;  5KYX B;  1OZ3 A;  2RJD A;  3L2Q A;  3JCM c;  4C8Q A;  4F14 A;  2DL8 A;  2DXB A;  1BI2 A;  4ME7 A;  5GAO r;  1C1A A;  2VKN A;  2D6F A;  1UHC A;  1VYV A;  1TSF A;  4RTW A;  2QDL A;  1YIJ A;  4QVC A;  1OQK A;  2VVK A;  3CCR Q;  3I56 A;  3TSZ A;  4XU1 A;  2CZ1 B;  1H3Z A;  1JBM A;  2A3L A;  2CSI A;  2E1H A;  1X6G A;  4LDX A;  4IUV A;  3QPH A;  3RKY A;  2HEQ A;  4N4I A;  5FU6 B;  4F17 A;  4AT1 B;  1EZZ B;  1NPP A;  1WHG A;  5HCK A;  2XDB A;  4C0D B;  3V8K A;  2K4Y A;  2QQ9 A;  5L8R E;  4ZGJ B;  4BY6 C;  2E64 A;  3J7A F;  4EMK B;  1NLP C;  2DAQ A;  3V8L A;  5KYX A;  1PKT A;  1K9M U;  1VOM A;  2GFA A;  2JS2 A;  2K5I A;  2HKN A;  2Y4Y A;  4HT8 A;  4C8Q B;  3QSU A;  3SFM A;  1I0C A;  4JRQ A;  1OX9 A;  2YRD A;  1TUD A;  2XDD A;  1KK7 A;  3CMA A;  1UJY A;  3JCM Q;  1W4S A;  5FW9 A;  1UB4 A;  2CP3 A;  2QAZ A;  2W0Z A;  5GAN d;  2JM9 A;  3VS6 A;  3SWN C;  1DJ7 B;  2E65 A;  3CCS A;  4C8Q D;  2JTE A;  2K6D A;  1OPL A;  2RH2 A;  1WHM A;  4PFZ A;  4E7K A;  4IKF A;  5GAN 6;  1SHG A;  2YDL A;  5IT9 E;  2IG0 A;  1G83 A;  3LH5 A;  1G3T A;  2EPD A;  1BYM A;  1U1S A;  5LJ3 j;  2HBP A;  4O6J A;  5IXF A;  1Y96 B;  1R77 A;  3EG0 A;  3MP1 A;  2DPP B;  4Z8A A;  3MEV A;  3QYG B;  4EMK A;  3VYH B;  5I21 A;  5ECA A;  4ESR A;  4M77 B;  2CH4 W;  3ZBD A;  5DLQ E;  1D0Z A;  4E7S A;  4MML A;  3O5Z A;  1YJ9 T;  2R58 A;  3VS7 A;  1PHT A;  1N9R A;  1VQL Q;  2RA2 A;  3RKX A;  5LJ5 e;  4M7A G;  3VKI A;  4E7I A;  3CMA T;  4F7U G;  4L6V 5;  2D8J A;  4HCK A;  2GBQ A;  1KD1 R;  4CC4 B;  4X9D A;  3M9Q A;  4PJM A;  1MND A;  4BE2 A;  1XOV A;  4GY5 A;  1YI2 Q;  3SWN B;  4AFQ C;  5FLX E;  4HVU A;  2EJ9 A;  5C6S A;  2LDM A;  1K8A U;  1AZG B;  4C0G A;  3HPW A;  2EWN A;  3A8L B;  2XK0 A;  2L8D A;  4JRK A;  2J05 A;  2RM4 A;  1Q81 C;  2RD1 A;  4C92 B;  4MDW A;  2NUT B;  3SDZ A;  4BAC A;  2CT3 A;  1YWO A;  3D7S B;  4VUB A;  3PIP A;  3FB9 A;  1VQ7 Q;  3GIB A;  1MNE A;  4OMN A;  1UEB A;  3CCE T;  2ABL A;  2PTK A;  3OYL A;  1AHJ B;  5I11 A;  4M7D B;  2EJG A;  5I2M A;  3I56 T;  2LT4 A;  2DVE A;  3CCR T;  4M75 B;  3I5R A;  2L2P A;  2FPE A;  3H0I A;  2X3W D;  4E7J A;  2ZAE A;  4HT9 A;  1G3S A;  2OJ2 A;  3CBM A;  5IH2 A;  2VC8 A;  4JJD A;  6AT1 B;  2CH4 A;  5AT1 B;  1K8A C;  2COW A;  2IPO B;  3HRT A;  4C92 A;  2FEI A;  3DLL A;  3G71 Q;  4M78 D;  1FMW A;  2DYB A;  3URG A;  3CPF A;  2D8H A;  1W2B A;  2JMA A;  4F7U E;  1PCX A;  1O9S A;  3EFS A;  1QP2 A;  1KG1 A;  3EFR A;  3LWH A;  2O88 A;  5CCA A;  3QJY A;  2XKO C;  1TTH B;  3MEW A;  2COZ A;  4FM4 B;  2O31 A;  2BIV A;  3G7Z A;  3OA6 A;  2EW3 A;  5GAN 5;  2LJ0 A;  1UGP B;  4C8Q E;  3C95 A;  3C0C A;  3MO8 A;  1A0N B;  3RNJ A;  3EG9 B;  2DZC A;  4FYV B;  1NZ9 A;  3CCJ Q;  3GF5 A;  4M7A E;  1VIE A;  1H92 A;  4RTU A;  1KQ2 A;  4KGV B;  4BE0 A;  2X4X A;  5LJ3 d;  2QEX T;  1K73 C;  3INZ A;  4FYY B;  3RMS A;  2JTF A;  5GAO m;  4D8K A;  3L2V A;  1OZ2 A;  3JB9 D;  1JXM A;  5L23 A;  2QXF A;  1RLQ C;  3SEM A;  1KFZ A;  4X34 A;  4R55 A;  5GAM d;  4IUU A;  4BI4 A;  1YJ9 Q;  1KQS S;  1QCO A;  1PKS A;  1Q95 G;  4EIK A;  2A7Y A;  1W6X A;  3KUF A;  2AZS A;  4XU3 A;  2MWO A;  4IUP A;  3EH1 A;  3JCM b;  5KE2 A;  2AT1 B;  4JLI A;  3TCJ A;  3OYM A;  3OS2 A;  1W1F A;  3ZL7 C;  1TG0 A;  3OYC A;  1Y07 A;  2P0Q A;  3EHR A;  3E9F A;  3A98 A;  3EG9 A;  3PMT A;  1WGS A;  2XD0 A;  5CIU A;  2EYZ A;  1D1A A;  4PJO B;  2EYW A;  2LVM A;  2DE0 X;  3NHN A;  2QI2 A;  1I1J A;  4XTX A;  3EHQ A;  3FIF A;  1M5Q 1;  3BFM A;  4M7A D;  2LTO A;  5GAM f;  1NYF A;  1TH7 A;  3M54 A;  3S3O A;  2KYB A;  4E7H A;  2JN0 A;  2L3Q A;  1SG5 A;  2LT1 A;  5EG2 A;  3QWY A;  3CCV Q;  2RQV A;  3R6N A;  2LMJ A;  2QTV A;  3M0S A;  4FYW B;  2GGR A;  5EC7 A;  1WFW A;  4DEY A;  2DTH A;  2LQ8 A;  4E7L A;  2R5M A;  2DRK A;  4MDX A;  4Z02 A;  1YIT Q;  4B6M A;  4BI3 A;  2YWW A;  4BDZ A;  1X6O A;  1S72 T;  1ABO A;  2LQN A;  4M7D E;  4PJO A;  1QVF S;  1UJ0 A;  3CD6 T;  2EYX A;  4FIB A;  5LJ3 f;  1YJW A;  4NL3 A;  2MPX C;  4PJN A;  1VQ6 Q;  3EGD B;  4OF1 A;  2KNB B;  2PU9 B;  2KT8 A;  5IAY A;  1KQ1 A;  2E3I A;  5HK3 A;  3I56 Q;  1JRI A;  1B3Q A;  2E5Q A;  1MMD A;  1TUG B;  1BU1 A;  1H64 1;  1QVG A;  2F1L A;  2DYI A;  3M56 A;  1D3B B;  2QYZ A;  3M59 A;  2DL7 A;  3GP8 A;  1Q86 R;  1K9A A;  3I5S A;  1HD3 A;  2YUQ A;  3FRN A;  2DER A;  3CME Q;  2KMT A;  1TS9 A;  2CGH A;  2H3E B;  1JEG A;  3J81 E;  1WHH A;  2EJF A;  1WYX A;  1HSQ A;  3V7S A;  2SEM A;  4ATO A;  3G1J A;  2MK5 A;  1XJW B;  3LW5 E;  2QEX Q;  2DO3 A;  3EAE A;  3OMG A;  3CCQ Q;  5CQX A;  3JCM X;  3OYJ A;  3PE0 A;  2K3X A;  5IN1 A;  4LXC A;  1K8A R;  4KH0 B;  3FJP A;  2JJ9 A;  2FZK B;  4JUV A;  3SD4 A;  1YJN T;  1M90 C;  3JCM g;  3DB3 A;  1C0M A;  2YUP A;  4BE1 A;  1ABQ A;  3VRY A;  1B7T A;  1X27 A;  3PIO A;  1VQK T;  2O2O A;  1WHJ A;  1VA7 A;  1VQK A;  1GRI A;  1QWF A;  3VS5 A;  3H41 A;  4XK8 E;  2BE9 B;  4XTW A;  3JCM h;  3CCE Q;  3P8B B;  4QVD A;  1MMG A;  4IUQ A;  3JB9 I;  1N8R C;  3LLR A;  5GAO q;  1RAC B;  4AG1 C;  1ZUU A;  2C0I A;  3OYB A;  1WHK A;  4EMH A;  2OTJ T;  3HFO A;  5KCO A;  3VS0 A;  3MHX A;  2WSF E;  1PD0 A;  2R5A A;  3OMC A;  1Q81 R;  2QAS A;  4A4H A;  5CVI A;  4J9I A;  3T9N A;  3VRZ A;  4DBF A;  5LJ5 d;  2DFU A;  1VQL A;  2QA4 T;  3L1A A;  3CPW P;  1FWZ A;  3OS5 A;  4CC2 A;  1UGS B;  2F5K A;  3NTI A;  5HY6 A;  1ZSG A;  1KD1 C;  4DBR A;  1N6A A;  3TQ7 P;  4PJO E;  2GQI A;  2YXY A;  1UEC A;  4M7D G;  2RQR A;  3SWN A;  1VIF A;  1IGQ A;  1NM7 A;  1WZO A;  2GF7 A;  3TVT A;  4C5E A;  3OY9 A;  1Q82 R;  3NPF A;  2HL3 A;  3A5Z B;  3CCQ A;  4J9B A;  4OB3 B;  2EQJ A;  1WLP B;  4RCC A;  3RKW A;  4JJB A;  2BZ8 A;  1UGV A;  1AVZ C;  2FRW A;  4CC3 A;  5LJ3 e;  4M7D A;  3OYD A;  1N9S A;  1GFD A;  1YJW Q;  4PJO F;  1NEB A;  1GFC A;  1PSE A;  1YP5 A;  5KE3 A;  4ORZ A;  2HQE A;  1D1B A;  2DXU A;  1T0H A;  2LJ3 A;  3M53 A;  2V1Q A;  2PVG B;  1YIT A;  1RAF B;  1ZUK A;  1QCN A;  5J3B A;  5GMK l;  8AT1 B;  1IHW A;  5GAN h;  2EVR A;  1IRE B;  3I55 T;  4DQ2 A;  4HKE A;  4CI0 C;  3L2U A;  4DEX A;  3CCL A;  4OB1 B;  1WI7 A;  1X6B A;  4OGE A;  1G8X A;  1O75 A;  2KY9 A;  1BIB A;  1SHF A;  3PVL A;  3OYG A;  4KUD K;  2B86 A;  3LYI A;  1VQN A;  5CKD A;  5D6W A;  2O01 E;  3RMQ A;  2FO0 A;  2E4H A;  2YLC A;  3PT9 A;  3WVD B;  2RQT A;  1VQO T;  2OI3 A;  1JJ2 P;  2NUP B;  2DEQ A;  1GXI E;  2C0O A;  4OMP A;  1MHN A;  1H3H A;  4M78 C;  5I22 A;  1OU9 A;  3JV3 A;  2QEX A;  2RHI A;  2CP2 A;  2EYQ A;  3EG2 A;  1U06 A;  2G6F X;  3HL8 A;  3VV0 A;  3RIR A;  2JW4 A;  4X1V A;  2AHJ B;  5KYN A;  2E6N A;  7AT1 B;  4O5V A;  2CP0 A;  3HRS A;  2RN8 A;  5GJV B;  2R57 A;  2EGE A;  2E3H A;  4HVW A;  1WDX A;  2VUB A;  2JS0 A;  4C8Q G;  2JOY A;  3ULR B;  2MAM A;  5A2Q E;  3GOX A;  4LUE A;  3X25 B;  5KYY B;  1PSF A;  3EFO A;  4QT7 A;  3CPW A;  4ANJ A;  5GAN g;  2QQR A;  1VQ5 Q;  4HVV A;  1M2V A;  1YJ9 A;  4RTZ A;  1F1B B;  3TEE A;  5GAN 7;  4Y92 A;  1YFN A;  1VQ4 T;  2KE9 A;  1OI1 A;  2KRO A;  2DL5 A;  4RMO A;  4MZP A;  3CME A;  1M3C A;  1VQK Q;  5GAO l;  3GPL A;  1I8F A;  1WA7 A;  1X2K A;  4J9D A;  2OAU A;  1NG2 A;  1M27 C;  4A4G A;  2OTL A;  3A8H B;  4J8O A;  1M1K U;  4J5Y A;  4WF2 A;  3M0T A;  3QDR B;  1Y7X A;  3G71 T;  2EQM A;  4M7D F;  2ZPE B;  1K9M R;  1X2Q A;  1RAB B;  2RI2 A;  3QUI A;  3UF4 A;  3QG1 A;  5HK0 A;  1OX8 A;  3PVQ A;  3HFN A;  1M2V B;  2HMA A;  4JRI A;  2E41 A;  2YLB A;  2KI7 A;  3V7C A;  4Y91 A;  2HZY A;  2AIR B;  2KSS A;  4XQ3 A;  3NTH A;  4F16 A;  1BI3 A;  3EGX B;  4FSS A;  1Q82 C;  1E6G A;  5FRM A;  4E2F B;  2IVW A;  2ZPH B;  1MUZ A;  2P84 A;  2V1R A;  4CC7 A;  3PTA A;  2K3B A;  1K9M C;  3OBY A;  2L3P A;  3J80 E;  3DKM A;  2LCC A;  1YN8 A;  1WJS A;  2L3S A;  3F70 A;  1W2B P;  1M8M A;  1N8R U;  2VV5 A;  1YNZ A;  5GAM g;  1X69 A;  3I55 Q;  2M0O A;  2PNI A;  2DIL A;  4II1 A;  3CQT A;  4FU6 A;  1ZSZ B;  3OW2 A;  2P4R A;  1RAE B;  2V8J A;  3EGD A;  4J83 A;  4A4K A;  3GNG A;  2PUK B;  4M77 F;  2DF6 A;  1KQS P;  2J6K A;  2RQU A;  4ZGE B;  3M4Y A;  2EIF A;  2L5Q A;  2HD0 A;  3ZFJ A;  2GCX A;  1ZLM A;  4M77 E;  2RMO A;  1NJI U;  1OU8 A;  4KT0 E;  2OTJ Q;  1D3B A;  3G71 A;  2YRC A;  4A63 B;  1I4K 1;  2XIC A;  2V8I A;  4C0F A;  2BUD A;  4LDV A;  3VUZ A;  1M3A A;  5D6Y A;  2QA4 Q;  1S1N A;  3CC7 A;  1GL5 A;  5LJ5 f;  1YWP A;  2RHX A;  4M77 G;  2K2M A;  1JO8 A;  3LH0 A;  4JS5 A;  1R0B G;  2DBM A;  2EQK A;  1Z9Q A;  2V8K A;  4C8Q F;  2Y4X A;  2VWF A;  3HSB A;  3MPU B;  2NWM A;  3VS4 A;  1VQO Q;  3UA6 A;  1VQ5 T;  3CPW S;  2PZ1 A;  1SRM A;  4YTL A;  2RHY A;  1LCK A;  3QZ5 B;  1YI2 A;  1VQM Q;  3FLG A;  4XU0 A;  1XQH A;  2LRQ A;  4J6X A;  4V2S A;  1K73 R;  1JB0 E;  3M58 A;  4PL6 A;  4NOY A;  3TRE A;  1OEB A;  1YIT T;  1MMN A;  3JB9 G;  1KD1 U;  1RL2 A;  2DA9 A;  3CCL Q;  5HKC A;  4M75 F;  1S72 Q;  3NMZ C;  1U1T A;  1WJR A;  3ASK A;  3HP9 A;  3H6Z A;  2KT1 A;  4J9E A;  1M1G A;  3L2W A;  4M75 E;  1KHI A;  1SEM A;  2D0N A;  1VQN T;  2FPD A;  4BY6 B;  2ZPF B;  3I35 A;  2I2L A;  4N0A A;  3QDF A;  3EGU A;  1T0J A;  3JCM f;  2J6O A;  1FMK A;  2A36 A;  2B8A A;  4QW2 A;  4OMQ A;  3DB4 A;  1M90 U;  2RJC A;  4C92 F;  2PUO B;  1ZHI A;  4OVA A;  3M0Q A;  2RF0 A;  3AT1 B;  3VS2 A;  5LJ5 g;  4M7A A;  1QQJ A;  3CC4 T;  5IXB A;  2GQV A;  1PG5 B;  3E19 A;  4IIM A;  2P4T A;  4M75 G;  4KRT A;  1WQW A;  2H3J A;  1KJW A;  4JPB W;  4L59 A;  3ME9 A;  4JJC A;  1FX7 A;  3EG1 A;  3A8M B;  2QA4 A;  4K11 A;  3NGP A;  2CSQ A;  2EGA A;  2EBP A;  4OB2 B;  5CKF A;  1FXX A;  4AFZ C;  4GLM A;  4N4G A;  3OBW A;  4BB7 A;  2CP7 A;  4QKU A;  1PWT A;  3RER A;  1UGR B;  2ESW A;  2DL3 A;  3H8Z A;  1KSW A;  3LGL A;  1WJQ A;  3OYY A;  4C5H A;  4J9C A;  2DIQ A;  1QW1 A;  4N4H A;  2QDY B;  4LDU A;  1YJN Q;  4DOW A;  1AOJ A;  1PRM C;  5FWC A;  1VQM A;  1Q81 U;  3S3M A;  2KQW A;  4BDY A;  2GFU A;  1MV3 A;  3RR6 A;  1QCF A;  4RG8 A;  2E6Z A;  1I5O B;  3UDC A;  2HSE B;  3JB9 J;  1RAA B;  1LJO A;  3C94 A;  1VQ7 T;  1JU5 C;  5CKH A;  2E70 A;  1U5S A;  5GAN j;  2A37 A;  1BK2 A;  4A53 A;  2K79 A;  2K5F A;  4AFU C;  3OYI A;  4RTV A;  3E2U A;  3HKS A;  1M1K C;  3CCE A;  1UDL A;  3CBO A;  4TVR A;  4C0Z A;  2RQW A;  2JTM A;  1VQP A;  2VGN A;  1RUW A;  4LE9 A;  4Z89 A;  5IHK A;  1KQS A;  2HCK A;  1BIA A;  2M1H A;  4JZ4 A;  2NUP A;  5I2S A;  1J3T A;  2F2V A;  1TU0 B;  4C0D C;  3UA7 A;  2DL4 A;  3GBQ A;  4EMK C;  1AZE A;  2KXD A;  1BBZ A;  1LVK A;  2XU8 A;  5FU6 C;  2MOX A;  1PNJ A;  4RUG A;  1VQM T;  1VQ9 A;  4DA4 A;  1AWX A;  3C4S A;  4R0K A;  1M2O A;  2CZ6 B;  4MZT A;  2RPN A;  1YIJ T;  4J6Y A;  1MV0 B;  3WXM B;  4XTU A;  2RHZ A;  3X28 B;  2F5T X;  2RI3 A;  3PNW C;  1ACM B;  3G6E T;  4FT2 A;  1YCY A;  1I81 A;  4JJN K;  4C92 G;  9ATC B;  1Z9Z A;  4OMO A;  5KYY A;  3EFO B;  3HRU A;  3CC2 A;  2RNA A;  2RI5 A;  5CR2 A;  4RKU E;  3CCM A;  4WCI A;  5FU7 B;  1WX6 A;  4PJL A;  3CCJ T;  3OSS C;  4LD9 K;  1RI9 A;  4ZNX A;  3G4S T;  2RK1 A;  3CCM Q;  3X26 B;  2AZV A;  3RUX A;  1M4Z A;  2O9S A;  2D0Q B;  4C5I A;  1GCQ C;  2LX9 A;  2AK5 A;  4QVZ A;  4X9C A;  3VYG A;  1Q7Y R;  3V8J A;  1NBE B;  1NJI C;  1K76 A;  2EAY A;  4RCB A;  3M4G A;  4QQG A;  1YJW T;  2K9G A;  1E7O A;  2DMO A;  2XDP A;  4PJO G;  2E5K A;  4P5N A;  4RTT A;  2A0F B;  4ZN1 A;  4KH1 B;  3JAM E;  4UC4 A;  4HCB A;  4PJO C;  3CCU T;  1CSK A;  2WSE E;  1JJ2 A;  2DD4 A;  4C92 D;  2C06 A;  3H0F A;  2PQW A;  5A0L A;  3FC3 A;  2OTL Q;  1IZ6 A;  1FYN A;  1PM3 A;  4J7I A;  4CRI A;  3L2Z A;  2VXF A;  4M78 E;  2RHU A;  2VGM A;  2V26 A;  5A0G A;  2K2V A;  3OYE A;  3EGX A;  1OV3 A;  1QKW A;  1HJD A;  2O9V A;  4E7Z A;  3REA B;  1M90 R;  4PK4 A;  5GAM h;  2KXC A;  3M0R A;  4FCY A;  1B34 B;  3ER0 A;  3KFV A;  5KYU A;  1SSH A;  3M57 A;  1KC8 U;  2DD5 A;  4OML A;  4E47 A;  2VXE A;  2CP5 A;  1VQO A;  4XTZ A;  4FW1 A;  1ARK A;  5CKE A;  2F2W A;  1M1K R;  5GJW B;  2FZG B;  1BI0 A;  2DTO A;  1NYG A;  1BCM A;  4HA8 A;  2QK0 A;  2QGF B;  1D1C A;  1ZSZ A;  3JRZ A;  2J7I A;  5GMK j;  2X4Y A;  1QLY A;  3OYK A;  1RAD B;  2KBT A;  5D7U A;  3QYH B;  2ZPB B;  2O4X A;  1Q7Y U;  3OYA A;  4JLG A;  2X4W A;  5GAO p;  2JT4 A;  3X20 B;  3IQL A;  1WQ7 A;  4FT4 A;  3VS1 A;  3CCU A;  2KRM A;  1VQ9 T;  3I55 A;  4JS4 A;  3UPU A;  2LZ6 B;  1UE9 A;  1QVF A;  3U23 A;  2MF2 A;  3LWI A;  1U3O A;  1VQN Q;  1WXU A;  2DJZ A;  3REB B;  5GAN 4;  2YT6 A;  4IUR A;  2LX7 A;  2M0Y A;  1RAH B;  1QWE A;  1X75 C;  5LL6 S;  4EPC A;  4F7U F;  3HHT B;  3NFC A;  2DRM A;  3KBG A;  1I07 A;  2MYS A;  2YRV A;  2A28 A;  4PKC C;  2X3X D;  2PVD B;  2XHC A;  3CC4 Q;  1Y57 A;  5FRO A;  3G4S A;  1BKB A;  2W10 A;  4M75 D;  2DEU A;  3H0H A;  2FRY A;  2KEA A;  4J9F A;  1IGU A;  4OGC A;  2O4X B;  5CAI A;  1XNI A;  4WTO B;  3JCM e;  4D6W A;  1AT1 B;  5GAN 2;  3V7R A;  1KC8 R;  4OB0 B;  1SKU B;  2VB6 A;  4QQ6 A;  3C12 A;  4KUL A;  2SRC A;  3OB9 A;  3ZEH A;  4HXJ A;  4ZTF A;  1T3S A;  3PGG A;  3CCM T;  2LQW A;  3CCV A;  2YHT A;  5LJ5 h;  1YBY A;  3CC2 T;  4C92 E;  1MMA A;  2FVU A;  1NLO C;  2I0N A;  2ZZD A;  1G3Y A;  3RDV A;  5IHI A;  1VQP Q;  1P92 A;  1VQ6 A;  1AD5 A;  4IUT A;  2QQB A;  1M9S A;  2DXC A;  4JDS A;  1VQ4 Q;  2CP6 A;  2LCS A;  4XTY A;  3WVE B;  5J39 A;  2LQK A;  2OTJ A;  2LCL A;  1LPL A;  3JSC A;  1D0X A;  1WHL A;  4LUD A;  2X9H A;  3QBY A;  3JCM d;  3CBP A;  1T3L A;  3MEA A;  5GMK i;  5GAN f;  3QWX X;  1H8K A;  5D6X A;  3CCU Q;  3I9Q A;  1RAI B;  2EKO A;  1RLP C;  2A08 A;  4OMF B;  2LC4 A;  4KGX B;  4EDU A;  1V29 B;  4M7A B;  3RBB B;  2ZPG B;  2DM1 A;  1WIE A;  4BI8 B;  4ZTJ A;  4F04 B;  2OAW A;  2MWP A;  3JCM P;  1Q7Y C;  4M77 D;  4Z88 A;  2FHD A;  2QQA A;  2EKH A;  4LN2 A;  1VQ8 Q;  2FL7 A;  2CZ0 B;  1WXB A;  3BW1 A;  5GMK e;  2JMC A;  4GBQ A;  4AFS C;  5LJ3 h;  2F69 A;  2HSP A;  4PFO A;  3E1S A;  2KYM A;  3CCV T;  1OYX A;  4Y28 E;  1Q82 U;  3EH2 A;  4M78 B;  4J6W A;  2J06 A;  1G2B A;  4KBM B;  4LDW A;  3P8H A;  1AWW A;  3MEU A;  3PFS A;  2DLP A;  4RTY A;  1K0S A;  2G3R A;  1ZQ1 A;  1YHQ Q;  2KK4 A;  4FSX A;  5GMK h;  2DNU A;  5KYW A;  3JCM V;  4KUI A;  1B07 A;  1KIK A;  3QO3 A;  2KRN A;  3NTK A;  1BI1 A;  3TU4 K;  2KGT A;  2ECZ A;  1Y0M A;  2X35 A;  3CCS T;  3OS0 A;  2COY A;  2HBW A;  1UFF A;  2JNG A;  3CCL T;  4ELY C;  4A54 A;  2MMP A;  3S6W A;  2CZ7 B;  1AEY A;  4M7A C;  1BB9 A;  2CS7 A;  1VYU A;  1XTD A;  2D9T A;  1X01 A;  2XI9 A;  2LNH B;  4GLK A;  1KHC A;  4RG2 A;  1PRL C;  4M7A F;  2JVV A;  2YUO A;  3QZ9 B;  1HK9 A;  4A4F A;  1WPY A;  1OPK A;  1M8V A;  4L5G A;  4M78 A;  1FMV A;  2X4J A;  3M0P A;  1ZSZ C;  3CC7 T;  3LX7 A;  5FU7 C;  3OYF A;  1RI0 A;  4MZM A;  3UT1 A;  1V1C A;  1QP3 A;  4C5G A;  3RES A;  2RB6 A;  3JB9 H;  4JRP A;  2FG0 A;  2LNV A;  1LOJ A;  4BUG A;  4LD6 A;  4F7U A;  1VQ9 Q;  2CKK A;  3AHU A;  4ZGD B;  2ROL A;  4PFP A;  3BE3 A;  1E6H A;  3CXC P;  1YCS B;  2OX7 A;  1I5L A;  1AWO A;  1YJN A;  2ENM A;  3CCJ A;  2FB7 A;  5LJ5 j;  1YI2 T;  5A0D A;  2BKD N;  3KXT A;  1M30 A;  3UAT A;  4LDY A;  1SPK A;  3OW2 S;  3FEO A;  2FPF A;  4LNP A;  1NEG A;  1ZX6 A;  2FZC B;  2ZCF B;  5GAN e;  1Q86 U;  2QQS A;  3VS3 A;  1HXD A;  3O8V A;  3OS1 A;  1MGQ A;  5CK9 A;  1G3W A;  2CUD A;  2QGG A;  4F7U B;  5IHN A;  2NYS A;  3OQ5 A;  3QKJ A;  2L89 A;  3JCM W;  3CXC S;  2DBK A;  3CC2 Q;  5FRN A;  1Y96 A;  4PLL A;  1SSF A;  1ZBJ A;  2CYZ B;  2NUZ A;  3BDL A;  2CRE A;  3CC4 A;  1K4U S;  4M4Z A;  2M9U A;  4PJJ A;  3G6E Q;  2HKQ B;  1QVF P;  3BY7 A;  1OOT A;  3VJP A;  4DOV A;  4FL6 A;  2DVJ A;  3GNF B;  4M77 A;  5DLO A;  3CD6 A;  2DKG A;  3OYH A;  2ROT A;  3M55 A;  3FDR A;  4J9G A;  5AYF A;  2EQI A;  1UHF A;  4FW2 A;  4NS5 A;  2PVO B;  1U8R A;  2YUN A;  1GCP A;  1JQQ A;  2K57 A;  4M78 F;  1Q86 C;  2E10 A;  2WAC A;  4N0A C;  1GBQ A;  4DBH A;  3BDU A;  2BZX A;  2AKK A;  4KGZ B;  4R56 A;  1QVP A;  3G4S Q;  1VQ7 A;  2RK2 A;  3SHW A;  4PNO A;  2LP5 A;  1YIJ Q;  5CO7 A;  2XMF A;  1N27 A;  2P0P A;  2HNI A;  1B34 A;  4IIO A;  5KYU B;  1VQ8 T;  2GTJ A;  1SF9 A;  3P8D A;  2EFI A;  2KRS A;  1IB8 A;  4B9X A;  5GAM e;  4M77 C;  3PMI A;  1WXT A;  1VQ5 A;  3LGF A;  3CXC A;  2L3R A;  2NUT A;  4OP0 A;  2DX1 A;  2F2X A;  2KAF A;  2YSQ A;  1UGQ B;  1JXO A;  1VUB A;  3JCM J;  2CDT A;  5LJ3 g;  3CEY A;  2BZY A;  2VAS A;  1YHQ T;  3MP6 A;  3QJ6 A;  2M02 A;  1NE8 A;  1IHV A;  2OTL T;  2XG8 D;  1S72 A;  2FYK A;  3GLX A;  5KH6 A;  3CCR A;  3L42 A;  4PJO D;  4M75 A;  4EMG A;  1QVG P;  3A8O B;  3A8G B;  3CCS Q;  1CKA A;  1IRX A;  3S3N A;  5GAN 8;  1QKX A;  5KCH A;  5GAN 3;  1N5Z A;  4BD3 A;  3A1P A;  4HCZ A;  4A4E A;  1GBR A;  3R6O A;  4M7D C;  2GNC A;  1NPR A;  2EYY A;  1X43 A;  2JM8 A;  4XAX B;  1GCQ A;  3JB9 F;  2BE7 D;  2HQH A;  1Y71 A;  2P0K A;  2AKL A;  2JXB A;  2EQU A;  3CC7 Q;  5M9O A;  2HDA A;  1TXQ A;  1IO6 A;  2H8H A;  2XID A;  1SRL A;  8ATC B;  4Q5W A;  5CQY A;  2JUF A;  1QMC A;  4J9H A;  2CT4 A;  1N8R R;  3CME T;  2J6F A;  2EGC A;  4OMM A;  3VUB A;  1AWJ A;  1R0C B;  4M75 C;  3TSW A;  1D09 B;  2K3Y A;  2D1X A;  1TOV A;  1NJI R;  2ED0 A;  1QVG S;  4FYX B;  3N5B B;  1PD1 A;  1M3B A;  1RAG B;  2ED1 A;  1R8O B;  4B9W A;  2IIM A;  1D0Y A;  2WSC E;  1TWB A;  2ZPI B;  5GMK m;  5DM7 R;  3MCA B;  2MIO A;  1IXD A;  1CKB A;  1ZBX A;  1W70 A;  2C0T A;  3MKD A;  2MI6 A;  4C92 C;  5DY9 A;  1UG1 A;  3L2R A;  4DBQ A;  3OYN A;  5GAO n;  3E9G A;  4QQD A;  1ZA1 B;  2DK3 A; 
#chains in the Genus database with same CATH homology
 2KEA A;  4J9F A;  1EFN A;  2DF6 A;  3M0U A;  2J6K A;  2RQU A;  3QWY A;  2RQV A;  3R6N A;  2LMJ A;  3FJ5 A;  3M0S A;  2SRC A;  4HXJ A;  1ZLM A;  1T3S A;  2GGR A;  2RMO A;  5EC7 A;  1WFW A;  4DEY A;  2LQW A;  4A63 B;  1ZUY A;  2DRK A;  1NLO C;  2I0N A;  5IHI A;  1M3A A;  1ABO A;  2LQN A;  2GTO A;  2CUB A;  1AD5 A;  1S1N A;  2BTT A;  4D8D A;  2LCS A;  1GL5 A;  1UJ0 A;  1YWP A;  2EYX A;  3EG3 A;  2K2M A;  1JO8 A;  4LUD A;  3THK A;  2DBM A;  1T3L A;  2K7A A;  1Z9Q A;  1VYT A;  2KNB B;  3QWX X;  2VWF A;  1H8K A;  2MCN A;  2L0A A;  3I9Q A;  1K0X A;  2KT8 A;  2NWM A;  1RLP C;  3VS4 A;  3UA6 A;  2A08 A;  2PZ1 A;  1SRM A;  3RBB B;  1B3Q A;  1LCK A;  2DM1 A;  1WIE A;  1BU1 A;  2OAW A;  4JZ3 A;  4RTX A;  2M51 A;  2DL7 A;  2KR3 A;  4Z88 A;  1OEB A;  2EKH A;  1K9A A;  4LN2 A;  3I5S A;  2DA9 A;  1WXB A;  1HD3 A;  2YUQ A;  2JMC A;  4GBQ A;  4AFS C;  3NMZ C;  1UTI A;  1JEG A;  4AG2 C;  2HSP A;  2KYM A;  5FWB A;  2DJQ A;  1K1Z A;  1TUC A;  1UUE A;  1WYX A;  2KT1 A;  4J9E A;  4E6R A;  1HSQ A;  2SEM A;  1SEM A;  2D0N A;  2FPD A;  2LJ1 A;  2J06 A;  3I35 A;  1G2B A;  3EGU A;  1T0J A;  4F14 A;  1AWW A;  2DL8 A;  2J6O A;  1FMK A;  2A36 A;  2DLP A;  2VKN A;  3PE0 A;  4OMQ A;  4RTY A;  1K0S A;  1UHC A;  1VYV A;  2DNU A;  3M0Q A;  2RF0 A;  4RTW A;  1B07 A;  3VS2 A;  1KIK A;  2QDL A;  2YUP A;  2VVK A;  1ABQ A;  5IXB A;  3TSZ A;  3VRY A;  2KRN A;  4IIM A;  4KRT A;  1X27 A;  2KGT A;  2CSI A;  1X6G A;  2ECZ A;  1Y0M A;  1KJW A;  2O2O A;  4JPB W;  2HBW A;  1VA7 A;  1UFF A;  4JJC A;  2HEQ A;  1GRI A;  1QWF A;  3EG1 A;  3H41 A;  3VS5 A;  4K11 A;  4F17 A;  1AEY A;  1BB9 A;  3NGP A;  1VYU A;  5HCK A;  2CSQ A;  2EGA A;  2EBP A;  2LNH B;  1PRL C;  4AFZ C;  4GLM A;  2YUO A;  4AG1 C;  1ZUU A;  2C0I A;  1OPK A;  1PWT A;  1NLP C;  3VS0 A;  2ESW A;  2DL3 A;  1PKT A;  3M0P A;  2JS2 A;  1KSW A;  1I0C A;  4J9C A;  4J9I A;  3VRZ A;  1V1C A;  1TUD A;  1AOJ A;  1PRM C;  5FWC A;  1UJY A;  5FW9 A;  2W0Z A;  1MV3 A;  2JM9 A;  1QCF A;  3VS6 A;  4CC2 A;  2FG0 A;  2JTE A;  1ZSG A;  2K6D A;  1OPL A;  2ROL A;  1JU5 C;  1U5S A;  1E6H A;  1SHG A;  1YCS B;  2YDL A;  1AWO A;  1G83 A;  2GQI A;  3LH5 A;  2EPD A;  2A37 A;  1BK2 A;  2K79 A;  2ENM A;  4AFU C;  1UEC A;  5IXF A;  2RQR A;  4RTV A;  1NM7 A;  3EG0 A;  3TVT A;  3NPF A;  1UDL A;  4Z8A A;  1M30 A;  3UAT A;  2RQW A;  1SPK A;  1RUW A;  4J9B A;  4LE9 A;  5ECA A;  4ESR A;  1WLP B;  2CH4 W;  2FPF A;  4JJB A;  4LNP A;  2BZ8 A;  1NEG A;  4Z89 A;  1UGV A;  1ZX6 A;  1AVZ C;  5IHK A;  2HCK A;  3O5Z A;  2FRW A;  4CC3 A;  3VS3 A;  3VS7 A;  1PHT A;  4JZ4 A;  1J3T A;  2F2V A;  1GFD A;  3UA7 A;  2DL4 A;  3GBQ A;  1AZE A;  2KXD A;  2CUD A;  1BBZ A;  1NEB A;  1GFC A;  1YP5 A;  2MOX A;  1PNJ A;  4ORZ A;  5IHN A;  4RUG A;  1T0H A;  1AWX A;  2LJ3 A;  2D8J A;  4HCK A;  4R0K A;  2RPN A;  2GBQ A;  2V1Q A;  2DBK A;  4CC4 B;  1ZUK A;  1MV0 B;  1XOV A;  4AFQ C;  1ZBJ A;  4HVU A;  2NUZ A;  2CRE A;  2EVR A;  1K4U S;  4M4Z A;  1AZG B;  4DEX A;  1OOT A;  2J05 A;  1WI7 A;  1X6B A;  2DVJ A;  1SHF A;  3PVL A;  2B86 A;  2CT3 A;  1YWO A;  2ROT A;  4J9G A;  1Z9Z A;  4OMO A;  2FO0 A;  2EQI A;  1UHF A;  2RNA A;  4OMN A;  2YUN A;  1GCP A;  1JQQ A;  2ABL A;  2PTK A;  4WCI A;  2RQT A;  1WX6 A;  5I11 A;  2OI3 A;  1GBQ A;  2C0O A;  4OMP A;  2BZX A;  1H3H A;  5I22 A;  2AKK A;  3JV3 A;  1RI9 A;  4ZNX A;  3SHW A;  2AZV A;  3EG2 A;  3I5R A;  2O9S A;  2LP5 A;  1U06 A;  2G6F X;  2L2P A;  2FPE A;  2XMF A;  3H0I A;  2JW4 A;  4X1V A;  2X3W D;  4IIO A;  2GTJ A;  1GCQ C;  2OJ2 A;  2RN8 A;  5GJV B;  2AK5 A;  2EGE A;  5IH2 A;  4HVW A;  2KRS A;  1WDX A;  4JJD A;  2JS0 A;  2CH4 A;  1K76 A;  1WXT A;  2K9G A;  1E7O A;  2DMO A;  2E5K A;  4RTT A;  3ULR B;  2FEI A;  4LUE A;  2DYB A;  2DX1 A;  2F2X A;  2YSQ A;  2D8H A;  1CSK A;  2JMA A;  4QT7 A;  1JXO A;  4HVV A;  2CDT A;  4RTZ A;  2BZY A;  3H0F A;  2O88 A;  4Y92 A;  1FYN A;  2KE9 A;  2KRO A;  2DL5 A;  2O31 A;  1OV3 A;  2EW3 A;  1QKW A;  1M3C A;  2O9V A;  1HJD A;  3REA B;  1CKA A;  2LJ0 A;  2KXC A;  3M0R A;  1WA7 A;  1X2K A;  4J9D A;  3KFV A;  3C0C A;  1QKX A;  1SSH A;  4OML A;  1N5Z A;  1A0N B;  3RNJ A;  1ARK A;  1NG2 A;  1GBR A;  1M27 C;  2F2W A;  5GJW B;  2GNC A;  2EYY A;  1X43 A;  2JM8 A;  1GCQ A;  3M0T A;  1NYG A;  1H92 A;  4RTU A;  1X2Q A;  2AKL A;  2JXB A;  2J7I A;  3UF4 A;  2HDA A;  1IO6 A;  2H8H A;  1SRL A;  1QLY A;  4D8K A;  2KBT A;  3PVQ A;  1JXM A;  5L23 A;  1RLQ C;  3SEM A;  4J9H A;  2CT4 A;  1KFZ A;  2J6F A;  2EGC A;  4OMM A;  1PKS A;  4EIK A;  1AWJ A;  2JT4 A;  3IQL A;  3VS1 A;  1W6X A;  2AZS A;  2KRM A;  3TSW A;  4F16 A;  2LZ6 B;  1UE9 A;  4FSS A;  2D1X A;  1E6G A;  3U23 A;  1MUZ A;  1W1F A;  2ED0 A;  2V1R A;  1U3O A;  3ZL7 C;  4CC7 A;  1WXU A;  2K3B A;  1TG0 A;  3REB B;  2L3P A;  2YT6 A;  2LX7 A;  2M0Y A;  1M3B A;  2ED1 A;  3EHR A;  2IIM A;  1YN8 A;  1QWE A;  3A98 A;  2L3S A;  2MIO A;  1M8M A;  2DRM A;  1I07 A;  2EYZ A;  1CKB A;  2EYW A;  2DE0 X;  1YNZ A;  2A28 A;  1W70 A;  1X69 A;  2C0T A;  2X3X D;  3NHN A;  2PNI A;  2DIL A;  1I1J A;  1UG1 A;  3EHQ A;  3CQT A;  1Y57 A;  2W10 A;  1NYF A;  2KYB A;  2P4R A;  3H0H A;  2FRY A;  2L3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...