1GD2E

Crystal structure of bzip transcription factor pap1 bound to dna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
DQEPSSKRKAQNRAAQRAFRKRKEDHLKALETQVVTLKELHSSTTLENDQLRQKVRQLEEELRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*GP*GP*TP*TP*AP*CP*GP*TP*AP*AP*CP*C)-3')
publication title Structural basis for the diversity of DNA recognition by bZIP transcription factors.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transcription/dna
total genus 25
structure length 65
sequence length 65
chains with identical sequence F, G, H, I, J
ec nomenclature
pdb deposition date 2000-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gd2E00
1G2CB 3HE4B 4C7NB 2VRSA 3IR9A 3B8EB 4HYTB 2BASA 5AVXB 1H8AA 1SLQA 1S9KD 1MUUA 4DZOA 1DH3A 3TYYA 5AVUB 1CZQA 3A7OA 3SWFA 5AVRB 2ZXEB 5AW4B 1OWAA 1J2JB 4JYBA 5AW3B 5AW1B 2Q5UA 2W6AA 3A2AA 3M0DA 2Q3IA 3M9HA 2R32A 3I5CA 1GZLA 3TK1A 4I6MC 4RESB 1T2KC 3A5TA 1S9KE 1HWTC 2XV5A 3MGNA 2C9LY 2R3CA 3P32A 4C46A 1JNMA 2Z5IA 5AVYB 3V5BA 3L36A 3A3YB 5CMZA 3LIEA 2WT7B 5AW7B 4M3LA 2WWWA 5AVWB 2XZRA 3NTNA 2C9NY 2Q7CA 1HBWA 2ZFCA 4B86A 3NFQA 3NMDA 1GD2E 2KP8A 1H89A 5APSA 1KQLA 2JJLA 3T97A 4KHXA 3VYIA 3KQGA 3O8ZA 4AYCA 1OXZA 3HTKA 3L35A 1FOSE 4I2LC 2QM8A 2E43A 2R5DA 3M06A 3P8MC 4GT1A 3VTPC 1HJBA 3M9BA 1H88A 1SP4A 5AVQB 3TNUA 1IO4A 2WT7A 2WPRA 2XU6A 3TNUB 3M91A 2P7JA 3L37A 2YNYA 2E42A 5AW8B 5AW0B 5AVTB 1FOSF 4AQRD 5APWA 2WTYA 1FAVA 3MD0A 2W27A 2Z5HA 5APQA 3VMXA 3NXSA 2P2UA 2QM7A 1GK4A 4GKGA 5AW5B 3UIAA 1A02F 2WPQA 3V4QA 1GTWA 1GK6A 1A02J 3P7KA 1CI6A 2N9BA 5APYA 4LC1A 1CI6B 2YO3A 5APVA 2H7HA 1NAFA 2P67A 4EOTA 3VMYA 1T2KD 3KDPB 5AVZB 3LIDA 5AW2B 1HUCA 1MV8A 1CSBA 5APUA 1MFZA 5AW6B 2R5BA 3VMZA 4AUWA 3V4WA 5AVSB 2IPPA 1GU5A 4XE5B 5APXA 1JUNA 1YYCA 5AVVB 4JYCA 3HE5A 1GU4A 5AW9B 3HE5B 2WPSA 1NWQA 3VN0A 2YO2A 1X8YA 5APTA 3HE4A 3M0AA 4C7NA 3OAKA
chains in the Genus database with same CATH superfamily
3R4YA 1VQPP 2E5TA 4PV1D 2RN0A 2KUBA 1JY2P 3KZIE 1KQGB 2ZVOB 2KOGA 2Q3IA 1GW4A 3M9HA 2JR8A 2IBZE 2Q6QA 2QJYC 4C46A 2L5GB 3LIEA 4Z1MH 2WT7B 2B9BA 3AECC 3SFEC 3RK2C 1NTKE 2PRRA 2B87B 2XKMA 1KZUB 2K3RA 2HFED 1J1EB 1JOCA 2GA1A 3ZDMA 5KLVD 5M1BA 4GT1A 1HJBA 1SVFA 4WVZA 3K5BA 3CXHE 1KTMA 1PGPA 2H88C 2E74B 2JWAA 1NTMD 3BCCJ 3C9IA 2KZJA 3RL0C 1DD4A 5E79H 4CPGA 2I1KA 2AXTH 3PP5A 1FDIA 3L74D 3CC2P 1JCCA 1L0NG 2LR2A 2A06D 3AE7C 1VF5B 3AE5C 3N7NA 3CWBG 4U3FG 4D6TE 1SFCA 3C8VA 4UB6H 2IFNA 3WMM0 3RBXA 5APUA 1SQVE 1IK9A 2YIUC 1NU1G 3CCUP 2HODA 1YITP 3MHVA 1KB9I 4JYCA 1N73C 4HH2A 1JY3O 1KQFB 3CI9A 2YO2A 3PH0A 3H1KD 5BVZA 3RBZA 1NAYA 1G2CB 2KLUA 2VRSA 3TGUJ 4YXWH 4I7ZB 3WUTA 4UB8H 2D2CB 3L75E 3L70E 2AXCA 2K9JA 1Y9BA 1DH3A 1YTZI 4EI2A 2QJPC 3RK3D 4WY4C 2JEEA 3CCSP 4Y28J 1AQ5A 1BE3D 1M1JB 1JNMA 1VQKP 4H0LB 5CHXA 3CLQA 2ZJSE 1NKZB 2Q7CA 1YI2P 4YXDC 1GL2D 1URQB 1QVFO 1LP1B 1HGZA 2Y9ZA 2BCCE 2E76C 1Q2NA 1BGYG 1SP4A 3CCMP 2P7JA 1LWUC 2KLVA 4IFDK 1SQPE 4HJGH 1FZCC 3I55P 1GDTA 3O6QA 1VQ8P 4N78E 2B88A 3BRVB 1JB0J 1PP9E 1CI6B 2IDBA 1NAFA 1GL2A 1PPJE 1JMBA 5KAFH 1LGHB 5AVZB 1AVOA 5AW2B 3WUVA 3R2PA 1IZNB 2R3SA 3L71G 1GU4A 5KAIE 3SFDC 1G1JA 4BRYB 2Z4EA 3EWKA 2M5AB 1H8AA 4K3AA 1KILC 3OW2O 1IFDA 3L72D 4JPZB 5AW3B 3BCCG 5CJ0A 5BU8B 3H1JG 1HWTC 1S3JA 1K9MQ 1NTKJ 1ZMEC 5AVYB 2O01N 3GG2A 1RQVA 5B5EE 3AEFC 1ZN5A 2KNCB 1OVUA 1LTIC 4PD4I 2P58A 3AEAC 1BCCE 1QGKB 2E74D 1SQXJ 4AYCA 3L35A 1P84E 2M3EA 3E7KA 3QWOC 2R5DA 3G4SP 2V7QH 5KLVK 3FWLA 4QMAA 2WT7A 1VF5D 3TGUG 1Q81Q 2YIUB 1L4AC 2O01J 3D70A 2UWJE 5CBOA 1S4XA 1SQQD 1NTZD 2E75C 1AV1A 1L0NE 2CPSA 1GK6A 3U59A 4LC1A 1EDLA 3FXDA 3MIWA 3KDPB 5GTHE 2IBZI 1OZHA 3H1LJ 5CCGD 1CSBA 1JEKA 2OGUA 1MFZA 1OIPA 3CWBD 4U3FD 1NU1E 4AUWA 1GMJA 3P8CE 2KS1A 3HE5B 4K35A 2WPSA 1KFNA 3ITKA 1N7LA 3HE4B 2QE7H 2OYHA 1FS0E 1KQSO 3EFGA 3CXHI 2ZXEB 1J2JB 4H0LD 1NO4A 1PIXA 2FXMA 2O3JA 3HRNA 2QEXP 5B66H 1NH4A 1DEEG 5CCGA 3GF7A 1URQD 1GW3A 1S9KE 1G2CA 3AE8C 2KSJA 4W7YA 1K04A 2W90A 2C0XA 3S1KA 3W67A 1KYOH 1N7SA 1E5WA 3HTKA 2XNXA 1RF1C 3L73D 5KKZB 2IYPA 4DT0A 3AEGC 2Q9IA 1X9VA 2DW3A 2YNYA 1HVVA 1UIIA 3L4FA 2WSCH 4GOEA 1FOSF 1SQBD 5DJUB 5KLVG 1LP1A 1S5LE 3C1LA 1NTMG 3AEEC 2YO3A 1OVVA 2P67A 5KLIB 2NZ2A 3JCUE 1SFCB 1MV8A 2HPCA 3L74G 3MP7B 1YYCA 3L71E 2HODB 5TISE 3PLNA 5AW9B 1SQXG 4C7NA 2WSFH 1WMKA 1FZFA 1E79H 2W6BA 1PZQA 1MUUA 2K9JB 3A7OA 1NVOA 3CCQP 3H1KG 2OTKE 5AW1B 3H6PA 3H1JE 2ZT9C 2R32A 3HD7C 1KORA 4BRYA 3BCCD 2XV5A 2R3CA 4IL6X 2M5AA 1ZXGA 1KYOD 1RE3C 3NMDA 1MKMA 2PP6A 1VDFA 4PD4H 2ZXXA 1EZVE 2GM4A 1Q7YQ 5H2FE 3VTPC 3H1IJ 5C39A 2Q3EA 1DD3A 1QVGO 4Y99C 2KNCA 1OW7A 3RK3B 3O6QB 3NXSA 4NPEA 3TGUD 4IL6E 1N7SC 2QM7A 1YBKA 5GTIE 1SQQK 1NTZK 3RL0g 1A02J 4WY4D 2FYUJ 1S2EA 1L0LJ 4L73A 1GL2B 2JKVA 2M3BA 1FDMA 1S72P 1JMMA 4OGQB 1N73A 2JO1A 1YQ4C 4PJ0E 3CX5E 2K37A 2YMYA 4JQ0D 2E76D 1IFNA 1P84I 1L2PA 1SLQA 1QL2A 1FZGA 3TYYA 5AVRB 3CXHH 4WY4A 2W6AA 1BDCA 1BDDA 3M0DC 3VP9A 2FYNC 4U7JA 4M3LA 3L72G 3B5NC 2AEFA 2O01H 1SS1A 4PD4D 2KP8A 2NRGA 5DJTB 3KXDA 3CMEP 2KZIA 2R44A 4C7RA 1LWUA 2RH0A 1FZCA 1WRGA 1T6AA 3MZWB 5AW0B 3A0BE 4H44B 3N4XA 5KLVE 3KPEA 2W27A 1KILD 2Z5HA 1SFCD 2W6JH 3V4QA 1T8ZA 5APYA 1T3UA 3I56P 1W2EA 2IBZD 4OH8B 4EYYQ 3U1AA 4BXLA 1HF9A 4ZKPA 2IZ1A 1SQQG 1NTZG 3L74E 5AW6B 3BATA 2A06E 2ZT9B 3H32A 1JUNA 1NTKD 2GUVA 2QSIA 3WU2E 2KS1B 1X8YA 5APTA 4WBAA 3HUSC 2OYHB 1SQXD 1KILA 4KJMA 4EDFA 5AW4B 3H1KE 2WSCJ 2QVAA 2Y9YA 2E75D 2OYOA 4Y99B 1LTJC 5CMZA 5AW7B 1RE4C 1L0LG 3BVHA 1BE3E 3JSVC 1N7SB 1NJIQ 2G3AA 1MZ9A 3HTKB 3CD6P 1TU3F 3H1HJ 3H1LD 3ABVC 3P8MC 3RGUA 3M9BA 1XTGB 2OARA 3AEBC 3SWKA 3TNUA 2K88A 2KB7P 2WSFJ 5KAIH 2KSEA 1L4AA 3CCRP 3Q1MA 3L73G 3GF3A 1LTBC 1DEBA 5APQA 1GK4A 1A02F 3KHUA 4OGQD 3OJAB 2WQYC 5E79E 1M1KQ 2AXTE 1SQBG 2IFMA 3V6IA 2HPCB 2R5BA 1U7MA 5B5EH 1AFOA 3V2RA 4UB6E 4GOFA 2ZYGA 3CCJP 1EXJA 2QA4P 4JBZA 4C7NB 1AA0A 1EZVI 1Q90D 1ZP0C 2RKLA 3CCVP 4HB1A 5AVXB 1P84H 3SWFA 2GUSA 1U7JA 4RKUJ 5L8RJ 1NGMB 3GW6A 4UB8E 3EFFK 1OW8A 3AE1C 4RESB 2QJYB 4W80A 3A5TA 4PV1C 3MGNA 2C9LY 2YXRB 2YMKA 3RK2B 1JY3P 1FDOA 3NTNA 4ZKUA 2I1JA 1G1IA 1RF1A 1USEA 1YHQP 4H44D 5K5GB 1JM0A 4L76A 1FZEA 4XFJA 2E42A 1DX7A 1CW5A 3RL0B 3D6ZA 4ASWA 4AQRD 1LJ2A 1VQ7P 1X79B 1RQUA 2M8RA 2LXBA 1RF0C 4H13C 2ZT9D 1R5SA 2FFDC 2SPZA 1FZAA 1NTMK 1SQQE 1NTZE 3VMZA 2YKOA 1N73B 3D71A 1UIXA 4OVNF 1YJWP 4D6TJ 1IFJA 3Q3DA 1LTJB 1M90Q 1P84D 3CWBE 3B4SA 1SQVJ 4U3FE 1SQXK 1ZLLA 3GHGC 4RO0A 2QJPB 3V2PA 2Y0CA 1Q86Q 1OMIA 3H1ID 1OVRA 3A2AA 2N1TA 4WY4B 1EDIA 3HD7A 1KB9H 1J1DC 2BEQD 4LGDE 3L75J 3L70J 1N7SD 3V5BA 1S5LH 1RE3A 1HBWA 3NFQA 1VQ4P 3D6YA 3T97A 2FYUD 1L0LD 2E76B 3M06A 3V2NA 1LWUB 2XU6A 2B89A 3M91A 5TISH 1FZCB 1LT9C 3L73E 2BCCJ 1LTTC 1OFCX 3USSA 1PFIA 1FE6A 2ITAA 1M7LA 4ASVA 2H7HA 1SQPJ 1BGYE 2QJKC 4EOTA 1X22A 3IF4A 1HUCA 3V4WA 1GU5A 1PP9J 5APXA 3H32B 3PRJA 5CCHC 2OYIC 2IBZG 1NOHA 4YPCA 3SWYA 1J1EC 1ZV8A 1KN7A 2BASA 1Z56A 3IN6A 2ZYAA 1KILB 3B71A 1LTAC 2H89C 1NTKG 3Q2YA 4TLFA 3G3ZA 3Q5SA 3M0DA 2Y0DA 3RK2D 2HLOA 1KB9D 1GZLA 3B5NA 1KC8Q 3A0HH 3S4RA 1VQ6P 1IK7A 2JJLA 4N3YB 3BCCE 2A45I 1N86A 2OQQA 3VMAA 1LNQA 2I8DA 3RL0D 4H13B 4R4MA 2N1TC 1KYOE 2YKQA 2LKMA 4D6TG 3TNUB 4PJ0H 1BCCJ 5AW8B 1L4AB 3H1LG 2WTYA 2E75B 3VMXA 3P7KA 2K9YA 2N9BA 1JY2O 1VF5C 3PJSK 1VQOP 2FY8A 3LIDA 3TGUE 2WSEJ 1L0NJ 2IPPA 4ZMDA 1J1DB 2OTJP 3M0AA 1JTHA 1M56D 3HUSA 3KZIH 2J59M 3B8EB 3QH9A 3V2QA 4I7ZC 1NU1J 2D2CC 5TJHA 3H1HD 1H0TA 1WT6A 3Q5PA 2P1JA 5KJ7C 1IJDB 1LTJA 2BEZF 1RE4A 4XA4A 1EDJA 1HGVA 1VQLP 1M1JC 3U1CA 3A3YB 1ZRTD 4H0LC 1PL5A 2WWWA 1SQPG 1EC5A 2ZFCA 5APSA 1KD1Q 1URQC 4IFFA 1RF1B 3KQGA 1OXZA 2FYUK 1FOSE 1IFIA 1L0LK 1IFPA 1ZW0A 2QJKB 1XTCC 1D7MA 2FBWC 3FGAD 4PD4E 1IO4A 1FJPA 5AVTB 1VL2A 2M0BA 1YIJP 4W7ZA 2NPSC 1M8OB 2WITA 4GDOA 4IOIH 3VMYA 2YXQB 1KILE 1VQ9P 1AVYA 2H43A 1Q82Q 1SQBK 1KFMA 2J5UA 1VQMP 1NTME 4DCKA 2P10A 3IR9A 2LXCB 4EIJA 2Q1KA 1YTZT 2E5YA 3L71J 1BCCG 4JYBA 2K1AA 3TSIA 2WPVB 2Q5UA 2N1TB 1NYHA 3HD7B 1SQXE 1T2KC 3CMAP 3AE6C 3WUUA 4RJTA 4H13D 3H1IG 3H1JJ 3CXHD 2FYZA 2ZAEB 4KHXA 3T97B 2XNDH 3AE3C 2PGDA 2A45H 1L4AD 1W5CE 3S9OA 5AVQB 1ZR4A 2AEMA 3L37A 1X0TA 2FYUG 1MFTA 1DIPA 3RK3E 3GLMA 2MJZA 3H1LE 4D6TD 5APWA 3MD0A 1R8EA 1LTGC 4GIFA 1SQVD 1RF0A 3PTZA 3LW5H 2RMZA 3E1IA 3G71P 2QRXA 1HTLC 5EFWB 2FFDA 3BRTB 2QG4A 1M57D 3L75D 5AVSB 3L70D 1NWQA 4MN4C 3AE4C 1PGJA 3F89A 1PGOA 1FBMA 3GHGA 4JF7A 3CC7P 1KYOI 1EQ7A 4O9BA 3KYQA 2FYNB 2BCCD 3B5NB 5AVWB 2IX7C 4DOJA 3E1RA 1VQNP 2NPSB 3TF5A 1SQPD 1EXIA 4I2LC 4TT3H 5KKZC 1AQTA 3CCEP 3G9RA 1YJNP 3G6EP 5CCHD 3PHLA 4N78D 1LT9A 2WPRA 1LT1A 3L72E 1PP9D 2WSEH 2QIWA 1PPJD 5GTHH 2P2UA 3Q5RA 4GKGA 4KT0J 2POHA 3CX5I 5KLIC 5KLVJ 1SFCC 1YJ9P 5BU5A 2W8ZA 3CL3D 1NTMJ 5CCHA 3CCLP 3VOPA 2OYIA 2CK3H 1K8AQ 1ZOYC 3VN0A 5KTBA 4WWIA 1FJKA 3OAKA 4YTPC 3M9QA 1JTHB 3HUSB 3FXEA 2N1TD 1S1CX 3L74J 3HD7D 4DZOA 1JY2N 5AVUB 1CZQA 4L75A 1NKNA 1QEXA 1H0TB 1EZVG 5KAFE 1Y47A 1VQ5P 3I5CA 3CPWO 2FXPA 3TK1A 1BCCD 1NTKK 4I6MC 1JCDA 3P32A 2C0WA 2Z5IA 3H1HG 3H1KJ 3H1IE 1K05A 3AE2C 2WSSH 4NPFX 4B86A 2HG5D 3SSUA 1USDA 2B87A 2KK7A 2WZ7A 2PFXA 1H88A 3F5HA 1L0ND 1QLED 1BE3J 2FYUE 3AEDC 1L0LE 3RK3C 3IFMA 2D2CD 1FAVA 4GODA 3JCUH 1LTSC 1T3JA 2WPQA 1SQVK 1NU1D 1U57A 1N8RQ 3P8CD 4R4LA 5KJ7D 3II6A 4L74A 1GL2C 1OW6A 4OGQC 2O1JA 1W2BO 3MUDA 1S5LX 1RY3A 3W68A 1YQ3C 1SQBE 1S9KD 4BWNA 1OWAA 2L91A 4N6JA 3VP8A 3B5ND 5KJ7A 4PV1B 2NPSD 1M1JA 1RHZB 3LW5J 3L36A 2WMMA 1HH0A 2C9NY 2KI7B 2WVRA 5H2FH 1BGYD 1GD2E 1KB9E 1URQA 3AE9C 1KQLA 2Y0EA 2HR3A 4OWFA 2V4HA 1SQPK 2QM8A 1PV3A 3L72J 2OTLP 4WB4A 2XDJA 4A7PA 4IL6H 5GTIH 3GMAA 5B66E 4H44C 2A06G 2NPSA 3TDKA 2IYOA 3UIAA 1GTWA 2FKWB 2JWDA 1CI6A 2YKPA 1IC2A 1EDKA 1FC2C 5APVA 3L71D 1T2KD 2FFDB 2N9YB 3EQ2A 2JP3A 1N2DC 3CX5H 4I1LA 2E74C 4NPDA 1PGQA 2J58A 1ZR2A 1SQVG 3JC22 4LLHA 5AVVB 2FXOA 1QX8A 1BSNA 3H1JD 1R5LA 1JY3N 4HYTB 1SQQJ 1NTZJ 3GHGB 3L75G 3L70G 4DJGA 1OX3A 2OYHC 2IZ0A 1BE3G 3CC4P 3FX0A 4ZNCA 3CWBJ 2ZVNB 4U3FJ 1JO5A 3FWNA 2CPBA 5CCGC 1EZVD 3H1HE 2KIKA 3MTUE 3MUDC 3H25A 2JDIH 2XZRA 2W83C 2ZYDA 1Y8AA 1H89A 2O1KA 2AEJA 5CBNA 3VYIA 3O8ZA 3BASA 2BCCG 1ZRTE 2E43A 3A0HE 3A0BH 2HYNA 1VPCA 4IFMA 4HKZH 1NHLA 3IAOA 1FU1A 1LT9B 2G8YA 1L0NK 2A45G 2KYVA 1HJ0A 2MKVA 1QL1A 2H8PD 5AW5B 1BSHA 1AJYA 1FZBA 2PAJA 1K73Q 1NU1K 1PP9G 2KXPB 1PPJG 3CX5D 3L73J 2V7QJ 1KMIZ 3WU2H 5CJ4A 1IFMA 4XE5B 1RH5B 3HE5A 1KV4A 3OA7A 2OYIB 1BGYJ 1SQBJ 3HE4A
chains in the Genus database with same CATH topology
1IFJA 2WSFH 1LTJB 1FZFA 1FBMA 2W6BA 3GHGA 4JF7A 1SQXK 1MUUA 1ZLLA 3GHGC 3A7OA 3V2PA 1JY2P 1EQ7A 5AW1B 3A2AA 2N1TA 3H6PA 4WY4B 2KOGA 3HD7A 2Q3IA 1GW4A 3M9HA 2R32A 3HD7C 1J1DC 2XV5A 3KYQA 4LGDE 4O9BA 1N7SD 2R3CA 4C46A 2L5GB 3V5BA 3LIEA 2WT7B 3B5NB 1RE3A 5AVWB 1HBWA 2IX7C 3RK2C 4DOJA 1RE3C 3NFQA 3NMDA 2PP6A 1VDFA 3T97A 2NPSB 2XKMA 1KZUB 2HFED 1J1EB 2GM4A 4I2LC 1JOCA 3M06A 3VTPC 4GT1A 1HJBA 3V2NA 5CCHD 1SVFA 4N78D 1LT9A 1LWUB 2WPRA 2XU6A 3M91A 4Y99C 1FZCB 1LT9C 2WSEH 3C9IA 3RK3B 3RL0C 1LTTC 1PFIA 2I1KA 3NXSA 3PP5A 2P2UA 1N7SC 2QM7A 4GKGA 1JCCA 1NTZK 1SQQK 1A02J 1M7LA 4WY4D 2H7HA 2POHA 3N7NA 4EOTA 1GL2B 1SFCA 2M3BA 2IFNA 1FDMA 1HUCA 3WMM0 1SFCC 5APUA 1JMMA 1IK9A 5BU5A 3CL3D 3V4WA 1N73A 1GU5A 5CCHA 3VOPA 2HODA 5APXA 3H32B 4JYCA 2OYIA 1N73C 4HH2A 1JY3O 5CCHC 3CI9A 2YO2A 3VN0A 2YMYA 5KTBA 2OYIC 1FJKA 3OAKA 5BVZA 1G2CB 1NOHA 3SWYA 1J1EC 3M9QA 2VRSA 1JTHB 1ZV8A 3HUSB 1IFNA 2N1TD 2BASA 1Z56A 3HD7D 1SLQA 1KILB 4DZOA 1JY2N 1LTAC 1YTZI 1QL2A 1DH3A 1FZGA 3TYYA 5AVUB 1CZQA 5AVRB 3G3ZA 4WY4A 1NKNA 3M0DA 2W6AA 3RK2D 2HLOA 3RK3D 4WY4C 2JEEA 3I5CA 3M0DC 3VP9A 1GZLA 3TK1A 1NTKK 4I6MC 1AQ5A 1JCDA 1M1JB 3P32A 2C0WA 1JNMA 2Z5IA 5CHXA 3B5NA 3CLQA 4M3LA 1NKZB 2Q7CA 3B5NC 2O01H 4B86A 2KP8A 2HG5D 1GL2D 1URQB 2JJLA 4N3YB 2A45I 1N86A 2WZ7A 1HGZA 3RL0D 2N1TC 4C7RA 2YKQA 1LWUA 1H88A 1SP4A 2LKMA 3TNUB 2P7JA 1FZCA 1LWUC 1WRGA 2KLVA 4IFDK 5AW8B 1FZCC 5AW0B 1L4AB 1GDTA 3N4XA 3RK3C 3IFMA 2WTYA 3KPEA 1FAVA 2W27A 1KILD 2Z5HA 1SFCD 3VMXA 4N78E 1LTSC 1T3JA 2WPQA 3V4QA 1SQVK 3BRVB 3P7KA 1T8ZA 2N9BA 5APYA 1CI6B 1JY2O 1NAFA 1T3UA 1GL2A 3P8CD 5KJ7D 1LGHB 5AVZB 3II6A 1W2EA 1GL2C 3LIDA 5AW2B 4OH8B 3U1AA 3R2PA 4ZKPA 5AW6B 3BATA 2IPPA 3H32A 1JUNA 2O1JA 2GUVA 1GU4A 1J1DB 1X8YA 5APTA 3M0AA 1G1JA 1JTHA 3MUDA 3HUSA 4WBAA 2Z4EA 2J59M 1RY3A 3B8EB 3V2QA 3HUSC 2OYHB 1KILA 1H8AA 1S9KD 1KILC 5AW4B 1IFDA 1OWAA 5AW3B 4N6JA 3VP8A 3B5ND 1WT6A 5CJ0A 5BU8B 5KJ7A 2P1JA 5KJ7C 1HWTC 1IJDB 2NPSD 1M1JA 1LTJA 1RE4A 4XA4A 1HGVA 5AVYB 1M1JC 4Y99B 1LTJC 3A3YB 3L36A 5CMZA 3U1CA 5AW7B 1RE4C 1HH0A 2WWWA 2C9NY 1ZN5A 2ZFCA 1GD2E 1LTIC 1URQA 5APSA 1KQLA 3BVHA 1URQC 4IFFA 1N7SB 1RF1B 3KQGA 4AYCA 1OXZA 3L35A 1SQPK 2FYUK 1FOSE 1MZ9A 3HTKB 2QM8A 1IFIA 1L0LK 2R5DA 3P8MC 1XTCC 5KLVK 3M9BA 4WB4A 1XTGB 2OARA 2XDJA 3TNUA 1IO4A 2KB7P 2WT7A 1FJPA 1L4AA 5AVTB 1L4AC 2NPSA 1LTBC 4W7ZA 1DEBA 5APQA 2NPSC 1GK4A 3UIAA 1A02F 2CPSA 1GTWA 1GK6A 2FKWB 2WITA 3U59A 1CI6A 2YKPA 4LC1A 1IC2A 3OJAB 5APVA 3MIWA 3VMYA 1T2KD 2FFDB 3KDPB 2IFMA 3EQ2A 5CCGD 1N2DC 4I1LA 1CSBA 2J58A 1ZR2A 1MFZA 2H43A 2HPCB 2R5BA 4LLHA 4AUWA 1SQBK 1KFMA 5AVVB 3V2RA 1AFOA 3P8CE 3HE5B 2WPSA 1KFNA 1N7LA 3HE4B 4C7NB 3IR9A 1JY3N 4HYTB 2OYHA 4EIJA 5AVXB 3GHGB 2OYHC 1YTZT 3EFGA 3SWFA 2GUSA 2ZXEB 1J2JB 4JYBA 1NO4A 3TSIA 2Q5UA 2N1TB 3HD7B 2FXMA 3HRNA 1NH4A 4RESB 5CCGA 4W80A 1URQD 1T2KC 1GW3A 3A5TA 1S9KE 1G2CA 1JO5A 3MGNA 2CPBA 5CCGC 2C9LY 2KSJA 4W7YA 2C0XA 3MTUE 3RK2B 2XZRA 1JY3P 3NTNA 4ZKUA 1H89A 2O1KA 2I1JA 1G1IA 1N7SA 1E5WA 1RF1A 2FYZA 4KHXA 3VYIA 3O8ZA 3HTKA 2XNXA 3BASA 2A45H 1RF1C 1L4AD 2E43A 2HYNA 1VPCA 4IFMA 2Q9IA 1NHLA 5AVQB 1X9VA 1FZEA 1ZR4A 1FU1A 1LT9B 3L37A 1L0NK 2A45G 2KYVA 2YNYA 1HVVA 2E42A 1DX7A 1CW5A 3RL0B 3L4FA 2WSCH 1FOSF 2MJZA 1QL1A 4AQRD 5APWA 2H8PD 3MD0A 1LTGC 1X79B 4GIFA 1RF0A 5AW5B 3LW5H 2M8RA 1FZBA 3E1IA 2PAJA 1RF0C 1NU1K 2YO3A 1HTLC 2P67A 2FFDA 2FFDC 1SFCB 1MV8A 1FZAA 1NTMK 5CJ4A 3BRTB 2HPCA 3VMZA 1IFMA 2YKOA 5AVSB 1N73B 4XE5B 1YYCA 3HE5A 2HODB 5AW9B 3OA7A 2OYIB 1NWQA 3HE4A 4C7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2C B;  3HE4 B;  4C7N B;  2VRS A;  3IR9 A;  3B8E B;  4HYT B;  2BAS A;  5AVX B;  1H8A A;  1SLQ A;  1S9K D;  1MUU A;  4DZO A;  1DH3 A;  3TYY A;  5AVU B;  1CZQ A;  3A7O A;  3SWF A;  5AVR B;  2ZXE B;  5AW4 B;  1OWA A;  1J2J B;  4JYB A;  5AW3 B;  5AW1 B;  2Q5U A;  2W6A A;  3A2A A;  3M0D A;  2Q3I A;  3M9H A;  2R32 A;  3I5C A;  1GZL A;  3TK1 A;  4I6M C;  4RES B;  1T2K C;  3A5T A;  1S9K E;  1HWT C;  2XV5 A;  3MGN A;  2C9L Y;  2R3C A;  3P32 A;  4C46 A;  1JNM A;  2Z5I A;  5AVY B;  3V5B A;  3L36 A;  3A3Y B;  5CMZ A;  3LIE A;  2WT7 B;  5AW7 B;  4M3L A;  2WWW A;  5AVW B;  2XZR A;  3NTN A;  2C9N Y;  2Q7C A;  1HBW A;  2ZFC A;  4B86 A;  3NFQ A;  3NMD A;  1GD2 E;  2KP8 A;  1H89 A;  5APS A;  1KQL A;  2JJL A;  3T97 A;  4KHX A;  3VYI A;  3KQG A;  3O8Z A;  4AYC A;  1OXZ A;  3HTK A;  3L35 A;  1FOS E;  4I2L C;  2QM8 A;  2E43 A;  2R5D A;  3M06 A;  3P8M C;  4GT1 A;  3VTP C;  1HJB A;  3M9B A;  1H88 A;  1SP4 A;  5AVQ B;  3TNU A;  1IO4 A;  2WT7 A;  2WPR A;  2XU6 A;  3TNU B;  3M91 A;  2P7J A;  3L37 A;  2YNY A;  2E42 A;  5AW8 B;  5AW0 B;  5AVT B;  1FOS F;  4AQR D;  5APW A;  2WTY A;  1FAV A;  3MD0 A;  2W27 A;  2Z5H A;  5APQ A;  3VMX A;  3NXS A;  2P2U A;  2QM7 A;  1GK4 A;  4GKG A;  5AW5 B;  3UIA A;  1A02 F;  2WPQ A;  3V4Q A;  1GTW A;  1GK6 A;  1A02 J;  3P7K A;  1CI6 A;  2N9B A;  5APY A;  4LC1 A;  1CI6 B;  2YO3 A;  5APV A;  2H7H A;  1NAF A;  2P67 A;  4EOT A;  3VMY A;  1T2K D;  3KDP B;  5AVZ B;  3LID A;  5AW2 B;  1HUC A;  1MV8 A;  1CSB A;  5APU A;  1MFZ A;  5AW6 B;  2R5B A;  3VMZ A;  4AUW A;  3V4W A;  5AVS B;  2IPP A;  1GU5 A;  4XE5 B;  5APX A;  1JUN A;  1YYC A;  5AVV B;  4JYC A;  3HE5 A;  1GU4 A;  5AW9 B;  3HE5 B;  2WPS A;  1NWQ A;  3VN0 A;  2YO2 A;  1X8Y A;  5APT A;  3HE4 A;  3M0A A;  4C7N A;  3OAK A; 
#chains in the Genus database with same CATH topology
 3R4Y A;  1VQP P;  2E5T A;  4PV1 D;  2RN0 A;  2KUB A;  1JY2 P;  3KZI E;  1KQG B;  2ZVO B;  2KOG A;  2Q3I A;  1GW4 A;  3M9H A;  2JR8 A;  2IBZ E;  2Q6Q A;  2QJY C;  4C46 A;  2L5G B;  3LIE A;  4Z1M H;  2WT7 B;  2B9B A;  3AEC C;  3SFE C;  3RK2 C;  1NTK E;  2PRR A;  2B87 B;  2XKM A;  1KZU B;  2K3R A;  2HFE D;  1J1E B;  1JOC A;  2GA1 A;  3ZDM A;  5KLV D;  5M1B A;  4GT1 A;  1HJB A;  1SVF A;  4WVZ A;  3K5B A;  3CXH E;  1KTM A;  1PGP A;  2H88 C;  2E74 B;  2JWA A;  1NTM D;  3BCC J;  3C9I A;  2KZJ A;  3RL0 C;  1DD4 A;  5E79 H;  4CPG A;  2I1K A;  2AXT H;  3PP5 A;  1FDI A;  3L74 D;  3CC2 P;  1JCC A;  1L0N G;  2LR2 A;  2A06 D;  3AE7 C;  1VF5 B;  3AE5 C;  3N7N A;  3CWB G;  4U3F G;  4D6T E;  1SFC A;  3C8V A;  4UB6 H;  2IFN A;  3WMM 0;  3RBX A;  5APU A;  1SQV E;  1IK9 A;  2YIU C;  1NU1 G;  3CCU P;  2HOD A;  1YIT P;  3MHV A;  1KB9 I;  4JYC A;  1N73 C;  4HH2 A;  1JY3 O;  1KQF B;  3CI9 A;  2YO2 A;  3PH0 A;  3H1K D;  5BVZ A;  3RBZ A;  1NAY A;  1G2C B;  2KLU A;  2VRS A;  3TGU J;  4YXW H;  4I7Z B;  3WUT A;  4UB8 H;  2D2C B;  3L75 E;  3L70 E;  2AXC A;  2K9J A;  1Y9B A;  1DH3 A;  1YTZ I;  4EI2 A;  2QJP C;  3RK3 D;  4WY4 C;  2JEE A;  3CCS P;  4Y28 J;  1AQ5 A;  1BE3 D;  1M1J B;  1JNM A;  1VQK P;  4H0L B;  5CHX A;  3CLQ A;  2ZJS E;  1NKZ B;  2Q7C A;  1YI2 P;  4YXD C;  1GL2 D;  1URQ B;  1QVF O;  1LP1 B;  1HGZ A;  2Y9Z A;  2BCC E;  2E76 C;  1Q2N A;  1BGY G;  1SP4 A;  3CCM P;  2P7J A;  1LWU C;  2KLV A;  4IFD K;  1SQP E;  4HJG H;  1FZC C;  3I55 P;  1GDT A;  3O6Q A;  1VQ8 P;  4N78 E;  2B88 A;  3BRV B;  1JB0 J;  1PP9 E;  1CI6 B;  2IDB A;  1NAF A;  1GL2 A;  1PPJ E;  1JMB A;  5KAF H;  1LGH B;  5AVZ B;  1AVO A;  5AW2 B;  3WUV A;  3R2P A;  1IZN B;  2R3S A;  3L71 G;  1GU4 A;  5KAI E;  3SFD C;  1G1J A;  4BRY B;  2Z4E A;  3EWK A;  2M5A B;  1H8A A;  4K3A A;  1KIL C;  3OW2 O;  1IFD A;  3L72 D;  4JPZ B;  5AW3 B;  3BCC G;  5CJ0 A;  5BU8 B;  3H1J G;  1HWT C;  1S3J A;  1K9M Q;  1NTK J;  1ZME C;  5AVY B;  2O01 N;  3GG2 A;  1RQV A;  5B5E E;  3AEF C;  1ZN5 A;  2KNC B;  1OVU A;  1LTI C;  4PD4 I;  2P58 A;  3AEA C;  1BCC E;  1QGK B;  2E74 D;  1SQX J;  4AYC A;  3L35 A;  1P84 E;  2M3E A;  3E7K A;  3QWO C;  2R5D A;  3G4S P;  2V7Q H;  5KLV K;  3FWL A;  4QMA A;  2WT7 A;  1VF5 D;  3TGU G;  1Q81 Q;  2YIU B;  1L4A C;  2O01 J;  3D70 A;  2UWJ E;  5CBO A;  1S4X A;  1SQQ D;  1NTZ D;  2E75 C;  1AV1 A;  1L0N E;  2CPS A;  1GK6 A;  3U59 A;  4LC1 A;  1EDL A;  3FXD A;  3MIW A;  3KDP B;  5GTH E;  2IBZ I;  1OZH A;  3H1L J;  5CCG D;  1CSB A;  1JEK A;  2OGU A;  1MFZ A;  1OIP A;  3CWB D;  4U3F D;  1NU1 E;  4AUW A;  1GMJ A;  3P8C E;  2KS1 A;  3HE5 B;  4K35 A;  2WPS A;  1KFN A;  3ITK A;  1N7L A;  3HE4 B;  2QE7 H;  2OYH A;  1FS0 E;  1KQS O;  3EFG A;  3CXH I;  2ZXE B;  1J2J B;  4H0L D;  1NO4 A;  1PIX A;  2FXM A;  2O3J A;  3HRN A;  2QEX P;  5B66 H;  1NH4 A;  1DEE G;  5CCG A;  3GF7 A;  1URQ D;  1GW3 A;  1S9K E;  1G2C A;  3AE8 C;  2KSJ A;  4W7Y A;  1K04 A;  2W90 A;  2C0X A;  3S1K A;  3W67 A;  1KYO H;  1N7S A;  1E5W A;  3HTK A;  2XNX A;  1RF1 C;  3L73 D;  5KKZ B;  2IYP A;  4DT0 A;  3AEG C;  2Q9I A;  1X9V A;  2DW3 A;  2YNY A;  1HVV A;  1UII A;  3L4F A;  2WSC H;  4GOE A;  1FOS F;  1SQB D;  5DJU B;  5KLV G;  1LP1 A;  1S5L E;  3C1L A;  1NTM G;  3AEE C;  2YO3 A;  1OVV A;  2P67 A;  5KLI B;  2NZ2 A;  3JCU E;  1SFC B;  1MV8 A;  2HPC A;  3L74 G;  3MP7 B;  1YYC A;  3L71 E;  2HOD B;  5TIS E;  3PLN A;  5AW9 B;  1SQX G;  4C7N A;  2WSF H;  1WMK A;  1FZF A;  1E79 H;  2W6B A;  1PZQ A;  1MUU A;  2K9J B;  3A7O A;  1NVO A;  3CCQ P;  3H1K G;  2OTK E;  5AW1 B;  3H6P A;  3H1J E;  2ZT9 C;  2R32 A;  3HD7 C;  1KOR A;  4BRY A;  3BCC D;  2XV5 A;  2R3C A;  4IL6 X;  2M5A A;  1ZXG A;  1KYO D;  1RE3 C;  3NMD A;  1MKM A;  2PP6 A;  1VDF A;  4PD4 H;  2ZXX A;  1EZV E;  2GM4 A;  1Q7Y Q;  5H2F E;  3VTP C;  3H1I J;  5C39 A;  2Q3E A;  1DD3 A;  1QVG O;  4Y99 C;  2KNC A;  1OW7 A;  3RK3 B;  3O6Q B;  3NXS A;  4NPE A;  3TGU D;  4IL6 E;  1N7S C;  2QM7 A;  1YBK A;  5GTI E;  1SQQ K;  1NTZ K;  3RL0 g;  1A02 J;  4WY4 D;  2FYU J;  1S2E A;  1L0L J;  4L73 A;  1GL2 B;  2JKV A;  2M3B A;  1FDM A;  1S72 P;  1JMM A;  4OGQ B;  1N73 A;  2JO1 A;  1YQ4 C;  4PJ0 E;  3CX5 E;  2K37 A;  2YMY A;  4JQ0 D;  2E76 D;  1IFN A;  1P84 I;  1L2P A;  1SLQ A;  1QL2 A;  1FZG A;  3TYY A;  5AVR B;  3CXH H;  4WY4 A;  2W6A A;  1BDC A;  1BDD A;  3M0D C;  3VP9 A;  2FYN C;  4U7J A;  4M3L A;  3L72 G;  3B5N C;  2AEF A;  2O01 H;  1SS1 A;  4PD4 D;  2KP8 A;  2NRG A;  5DJT B;  3KXD A;  3CME P;  2KZI A;  2R44 A;  4C7R A;  1LWU A;  2RH0 A;  1FZC A;  1WRG A;  1T6A A;  3MZW B;  5AW0 B;  3A0B E;  4H44 B;  3N4X A;  5KLV E;  3KPE A;  2W27 A;  1KIL D;  2Z5H A;  1SFC D;  2W6J H;  3V4Q A;  1T8Z A;  5APY A;  1T3U A;  3I56 P;  1W2E A;  2IBZ D;  4OH8 B;  4EYY Q;  3U1A A;  4BXL A;  1HF9 A;  4ZKP A;  2IZ1 A;  1SQQ G;  1NTZ G;  3L74 E;  5AW6 B;  3BAT A;  2A06 E;  2ZT9 B;  3H32 A;  1JUN A;  1NTK D;  2GUV A;  2QSI A;  3WU2 E;  2KS1 B;  1X8Y A;  5APT A;  4WBA A;  3HUS C;  2OYH B;  1SQX D;  1KIL A;  4KJM A;  4EDF A;  5AW4 B;  3H1K E;  2WSC J;  2QVA A;  2Y9Y A;  2E75 D;  2OYO A;  4Y99 B;  1LTJ C;  5CMZ A;  5AW7 B;  1RE4 C;  1L0L G;  3BVH A;  1BE3 E;  3JSV C;  1N7S B;  1NJI Q;  2G3A A;  1MZ9 A;  3HTK B;  3CD6 P;  1TU3 F;  3H1H J;  3H1L D;  3ABV C;  3P8M C;  3RGU A;  3M9B A;  1XTG B;  2OAR A;  3AEB C;  3SWK A;  3TNU A;  2K88 A;  2KB7 P;  2WSF J;  5KAI H;  2KSE A;  1L4A A;  3CCR P;  3Q1M A;  3L73 G;  3GF3 A;  1LTB C;  1DEB A;  5APQ A;  1GK4 A;  1A02 F;  3KHU A;  4OGQ D;  3OJA B;  2WQY C;  5E79 E;  1M1K Q;  2AXT E;  1SQB G;  2IFM A;  3V6I A;  2HPC B;  2R5B A;  1U7M A;  5B5E H;  1AFO A;  3V2R A;  4UB6 E;  4GOF A;  2ZYG A;  3CCJ P;  1EXJ A;  2QA4 P;  4JBZ A;  4C7N B;  1AA0 A;  1EZV I;  1Q90 D;  1ZP0 C;  2RKL A;  3CCV P;  4HB1 A;  5AVX B;  1P84 H;  3SWF A;  2GUS A;  1U7J A;  4RKU J;  5L8R J;  1NGM B;  3GW6 A;  4UB8 E;  3EFF K;  1OW8 A;  3AE1 C;  4RES B;  2QJY B;  4W80 A;  3A5T A;  4PV1 C;  3MGN A;  2C9L Y;  2YXR B;  2YMK A;  3RK2 B;  1JY3 P;  1FDO A;  3NTN A;  4ZKU A;  2I1J A;  1G1I A;  1RF1 A;  1USE A;  1YHQ P;  4H44 D;  5K5G B;  1JM0 A;  4L76 A;  1FZE A;  4XFJ A;  2E42 A;  1DX7 A;  1CW5 A;  3RL0 B;  3D6Z A;  4ASW A;  4AQR D;  1LJ2 A;  1VQ7 P;  1X79 B;  1RQU A;  2M8R A;  2LXB A;  1RF0 C;  4H13 C;  2ZT9 D;  1R5S A;  2FFD C;  2SPZ A;  1FZA A;  1NTM K;  1SQQ E;  1NTZ E;  3VMZ A;  2YKO A;  1N73 B;  3D71 A;  1UIX A;  4OVN F;  1YJW P;  4D6T J;  1IFJ A;  3Q3D A;  1LTJ B;  1M90 Q;  1P84 D;  3CWB E;  3B4S A;  1SQV J;  4U3F E;  1SQX K;  1ZLL A;  3GHG C;  4RO0 A;  2QJP B;  3V2P A;  2Y0C A;  1Q86 Q;  1OMI A;  3H1I D;  1OVR A;  3A2A A;  2N1T A;  4WY4 B;  1EDI A;  3HD7 A;  1KB9 H;  1J1D C;  2BEQ D;  4LGD E;  3L75 J;  3L70 J;  1N7S D;  3V5B A;  1S5L H;  1RE3 A;  1HBW A;  3NFQ A;  1VQ4 P;  3D6Y A;  3T97 A;  2FYU D;  1L0L D;  2E76 B;  3M06 A;  3V2N A;  1LWU B;  2XU6 A;  2B89 A;  3M91 A;  5TIS H;  1FZC B;  1LT9 C;  3L73 E;  2BCC J;  1LTT C;  1OFC X;  3USS A;  1PFI A;  1FE6 A;  2ITA A;  1M7L A;  4ASV A;  2H7H A;  1SQP J;  1BGY E;  2QJK C;  4EOT A;  1X22 A;  3IF4 A;  1HUC A;  3V4W A;  1GU5 A;  1PP9 J;  5APX A;  3H32 B;  3PRJ A;  5CCH C;  2OYI C;  2IBZ G;  1NOH A;  4YPC A;  3SWY A;  1J1E C;  1ZV8 A;  1KN7 A;  2BAS A;  1Z56 A;  3IN6 A;  2ZYA A;  1KIL B;  3B71 A;  1LTA C;  2H89 C;  1NTK G;  3Q2Y A;  4TLF A;  3G3Z A;  3Q5S A;  3M0D A;  2Y0D A;  3RK2 D;  2HLO A;  1KB9 D;  1GZL A;  3B5N A;  1KC8 Q;  3A0H H;  3S4R A;  1VQ6 P;  1IK7 A;  2JJL A;  4N3Y B;  3BCC E;  2A45 I;  1N86 A;  2OQQ A;  3VMA A;  1LNQ A;  2I8D A;  3RL0 D;  4H13 B;  4R4M A;  2N1T C;  1KYO E;  2YKQ A;  2LKM A;  4D6T G;  3TNU B;  4PJ0 H;  1BCC J;  5AW8 B;  1L4A B;  3H1L G;  2WTY A;  2E75 B;  3VMX A;  3P7K A;  2K9Y A;  2N9B A;  1JY2 O;  1VF5 C;  3PJS K;  1VQO P;  2FY8 A;  3LID A;  3TGU E;  2WSE J;  1L0N J;  2IPP A;  4ZMD A;  1J1D B;  2OTJ P;  3M0A A;  1JTH A;  1M56 D;  3HUS A;  3KZI H;  2J59 M;  3B8E B;  3QH9 A;  3V2Q A;  4I7Z C;  1NU1 J;  2D2C C;  5TJH A;  3H1H D;  1H0T A;  1WT6 A;  3Q5P A;  2P1J A;  5KJ7 C;  1IJD B;  1LTJ A;  2BEZ F;  1RE4 A;  4XA4 A;  1EDJ A;  1HGV A;  1VQL P;  1M1J C;  3U1C A;  3A3Y B;  1ZRT D;  4H0L C;  1PL5 A;  2WWW A;  1SQP G;  1EC5 A;  2ZFC A;  5APS A;  1KD1 Q;  1URQ C;  4IFF A;  1RF1 B;  3KQG A;  1OXZ A;  2FYU K;  1FOS E;  1IFI A;  1L0L K;  1IFP A;  1ZW0 A;  2QJK B;  1XTC C;  1D7M A;  2FBW C;  3FGA D;  4PD4 E;  1IO4 A;  1FJP A;  5AVT B;  1VL2 A;  2M0B A;  1YIJ P;  4W7Z A;  2NPS C;  1M8O B;  2WIT A;  4GDO A;  4IOI H;  3VMY A;  2YXQ B;  1KIL E;  1VQ9 P;  1AVY A;  2H43 A;  1Q82 Q;  1SQB K;  1KFM A;  2J5U A;  1VQM P;  1NTM E;  4DCK A;  2P10 A;  3IR9 A;  2LXC B;  4EIJ A;  2Q1K A;  1YTZ T;  2E5Y A;  3L71 J;  1BCC G;  4JYB A;  2K1A A;  3TSI A;  2WPV B;  2Q5U A;  2N1T B;  1NYH A;  3HD7 B;  1SQX E;  1T2K C;  3CMA P;  3AE6 C;  3WUU A;  4RJT A;  4H13 D;  3H1I G;  3H1J J;  3CXH D;  2FYZ A;  2ZAE B;  4KHX A;  3T97 B;  2XND H;  3AE3 C;  2PGD A;  2A45 H;  1L4A D;  1W5C E;  3S9O A;  5AVQ B;  1ZR4 A;  2AEM A;  3L37 A;  1X0T A;  2FYU G;  1MFT A;  1DIP A;  3RK3 E;  3GLM A;  2MJZ A;  3H1L E;  4D6T D;  5APW A;  3MD0 A;  1R8E A;  1LTG C;  4GIF A;  1SQV D;  1RF0 A;  3PTZ A;  3LW5 H;  2RMZ A;  3E1I A;  3G71 P;  2QRX A;  1HTL C;  5EFW B;  2FFD A;  3BRT B;  2QG4 A;  1M57 D;  3L75 D;  5AVS B;  3L70 D;  1NWQ A;  4MN4 C;  3AE4 C;  1PGJ A;  3F89 A;  1PGO A;  1FBM A;  3GHG A;  4JF7 A;  3CC7 P;  1KYO I;  1EQ7 A;  4O9B A;  3KYQ A;  2FYN B;  2BCC D;  3B5N B;  5AVW B;  2IX7 C;  4DOJ A;  3E1R A;  1VQN P;  2NPS B;  3TF5 A;  1SQP D;  1EXI A;  4I2L C;  4TT3 H;  5KKZ C;  1AQT A;  3CCE P;  3G9R A;  1YJN P;  3G6E P;  5CCH D;  3PHL A;  4N78 D;  1LT9 A;  2WPR A;  1LT1 A;  3L72 E;  1PP9 D;  2WSE H;  2QIW A;  1PPJ D;  5GTH H;  2P2U A;  3Q5R A;  4GKG A;  4KT0 J;  2POH A;  3CX5 I;  5KLI C;  5KLV J;  1SFC C;  1YJ9 P;  5BU5 A;  2W8Z A;  3CL3 D;  1NTM J;  5CCH A;  3CCL P;  3VOP A;  2OYI A;  2CK3 H;  1K8A Q;  1ZOY C;  3VN0 A;  5KTB A;  4WWI A;  1FJK A;  3OAK A;  4YTP C;  3M9Q A;  1JTH B;  3HUS B;  3FXE A;  2N1T D;  1S1C X;  3L74 J;  3HD7 D;  4DZO A;  1JY2 N;  5AVU B;  1CZQ A;  4L75 A;  1NKN A;  1QEX A;  1H0T B;  1EZV G;  5KAF E;  1Y47 A;  1VQ5 P;  3I5C A;  3CPW O;  2FXP A;  3TK1 A;  1BCC D;  1NTK K;  4I6M C;  1JCD A;  3P32 A;  2C0W A;  2Z5I A;  3H1H G;  3H1K J;  3H1I E;  1K05 A;  3AE2 C;  2WSS H;  4NPF X;  4B86 A;  2HG5 D;  3SSU A;  1USD A;  2B87 A;  2KK7 A;  2WZ7 A;  2PFX A;  1H88 A;  3F5H A;  1L0N D;  1QLE D;  1BE3 J;  2FYU E;  3AED C;  1L0L E;  3RK3 C;  3IFM A;  2D2C D;  1FAV A;  4GOD A;  3JCU H;  1LTS C;  1T3J A;  2WPQ A;  1SQV K;  1NU1 D;  1U57 A;  1N8R Q;  3P8C D;  4R4L A;  5KJ7 D;  3II6 A;  4L74 A;  1GL2 C;  1OW6 A;  4OGQ C;  2O1J A;  1W2B O;  3MUD A;  1S5L X;  1RY3 A;  3W68 A;  1YQ3 C;  1SQB E;  1S9K D;  4BWN A;  1OWA A;  2L91 A;  4N6J A;  3VP8 A;  3B5N D;  5KJ7 A;  4PV1 B;  2NPS D;  1M1J A;  1RHZ B;  3LW5 J;  3L36 A;  2WMM A;  1HH0 A;  2C9N Y;  2KI7 B;  2WVR A;  5H2F H;  1BGY D;  1GD2 E;  1KB9 E;  1URQ A;  3AE9 C;  1KQL A;  2Y0E A;  2HR3 A;  4OWF A;  2V4H A;  1SQP K;  2QM8 A;  1PV3 A;  3L72 J;  2OTL P;  4WB4 A;  2XDJ A;  4A7P A;  4IL6 H;  5GTI H;  3GMA A;  5B66 E;  4H44 C;  2A06 G;  2NPS A;  3TDK A;  2IYO A;  3UIA A;  1GTW A;  2FKW B;  2JWD A;  1CI6 A;  2YKP A;  1IC2 A;  1EDK A;  1FC2 C;  5APV A;  3L71 D;  1T2K D;  2FFD B;  2N9Y B;  3EQ2 A;  2JP3 A;  1N2D C;  3CX5 H;  4I1L A;  2E74 C;  4NPD A;  1PGQ A;  2J58 A;  1ZR2 A;  1SQV G;  3JC2 2;  4LLH A;  5AVV B;  2FXO A;  1QX8 A;  1BSN A;  3H1J D;  1R5L A;  1JY3 N;  4HYT B;  1SQQ J;  1NTZ J;  3GHG B;  3L75 G;  3L70 G;  4DJG A;  1OX3 A;  2OYH C;  2IZ0 A;  1BE3 G;  3CC4 P;  3FX0 A;  4ZNC A;  3CWB J;  2ZVN B;  4U3F J;  1JO5 A;  3FWN A;  2CPB A;  5CCG C;  1EZV D;  3H1H E;  2KIK A;  3MTU E;  3MUD C;  3H25 A;  2JDI H;  2XZR A;  2W83 C;  2ZYD A;  1Y8A A;  1H89 A;  2O1K A;  2AEJ A;  5CBN A;  3VYI A;  3O8Z A;  3BAS A;  2BCC G;  1ZRT E;  2E43 A;  3A0H E;  3A0B H;  2HYN A;  1VPC A;  4IFM A;  4HKZ H;  1NHL A;  3IAO A;  1FU1 A;  1LT9 B;  2G8Y A;  1L0N K;  2A45 G;  2KYV A;  1HJ0 A;  2MKV A;  1QL1 A;  2H8P D;  5AW5 B;  1BSH A;  1AJY A;  1FZB A;  2PAJ A;  1K73 Q;  1NU1 K;  1PP9 G;  2KXP B;  1PPJ G;  3CX5 D;  3L73 J;  2V7Q J;  1KMI Z;  3WU2 H;  5CJ4 A;  1IFM A;  4XE5 B;  1RH5 B;  3HE5 A;  1KV4 A;  3OA7 A;  2OYI B;  1BGY J;  1SQB J;  3HE4 A; 
#chains in the Genus database with same CATH homology
 1IFJ A;  2WSF H;  1LTJ B;  1FZF A;  1FBM A;  2W6B A;  3GHG A;  4JF7 A;  1SQX K;  1MUU A;  1ZLL A;  3GHG C;  3A7O A;  3V2P A;  1JY2 P;  1EQ7 A;  5AW1 B;  3A2A A;  2N1T A;  3H6P A;  4WY4 B;  2KOG A;  3HD7 A;  2Q3I A;  1GW4 A;  3M9H A;  2R32 A;  3HD7 C;  1J1D C;  2XV5 A;  3KYQ A;  4LGD E;  4O9B A;  1N7S D;  2R3C A;  4C46 A;  2L5G B;  3V5B A;  3LIE A;  2WT7 B;  3B5N B;  1RE3 A;  5AVW B;  1HBW A;  2IX7 C;  3RK2 C;  4DOJ A;  1RE3 C;  3NFQ A;  3NMD A;  2PP6 A;  1VDF A;  3T97 A;  2NPS B;  2XKM A;  1KZU B;  2HFE D;  1J1E B;  2GM4 A;  4I2L C;  1JOC A;  3M06 A;  3VTP C;  4GT1 A;  1HJB A;  3V2N A;  5CCH D;  1SVF A;  4N78 D;  1LT9 A;  1LWU B;  2WPR A;  2XU6 A;  3M91 A;  4Y99 C;  1FZC B;  1LT9 C;  2WSE H;  3C9I A;  3RK3 B;  3RL0 C;  1LTT C;  1PFI A;  2I1K A;  3NXS A;  3PP5 A;  2P2U A;  1N7S C;  2QM7 A;  4GKG A;  1JCC A;  1NTZ K;  1SQQ K;  1A02 J;  1M7L A;  4WY4 D;  2H7H A;  2POH A;  3N7N A;  4EOT A;  1GL2 B;  1SFC A;  2M3B A;  2IFN A;  1FDM A;  1HUC A;  3WMM 0;  1SFC C;  5APU A;  1JMM A;  1IK9 A;  5BU5 A;  3CL3 D;  3V4W A;  1N73 A;  1GU5 A;  5CCH A;  3VOP A;  2HOD A;  5APX A;  3H32 B;  4JYC A;  2OYI A;  1N73 C;  4HH2 A;  1JY3 O;  5CCH C;  3CI9 A;  2YO2 A;  3VN0 A;  2YMY A;  5KTB A;  2OYI C;  1FJK A;  3OAK A;  5BVZ A;  1G2C B;  1NOH A;  3SWY A;  1J1E C;  3M9Q A;  2VRS A;  1JTH B;  1ZV8 A;  3HUS B;  1IFN A;  2N1T D;  2BAS A;  1Z56 A;  3HD7 D;  1SLQ A;  1KIL B;  4DZO A;  1JY2 N;  1LTA C;  1YTZ I;  1QL2 A;  1DH3 A;  1FZG A;  3TYY A;  5AVU B;  1CZQ A;  5AVR B;  3G3Z A;  4WY4 A;  1NKN A;  3M0D A;  2W6A A;  3RK2 D;  2HLO A;  3RK3 D;  4WY4 C;  2JEE A;  3I5C A;  3M0D C;  3VP9 A;  1GZL A;  3TK1 A;  1NTK K;  4I6M C;  1AQ5 A;  1JCD A;  1M1J B;  3P32 A;  2C0W A;  1JNM A;  2Z5I A;  5CHX A;  3B5N A;  3CLQ A;  4M3L A;  1NKZ B;  2Q7C A;  3B5N C;  2O01 H;  4B86 A;  2KP8 A;  2HG5 D;  1GL2 D;  1URQ B;  2JJL A;  4N3Y B;  2A45 I;  1N86 A;  2WZ7 A;  1HGZ A;  3RL0 D;  2N1T C;  4C7R A;  2YKQ A;  1LWU A;  1H88 A;  1SP4 A;  2LKM A;  3TNU B;  2P7J A;  1FZC A;  1LWU C;  1WRG A;  2KLV A;  4IFD K;  5AW8 B;  1FZC C;  5AW0 B;  1L4A B;  1GDT A;  3N4X A;  3RK3 C;  3IFM A;  2WTY A;  3KPE A;  1FAV A;  2W27 A;  1KIL D;  2Z5H A;  1SFC D;  3VMX A;  4N78 E;  1LTS C;  1T3J A;  2WPQ A;  3V4Q A;  1SQV K;  3BRV B;  3P7K A;  1T8Z A;  2N9B A;  5APY A;  1CI6 B;  1JY2 O;  1NAF A;  1T3U A;  1GL2 A;  3P8C D;  5KJ7 D;  1LGH B;  5AVZ B;  3II6 A;  1W2E A;  1GL2 C;  3LID A;  5AW2 B;  4OH8 B;  3U1A A;  3R2P A;  4ZKP A;  5AW6 B;  3BAT A;  2IPP A;  3H32 A;  1JUN A;  2O1J A;  2GUV A;  1GU4 A;  1J1D B;  1X8Y A;  5APT A;  3M0A A;  1G1J A;  1JTH A;  3MUD A;  3HUS A;  4WBA A;  2Z4E A;  2J59 M;  1RY3 A;  3B8E B;  3V2Q A;  3HUS C;  2OYH B;  1KIL A;  1H8A A;  1S9K D;  1KIL C;  5AW4 B;  1IFD A;  1OWA A;  5AW3 B;  4N6J A;  3VP8 A;  3B5N D;  1WT6 A;  5CJ0 A;  5BU8 B;  5KJ7 A;  2P1J A;  5KJ7 C;  1HWT C;  1IJD B;  2NPS D;  1M1J A;  1LTJ A;  1RE4 A;  4XA4 A;  1HGV A;  5AVY B;  1M1J C;  4Y99 B;  1LTJ C;  3A3Y B;  3L36 A;  5CMZ A;  3U1C A;  5AW7 B;  1RE4 C;  1HH0 A;  2WWW A;  2C9N Y;  1ZN5 A;  2ZFC A;  1GD2 E;  1LTI C;  1URQ A;  5APS A;  1KQL A;  3BVH A;  1URQ C;  4IFF A;  1N7S B;  1RF1 B;  3KQG A;  4AYC A;  1OXZ A;  3L35 A;  1SQP K;  2FYU K;  1FOS E;  1MZ9 A;  3HTK B;  2QM8 A;  1IFI A;  1L0L K;  2R5D A;  3P8M C;  1XTC C;  5KLV K;  3M9B A;  4WB4 A;  1XTG B;  2OAR A;  2XDJ A;  3TNU A;  1IO4 A;  2KB7 P;  2WT7 A;  1FJP A;  1L4A A;  5AVT B;  1L4A C;  2NPS A;  1LTB C;  4W7Z A;  1DEB A;  5APQ A;  2NPS C;  1GK4 A;  3UIA A;  1A02 F;  2CPS A;  1GTW A;  1GK6 A;  2FKW B;  2WIT A;  3U59 A;  1CI6 A;  2YKP A;  4LC1 A;  1IC2 A;  3OJA B;  5APV A;  3MIW A;  3VMY A;  1T2K D;  2FFD B;  3KDP B;  2IFM A;  3EQ2 A;  5CCG D;  1N2D C;  4I1L A;  1CSB A;  2J58 A;  1ZR2 A;  1MFZ A;  2H43 A;  2HPC B;  2R5B A;  4LLH A;  4AUW A;  1SQB K;  1KFM A;  5AVV B;  3V2R A;  1AFO A;  3P8C E;  3HE5 B;  2WPS A;  1KFN A;  1N7L A;  3HE4 B;  4C7N B;  3IR9 A;  1JY3 N;  4HYT B;  2OYH A;  4EIJ A;  5AVX B;  3GHG B;  2OYH C;  1YTZ T;  3EFG A;  3SWF A;  2GUS A;  2ZXE B;  1J2J B;  4JYB A;  1NO4 A;  3TSI A;  2Q5U A;  2N1T B;  3HD7 B;  2FXM A;  3HRN A;  1NH4 A;  4RES B;  5CCG A;  4W80 A;  1URQ D;  1T2K C;  1GW3 A;  3A5T A;  1S9K E;  1G2C A;  1JO5 A;  3MGN A;  2CPB A;  5CCG C;  2C9L Y;  2KSJ A;  4W7Y A;  2C0X A;  3MTU E;  3RK2 B;  2XZR A;  1JY3 P;  3NTN A;  4ZKU A;  1H89 A;  2O1K A;  2I1J A;  1G1I A;  1N7S A;  1E5W A;  1RF1 A;  2FYZ A;  4KHX A;  3VYI A;  3O8Z A;  3HTK A;  2XNX A;  3BAS A;  2A45 H;  1RF1 C;  1L4A D;  2E43 A;  2HYN A;  1VPC A;  4IFM A;  2Q9I A;  1NHL A;  5AVQ B;  1X9V A;  1FZE A;  1ZR4 A;  1FU1 A;  1LT9 B;  3L37 A;  1L0N K;  2A45 G;  2KYV A;  2YNY A;  1HVV A;  2E42 A;  1DX7 A;  1CW5 A;  3RL0 B;  3L4F A;  2WSC H;  1FOS F;  2MJZ A;  1QL1 A;  4AQR D;  5APW A;  2H8P D;  3MD0 A;  1LTG C;  1X79 B;  4GIF A;  1RF0 A;  5AW5 B;  3LW5 H;  2M8R A;  1FZB A;  3E1I A;  2PAJ A;  1RF0 C;  1NU1 K;  2YO3 A;  1HTL C;  2P67 A;  2FFD A;  2FFD C;  1SFC B;  1MV8 A;  1FZA A;  1NTM K;  5CJ4 A;  3BRT B;  2HPC A;  3VMZ A;  1IFM A;  2YKO A;  5AVS B;  1N73 B;  4XE5 B;  1YYC A;  3HE5 A;  2HOD B;  5AW9 B;  3OA7 A;  2OYI B;  1NWQ A;  3HE4 A;  4C7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...