1GD2E

Crystal structure of bzip transcription factor pap1 bound to dna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
DQEPSSKRKAQNRAAQRAFRKRKEDHLKALETQVVTLKELHSSTTLENDQLRQKVRQLEEELRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the diversity of DNA recognition by bZIP transcription factors.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*GP*GP*TP*TP*AP*CP*GP*TP*AP*AP*CP*C)-3')
total genus 25
structure length 65
sequence length 65
chains with identical sequence F, G, H, I, J
ec nomenclature
pdb deposition date 2000-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gd2E00
2VRSA 1JUNA 4I6MC 3HE4B 3NFQA 3HE5B 1MV8A 2P2UA 5AVWB 1HJBA 2R32A 5APWA 5AW3B 5AW1B 2Q5UA 3TK1A 5AW5B 3M91A 3KDPB 3M9BA 2Q7CA 1FAVA 2YO3A 3M0DA 5APXA 3V4QA 3LIDA 1NAFA 2Q3IA 4LC1A 1HWTC 1KQLA 1SLQA 1T2KD 1JNMA 3NXSA 5AW8B 1S9KE 1OWAA 2R3CA 1CI6B 2YNYA 1GTWA 1HUCA 3TNUA 1OXZA 3L35A 3V5BA 1G2CB 1NWQA 4HYTB 5APVA 2QM8A 1MUUA 1CI6A 5AW2B 2WPRA 1IO4A 5AVUB 2KP8A 2XZRA 4EOTA 3VYIA 5AVTB 3B8EB 4C7NB 3P7KA 2R5BA 3M06A 3VMYA 3HTKA 1T2KC 1GD2E 2E42A 2WPSA 3P8MC 3VMXA 5AVVB 3A7OA 1X8YA 2JJLA 3O8ZA 5AW9B 2P7JA 4AYCA 3UIAA 3A5TA 4C7NA 5APQA 3L36A 1H8AA 5CMZA 4AUWA 5APSA 2WT7B 5AVQB 2C9LY 3TYYA 1FOSF 5APUA 5AW4B 1MFZA 2W27A 3KQGA 1A02F 2QM7A 4I2LC 3NMDA 3V4WA 3P32A 1GU5A 2ZFCA 5AVRB 2WT7A 3A2AA 5AVXB 4GKGA 2BASA 4KHXA 3VTPC 3A3YB 4GT1A 1YYCA 1FOSE 2E43A 3IR9A 2Z5HA 2WWWA 2XU6A 4B86A 1CSBA 3VMZA 5AVZB 3M0AA 4JYBA 3M9HA 3LIEA 3MGNA 5AW6B 1GU4A 3L37A 2WPQA 1GK4A 5AVSB 2C9NY 2P67A 1H89A 1J2JB 1DH3A 5APYA 1SP4A 2W6AA 1H88A 5AVYB 4C46A 3HE4A 1CZQA 2IPPA 3NTNA 2WTYA 3SWFA 4M3LA 3TNUB 3OAKA 3MD0A 4RESB 1S9KD 3HE5A 5AW0B 2ZXEB 3I5CA 2YO2A 2N9BA 2Z5IA 1A02J 1GZLA 5APTA 2XV5A 4DZOA 5AW7B 4XE5B 3T97A 2R5DA 1GK6A 4AQRD 4JYCA 2H7HA 3VN0A 1HBWA
chains in the Genus database with same CATH superfamily
2M3EA 3AEFC 1JUNA 2QA4P 1NTKJ 1VQ5P 2OYHB 4XA4A 3P8CE 2Q1KA 2N1TB 1NTME 1PIXA 2Q3EA 3HTKB 1ZLLA 1LTBC 2H89C 1KILB 1TU3F 2P2UA 3NFQA 4PV1B 4UB8H 3B5NB 5AVWB 1QGKB 1UIIA 2R32A 1P84H 4H13D 1RE4C 5APWA 1HJBA 2Q5UA 4IFMA 1E5WA 3MUDC 2KIKA 4PV1D 1KV4A 5L8RJ 1IC2A 4RJTA 2M5AB 2QEXP 2UWJE 2KLUA 2NPSD 3M9BA 1FAVA 5KLIB 3M0DA 3RL0g 4BRYB 1HVVA 1Q7YQ 2Q3IA 2QIWA 4LC1A 2JWDA 2FFDB 1EDIA 3AEAC 3PTZA 4JPZB 2R3CA 2QG4A 4ZNCA 2WSCJ 3V2QA 1GW4A 1LP1B 2YNYA 3H1ID 4KJMA 2A06E 1HUCA 4H0LC 4EI2A 1YTZT 1SQVD 1L0LJ 1KILD 3H1HE 3AEEC 1KMIZ 3L35A 1VQPP 3C1LA 2N1TC 3HD7D 5K5GB 1G2CB 3H1LD 2AXTE 1KILC 2XDJA 3KHUA 2Y0EA 3H32B 1LNQA 2QM8A 2E74B 3B5NC 1CI6A 1NH4A 1ZP0C 2W6BA 3F5HA 3GW6A 1PP9D 3H1JE 1SQVE 3H1HD 3OJAB 3PH0A 2BCCE 4WY4A 3USSA 1AVYA 1MZ9A 1SQBD 3H1IJ 3VYIA 5CBNA 4EOTA 3B8EB 4H44B 1S2EA 1ZR2A 3P7KA 1RF0A 2PFXA 1SQQK 4OGQB 5B5EH 1GD2E 2CPSA 1SFCB 3OW2O 3IAOA 1L4AB 2J58A 1Y47A 1JB0J 3L75G 4K35A 1K73Q 5CCGD 3V2PA 2HLOA 2P7JA 1LT9C 1SS1A 3A5TA 3L36A 4H0LB 1SQBJ 1ZR4A 1H8AA 1FS0E 4U7JA 3MZWB 3L74E 1VQ9P 4AUWA 1BGYG 2FXPA 4I1LA 3TGUE 1XTGB 2BCCD 1J1DC 1VQ4P 5APUA 1PP9E 2M8RA 2ZAEB 2E76C 1ZXGA 3PLNA 3EFGA 1EZVD 3H1JD 1M56D 2ZVNB 2IBZE 4IFFA 2A45H 4I2LC 3NMDA 5CHXA 1G1JA 1NOHA 2H88C 5H2FH 2JO1A 3C8VA 2K9JA 3FWLA 1OVRA 4KHXA 3BCCG 3VTPC 3A3YB 5KLVG 3ZDMA 2I1KA 1SFCC 5B66H 1OX3A 2NPSA 2FFDA 1J1EC 1T6AA 4D6TG 3H1JJ 1BE3D 3RK3E 1FZAA 3BRVB 1M57D 2JEEA 1X9VA 2FKWB 1S72P 1FZGA 3S9OA 2KUBA 2M3BA 3L71G 3F89A 2WPQA 1GK4A 1PPJD 1IK7A 3M9QA 3A0HH 3EWKA 5KLVD 2C9NY 1K9MQ 1J2JB 1DH3A 5APYA 2E76B 1JCDA 1SP4A 2AEMA 1OVUA 2LR2A 1RE4A 2IBZI 1ZW0A 1KN7A 1IFDA 3W68A 2IPPA 2YIUB 3NTNA 5KAIH 2WTYA 4OWFA 1N73B 3CC2P 2B88A 3L73J 2K9YA 3GHGB 1OIPA 2GUVA 1SFCD 2WSEH 3L72E 2WSCH 1IK9A 1NTMG 1GW3A 5AW0B 1KQFB 2A45G 1SQXK 1SQPK 4Y99C 2IFMA 3I5CA 1AQTA 5TISE 1NTKG 1H0TA 4L73A 1U57A 3H25A 1GZLA 1RE3A 1USEA 2P58A 5APTA 4A7PA 1SQQJ 4ASWA 3CCEP 3Q1MA 2WSFJ 4RO0A 2IYPA 2KSEA 2ZYDA 2JP3A 4UB8E 3AE6C 2LXCB 4I7ZC 4AQRD 3L70G 4W7YA 4DCKA 3Q3DA 3VN0A 3HUSC 3CX5I 4TLFA 1KQGB 1NU1G 3SWKA 1NJIQ 1HBWA 4W80A 1N7SC 2A45I 3G3ZA 4I6MC 3G71P 1M8OB 2R3SA 1VF5D 3VMAA 4IFDK 3CCJP 2AEJA 3HE5B 1MKMA 3IFMA 5CCGA 1ZRTD 2BEQD 2V7QH 2B87B 3BCCJ 5AW1B 3TK1A 4Y99B 1NTZD 3RGUA 1LT1A 3KYQA 3CMEP 4N78D 2GA1A 3KDPB 1K05A 2Q7CA 2O01J 4Y28J 1NTMK 3CLQA 5KLVK 2MJZA 1URQD 3H1LJ 5TJHA 3CCLP 1JY2O 1KQLA 1HGZA 2OYIC 1T3JA 3NXSA 1S9KE 3AE8C 2AXTH 1FE6A 2WITA 2ZT9C 1N73A 2NRGA 3H1HJ 4WY4D 1W2EA 4PD4D 3OA7A 2IYOA 2N1TD 4HH2A 1EXJA 1N7SB 3GHGA 2D2CC 1EZVI 4GIFA 2HFED 2Z4EA 3TGUG 3Q5PA 3MP7B 1ZRTE 2E74D 2Q6QA 3BASA 1L0LG 2FYNC 2J59M 3FXDA 3H1KE 5APVA 1SQPD 2K9JB 2FYUJ 2WPRA 3S1KA 1IO4A 2YKPA 5AVUB 1OFCX 4HB1A 5B66E 1OVVA 1OW6A 1M1JC 1T3UA 4R4MA 4BXLA 1RH5B 4C7NB 1NTKE 1N7LA 1CW5A 1Z56A 2R5BA 2BCCJ 2KS1B 3RL0B 1AA0A 2BEZF 1SQXE 3L70E 3RBXA 1EXIA 2E42A 1VQ6P 1LT9A 2O01N 2OYIB 3KZIH 2HODA 3R4YA 1SQVK 1YQ3C 2I8DA 3L73D 3WMM0 1UIXA 1LWUC 3A7OA 1NHLA 1SQPJ 1X8YA 1JOCA 3B71A 3AEGC 3HRNA 3KXDA 4YPCA 3UIAA 2H43A 3CD6P 1KYOE 1VQNP 3LW5J 3II6A 1NO4A 2C9LY 5KAIE 3TYYA 2FY8A 1EDLA 1QL1A 3KQGA 3L71D 1RQVA 2QM7A 1L2PA 2KXPB 1GU5A 1JMBA 1SQQD 3WU2H 2B9BA 1EDKA 3CXHE 4QMAA 3FWNA 2QJKB 1P84D 2WZ7A 3A2AA 5EFWB 1L4AD 2E75C 4GKGA 5AVXB 1USDA 1SQBG 2O1KA 4LLHA 1Q81Q 4N6JA 3G6EP 1SQQG 1M1KQ 1FOSE 3PRJA 2E43A 1VF5C 1H0TB 4H44D 4Z1MH 3VMZA 3RK2D 5CCHC 2PGDA 3VOPA 4LGDE 3L71J 3H1LG 1NTKD 5KLVE 1LWUB 3CXHH 5GTIE 4JYBA 4WVZA 2CPBA 3AE1C 3ABVC 2OQQA 1S5LX 2KLVA 3CL3D 3CX5H 1FC2C 2GUSA 3M9HA 4JQ0D 4DOJA 2ZVOB 4ASVA 1NTMJ 3H1JG 4L74A 3CWBJ 4OH8B 3RL0D 3CMAP 1BE3E 2N1TA 1HH0A 5CBOA 2W90A 1KTMA 3B5ND 2KI7B 1KB9D 3L73G 1QVFO 4D6TE 2OTJP 1AQ5A 1FJKA 1DD4A 1OMIA 4PJ0E 3TGUJ 1G1IA 1R8EA 2E75D 4NPEA 4WY4C 4ZKPA 1K04A 1X0TA 4M3LA 1S5LH 1BGYJ 3TNUB 2AEFA 2E75B 3W67A 2HODB 3KPEA 1KC8Q 3I56P 2K3RA 1VQKP 1NU1D 4RESB 1S9KD 3D6YA 3HE5A 4JF7A 2IBZD 1VF5B 3E1IA 3JSVC 4AYCA 2C0XA 1YITP 1BSHA 1L0LD 2FBWC 2IX7C 2ZJSE 1JY2P 1SQXG 4YXDC 4ZMDA 1WT6A 4C7RA 2HPCB 1RF1C 3TGUD 5KTBA 2KSJA 2Y0DA 2Z5IA 4PD4H 1QL2A 1SQBK 1VL2A 2I1JA 3L74J 2W6JH 4DZOA 2XV5A 2DW3A 2IDBA 2FYUD 3RBZA 1FZBA 1S3JA 1FU1A 1NU1J 3A0BE 2R5DA 4XE5B 5KJ7A 1GK6A 1T8ZA 2HG5D 4WY4B 2JR8A 3T97B 1GL2B 4GDOA 1L0NK 2JDIH 1OZHA 2QSIA 3GMAA 1SQBE 4N3YB 2BCCG 1NTZG 1S4XA 2D2CD 1JY2N 2Y9YA 3BATA 1MV8A 1VDFA 2E5YA 2WSSH 1X22A 3HD7C 1N7SA 2E74C 1DD3A 1L4AA 1NTKK 1YQ4C 1LGHB 3JCUH 4WBAA 5AW3B 3WUTA 4BRYA 1LWUA 2ZYAA 1Y8AA 2LKMA 3M91A 3O6QA 3AE5C 3CC4P 5CJ0A 1PV3A 3VP8A 2YO3A 1VQ7P 1HTLC 2PAJA 1BGYE 2A06D 4OGQC 1NAFA 3H1IE 5AW9B 1EC5A 2LXBA 1SLQA 1JNMA 3RK3C 1HWTC 1DIPA 3LW5H 3QWOC 2O3JA 1URQC 3QH9A 5C39A 3RK2C 3TDKA 5CCHD 3CCMP 1FZCA 3SFEC 1LT9B 1X79B 1GTWA 2P1JA 3FXEA 1GL2C 3H6PA 3TNUA 2OYHC 1OXZA 1Q86Q 1FZEA 1BE3J 3RL0C 1NWQA 2IFNA 3U1AA 4PV1C 3CC7P 2PRRA 1PPJE 2QRXA 1SQVG 3N4XA 4OVNF 5AW2B 4YTPC 3M0DC 4DJGA 1NTMD 2GM4A 2KP8A 2XZRA 3P8CD 1JCCA 1QLED 1NVOA 1EDJA 1IFPA 3FX0A 3RK3D 3GF3A 3V6IA 2WVRA 1RE3C 3M06A 4GODA 1LTGC 3HTKA 5KLIC 3VMYA 1T2KC 1ZMEC 1WRGA 1GDTA 1M1JA 3JCUE 2KNCA 1RHZB 2ITAA 3P8MC 4JBZA 1J1EB 1GL2A 3TF5A 1KD1Q 2K88A 1URQB 5AVVB 4MN4C 1YJ9P 2N9YB 4H0LD 3V2NA 2OARA 1YHQP 4IL6E 1PPJG 4C7NA 5APQA 2E76D 2OYOA 2YMYA 2NZ2A 3FGAD 2WT7B 1EZVE 3K5BA 2OYIA 5KKZC 1S5LE 3PP5A 1PL5A 2L91A 1HF9A 3H1HG 1EQ7A 1MFZA 1A02F 1HJ0A 3E7KA 3L74D 3V4WA 4CPGA 3P32A 2KK7A 4U3FJ 2ZFCA 3AEBC 4L75A 2OTLP 5KAFH 2WQYC 3GHGC 5CJ4A 2OTKE 3CX5D 4H44C 2BASA 3VP9A 3GLMA 4GT1A 5TISH 1VQ8P 5CCGC 3IR9A 4DT0A 2Z5HA 3R2PA 1KORA 1PGQA 2XU6A 3EQ2A 1L4AC 4R4LA 4B86A 5CCHA 1EZVG 2R44A 3MTUE 5AVZB 1Q90D 3M0AA 3CCRP 5B5EE 1N8RQ 3D71A 4TT3H 1GL2D 2WSEJ 1FDIA 1NTZK 1BGYD 1FDOA 2MKVA 1IFIA 1LTJB 1PP9J 5AW6B 3MGNA 5DJUB 3CCUP 3H1KG 1N86A 1GU4A 2B89A 4OGQD 5M1BA 1J1DB 3H1LE 1DEBA 1NTZJ 5KKZB 1H89A 1BCCG 1KFMA 4I7ZB 1JTHB 1SQPG 2FYUK 1ZN5A 5AVYB 5GTHE 1CZQA 1KILE 2B87A 3AE3C 4PD4I 3V2RA 3L74G 1RY3A 1IFMA 4EDFA 3SWFA 1L0NE 3G4SP 1VQOP 1YIJP 2QVAA 1AVOA 3L72G 3OAKA 4D6TD 3I55P 1SQXJ 1KB9E 3AE9C 2YMKA 3HUSA 1DEEG 5DJTB 1E79H 2ZXXA 2XKMA 4PJ0H 3GF7A 5H2FE 1M90Q 1FDMA 3Q2YA 2FYUE 1BCCE 3S4RA 1FJPA 3BCCE 3L75J 1LTJC 3G9RA 1RF0C 2QJYB 2SPZA 3SFDC 1WMKA 1VPCA 5AW7B 1K8AQ 1NKNA 4K3AA 1KFNA 3ITKA 3AE7C 4EYYQ 5BU8B 2NPSB 1FZCB 1R5SA 4KT0J 1L0LE 2YKQA 1L0NG 2PP6A 1VQLP 4GOFA 4HKZH 1P84E 3MIWA 2H7HA 1NU1E 3CXHD 2YIUC 4XFJA 1N73C 1IFJA 2VRSA 2AXCA 1JY3P 3CCQP 2D2CB 2JWAA 2K1AA 3L75D 1NAYA 3CWBE 1BSNA 3AE2C 2KS1A 3HE4B 4RKUJ 4U3FG 1GMJA 3SSUA 5BVZA 3CI9A 1KZUB 5KLVJ 3D6ZA 1JM0A 5AW5B 3L4FA 2RKLA 4ZKUA 1JY3O 1LP1A 1HGVA 1M1JB 1YBKA 2O1JA 1LTIC 2QE7H 4NPDA 3AEDC 3Q5RA 2YKOA 2FXMA 3L73E 5APXA 2QJYC 3V4QA 1URQA 3LIDA 3MUDA 1JO5A 1FZCC 1JMMA 3CXHI 1T2KD 2KNCB 2NPSC 4U3FD 5AW8B 2P10A 1OWAA 3AECC 2OYHA 1CI6B 2XNXA 3O6QB 3CWBG 4YXWH 1RF1A 2IZ0A 4BWNA 5E79E 3HUSB 3A0BH 1AV1A 3BVHA 2YXQB 1SQPE 2M0BA 3D70A 3WU2E 1SQQE 3V5BA 3EFFK 4H13C 4HYTB 3IF4A 2M5AA 1MUUA 2KB7P 3L71E 3CCSP 2G3AA 3C9IA 3L70J 2WMMA 3CWBD 3L75E 1QX8A 4IL6H 5AVTB 3B5NA 1KYOH 1SQVJ 1KYOD 3Q5SA 1AJYA 5GTIH 4GOEA 4O9BA 2WPSA 3HD7A 1YTZI 1NU1K 1YJNP 3VMXA 1BE3G 2ZT9B 3E1RA 4W7ZA 1KB9I 1IFNA 2JJLA 3O8ZA 1FZFA 4N78E 1OW8A 1SQXD 3PJSK 2C0WA 3L70D 1NTZE 2KZJA 1L0NJ 1N7SD 1Q2NA 2WSFH 1LTJA 3BCCD 4IL6X 5CMZA 2Y0CA 5APSA 2IBZG 4WB4A 5KAFE 1BCCD 1OW7A 1R5LA 5AVQB 1FOSF 4H13B 5AW4B 5E79H 2W27A 2FYNB 3H1KD 2H8PD 3WUUA 2POHA 4UB6H 2ZYGA 1LTSC 2Y9ZA 5AVRB 3BRTB 3PHLA 3CCVP 3H32A 1JTHA 2XNDH 5KJ7D 1L0ND 2WT7A 1SVFA 1P84I 1MFTA 2KZIA 1PFIA 3WUVA 1YYCA 1BCCJ 1KILA 2V4HA 2J5UA 4PD4E 1QVGO 2W8ZA 2WWWA 1Q82Q 1CSBA 4UB6E 3U59A 1YI2P 3U1CA 3H1KJ 3CPWO 2JKVA 1JY3N 1W5CE 2YXRB 1ZOYC 5GTHH 1RF1B 1Y9BA 1DX7A 1L0LK 1PGJA 1PGOA 3KZIE 4D6TJ 1S1CX 2RN0A 3LIEA 4HJGH 2FXOA 3L37A 1U7JA 1ZV8A 2FYZA 5AVSB 2IZ1A 2HYNA 3MHVA 3JC22 1AFOA 4WWIA 2P67A 1NGMB 2QJPB 2G8YA 3L72D 2OGUA 1JEKA 1PP9G 2W6AA 1BDCA 1H88A 1NKZB 1RQUA 4C46A 1BDDA 3AE4C 3HE4A 1LTAC 5KJ7C 2A06G 3CX5E 3GG2A 1N2DC 2W83C 3B4SA 5BU5A 1YJWP 2E5TA 2QJKC 3SWYA 1FBMA 1PGPA 3MD0A 4L76A 1W2BO 3N7NA 4U3FE 3TSIA 1VQMP 3HD7B 3H1IG 1KYOI 1PZQA 1LTTC 2WPVB 2ZXEB 3L72J 1XTCC 2RH0A 1G2CA 1U7MA 2L5GB 1IJDB 2KYVA 4NPFX 2YO2A 1KQSO 2O01H 2N9BA 2RMZA 1A02J 2HR3A 2CK3H 4EIJA 1KB9H 1IZNB 1QEXA 2KOGA 2HPCA 2Q9IA 1SFCA 2V7QJ 3RK3B 2FFDC 3IN6A 3T97A 2QJPC 1D7MA 3RK2B 2ZT9D 1LJ2A 1M7LA 4JYCA 2FYUG 4IOIH 2K37A 3A0HE 1NYHA
chains in the Genus database with same CATH topology
1JUNA 2OYHB 4XA4A 3P8CE 2N1TB 3HTKB 1ZLLA 3NFQA 1LTBC 1KILB 4W7YA 2P2UA 5AVWB 3RL0B 3B5NB 1HJBA 2R32A 5APWA 1RE4C 2Q5UA 4IFMA 1E5WA 1IC2A 3M9BA 2NPSD 1FAVA 3M0DA 1HVVA 2Q3IA 4LC1A 2FFDB 2R3CA 3V2QA 1GW4A 2YNYA 1HUCA 1YTZT 1KILD 3L35A 2N1TC 3HD7D 1G2CB 1KILC 2XDJA 3H32B 2QM8A 3B5NC 1CI6A 1NH4A 2W6BA 3OJAB 4WY4A 1MZ9A 4EOTA 3VYIA 3B8EB 1ZR2A 3P7KA 1RF0A 1SQQK 1GD2E 2CPSA 1SFCB 1L4AB 2J58A 5CCGD 3V2PA 2HLOA 2P7JA 1LT9C 3A5TA 3L36A 1H8AA 1ZR4A 4AUWA 4I1LA 1XTGB 1J1DC 5APUA 2M8RA 3EFGA 4IFFA 2A45H 4I2LC 3NMDA 5CHXA 1G1JA 1NOHA 4KHXA 3VTPC 3A3YB 2I1KA 1SFCC 2NPSA 2FFDA 1J1EC 1FZAA 3BRVB 2JEEA 1X9VA 2FKWB 1FZGA 2M3BA 2WPQA 1GK4A 3M9QA 2C9NY 1J2JB 1DH3A 5APYA 1JCDA 1SP4A 1RE4A 1IFDA 2IPPA 3NTNA 2WTYA 1N73B 3GHGB 2GUVA 1SFCD 2WSEH 2WSCH 1IK9A 1GW3A 5AW0B 2A45G 1SQXK 1SQPK 4Y99C 2IFMA 3I5CA 1GZLA 1RE3A 5APTA 4AQRD 3VN0A 3HUSC 1HBWA 4W80A 1N7SC 2A45I 3G3ZA 4I6MC 3HE5B 3IFMA 5AW1B 3TK1A 4Y99B 3KYQA 4N78D 3KDPB 2Q7CA 1NTMK 3CLQA 5KLVK 2MJZA 1URQD 1JY2O 1KQLA 1HGZA 2OYIC 1T3JA 3NXSA 1S9KE 1N73A 2WITA 4WY4D 1W2EA 3OA7A 2N1TD 4HH2A 1N7SB 3GHGA 2Z4EA 4GIFA 2HFED 3BASA 2J59M 5APVA 2WPRA 1IO4A 2YKPA 5AVUB 1M1JC 1T3UA 4C7NB 1N7LA 1CW5A 1Z56A 2R5BA 2E42A 1LT9A 2OYIB 2HODA 3WMM0 1SQVK 1LWUC 3A7OA 1NHLA 1X8YA 3HRNA 1JOCA 4AYCA 2H43A 3UIAA 3II6A 1NO4A 2C9LY 3TYYA 1QL1A 3KQGA 2QM7A 1GU5A 2WZ7A 1FJPA 3A2AA 4IFDK 5AVXB 1L4AD 4GKGA 2O1KA 4LLHA 4N6JA 2E43A 1FOSE 3VMZA 3RK2D 5CCHC 3VOPA 4LGDE 1LWUB 4JYBA 2CPBA 3CL3D 2KLVA 2GUSA 3M9HA 4DOJA 4OH8B 3RL0D 2N1TA 1HH0A 3B5ND 1AQ5A 1FJKA 1G1IA 4WY4C 4ZKPA 4M3LA 3TNUB 2HODB 4RESB 1S9KD 3HE5A 4JF7A 3E1IA 2C0XA 2IX7C 1JY2P 2HPCB 1WT6A 4C7RA 1RF1C 5KTBA 2KSJA 2Z5IA 1QL2A 1SQBK 2I1JA 4DZOA 2XV5A 1FZBA 1FU1A 4XE5B 5KJ7A 2R5DA 1GK6A 1T8ZA 2HG5D 4WY4B 1GL2B 1L0NK 4N3YB 3V2RA 1JY2N 3BATA 3KPEA 1MV8A 1VDFA 3HD7C 5CCGA 1N7SA 1L4AA 1NTKK 4WBAA 1LGHB 5AW3B 1LWUA 2LKMA 3M91A 5CJ0A 3VP8A 2YO3A 1HTLC 2PAJA 1NAFA 1HWTC 1SLQA 1JNMA 3RK3C 3LW5H 1URQC 3RK2C 5CCHD 1FZCA 1LT9B 1X79B 1GTWA 2P1JA 1GL2C 3H6PA 3TNUA 2OYHC 1OXZA 1FZEA 3RL0C 1NWQA 2IFNA 3U1AA 5AW2B 3N4XA 3M0DC 2GM4A 2KP8A 2XZRA 3P8CD 1JCCA 3RK3D 3VMYA 1RE3C 3M06A 1LTGC 3HTKA 1T2KC 1WRGA 1GDTA 1M1JA 3P8MC 1J1EB 1GL2A 1URQB 5AVVB 3V2NA 2OARA 4C7NA 5APQA 2YMYA 2WT7B 2OYIA 3PP5A 1EQ7A 1MFZA 1A02F 3V4WA 3P32A 2ZFCA 3GHGC 5CJ4A 3VP9A 2BASA 4GT1A 5CCGC 3IR9A 4ZKUA 2Z5HA 3R2PA 3EQ2A 2XU6A 1L4AC 4B86A 3MTUE 5AVZB 3M0AA 1GL2D 1NTZK 1IFIA 1LTJB 5AW6B 3MGNA 1GU4A 1N86A 1J1DB 1H89A 1DEBA 1KFMA 1JTHB 2FYUK 1ZN5A 5AVYB 1CZQA 3SWFA 1RY3A 1IFMA 3OAKA 3HUSA 2XKMA 1FDMA 1LTJC 1RF0C 1VPCA 5AW7B 1NKNA 1FZCB 1KFNA 5BU8B 2NPSB 2YKQA 2PP6A 3MIWA 2H7HA 1N73C 1IFJA 2VRSA 1JY3P 3HE4B 5BVZA 3CI9A 1KZUB 5AW5B 3L4FA 1JY3O 1HGVA 1M1JB 2O1JA 1LTIC 2YKOA 2FXMA 5APXA 3V4QA 1URQA 3LIDA 3MUDA 1JO5A 1FZCC 1JMMA 1T2KD 2NPSC 5AW8B 1OWAA 2OYHA 1CI6B 2XNXA 1RF1A 3HUSB 3BVHA 3V5BA 4HYTB 1MUUA 2KB7P 3C9IA 5AVTB 3B5NA 4O9BA 2WPSA 3HD7A 1YTZI 1NU1K 3VMXA 4W7ZA 1IFNA 2JJLA 3O8ZA 1FZFA 4N78E 5AW9B 2C0WA 1N7SD 5CCHA 2WSFH 1LTJA 5CMZA 5APSA 4WB4A 5AVQB 1FOSF 5AW4B 2W27A 2H8PD 2POHA 1LTSC 5AVRB 3BRTB 3H32A 1JTHA 5KJ7D 2WT7A 1SVFA 1PFIA 1YYCA 1KILA 2WWWA 1CSBA 3U59A 3U1CA 1JY3N 1RF1B 1DX7A 1L0LK 3LIEA 3L37A 1ZV8A 2FYZA 5AVSB 2HYNA 1AFOA 2P67A 2W6AA 1H88A 1NKZB 4C46A 3HE4A 1LTAC 5KJ7C 1N2DC 5BU5A 3SWYA 1FBMA 3MD0A 3N7NA 3TSIA 3HD7B 1LTTC 2ZXEB 1XTCC 1G2CA 2L5GB 1IJDB 2KYVA 2YO2A 2O01H 2N9BA 1A02J 4EIJA 2Q9IA 2KOGA 2HPCA 1SFCA 3RK3B 2FFDC 3T97A 3RK2B 4JYCA 1M7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VRS A;  1JUN A;  4I6M C;  3HE4 B;  3NFQ A;  3HE5 B;  1MV8 A;  2P2U A;  5AVW B;  1HJB A;  2R32 A;  5APW A;  5AW3 B;  5AW1 B;  2Q5U A;  3TK1 A;  5AW5 B;  3M91 A;  3KDP B;  3M9B A;  2Q7C A;  1FAV A;  2YO3 A;  3M0D A;  5APX A;  3V4Q A;  3LID A;  1NAF A;  2Q3I A;  4LC1 A;  1HWT C;  1KQL A;  1SLQ A;  1T2K D;  1JNM A;  3NXS A;  5AW8 B;  1S9K E;  1OWA A;  2R3C A;  1CI6 B;  2YNY A;  1GTW A;  1HUC A;  3TNU A;  1OXZ A;  3L35 A;  3V5B A;  1G2C B;  1NWQ A;  4HYT B;  5APV A;  2QM8 A;  1MUU A;  1CI6 A;  5AW2 B;  2WPR A;  1IO4 A;  5AVU B;  2KP8 A;  2XZR A;  4EOT A;  3VYI A;  5AVT B;  3B8E B;  4C7N B;  3P7K A;  2R5B A;  3M06 A;  3VMY A;  3HTK A;  1T2K C;  1GD2 E;  2E42 A;  2WPS A;  3P8M C;  3VMX A;  5AVV B;  3A7O A;  1X8Y A;  2JJL A;  3O8Z A;  5AW9 B;  2P7J A;  4AYC A;  3UIA A;  3A5T A;  4C7N A;  5APQ A;  3L36 A;  1H8A A;  5CMZ A;  4AUW A;  5APS A;  2WT7 B;  5AVQ B;  2C9L Y;  3TYY A;  1FOS F;  5APU A;  5AW4 B;  1MFZ A;  2W27 A;  3KQG A;  1A02 F;  2QM7 A;  4I2L C;  3NMD A;  3V4W A;  3P32 A;  1GU5 A;  2ZFC A;  5AVR B;  2WT7 A;  3A2A A;  5AVX B;  4GKG A;  2BAS A;  4KHX A;  3VTP C;  3A3Y B;  4GT1 A;  1YYC A;  1FOS E;  2E43 A;  3IR9 A;  2Z5H A;  2WWW A;  2XU6 A;  4B86 A;  1CSB A;  3VMZ A;  5AVZ B;  3M0A A;  4JYB A;  3M9H A;  3LIE A;  3MGN A;  5AW6 B;  1GU4 A;  3L37 A;  2WPQ A;  1GK4 A;  5AVS B;  2C9N Y;  2P67 A;  1H89 A;  1J2J B;  1DH3 A;  5APY A;  1SP4 A;  2W6A A;  1H88 A;  5AVY B;  4C46 A;  3HE4 A;  1CZQ A;  2IPP A;  3NTN A;  2WTY A;  3SWF A;  4M3L A;  3TNU B;  3OAK A;  3MD0 A;  4RES B;  1S9K D;  3HE5 A;  5AW0 B;  2ZXE B;  3I5C A;  2YO2 A;  2N9B A;  2Z5I A;  1A02 J;  1GZL A;  5APT A;  2XV5 A;  4DZO A;  5AW7 B;  4XE5 B;  3T97 A;  2R5D A;  1GK6 A;  4AQR D;  4JYC A;  2H7H A;  3VN0 A;  1HBW A; 
#chains in the Genus database with same CATH topology
 2M3E A;  3AEF C;  1JUN A;  2QA4 P;  1NTK J;  1VQ5 P;  2OYH B;  4XA4 A;  3P8C E;  2Q1K A;  2N1T B;  1NTM E;  1PIX A;  2Q3E A;  3HTK B;  1ZLL A;  1LTB C;  2H89 C;  1KIL B;  1TU3 F;  2P2U A;  3NFQ A;  4PV1 B;  4UB8 H;  3B5N B;  5AVW B;  1QGK B;  1UII A;  2R32 A;  1P84 H;  4H13 D;  1RE4 C;  5APW A;  1HJB A;  2Q5U A;  4IFM A;  1E5W A;  3MUD C;  2KIK A;  4PV1 D;  1KV4 A;  5L8R J;  1IC2 A;  4RJT A;  2M5A B;  2QEX P;  2UWJ E;  2KLU A;  2NPS D;  3M9B A;  1FAV A;  5KLI B;  3M0D A;  3RL0 g;  4BRY B;  1HVV A;  1Q7Y Q;  2Q3I A;  2QIW A;  4LC1 A;  2JWD A;  2FFD B;  1EDI A;  3AEA C;  3PTZ A;  4JPZ B;  2R3C A;  2QG4 A;  4ZNC A;  2WSC J;  3V2Q A;  1GW4 A;  1LP1 B;  2YNY A;  3H1I D;  4KJM A;  2A06 E;  1HUC A;  4H0L C;  4EI2 A;  1YTZ T;  1SQV D;  1L0L J;  1KIL D;  3H1H E;  3AEE C;  1KMI Z;  3L35 A;  1VQP P;  3C1L A;  2N1T C;  3HD7 D;  5K5G B;  1G2C B;  3H1L D;  2AXT E;  1KIL C;  2XDJ A;  3KHU A;  2Y0E A;  3H32 B;  1LNQ A;  2QM8 A;  2E74 B;  3B5N C;  1CI6 A;  1NH4 A;  1ZP0 C;  2W6B A;  3F5H A;  3GW6 A;  1PP9 D;  3H1J E;  1SQV E;  3H1H D;  3OJA B;  3PH0 A;  2BCC E;  4WY4 A;  3USS A;  1AVY A;  1MZ9 A;  1SQB D;  3H1I J;  3VYI A;  5CBN A;  4EOT A;  3B8E B;  4H44 B;  1S2E A;  1ZR2 A;  3P7K A;  1RF0 A;  2PFX A;  1SQQ K;  4OGQ B;  5B5E H;  1GD2 E;  2CPS A;  1SFC B;  3OW2 O;  3IAO A;  1L4A B;  2J58 A;  1Y47 A;  1JB0 J;  3L75 G;  4K35 A;  1K73 Q;  5CCG D;  3V2P A;  2HLO A;  2P7J A;  1LT9 C;  1SS1 A;  3A5T A;  3L36 A;  4H0L B;  1SQB J;  1ZR4 A;  1H8A A;  1FS0 E;  4U7J A;  3MZW B;  3L74 E;  1VQ9 P;  4AUW A;  1BGY G;  2FXP A;  4I1L A;  3TGU E;  1XTG B;  2BCC D;  1J1D C;  1VQ4 P;  5APU A;  1PP9 E;  2M8R A;  2ZAE B;  2E76 C;  1ZXG A;  3PLN A;  3EFG A;  1EZV D;  3H1J D;  1M56 D;  2ZVN B;  2IBZ E;  4IFF A;  2A45 H;  4I2L C;  3NMD A;  5CHX A;  1G1J A;  1NOH A;  2H88 C;  5H2F H;  2JO1 A;  3C8V A;  2K9J A;  3FWL A;  1OVR A;  4KHX A;  3BCC G;  3VTP C;  3A3Y B;  5KLV G;  3ZDM A;  2I1K A;  1SFC C;  5B66 H;  1OX3 A;  2NPS A;  2FFD A;  1J1E C;  1T6A A;  4D6T G;  3H1J J;  1BE3 D;  3RK3 E;  1FZA A;  3BRV B;  1M57 D;  2JEE A;  1X9V A;  2FKW B;  1S72 P;  1FZG A;  3S9O A;  2KUB A;  2M3B A;  3L71 G;  3F89 A;  2WPQ A;  1GK4 A;  1PPJ D;  1IK7 A;  3M9Q A;  3A0H H;  3EWK A;  5KLV D;  2C9N Y;  1K9M Q;  1J2J B;  1DH3 A;  5APY A;  2E76 B;  1JCD A;  1SP4 A;  2AEM A;  1OVU A;  2LR2 A;  1RE4 A;  2IBZ I;  1ZW0 A;  1KN7 A;  1IFD A;  3W68 A;  2IPP A;  2YIU B;  3NTN A;  5KAI H;  2WTY A;  4OWF A;  1N73 B;  3CC2 P;  2B88 A;  3L73 J;  2K9Y A;  3GHG B;  1OIP A;  2GUV A;  1SFC D;  2WSE H;  3L72 E;  2WSC H;  1IK9 A;  1NTM G;  1GW3 A;  5AW0 B;  1KQF B;  2A45 G;  1SQX K;  1SQP K;  4Y99 C;  2IFM A;  3I5C A;  1AQT A;  5TIS E;  1NTK G;  1H0T A;  4L73 A;  1U57 A;  3H25 A;  1GZL A;  1RE3 A;  1USE A;  2P58 A;  5APT A;  4A7P A;  1SQQ J;  4ASW A;  3CCE P;  3Q1M A;  2WSF J;  4RO0 A;  2IYP A;  2KSE A;  2ZYD A;  2JP3 A;  4UB8 E;  3AE6 C;  2LXC B;  4I7Z C;  4AQR D;  3L70 G;  4W7Y A;  4DCK A;  3Q3D A;  3VN0 A;  3HUS C;  3CX5 I;  4TLF A;  1KQG B;  1NU1 G;  3SWK A;  1NJI Q;  1HBW A;  4W80 A;  1N7S C;  2A45 I;  3G3Z A;  4I6M C;  3G71 P;  1M8O B;  2R3S A;  1VF5 D;  3VMA A;  4IFD K;  3CCJ P;  2AEJ A;  3HE5 B;  1MKM A;  3IFM A;  5CCG A;  1ZRT D;  2BEQ D;  2V7Q H;  2B87 B;  3BCC J;  5AW1 B;  3TK1 A;  4Y99 B;  1NTZ D;  3RGU A;  1LT1 A;  3KYQ A;  3CME P;  4N78 D;  2GA1 A;  3KDP B;  1K05 A;  2Q7C A;  2O01 J;  4Y28 J;  1NTM K;  3CLQ A;  5KLV K;  2MJZ A;  1URQ D;  3H1L J;  5TJH A;  3CCL P;  1JY2 O;  1KQL A;  1HGZ A;  2OYI C;  1T3J A;  3NXS A;  1S9K E;  3AE8 C;  2AXT H;  1FE6 A;  2WIT A;  2ZT9 C;  1N73 A;  2NRG A;  3H1H J;  4WY4 D;  1W2E A;  4PD4 D;  3OA7 A;  2IYO A;  2N1T D;  4HH2 A;  1EXJ A;  1N7S B;  3GHG A;  2D2C C;  1EZV I;  4GIF A;  2HFE D;  2Z4E A;  3TGU G;  3Q5P A;  3MP7 B;  1ZRT E;  2E74 D;  2Q6Q A;  3BAS A;  1L0L G;  2FYN C;  2J59 M;  3FXD A;  3H1K E;  5APV A;  1SQP D;  2K9J B;  2FYU J;  2WPR A;  3S1K A;  1IO4 A;  2YKP A;  5AVU B;  1OFC X;  4HB1 A;  5B66 E;  1OVV A;  1OW6 A;  1M1J C;  1T3U A;  4R4M A;  4BXL A;  1RH5 B;  4C7N B;  1NTK E;  1N7L A;  1CW5 A;  1Z56 A;  2R5B A;  2BCC J;  2KS1 B;  3RL0 B;  1AA0 A;  2BEZ F;  1SQX E;  3L70 E;  3RBX A;  1EXI A;  2E42 A;  1VQ6 P;  1LT9 A;  2O01 N;  2OYI B;  3KZI H;  2HOD A;  3R4Y A;  1SQV K;  1YQ3 C;  2I8D A;  3L73 D;  3WMM 0;  1UIX A;  1LWU C;  3A7O A;  1NHL A;  1SQP J;  1X8Y A;  1JOC A;  3B71 A;  3AEG C;  3HRN A;  3KXD A;  4YPC A;  3UIA A;  2H43 A;  3CD6 P;  1KYO E;  1VQN P;  3LW5 J;  3II6 A;  1NO4 A;  2C9L Y;  5KAI E;  3TYY A;  2FY8 A;  1EDL A;  1QL1 A;  3KQG A;  3L71 D;  1RQV A;  2QM7 A;  1L2P A;  2KXP B;  1GU5 A;  1JMB A;  1SQQ D;  3WU2 H;  2B9B A;  1EDK A;  3CXH E;  4QMA A;  3FWN A;  2QJK B;  1P84 D;  2WZ7 A;  3A2A A;  5EFW B;  1L4A D;  2E75 C;  4GKG A;  5AVX B;  1USD A;  1SQB G;  2O1K A;  4LLH A;  1Q81 Q;  4N6J A;  3G6E P;  1SQQ G;  1M1K Q;  1FOS E;  3PRJ A;  2E43 A;  1VF5 C;  1H0T B;  4H44 D;  4Z1M H;  3VMZ A;  3RK2 D;  5CCH C;  2PGD A;  3VOP A;  4LGD E;  3L71 J;  3H1L G;  1NTK D;  5KLV E;  1LWU B;  3CXH H;  5GTI E;  4JYB A;  4WVZ A;  2CPB A;  3AE1 C;  3ABV C;  2OQQ A;  1S5L X;  2KLV A;  3CL3 D;  3CX5 H;  1FC2 C;  2GUS A;  3M9H A;  4JQ0 D;  4DOJ A;  2ZVO B;  4ASV A;  1NTM J;  3H1J G;  4L74 A;  3CWB J;  4OH8 B;  3RL0 D;  3CMA P;  1BE3 E;  2N1T A;  1HH0 A;  5CBO A;  2W90 A;  1KTM A;  3B5N D;  2KI7 B;  1KB9 D;  3L73 G;  1QVF O;  4D6T E;  2OTJ P;  1AQ5 A;  1FJK A;  1DD4 A;  1OMI A;  4PJ0 E;  3TGU J;  1G1I A;  1R8E A;  2E75 D;  4NPE A;  4WY4 C;  4ZKP A;  1K04 A;  1X0T A;  4M3L A;  1S5L H;  1BGY J;  3TNU B;  2AEF A;  2E75 B;  3W67 A;  2HOD B;  3KPE A;  1KC8 Q;  3I56 P;  2K3R A;  1VQK P;  1NU1 D;  4RES B;  1S9K D;  3D6Y A;  3HE5 A;  4JF7 A;  2IBZ D;  1VF5 B;  3E1I A;  3JSV C;  4AYC A;  2C0X A;  1YIT P;  1BSH A;  1L0L D;  2FBW C;  2IX7 C;  2ZJS E;  1JY2 P;  1SQX G;  4YXD C;  4ZMD A;  1WT6 A;  4C7R A;  2HPC B;  1RF1 C;  3TGU D;  5KTB A;  2KSJ A;  2Y0D A;  2Z5I A;  4PD4 H;  1QL2 A;  1SQB K;  1VL2 A;  2I1J A;  3L74 J;  2W6J H;  4DZO A;  2XV5 A;  2DW3 A;  2IDB A;  2FYU D;  3RBZ A;  1FZB A;  1S3J A;  1FU1 A;  1NU1 J;  3A0B E;  2R5D A;  4XE5 B;  5KJ7 A;  1GK6 A;  1T8Z A;  2HG5 D;  4WY4 B;  2JR8 A;  3T97 B;  1GL2 B;  4GDO A;  1L0N K;  2JDI H;  1OZH A;  2QSI A;  3GMA A;  1SQB E;  4N3Y B;  2BCC G;  1NTZ G;  1S4X A;  2D2C D;  1JY2 N;  2Y9Y A;  3BAT A;  1MV8 A;  1VDF A;  2E5Y A;  2WSS H;  1X22 A;  3HD7 C;  1N7S A;  2E74 C;  1DD3 A;  1L4A A;  1NTK K;  1YQ4 C;  1LGH B;  3JCU H;  4WBA A;  5AW3 B;  3WUT A;  4BRY A;  1LWU A;  2ZYA A;  1Y8A A;  2LKM A;  3M91 A;  3O6Q A;  3AE5 C;  3CC4 P;  5CJ0 A;  1PV3 A;  3VP8 A;  2YO3 A;  1VQ7 P;  1HTL C;  2PAJ A;  1BGY E;  2A06 D;  4OGQ C;  1NAF A;  3H1I E;  5AW9 B;  1EC5 A;  2LXB A;  1SLQ A;  1JNM A;  3RK3 C;  1HWT C;  1DIP A;  3LW5 H;  3QWO C;  2O3J A;  1URQ C;  3QH9 A;  5C39 A;  3RK2 C;  3TDK A;  5CCH D;  3CCM P;  1FZC A;  3SFE C;  1LT9 B;  1X79 B;  1GTW A;  2P1J A;  3FXE A;  1GL2 C;  3H6P A;  3TNU A;  2OYH C;  1OXZ A;  1Q86 Q;  1FZE A;  1BE3 J;  3RL0 C;  1NWQ A;  2IFN A;  3U1A A;  4PV1 C;  3CC7 P;  2PRR A;  1PPJ E;  2QRX A;  1SQV G;  3N4X A;  4OVN F;  5AW2 B;  4YTP C;  3M0D C;  4DJG A;  1NTM D;  2GM4 A;  2KP8 A;  2XZR A;  3P8C D;  1JCC A;  1QLE D;  1NVO A;  1EDJ A;  1IFP A;  3FX0 A;  3RK3 D;  3GF3 A;  3V6I A;  2WVR A;  1RE3 C;  3M06 A;  4GOD A;  1LTG C;  3HTK A;  5KLI C;  3VMY A;  1T2K C;  1ZME C;  1WRG A;  1GDT A;  1M1J A;  3JCU E;  2KNC A;  1RHZ B;  2ITA A;  3P8M C;  4JBZ A;  1J1E B;  1GL2 A;  3TF5 A;  1KD1 Q;  2K88 A;  1URQ B;  5AVV B;  4MN4 C;  1YJ9 P;  2N9Y B;  4H0L D;  3V2N A;  2OAR A;  1YHQ P;  4IL6 E;  1PPJ G;  4C7N A;  5APQ A;  2E76 D;  2OYO A;  2YMY A;  2NZ2 A;  3FGA D;  2WT7 B;  1EZV E;  3K5B A;  2OYI A;  5KKZ C;  1S5L E;  3PP5 A;  1PL5 A;  2L91 A;  1HF9 A;  3H1H G;  1EQ7 A;  1MFZ A;  1A02 F;  1HJ0 A;  3E7K A;  3L74 D;  3V4W A;  4CPG A;  3P32 A;  2KK7 A;  4U3F J;  2ZFC A;  3AEB C;  4L75 A;  2OTL P;  5KAF H;  2WQY C;  3GHG C;  5CJ4 A;  2OTK E;  3CX5 D;  4H44 C;  2BAS A;  3VP9 A;  3GLM A;  4GT1 A;  5TIS H;  1VQ8 P;  5CCG C;  3IR9 A;  4DT0 A;  2Z5H A;  3R2P A;  1KOR A;  1PGQ A;  2XU6 A;  3EQ2 A;  1L4A C;  4R4L A;  4B86 A;  5CCH A;  1EZV G;  2R44 A;  3MTU E;  5AVZ B;  1Q90 D;  3M0A A;  3CCR P;  5B5E E;  1N8R Q;  3D71 A;  4TT3 H;  1GL2 D;  2WSE J;  1FDI A;  1NTZ K;  1BGY D;  1FDO A;  2MKV A;  1IFI A;  1LTJ B;  1PP9 J;  5AW6 B;  3MGN A;  5DJU B;  3CCU P;  3H1K G;  1N86 A;  1GU4 A;  2B89 A;  4OGQ D;  5M1B A;  1J1D B;  3H1L E;  1DEB A;  1NTZ J;  5KKZ B;  1H89 A;  1BCC G;  1KFM A;  4I7Z B;  1JTH B;  1SQP G;  2FYU K;  1ZN5 A;  5AVY B;  5GTH E;  1CZQ A;  1KIL E;  2B87 A;  3AE3 C;  4PD4 I;  3V2R A;  3L74 G;  1RY3 A;  1IFM A;  4EDF A;  3SWF A;  1L0N E;  3G4S P;  1VQO P;  1YIJ P;  2QVA A;  1AVO A;  3L72 G;  3OAK A;  4D6T D;  3I55 P;  1SQX J;  1KB9 E;  3AE9 C;  2YMK A;  3HUS A;  1DEE G;  5DJT B;  1E79 H;  2ZXX A;  2XKM A;  4PJ0 H;  3GF7 A;  5H2F E;  1M90 Q;  1FDM A;  3Q2Y A;  2FYU E;  1BCC E;  3S4R A;  1FJP A;  3BCC E;  3L75 J;  1LTJ C;  3G9R A;  1RF0 C;  2QJY B;  2SPZ A;  3SFD C;  1WMK A;  1VPC A;  5AW7 B;  1K8A Q;  1NKN A;  4K3A A;  1KFN A;  3ITK A;  3AE7 C;  4EYY Q;  5BU8 B;  2NPS B;  1FZC B;  1R5S A;  4KT0 J;  1L0L E;  2YKQ A;  1L0N G;  2PP6 A;  1VQL P;  4GOF A;  4HKZ H;  1P84 E;  3MIW A;  2H7H A;  1NU1 E;  3CXH D;  2YIU C;  4XFJ A;  1N73 C;  1IFJ A;  2VRS A;  2AXC A;  1JY3 P;  3CCQ P;  2D2C B;  2JWA A;  2K1A A;  3L75 D;  1NAY A;  3CWB E;  1BSN A;  3AE2 C;  2KS1 A;  3HE4 B;  4RKU J;  4U3F G;  1GMJ A;  3SSU A;  5BVZ A;  3CI9 A;  1KZU B;  5KLV J;  3D6Z A;  1JM0 A;  5AW5 B;  3L4F A;  2RKL A;  4ZKU A;  1JY3 O;  1LP1 A;  1HGV A;  1M1J B;  1YBK A;  2O1J A;  1LTI C;  2QE7 H;  4NPD A;  3AED C;  3Q5R A;  2YKO A;  2FXM A;  3L73 E;  5APX A;  2QJY C;  3V4Q A;  1URQ A;  3LID A;  3MUD A;  1JO5 A;  1FZC C;  1JMM A;  3CXH I;  1T2K D;  2KNC B;  2NPS C;  4U3F D;  5AW8 B;  2P10 A;  1OWA A;  3AEC C;  2OYH A;  1CI6 B;  2XNX A;  3O6Q B;  3CWB G;  4YXW H;  1RF1 A;  2IZ0 A;  4BWN A;  5E79 E;  3HUS B;  3A0B H;  1AV1 A;  3BVH A;  2YXQ B;  1SQP E;  2M0B A;  3D70 A;  3WU2 E;  1SQQ E;  3V5B A;  3EFF K;  4H13 C;  4HYT B;  3IF4 A;  2M5A A;  1MUU A;  2KB7 P;  3L71 E;  3CCS P;  2G3A A;  3C9I A;  3L70 J;  2WMM A;  3CWB D;  3L75 E;  1QX8 A;  4IL6 H;  5AVT B;  3B5N A;  1KYO H;  1SQV J;  1KYO D;  3Q5S A;  1AJY A;  5GTI H;  4GOE A;  4O9B A;  2WPS A;  3HD7 A;  1YTZ I;  1NU1 K;  1YJN P;  3VMX A;  1BE3 G;  2ZT9 B;  3E1R A;  4W7Z A;  1KB9 I;  1IFN A;  2JJL A;  3O8Z A;  1FZF A;  4N78 E;  1OW8 A;  1SQX D;  3PJS K;  2C0W A;  3L70 D;  1NTZ E;  2KZJ A;  1L0N J;  1N7S D;  1Q2N A;  2WSF H;  1LTJ A;  3BCC D;  4IL6 X;  5CMZ A;  2Y0C A;  5APS A;  2IBZ G;  4WB4 A;  5KAF E;  1BCC D;  1OW7 A;  1R5L A;  5AVQ B;  1FOS F;  4H13 B;  5AW4 B;  5E79 H;  2W27 A;  2FYN B;  3H1K D;  2H8P D;  3WUU A;  2POH A;  4UB6 H;  2ZYG A;  1LTS C;  2Y9Z A;  5AVR B;  3BRT B;  3PHL A;  3CCV P;  3H32 A;  1JTH A;  2XND H;  5KJ7 D;  1L0N D;  2WT7 A;  1SVF A;  1P84 I;  1MFT A;  2KZI A;  1PFI A;  3WUV A;  1YYC A;  1BCC J;  1KIL A;  2V4H A;  2J5U A;  4PD4 E;  1QVG O;  2W8Z A;  2WWW A;  1Q82 Q;  1CSB A;  4UB6 E;  3U59 A;  1YI2 P;  3U1C A;  3H1K J;  3CPW O;  2JKV A;  1JY3 N;  1W5C E;  2YXR B;  1ZOY C;  5GTH H;  1RF1 B;  1Y9B A;  1DX7 A;  1L0L K;  1PGJ A;  1PGO A;  3KZI E;  4D6T J;  1S1C X;  2RN0 A;  3LIE A;  4HJG H;  2FXO A;  3L37 A;  1U7J A;  1ZV8 A;  2FYZ A;  5AVS B;  2IZ1 A;  2HYN A;  3MHV A;  3JC2 2;  1AFO A;  4WWI A;  2P67 A;  1NGM B;  2QJP B;  2G8Y A;  3L72 D;  2OGU A;  1JEK A;  1PP9 G;  2W6A A;  1BDC A;  1H88 A;  1NKZ B;  1RQU A;  4C46 A;  1BDD A;  3AE4 C;  3HE4 A;  1LTA C;  5KJ7 C;  2A06 G;  3CX5 E;  3GG2 A;  1N2D C;  2W83 C;  3B4S A;  5BU5 A;  1YJW P;  2E5T A;  2QJK C;  3SWY A;  1FBM A;  1PGP A;  3MD0 A;  4L76 A;  1W2B O;  3N7N A;  4U3F E;  3TSI A;  1VQM P;  3HD7 B;  3H1I G;  1KYO I;  1PZQ A;  1LTT C;  2WPV B;  2ZXE B;  3L72 J;  1XTC C;  2RH0 A;  1G2C A;  1U7M A;  2L5G B;  1IJD B;  2KYV A;  4NPF X;  2YO2 A;  1KQS O;  2O01 H;  2N9B A;  2RMZ A;  1A02 J;  2HR3 A;  2CK3 H;  4EIJ A;  1KB9 H;  1IZN B;  1QEX A;  2KOG A;  2HPC A;  2Q9I A;  1SFC A;  2V7Q J;  3RK3 B;  2FFD C;  3IN6 A;  3T97 A;  2QJP C;  1D7M A;  3RK2 B;  2ZT9 D;  1LJ2 A;  1M7L A;  4JYC A;  2FYU G;  4IOI H;  2K37 A;  3A0H E;  1NYH A; 
#chains in the Genus database with same CATH homology
 1JUN A;  2OYH B;  4XA4 A;  3P8C E;  2N1T B;  3HTK B;  1ZLL A;  3NFQ A;  1LTB C;  1KIL B;  4W7Y A;  2P2U A;  5AVW B;  3RL0 B;  3B5N B;  1HJB A;  2R32 A;  5APW A;  1RE4 C;  2Q5U A;  4IFM A;  1E5W A;  1IC2 A;  3M9B A;  2NPS D;  1FAV A;  3M0D A;  1HVV A;  2Q3I A;  4LC1 A;  2FFD B;  2R3C A;  3V2Q A;  1GW4 A;  2YNY A;  1HUC A;  1YTZ T;  1KIL D;  3L35 A;  2N1T C;  3HD7 D;  1G2C B;  1KIL C;  2XDJ A;  3H32 B;  2QM8 A;  3B5N C;  1CI6 A;  1NH4 A;  2W6B A;  3OJA B;  4WY4 A;  1MZ9 A;  4EOT A;  3VYI A;  3B8E B;  1ZR2 A;  3P7K A;  1RF0 A;  1SQQ K;  1GD2 E;  2CPS A;  1SFC B;  1L4A B;  2J58 A;  5CCG D;  3V2P A;  2HLO A;  2P7J A;  1LT9 C;  3A5T A;  3L36 A;  1H8A A;  1ZR4 A;  4AUW A;  4I1L A;  1XTG B;  1J1D C;  5APU A;  2M8R A;  3EFG A;  4IFF A;  2A45 H;  4I2L C;  3NMD A;  5CHX A;  1G1J A;  1NOH A;  4KHX A;  3VTP C;  3A3Y B;  2I1K A;  1SFC C;  2NPS A;  2FFD A;  1J1E C;  1FZA A;  3BRV B;  2JEE A;  1X9V A;  2FKW B;  1FZG A;  2M3B A;  2WPQ A;  1GK4 A;  3M9Q A;  2C9N Y;  1J2J B;  1DH3 A;  5APY A;  1JCD A;  1SP4 A;  1RE4 A;  1IFD A;  2IPP A;  3NTN A;  2WTY A;  1N73 B;  3GHG B;  2GUV A;  1SFC D;  2WSE H;  2WSC H;  1IK9 A;  1GW3 A;  5AW0 B;  2A45 G;  1SQX K;  1SQP K;  4Y99 C;  2IFM A;  3I5C A;  1GZL A;  1RE3 A;  5APT A;  4AQR D;  3VN0 A;  3HUS C;  1HBW A;  4W80 A;  1N7S C;  2A45 I;  3G3Z A;  4I6M C;  3HE5 B;  3IFM A;  5AW1 B;  3TK1 A;  4Y99 B;  3KYQ A;  4N78 D;  3KDP B;  2Q7C A;  1NTM K;  3CLQ A;  5KLV K;  2MJZ A;  1URQ D;  1JY2 O;  1KQL A;  1HGZ A;  2OYI C;  1T3J A;  3NXS A;  1S9K E;  1N73 A;  2WIT A;  4WY4 D;  1W2E A;  3OA7 A;  2N1T D;  4HH2 A;  1N7S B;  3GHG A;  2Z4E A;  4GIF A;  2HFE D;  3BAS A;  2J59 M;  5APV A;  2WPR A;  1IO4 A;  2YKP A;  5AVU B;  1M1J C;  1T3U A;  4C7N B;  1N7L A;  1CW5 A;  1Z56 A;  2R5B A;  2E42 A;  1LT9 A;  2OYI B;  2HOD A;  3WMM 0;  1SQV K;  1LWU C;  3A7O A;  1NHL A;  1X8Y A;  3HRN A;  1JOC A;  4AYC A;  2H43 A;  3UIA A;  3II6 A;  1NO4 A;  2C9L Y;  3TYY A;  1QL1 A;  3KQG A;  2QM7 A;  1GU5 A;  2WZ7 A;  1FJP A;  3A2A A;  4IFD K;  5AVX B;  1L4A D;  4GKG A;  2O1K A;  4LLH A;  4N6J A;  2E43 A;  1FOS E;  3VMZ A;  3RK2 D;  5CCH C;  3VOP A;  4LGD E;  1LWU B;  4JYB A;  2CPB A;  3CL3 D;  2KLV A;  2GUS A;  3M9H A;  4DOJ A;  4OH8 B;  3RL0 D;  2N1T A;  1HH0 A;  3B5N D;  1AQ5 A;  1FJK A;  1G1I A;  4WY4 C;  4ZKP A;  4M3L A;  3TNU B;  2HOD B;  4RES B;  1S9K D;  3HE5 A;  4JF7 A;  3E1I A;  2C0X A;  2IX7 C;  1JY2 P;  2HPC B;  1WT6 A;  4C7R A;  1RF1 C;  5KTB A;  2KSJ A;  2Z5I A;  1QL2 A;  1SQB K;  2I1J A;  4DZO A;  2XV5 A;  1FZB A;  1FU1 A;  4XE5 B;  5KJ7 A;  2R5D A;  1GK6 A;  1T8Z A;  2HG5 D;  4WY4 B;  1GL2 B;  1L0N K;  4N3Y B;  3V2R A;  1JY2 N;  3BAT A;  3KPE A;  1MV8 A;  1VDF A;  3HD7 C;  5CCG A;  1N7S A;  1L4A A;  1NTK K;  4WBA A;  1LGH B;  5AW3 B;  1LWU A;  2LKM A;  3M91 A;  5CJ0 A;  3VP8 A;  2YO3 A;  1HTL C;  2PAJ A;  1NAF A;  1HWT C;  1SLQ A;  1JNM A;  3RK3 C;  3LW5 H;  1URQ C;  3RK2 C;  5CCH D;  1FZC A;  1LT9 B;  1X79 B;  1GTW A;  2P1J A;  1GL2 C;  3H6P A;  3TNU A;  2OYH C;  1OXZ A;  1FZE A;  3RL0 C;  1NWQ A;  2IFN A;  3U1A A;  5AW2 B;  3N4X A;  3M0D C;  2GM4 A;  2KP8 A;  2XZR A;  3P8C D;  1JCC A;  3RK3 D;  3VMY A;  1RE3 C;  3M06 A;  1LTG C;  3HTK A;  1T2K C;  1WRG A;  1GDT A;  1M1J A;  3P8M C;  1J1E B;  1GL2 A;  1URQ B;  5AVV B;  3V2N A;  2OAR A;  4C7N A;  5APQ A;  2YMY A;  2WT7 B;  2OYI A;  3PP5 A;  1EQ7 A;  1MFZ A;  1A02 F;  3V4W A;  3P32 A;  2ZFC A;  3GHG C;  5CJ4 A;  3VP9 A;  2BAS A;  4GT1 A;  5CCG C;  3IR9 A;  4ZKU A;  2Z5H A;  3R2P A;  3EQ2 A;  2XU6 A;  1L4A C;  4B86 A;  3MTU E;  5AVZ B;  3M0A A;  1GL2 D;  1NTZ K;  1IFI A;  1LTJ B;  5AW6 B;  3MGN A;  1GU4 A;  1N86 A;  1J1D B;  1H89 A;  1DEB A;  1KFM A;  1JTH B;  2FYU K;  1ZN5 A;  5AVY B;  1CZQ A;  3SWF A;  1RY3 A;  1IFM A;  3OAK A;  3HUS A;  2XKM A;  1FDM A;  1LTJ C;  1RF0 C;  1VPC A;  5AW7 B;  1NKN A;  1FZC B;  1KFN A;  5BU8 B;  2NPS B;  2YKQ A;  2PP6 A;  3MIW A;  2H7H A;  1N73 C;  1IFJ A;  2VRS A;  1JY3 P;  3HE4 B;  5BVZ A;  3CI9 A;  1KZU B;  5AW5 B;  3L4F A;  1JY3 O;  1HGV A;  1M1J B;  2O1J A;  1LTI C;  2YKO A;  2FXM A;  5APX A;  3V4Q A;  1URQ A;  3LID A;  3MUD A;  1JO5 A;  1FZC C;  1JMM A;  1T2K D;  2NPS C;  5AW8 B;  1OWA A;  2OYH A;  1CI6 B;  2XNX A;  1RF1 A;  3HUS B;  3BVH A;  3V5B A;  4HYT B;  1MUU A;  2KB7 P;  3C9I A;  5AVT B;  3B5N A;  4O9B A;  2WPS A;  3HD7 A;  1YTZ I;  1NU1 K;  3VMX A;  4W7Z A;  1IFN A;  2JJL A;  3O8Z A;  1FZF A;  4N78 E;  5AW9 B;  2C0W A;  1N7S D;  5CCH A;  2WSF H;  1LTJ A;  5CMZ A;  5APS A;  4WB4 A;  5AVQ B;  1FOS F;  5AW4 B;  2W27 A;  2H8P D;  2POH A;  1LTS C;  5AVR B;  3BRT B;  3H32 A;  1JTH A;  5KJ7 D;  2WT7 A;  1SVF A;  1PFI A;  1YYC A;  1KIL A;  2WWW A;  1CSB A;  3U59 A;  3U1C A;  1JY3 N;  1RF1 B;  1DX7 A;  1L0L K;  3LIE A;  3L37 A;  1ZV8 A;  2FYZ A;  5AVS B;  2HYN A;  1AFO A;  2P67 A;  2W6A A;  1H88 A;  1NKZ B;  4C46 A;  3HE4 A;  1LTA C;  5KJ7 C;  1N2D C;  5BU5 A;  3SWY A;  1FBM A;  3MD0 A;  3N7N A;  3TSI A;  3HD7 B;  1LTT C;  2ZXE B;  1XTC C;  1G2C A;  2L5G B;  1IJD B;  2KYV A;  2YO2 A;  2O01 H;  2N9B A;  1A02 J;  4EIJ A;  2Q9I A;  2KOG A;  2HPC A;  1SFC A;  3RK3 B;  2FFD C;  3T97 A;  3RK2 B;  4JYC A;  1M7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...