1GD2E

Crystal structure of bzip transcription factor pap1 bound to dna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
DQEPSSKRKAQNRAAQRAFRKRKEDHLKALETQVVTLKELHSSTTLENDQLRQKVRQLEEELRIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the diversity of DNA recognition by bZIP transcription factors.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*GP*GP*TP*TP*AP*CP*GP*TP*AP*AP*CP*C)-3')
total genus 25
structure length 65
sequence length 65
chains with identical sequence F, G, H, I, J
ec nomenclature
pdb deposition date 2000-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gd2E00
3MD0A 1MFZA 4XE5B 3LIEA 3TNUA 1H88A 3M9HA 3LIDA 4DZOA 5AW9B 5APQA 1A02J 1FOSE 1FAVA 1H8AA 4LC1A 2XV5A 5APUA 2XZRA 1GZLA 5AW8B 3OAKA 2P2UA 5AW1B 4I2LC 5AW4B 3NFQA 3A2AA 1HJBA 5AVTB 3HE4B 2P67A 1SLQA 5AVUB 2Z5HA 2WPRA 5APXA 3M06A 2R5DA 3P32A 5APVA 4HYTB 2WPSA 1HUCA 3A3YB 2BASA 1MV8A 4B86A 2C9LY 2YO2A 3V4WA 2W27A 2QM8A 2E42A 5CMZA 3SWFA 2Q3IA 3B8EB 3VMXA 1J2JB 3HTKA 4AQRD 3T97A 3TNUB 2WWWA 1H89A 2R5BA 5AW0B 4JYCA 1JNMA 3MGNA 2ZXEB 3HE5B 5APSA 1GD2E 3KQGA 1HBWA 2R32A 2QM7A 2P7JA 2E43A 2W6AA 3VMZA 1IO4A 5AVVB 3TYYA 1A02F 3NMDA 1JUNA 1GK4A 1NWQA 2C9NY 3VTPC 1X8YA 4EOTA 3L36A 1T2KC 1GU4A 1G2CB 2WPQA 2WTYA 5AVQB 3M91A 4C46A 1CI6B 2Q5UA 2JJLA 3L35A 1OWAA 1MUUA 4KHXA 5AVZB 2IPPA 3V5BA 1OXZA 1CZQA 5AW7B 3IR9A 4C7NA 1FOSF 2WT7A 2VRSA 3A5TA 2Z5IA 3A7OA 3VMYA 5AVRB 4AUWA 3P7KA 1GK6A 1KQLA 1GTWA 1T2KD 5AW2B 2N9BA 3M0AA 3P8MC 3L37A 5AVSB 3HE4A 4JYBA 1S9KE 2Q7CA 5APWA 1SP4A 3NXSA 2YNYA 1YYCA 2YO3A 1CSBA 5AW6B 3M0DA 1DH3A 2H7HA 5APYA 4C7NB 3I5CA 3O8ZA 1S9KD 4I6MC 2KP8A 1CI6A 3UIAA 1GU5A 5AW3B 4M3LA 5AVXB 4GT1A 5AVWB 1HWTC 2R3CA 2WT7B 3KDPB 4GKGA 3V4QA 3TK1A 1NAFA 4RESB 5AW5B 2XU6A 3NTNA 4AYCA 2ZFCA 3HE5A 3M9BA 5AVYB 3VN0A 5APTA 3VYIA
chains in the Genus database with same CATH superfamily
3MD0A 2V4HA 3D6YA 1YJ9P 2KS1B 2WMMA 4U3FG 2E74B 2KOGA 1BGYE 2MKVA 3TNUA 2OQQA 3V4WA 5B5EH 1URQC 1K73Q 3H1KG 1JOCA 4RKUJ 3RL0C 5AW9B 4DZOA 3CCMP 1HGVA 2DW3A 2B87B 1N73B 1L0LK 1PP9E 1HGZA 3MZWB 3OJAB 1GMJA 5B66E 4L74A 1NTMG 1SQQE 2KLVA 2J58A 3AEFC 3WUUA 2XZRA 5KKZB 1OIPA 5CCHC 1J1DC 2QEXP 1Q81Q 1NU1K 1KB9E 3CCUP 1FBMA 1SQQK 4IFMA 3U59A 3TGUD 2ZT9C 4I2LC 3A2AA 2E75B 5KLVJ 2QJYC 3HE4B 4JF7A 4ASWA 1FZEA 2POHA 3M06A 2OYHC 2QSIA 3VMAA 1MKMA 2O1JA 3ITKA 3VMYA 1CW5A 1SQQD 1G1IA 1LTAC 4D6TJ 2C0XA 1MV8A 1PIXA 2O1KA 2WSEH 3RK3B 2C9LY 2YO2A 1JY2N 4NPFX 4BWNA 5CJ4A 1LTJC 4N6JA 2E42A 1YJNP 1GL2A 1URQB 1SQPJ 2B88A 2IBZI 1GL2C 1S4XA 1SFCC 2FYUE 2WITA 3CI9A 3CWBJ 3GLMA 1J2JB 3PTZA 1EZVE 4UB8E 3F5HA 3GMAA 3VMXA 5CCHD 5KJ7C 1FZCA 1KILB 1KILD 2A06G 3FWNA 1KC8Q 1M1JA 3IAOA 2HR3A 1L0NE 2IBZG 2WWWA 2YKQA 4R4LA 2BEQD 4JYCA 3MGNA 4N78D 4Y99B 2OTKE 1Q2NA 1X9VA 3L72D 3EFFK 2OYHB 1EDIA 2Y0DA 4XFJA 4WY4B 1IO4A 1SQXG 2IZ0A 2ZVOB 3GW6A 3VMZA 3CCVP 3TYYA 5KLVK 2B9BA 1PFIA 3Q5RA 1JUNA 5KAIE 1BDCA 3PH0A 3L73G 4WY4A 5KTBA 3PHLA 3GG2A 2KZIA 4C7RA 1T2KC 3JCUH 1G2CB 3CWBE 2Y9ZA 3M9QA 1FZGA 2A06D 4C46A 5K5GB 2Q5UA 1JMMA 1N7SD 1AVOA 1OWAA 3L35A 1FDMA 1FZBA 3C9IA 3L70D 3BCCE 4KHXA 3AE3C 2IPPA 4U3FJ 1OXZA 2M0BA 2RKLA 3RK3E 3RL0B 4C7NA 1ZR2A 3P8CD 2KIKA 2AEMA 2RH0A 2G8YA 3KZIE 3L73E 1LWUC 1DEBA 2I1JA 2H8PD 3CCEP 1SVFA 1XTCC 4IL6E 1ZLLA 1NOHA 2BCCG 1KILE 3GHGC 1VPCA 1FZCC 3Q3DA 3H1HE 2J5UA 1AA0A 3SFDC 1T2KD 1GTWA 3PLNA 3AE4C 2ITAA 3P8MC 5AVSB 4JYBA 4PJ0E 2AXTE 2ZT9D 3CPWO 3AE2C 3LW5H 2XDJA 5EFWB 1NTZD 1T3UA 3NXSA 1M57D 5CHXA 5DJUB 2YO3A 1ZW0A 3N4XA 1FDOA 3M0DA 3SFEC 3WU2H 4U3FE 3SWFA 3D71A 2H7HA 2BEZF 2ZYDA 3CXHH 2WQYC 3O8ZA 2K9JB 4NPEA 5GTIE 1SFCB 3TDKA 1BSNA 1WRGA 2KP8A 1PPJG 1PP9G 1QX8A 1KYOH 2WSCJ 5E79H 3UIAA 1LTJB 4UB8H 3CX5H 4L73A 1NTKG 1RQVA 1GU5A 1BE3E 2KNCA 3EWKA 1PGQA 5AW3B 4WY4D 3H1JE 2M5AB 1ZR4A 2AXTH 1LGHB 1SQPG 2IDBA 3S4RA 1M90Q 1EZVI 1LT9C 2NPSC 1LTGC 1VQ6P 3IFMA 1U57A 1VL2A 3V2PA 1OW8A 2QG4A 3H1IJ 2JWAA 3KDPB 3FXEA 2B87A 2YMYA 4H0LD 1EZVD 1N73A 1BGYD 1PZQA 1NKNA 1DD3A 3BRVB 3M9BA 2WSFH 3CCRP 1GL2D 1YHQP 4DJGA 3OW2O 1YJWP 1RF1A 1M1JB 3AEBC 1KMIZ 1MFZA 2FYUJ 3AECC 5CCHA 1SQBK 1BCCD 3QWOC 1Z56A 3A0HH 3M9HA 1NTZG 2KSJA 1KN7A 1VQMP 1SQBE 5APQA 1A02J 4IFDK 5CJ0A 3S1KA 1FZAA 1FAVA 1NTMJ 3EFGA 2IBZE 3HUSA 3L74G 4OH8B 2W83C 1USDA 1AVYA 1NU1G 2D2CC 2XKMA 5H2FE 5APUA 4OWFA 1S5LX 2GUVA 2WSEJ 2E76D 1Y9BA 3V2RA 1KQGB 5AW4B 1SQPD 2KSEA 1YTZI 2HPCA 2K1AA 1VQ7P 1W5CE 1PP9J 2HYNA 2GA1A 2P67A 3HD7B 2FYUD 1N86A 3AEDC 4O9BA 1JCDA 2WPRA 1SQXK 4N3YB 2N1TA 1FE6A 1L0LD 3C8VA 5APVA 3WMM0 1X0TA 1S5LE 1HUCA 1L0ND 1RH5B 1OVRA 2BASA 2WPSA 2N1TB 2E74D 3R4YA 3H25A 3BCCJ 5GTIH 3CWBG 4YTPC 4OGQB 4ZNCA 1N73C 1MFTA 1GW4A 3AE6C 4QMAA 1NU1D 1IZNB 1YQ4C 4IOIH 1KORA 2Q3IA 1PL5A 3AE7C 1JTHB 1RE4C 3HTKA 3MUDC 2IFMA 2ZAEB 5DJTB 1J1EB 3EQ2A 4AQRD 2FY8A 2ZYAA 4YXWH 3TNUB 1H89A 5AW0B 3CX5E 2QRXA 3D6ZA 2FYUG 1JNMA 3L71E 4WBAA 3RK2C 4BRYA 1HBWA 1QGKB 2A45I 2KYVA 2O3JA 2IBZD 3CCSP 1BE3J 2KK7A 2P7JA 1L0NG 3L71J 3RK2B 1OW6A 2CK3H 2W6AA 4DOJA 1LT9B 1VQ9P 1OVUA 2G3AA 1NWQA 2ZT9B 3K5BA 1N7SA 3H1KE 1E5WA 1SQBJ 2IZ1A 1N7SC 3VTPC 1OVVA 1X8YA 2B89A 3AE1C 3L36A 4RJTA 1GU4A 3SSUA 1G2CA 1BGYJ 1EDKA 3CX5D 2WTYA 4LGDE 1KYOD 1VDFA 2JJLA 4I1LA 4W80A 2PRRA 1IFJA 4KJMA 1PGPA 3RBXA 1E79H 2JP3A 3C1LA 3V5BA 5AW7B 1OMIA 3IR9A 4MN4C 1BE3G 3PJSK 1QLED 3MP7B 1DX7A 2HFED 1IJDB 2D2CB 3H1KD 2K9YA 3A7OA 1K04A 1IK9A 2JKVA 1SQVK 2LR2A 2RMZA 3W68A 2FFDA 1AQTA 3M0DC 2Y0EA 3I55P 4AUWA 1XTGB 2P58A 3L73D 1L4AD 4H44D 4PD4D 1YBKA 2FYNB 5AW2B 1P84H 2N9BA 3FX0A 3M0AA 3L37A 4IFFA 1UIXA 2H43A 1SQVD 1KFMA 4ZKPA 1GW3A 3H1JJ 1M7LA 3KYQA 2H88C 1EZVG 3L72J 1DH3A 1RE3A 2NZ2A 1SS1A 3RK3C 4C7NB 3RGUA 3B71A 3SWKA 2CPSA 2Q6QA 2OYOA 3Q1MA 4I6MC 4PD4E 1JMBA 1LNQA 1HF9A 1SQQG 4GDOA 1JY2P 3SWYA 1CI6A 1KB9D 3VOPA 1RF0C 1VF5D 2XNXA 1SQPK 3H1LG 2FXOA 1KV4A 1NU1J 4U7JA 3L74D 1NTKK 4Y99C 2NPSA 5M1BA 1QL2A 1K9MQ 2KZJA 4OGQD 4CPGA 2JWDA 2YIUB 5TJHA 1FJPA 1OFCX 1QVGO 2R3CA 1LJ2A 4HH2A 1VQ5P 1YTZT 4Y28J 3RK3D 3V4QA 3MHVA 2NPSD 3TK1A 1NAFA 3CMAP 2GUSA 2M3BA 2XU6A 3E1IA 4PD4H 3L75D 4ASVA 1BDDA 1L0NJ 5KLVD 1USEA 1SQQJ 4D6TD 2OYIB 3O6QB 2Z4EA 5TISH 4L75A 5CCGC 2GM4A 4H0LC 1TU3F 3F89A 1G1JA 3A0BE 3MIWA 2IYOA 2QJKC 4XE5B 2M5AA 3WUVA 5CCGA 3H1IG 3U1AA 1SQVE 2OYIA 3IN6A 1VQPP 1FOSE 3HUSC 2L91A 3L72E 2ZXXA 3L74J 1FZFA 3CD6P 3E7KA 4PV1C 1L4AB 4BRYB 1KTMA 1FS0E 3W67A 1ZRTE 3MTUE 2NPSB 1GZLA 2BCCJ 1SQXJ 2I1KA 4D6TG 1T6AA 2FKWB 2D2CD 3H1IE 5AW1B 3T97B 1HJBA 1PGJA 1W2EA 3G9RA 1NU1E 1JTHA 3HD7A 1M8OB 2QIWA 2Z5HA 4GOFA 3TF5A 1S5LH 2Q3EA 3H6PA 4OVNF 3H1HD 4H13D 1KQSO 2K37A 3AEAC 3CCJP 3D70A 3L70G 3H1JD 1RY3A 1M1JC 1PPJE 1SQXD 1JY2O 2M3EA 3CCLP 3HUSB 1ZRTD 3P8CE 1HVVA 1NTMK 2KI7B 2QM8A 2ZVNB 5CMZA 1Q86Q 1YITP 1EXJA 3KXDA 1EC5A 2WSCH 2K3RA 3B8EB 5KAFH 1IC2A 2KB7P 2HODA 2LKMA 3H1KJ 3G4SP 1K8AQ 1IFDA 2QJPC 1MZ9A 1L4AA 2R5BA 4I7ZC 1JEKA 5KKZC 2KUBA 1RF0A 3A0HE 3CX5I 5APSA 3RK2D 3WU2E 2Q9IA 4L76A 5KLVE 1NHLA 1LTTC 1L0LJ 2QA4P 3H1HJ 2KLUA 1HTLC 2QJYB 1JY3N 1LT9A 3H32A 2LXBA 3N7NA 4H13B 3B5NC 1GK4A 5B66H 1A02F 3HRNA 3L71D 1SQBG 4GOEA 2LXCB 1S72P 3L74E 5KJ7D 1R5LA 2WPQA 3HTKB 1N2DC 3M91A 4IL6X 2YKPA 5AVQB 1CI6B 1K05A 1NGMB 1P84E 3WUTA 1RHZB 1BE3D 2PAJA 1S3JA 3BRTB 2K9JA 2H89C 2QE7H 2YKOA 4K35A 1HH0A 5AVZB 1NTMD 3Q2YA 2W6JH 2A45H 2MJZA 3HD7D 3GHGB 1PV3A 3R2PA 2OTJP 3JSVC 2WSFJ 3S9OA 2UWJE 2VRSA 3A5TA 1LP1A 2KNCB 2ZJSE 5APXA 3B5ND 1VQ4P 3Q5PA 1RE3C 5GTHH 3B5NB 4DT0A 1Q82Q 3P7KA 4IL6H 1GK6A 3V2NA 3ABVC 4WWIA 4WY4C 1DEEG 1NTME 1IK7A 3B5NA 1H0TB 1S9KE 1FC2C 1RQUA 3HE4A 3B4SA 3G71P 2Q7CA 4N78E 1FZCB 2FYUK 1EDLA 2K88A 1SP4A 4GODA 1HJ0A 2YNYA 4PJ0H 1YYCA 5AW6B 1IFPA 2PFXA 3AE9C 2O01H 1L0NK 2P1JA 3AE5C 3L71G 5APYA 5BU8B 1ZMEC 2YXQB 1SQVG 1VQ8P 5E79E 2AEFA 1FDIA 4JBZA 2HPCB 4WVZA 5GTHE 4GIFA 4W7ZA 2N1TD 5KJ7A 2FFDB 1KB9I 2C0WA 3CL3D 3QH9A 1VF5B 3CC4P 2E5TA 1P84D 5CBOA 1X22A 1EDJA 4Z1MH 3GF3A 1LT1A 2XNDH 4M3LA 1X79B 1IFIA 1J1DB 2FBWC 5AVXB 4GT1A 5AVWB 3CC2P 4H13C 4KT0J 2JEEA 4RO0A 2OYIC 1Q7YQ 1NTZJ 1SQBD 3G6EP 1VQKP 2OARA 2WT7B 2OYHA 4GKGA 1D7MA 3CLQA 2FYNC 1JB0J 4RESB 3NTNA 2ZFCA 4NPDA 2A06E 2E76C 5AVYB 1UIIA 1SFCD 3VN0A 3A0BH 2E75D 5APTA 4H44B 1SQVJ 1ZXGA 2N1TC 3L75J 1R8EA 1M1KQ 1KFNA 1KILA 1N7LA 2YXRB 1NTKD 2O01N 5APWA 3AEEC 5KLIC 3LIEA 2JDIH 1NKZB 1SFCA 4BXLA 1H88A 1T3JA 3L75E 3CMEP 3LIDA 1LTJA 1EXIA 1H0TA 1JO5A 2E74C 3BASA 3CXHI 5H2FH 3AEGC 3KPEA 1H8AA 1GL2B 1URQA 1YQ3C 4LC1A 2XV5A 3CXHE 1KYOI 1NTKJ 3BCCG 1Y8AA 2CPBA 1PPJD 2FFDC 3HD7C 5AW8B 3USSA 3OAKA 3Q5SA 2OTLP 1W2BO 2P2UA 3L75G 3NFQA 1JM0A 4EDFA 5KLVG 5AVTB 3CCQP 3OA7A 1FJKA 2E5YA 1SLQA 2I8DA 2Y0CA 5AVUB 2W90A 1JY3O 2YIUC 1BCCG 4K3AA 1NTZK 1ZOYC 1S2EA 2R5DA 3H1LE 4OGQC 2JO1A 2RN0A 3P32A 4ZKUA 1QL1A 4HKZH 4HYTB 2FYZA 3VP8A 1AFOA 1ZP0C 3A3YB 3AE8C 4B86A 1JY3P 2L5GB 1M56D 4HB1A 1BGYG 2W27A 1LP1B 1U7MA 1Y47A 1FU1A 1NAYA 1VF5C 2KXPB 1J1EC 5KAFE 2WZ7A 1ZV8A 1L2PA 1PGOA 1JCCA 2QJKB 2SPZA 1GDTA 1OX3A 2QVAA 3L70J 5L8RJ 3T97A 1VQNP 2PP6A 1LWUB 2WSSH 3FWLA 4ZMDA 4JPZB 1AQ5A 1BCCJ 2Q1KA 1VQLP 1EQ7A 1DD4A 1U7JA 1KILC 2FXMA 2ZXEB 3HE5B 4WB4A 2O01J 3KQGA 3I56P 1GD2E 4PD4I 3U1CA 2R32A 2QM7A 2E43A 3BATA 1Q90D 3H1JG 4JQ0D 2IFNA 5AVVB 3H32B 2KS1A 2AEJA 3BCCD 3L72G 3NMDA 3RBZA 4YXDC 1NTKE 5BVZA 1YIJP 2C9NY 2HLOA 5KLIB 1DIPA 5C39A 3V6IA 4EOTA 3TGUJ 1URQD 1QVFO 4H44C 3FXDA 4A7PA 3RL0D 1RF1B 2E76B 1IFNA 4D6TE 1RF1C 3JCUE 2R44A 1N7SB 1L0LG 1MUUA 3ZDMA 4EYYQ 1LTBC 3H1LJ 1ZN5A 4PV1D 2V7QJ 3BVHA 1BSHA 2J59M 1CZQA 4UB6E 1NO4A 4HJGH 2BCCD 3II6A 1FOSF 2WT7A 2AXCA 3CWBD 1KD1Q 2PGDA 4I7ZB 1LWUA 4PV1B 3KZIH 1KB9H 1SQXE 1NTZE 1OZHA 1WMKA 2Z5IA 3PRJA 4TLFA 4TT3H 2HG5D 2JR8A 2ZYGA 1NYHA 1NVOA 2HODB 1KZUB 5AVRB 2N9YB 1AJYA 2QJPB 3H1LD 1L0LE 1WT6A 1KQLA 2IYPA 3PP5A 1S1CX 3IF4A 3JC22 3V2QA 4XA4A 1YI2P 3LW5J 3TGUG 3CC7P 1OW7A 4W7YA 1NH4A 2W8ZA 2WVRA 3H1ID 3L73J 4UB6H 2FXPA 4H0LB 3TSIA 4EIJA 2NRGA 1CSBA 3KHUA 3GHGA 3CXHD 5BU5A 2R3SA 2W6BA 3VP9A 1PP9D 3I5CA 1S9KD 1KQFB 3G3ZA 1SQPE 2P10A 2YMKA 3FGAD 1T8ZA 2A45G 3GF7A 5CCGD 1RE4A 3MUDA 5CBNA 3TGUE 2V7QH 3RL0g 2IX7C 2M8RA 4U3FD 1VQOP 1L4AC 2WPVB 1KYOE 4DCKA 5B5EE 2Y9YA 1LTSC 1R5SA 1IFMA 1LTIC 1HWTC 2BCCE 4EI2A 1QEXA 3O6QA 3L4FA 3H1HG 3L70E 5KAIH 1AV1A 2E75C 3E1RA 1BCCE 4R4MA 5AW5B 5TISE 4AYCA 3HE5A 4LLHA 1NJIQ 2OGUA 1N8RQ 4YPCA 1P84I 3VYIA
chains in the Genus database with same CATH topology
3MD0A 2KOGA 3TNUA 1URQC 1JOCA 3RL0C 5AW9B 4DZOA 1HGVA 1N73B 1L0LK 1HGZA 3OJAB 2KLVA 2J58A 2XZRA 5CCHC 1J1DC 1NU1K 1FBMA 1SQQK 4IFMA 3U59A 4I2LC 3A2AA 3HE4B 4JF7A 1FZEA 2POHA 3M06A 2OYHC 2O1JA 1CW5A 1LTAC 1G1IA 2C0XA 1MV8A 2WSEH 2O1KA 3RK3B 2C9LY 2YO2A 1JY2N 5CJ4A 1LTJC 4N6JA 2E42A 1GL2A 1URQB 1GL2C 1SFCC 3CI9A 2WITA 3SWFA 1FZGA 3VMXA 5CCHD 1J2JB 1FZCA 5KJ7C 1KILB 1KILD 1M1JA 2WWWA 2YKQA 4Y99B 4JYCA 3MGNA 4N78D 1X9VA 2OYHB 4WY4B 1IO4A 3VMZA 1PFIA 3TYYA 5KLVK 1JUNA 4WY4A 5KTBA 4C7RA 1T2KC 1G2CB 3M9QA 4C46A 3L35A 2Q5UA 1JMMA 1N7SD 1OWAA 1FDMA 1FZBA 3C9IA 4KHXA 2IPPA 1OXZA 3RL0B 4C7NA 1ZR2A 3P8CD 1LWUC 1DEBA 2I1JA 2H8PD 1SVFA 1XTCC 1ZLLA 1NOHA 1FZCC 3GHGC 1VPCA 1GTWA 1T2KD 3P8MC 5AVSB 4JYBA 3LW5H 2XDJA 5APWA 1T3UA 3NXSA 5CHXA 2YO3A 3N4XA 2H7HA 3M0DA 3O8ZA 1SFCB 2KP8A 1WRGA 3UIAA 1LTJB 1GU5A 5AW3B 4WY4D 1ZR4A 1LGHB 1LT9C 2NPSC 1LTGC 3IFMA 3V2PA 3KDPB 2YMYA 1N73A 1NKNA 3BRVB 3M9BA 2WSFH 1GL2D 1RF1A 1M1JB 1MFZA 5CCHA 1SQBK 1Z56A 3M9HA 2KSJA 5APQA 1A02J 4IFDK 5CJ0A 1FZAA 1FAVA 3EFGA 3HUSA 4OH8B 2XKMA 5APUA 2GUVA 3V2RA 5AW4B 1YTZI 2HPCA 2HYNA 2P67A 3HD7B 1N86A 4O9BA 1JCDA 2WPRA 1SQXK 4N3YB 2N1TA 3WMM0 5APVA 2WPSA 1HUCA 2BASA 2N1TB 1N73C 1GW4A 2Q3IA 1JTHB 1RE4C 3HTKA 2IFMA 1J1EB 3EQ2A 4AQRD 3TNUB 1H89A 5AW0B 1JNMA 4WBAA 1HBWA 2A45I 2KYVA 2P7JA 2W6AA 4DOJA 1LT9B 1NWQA 1N7SA 3VTPC 1E5WA 1N7SC 1X8YA 3L36A 1GU4A 1G2CA 2WTYA 4LGDE 1VDFA 2JJLA 4I1LA 4W80A 1IFJA 3V5BA 5AW7B 3IR9A 1DX7A 2HFED 1IJDB 3A7OA 1IK9A 1SQVK 2FFDA 3M0DC 4AUWA 1XTGB 1L4AD 5AW2B 2N9BA 3M0AA 3L37A 4IFFA 2H43A 1KFMA 4ZKPA 1GW3A 3KYQA 1M7LA 1DH3A 1RE3A 3RK3C 4C7NB 2CPSA 4I6MC 3SWYA 1JY2P 1CI6A 3VOPA 1RF0C 2XNXA 1SQPK 1NTKK 4Y99C 2NPSA 1QL2A 1FJPA 2R3CA 4HH2A 1YTZT 3RK3D 3V4QA 3TK1A 2NPSD 1NAFA 2GUSA 2M3BA 2XU6A 3E1IA 2OYIB 2Z4EA 5CCGC 2GM4A 1G1JA 4XE5B 3MIWA 5CCGA 3U1AA 2OYIA 1FOSE 3HUSC 1FZFA 1L4AB 3MTUE 2NPSB 1GZLA 2I1KA 2FKWB 5AW1B 1HJBA 1W2EA 1JTHA 3HD7A 2Z5HA 1AQ5A 3H6PA 1RY3A 1M1JC 1JY2O 3HUSB 3P8CE 1HVVA 1NTMK 2QM8A 5CMZA 2WSCH 3B8EB 1IC2A 2KB7P 2HODA 2LKMA 1IFDA 1MZ9A 1L4AA 2R5BA 1RF0A 5APSA 3RK2D 2Q9IA 1NHLA 1LTTC 1HTLC 3N7NA 1JY3N 1LT9A 3H32A 1A02F 3B5NC 1GK4A 3HRNA 5KJ7D 2WPQA 3HTKB 1N2DC 3M91A 5AVQB 2YKPA 1CI6B 2PAJA 3BRTB 5AVZB 2YKOA 1HH0A 2A45H 2MJZA 3HD7D 3GHGB 3R2PA 2VRSA 3A5TA 3B5ND 1RE3C 3B5NB 3P7KA 1GK6A 3V2NA 4WY4C 3B5NA 1S9KE 1FZCB 3HE4A 2Q7CA 4N78E 2FYUK 1SP4A 2YNYA 1YYCA 5AW6B 2O01H 1L0NK 2P1JA 5APYA 5BU8B 2HPCB 4GIFA 4W7ZA 2N1TD 5KJ7A 2FFDB 2C0WA 3CL3D 4M3LA 1X79B 1IFIA 1J1DB 5AVXB 4GT1A 5AVWB 2JEEA 2OYIC 2OARA 2WT7B 2OYHA 4GKGA 3CLQA 4RESB 3NTNA 2ZFCA 5AVYB 1SFCD 3VN0A 5APTA 2N1TC 1KFNA 1KILA 1N7LA 3LIEA 1NKZB 1SFCA 1H88A 1T3JA 3LIDA 1LTJA 1JO5A 3BASA 3KPEA 1H8AA 1GL2B 1URQA 4LC1A 2XV5A 2FFDC 2CPBA 3HD7C 5AW8B 3OAKA 2P2UA 3NFQA 5AVTB 3OA7A 1FJKA 3RK2B 1SLQA 5AVUB 4ZKUA 1JY3O 5APXA 1NTZK 1RF1C 2R5DA 3P32A 1QL1A 4HYTB 2FYZA 3VP8A 1AFOA 3A3YB 4B86A 1JY3P 2L5GB 3V4WA 2W27A 1FU1A 1J1EC 2WZ7A 1ZV8A 1JCCA 1GDTA 3T97A 2PP6A 1LWUB 1EQ7A 2ZXEB 1KILC 2FXMA 3HE5B 4WB4A 1GD2E 3KQGA 3U1CA 2R32A 2QM7A 2E43A 3BATA 3RK2C 2IFNA 5AVVB 3H32B 3NMDA 5BVZA 2C9NY 2HLOA 4EOTA 1URQD 3RL0D 1RF1B 1IFNA 1N7SB 1MUUA 3BVHA 1LTBC 1ZN5A 2J59M 1CZQA 1NO4A 3II6A 1FOSF 2WT7A 1LWUA 2Z5IA 3VMYA 2HG5D 5AVRB 2HODB 1KZUB 1WT6A 1KQLA 3PP5A 3V2QA 4XA4A 4W7YA 1NH4A 4EIJA 3TSIA 1CSBA 3GHGA 5BU5A 2W6BA 3VP9A 3I5CA 1S9KD 3G3ZA 1T8ZA 2A45G 5CCGD 1RE4A 3MUDA 2IX7C 2M8RA 1L4AC 1LTSC 1IFMA 1LTIC 1HWTC 3L4FA 5AW5B 4AYCA 3HE5A 4LLHA 3VYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MD0 A;  1MFZ A;  4XE5 B;  3LIE A;  3TNU A;  1H88 A;  3M9H A;  3LID A;  4DZO A;  5AW9 B;  5APQ A;  1A02 J;  1FOS E;  1FAV A;  1H8A A;  4LC1 A;  2XV5 A;  5APU A;  2XZR A;  1GZL A;  5AW8 B;  3OAK A;  2P2U A;  5AW1 B;  4I2L C;  5AW4 B;  3NFQ A;  3A2A A;  1HJB A;  5AVT B;  3HE4 B;  2P67 A;  1SLQ A;  5AVU B;  2Z5H A;  2WPR A;  5APX A;  3M06 A;  2R5D A;  3P32 A;  5APV A;  4HYT B;  2WPS A;  1HUC A;  3A3Y B;  2BAS A;  1MV8 A;  4B86 A;  2C9L Y;  2YO2 A;  3V4W A;  2W27 A;  2QM8 A;  2E42 A;  5CMZ A;  3SWF A;  2Q3I A;  3B8E B;  3VMX A;  1J2J B;  3HTK A;  4AQR D;  3T97 A;  3TNU B;  2WWW A;  1H89 A;  2R5B A;  5AW0 B;  4JYC A;  1JNM A;  3MGN A;  2ZXE B;  3HE5 B;  5APS A;  1GD2 E;  3KQG A;  1HBW A;  2R32 A;  2QM7 A;  2P7J A;  2E43 A;  2W6A A;  3VMZ A;  1IO4 A;  5AVV B;  3TYY A;  1A02 F;  3NMD A;  1JUN A;  1GK4 A;  1NWQ A;  2C9N Y;  3VTP C;  1X8Y A;  4EOT A;  3L36 A;  1T2K C;  1GU4 A;  1G2C B;  2WPQ A;  2WTY A;  5AVQ B;  3M91 A;  4C46 A;  1CI6 B;  2Q5U A;  2JJL A;  3L35 A;  1OWA A;  1MUU A;  4KHX A;  5AVZ B;  2IPP A;  3V5B A;  1OXZ A;  1CZQ A;  5AW7 B;  3IR9 A;  4C7N A;  1FOS F;  2WT7 A;  2VRS A;  3A5T A;  2Z5I A;  3A7O A;  3VMY A;  5AVR B;  4AUW A;  3P7K A;  1GK6 A;  1KQL A;  1GTW A;  1T2K D;  5AW2 B;  2N9B A;  3M0A A;  3P8M C;  3L37 A;  5AVS B;  3HE4 A;  4JYB A;  1S9K E;  2Q7C A;  5APW A;  1SP4 A;  3NXS A;  2YNY A;  1YYC A;  2YO3 A;  1CSB A;  5AW6 B;  3M0D A;  1DH3 A;  2H7H A;  5APY A;  4C7N B;  3I5C A;  3O8Z A;  1S9K D;  4I6M C;  2KP8 A;  1CI6 A;  3UIA A;  1GU5 A;  5AW3 B;  4M3L A;  5AVX B;  4GT1 A;  5AVW B;  1HWT C;  2R3C A;  2WT7 B;  3KDP B;  4GKG A;  3V4Q A;  3TK1 A;  1NAF A;  4RES B;  5AW5 B;  2XU6 A;  3NTN A;  4AYC A;  2ZFC A;  3HE5 A;  3M9B A;  5AVY B;  3VN0 A;  5APT A;  3VYI A; 
#chains in the Genus database with same CATH topology
 3MD0 A;  2V4H A;  3D6Y A;  1YJ9 P;  2KS1 B;  2WMM A;  4U3F G;  2E74 B;  2KOG A;  1BGY E;  2MKV A;  3TNU A;  2OQQ A;  3V4W A;  5B5E H;  1URQ C;  1K73 Q;  3H1K G;  1JOC A;  4RKU J;  3RL0 C;  5AW9 B;  4DZO A;  3CCM P;  1HGV A;  2DW3 A;  2B87 B;  1N73 B;  1L0L K;  1PP9 E;  1HGZ A;  3MZW B;  3OJA B;  1GMJ A;  5B66 E;  4L74 A;  1NTM G;  1SQQ E;  2KLV A;  2J58 A;  3AEF C;  3WUU A;  2XZR A;  5KKZ B;  1OIP A;  5CCH C;  1J1D C;  2QEX P;  1Q81 Q;  1NU1 K;  1KB9 E;  3CCU P;  1FBM A;  1SQQ K;  4IFM A;  3U59 A;  3TGU D;  2ZT9 C;  4I2L C;  3A2A A;  2E75 B;  5KLV J;  2QJY C;  3HE4 B;  4JF7 A;  4ASW A;  1FZE A;  2POH A;  3M06 A;  2OYH C;  2QSI A;  3VMA A;  1MKM A;  2O1J A;  3ITK A;  3VMY A;  1CW5 A;  1SQQ D;  1G1I A;  1LTA C;  4D6T J;  2C0X A;  1MV8 A;  1PIX A;  2O1K A;  2WSE H;  3RK3 B;  2C9L Y;  2YO2 A;  1JY2 N;  4NPF X;  4BWN A;  5CJ4 A;  1LTJ C;  4N6J A;  2E42 A;  1YJN P;  1GL2 A;  1URQ B;  1SQP J;  2B88 A;  2IBZ I;  1GL2 C;  1S4X A;  1SFC C;  2FYU E;  2WIT A;  3CI9 A;  3CWB J;  3GLM A;  1J2J B;  3PTZ A;  1EZV E;  4UB8 E;  3F5H A;  3GMA A;  3VMX A;  5CCH D;  5KJ7 C;  1FZC A;  1KIL B;  1KIL D;  2A06 G;  3FWN A;  1KC8 Q;  1M1J A;  3IAO A;  2HR3 A;  1L0N E;  2IBZ G;  2WWW A;  2YKQ A;  4R4L A;  2BEQ D;  4JYC A;  3MGN A;  4N78 D;  4Y99 B;  2OTK E;  1Q2N A;  1X9V A;  3L72 D;  3EFF K;  2OYH B;  1EDI A;  2Y0D A;  4XFJ A;  4WY4 B;  1IO4 A;  1SQX G;  2IZ0 A;  2ZVO B;  3GW6 A;  3VMZ A;  3CCV P;  3TYY A;  5KLV K;  2B9B A;  1PFI A;  3Q5R A;  1JUN A;  5KAI E;  1BDC A;  3PH0 A;  3L73 G;  4WY4 A;  5KTB A;  3PHL A;  3GG2 A;  2KZI A;  4C7R A;  1T2K C;  3JCU H;  1G2C B;  3CWB E;  2Y9Z A;  3M9Q A;  1FZG A;  2A06 D;  4C46 A;  5K5G B;  2Q5U A;  1JMM A;  1N7S D;  1AVO A;  1OWA A;  3L35 A;  1FDM A;  1FZB A;  3C9I A;  3L70 D;  3BCC E;  4KHX A;  3AE3 C;  2IPP A;  4U3F J;  1OXZ A;  2M0B A;  2RKL A;  3RK3 E;  3RL0 B;  4C7N A;  1ZR2 A;  3P8C D;  2KIK A;  2AEM A;  2RH0 A;  2G8Y A;  3KZI E;  3L73 E;  1LWU C;  1DEB A;  2I1J A;  2H8P D;  3CCE P;  1SVF A;  1XTC C;  4IL6 E;  1ZLL A;  1NOH A;  2BCC G;  1KIL E;  3GHG C;  1VPC A;  1FZC C;  3Q3D A;  3H1H E;  2J5U A;  1AA0 A;  3SFD C;  1T2K D;  1GTW A;  3PLN A;  3AE4 C;  2ITA A;  3P8M C;  5AVS B;  4JYB A;  4PJ0 E;  2AXT E;  2ZT9 D;  3CPW O;  3AE2 C;  3LW5 H;  2XDJ A;  5EFW B;  1NTZ D;  1T3U A;  3NXS A;  1M57 D;  5CHX A;  5DJU B;  2YO3 A;  1ZW0 A;  3N4X A;  1FDO A;  3M0D A;  3SFE C;  3WU2 H;  4U3F E;  3SWF A;  3D71 A;  2H7H A;  2BEZ F;  2ZYD A;  3CXH H;  2WQY C;  3O8Z A;  2K9J B;  4NPE A;  5GTI E;  1SFC B;  3TDK A;  1BSN A;  1WRG A;  2KP8 A;  1PPJ G;  1PP9 G;  1QX8 A;  1KYO H;  2WSC J;  5E79 H;  3UIA A;  1LTJ B;  4UB8 H;  3CX5 H;  4L73 A;  1NTK G;  1RQV A;  1GU5 A;  1BE3 E;  2KNC A;  3EWK A;  1PGQ A;  5AW3 B;  4WY4 D;  3H1J E;  2M5A B;  1ZR4 A;  2AXT H;  1LGH B;  1SQP G;  2IDB A;  3S4R A;  1M90 Q;  1EZV I;  1LT9 C;  2NPS C;  1LTG C;  1VQ6 P;  3IFM A;  1U57 A;  1VL2 A;  3V2P A;  1OW8 A;  2QG4 A;  3H1I J;  2JWA A;  3KDP B;  3FXE A;  2B87 A;  2YMY A;  4H0L D;  1EZV D;  1N73 A;  1BGY D;  1PZQ A;  1NKN A;  1DD3 A;  3BRV B;  3M9B A;  2WSF H;  3CCR P;  1GL2 D;  1YHQ P;  4DJG A;  3OW2 O;  1YJW P;  1RF1 A;  1M1J B;  3AEB C;  1KMI Z;  1MFZ A;  2FYU J;  3AEC C;  5CCH A;  1SQB K;  1BCC D;  3QWO C;  1Z56 A;  3A0H H;  3M9H A;  1NTZ G;  2KSJ A;  1KN7 A;  1VQM P;  1SQB E;  5APQ A;  1A02 J;  4IFD K;  5CJ0 A;  3S1K A;  1FZA A;  1FAV A;  1NTM J;  3EFG A;  2IBZ E;  3HUS A;  3L74 G;  4OH8 B;  2W83 C;  1USD A;  1AVY A;  1NU1 G;  2D2C C;  2XKM A;  5H2F E;  5APU A;  4OWF A;  1S5L X;  2GUV A;  2WSE J;  2E76 D;  1Y9B A;  3V2R A;  1KQG B;  5AW4 B;  1SQP D;  2KSE A;  1YTZ I;  2HPC A;  2K1A A;  1VQ7 P;  1W5C E;  1PP9 J;  2HYN A;  2GA1 A;  2P67 A;  3HD7 B;  2FYU D;  1N86 A;  3AED C;  4O9B A;  1JCD A;  2WPR A;  1SQX K;  4N3Y B;  2N1T A;  1FE6 A;  1L0L D;  3C8V A;  5APV A;  3WMM 0;  1X0T A;  1S5L E;  1HUC A;  1L0N D;  1RH5 B;  1OVR A;  2BAS A;  2WPS A;  2N1T B;  2E74 D;  3R4Y A;  3H25 A;  3BCC J;  5GTI H;  3CWB G;  4YTP C;  4OGQ B;  4ZNC A;  1N73 C;  1MFT A;  1GW4 A;  3AE6 C;  4QMA A;  1NU1 D;  1IZN B;  1YQ4 C;  4IOI H;  1KOR A;  2Q3I A;  1PL5 A;  3AE7 C;  1JTH B;  1RE4 C;  3HTK A;  3MUD C;  2IFM A;  2ZAE B;  5DJT B;  1J1E B;  3EQ2 A;  4AQR D;  2FY8 A;  2ZYA A;  4YXW H;  3TNU B;  1H89 A;  5AW0 B;  3CX5 E;  2QRX A;  3D6Z A;  2FYU G;  1JNM A;  3L71 E;  4WBA A;  3RK2 C;  4BRY A;  1HBW A;  1QGK B;  2A45 I;  2KYV A;  2O3J A;  2IBZ D;  3CCS P;  1BE3 J;  2KK7 A;  2P7J A;  1L0N G;  3L71 J;  3RK2 B;  1OW6 A;  2CK3 H;  2W6A A;  4DOJ A;  1LT9 B;  1VQ9 P;  1OVU A;  2G3A A;  1NWQ A;  2ZT9 B;  3K5B A;  1N7S A;  3H1K E;  1E5W A;  1SQB J;  2IZ1 A;  1N7S C;  3VTP C;  1OVV A;  1X8Y A;  2B89 A;  3AE1 C;  3L36 A;  4RJT A;  1GU4 A;  3SSU A;  1G2C A;  1BGY J;  1EDK A;  3CX5 D;  2WTY A;  4LGD E;  1KYO D;  1VDF A;  2JJL A;  4I1L A;  4W80 A;  2PRR A;  1IFJ A;  4KJM A;  1PGP A;  3RBX A;  1E79 H;  2JP3 A;  3C1L A;  3V5B A;  5AW7 B;  1OMI A;  3IR9 A;  4MN4 C;  1BE3 G;  3PJS K;  1QLE D;  3MP7 B;  1DX7 A;  2HFE D;  1IJD B;  2D2C B;  3H1K D;  2K9Y A;  3A7O A;  1K04 A;  1IK9 A;  2JKV A;  1SQV K;  2LR2 A;  2RMZ A;  3W68 A;  2FFD A;  1AQT A;  3M0D C;  2Y0E A;  3I55 P;  4AUW A;  1XTG B;  2P58 A;  3L73 D;  1L4A D;  4H44 D;  4PD4 D;  1YBK A;  2FYN B;  5AW2 B;  1P84 H;  2N9B A;  3FX0 A;  3M0A A;  3L37 A;  4IFF A;  1UIX A;  2H43 A;  1SQV D;  1KFM A;  4ZKP A;  1GW3 A;  3H1J J;  1M7L A;  3KYQ A;  2H88 C;  1EZV G;  3L72 J;  1DH3 A;  1RE3 A;  2NZ2 A;  1SS1 A;  3RK3 C;  4C7N B;  3RGU A;  3B71 A;  3SWK A;  2CPS A;  2Q6Q A;  2OYO A;  3Q1M A;  4I6M C;  4PD4 E;  1JMB A;  1LNQ A;  1HF9 A;  1SQQ G;  4GDO A;  1JY2 P;  3SWY A;  1CI6 A;  1KB9 D;  3VOP A;  1RF0 C;  1VF5 D;  2XNX A;  1SQP K;  3H1L G;  2FXO A;  1KV4 A;  1NU1 J;  4U7J A;  3L74 D;  1NTK K;  4Y99 C;  2NPS A;  5M1B A;  1QL2 A;  1K9M Q;  2KZJ A;  4OGQ D;  4CPG A;  2JWD A;  2YIU B;  5TJH A;  1FJP A;  1OFC X;  1QVG O;  2R3C A;  1LJ2 A;  4HH2 A;  1VQ5 P;  1YTZ T;  4Y28 J;  3RK3 D;  3V4Q A;  3MHV A;  2NPS D;  3TK1 A;  1NAF A;  3CMA P;  2GUS A;  2M3B A;  2XU6 A;  3E1I A;  4PD4 H;  3L75 D;  4ASV A;  1BDD A;  1L0N J;  5KLV D;  1USE A;  1SQQ J;  4D6T D;  2OYI B;  3O6Q B;  2Z4E A;  5TIS H;  4L75 A;  5CCG C;  2GM4 A;  4H0L C;  1TU3 F;  3F89 A;  1G1J A;  3A0B E;  3MIW A;  2IYO A;  2QJK C;  4XE5 B;  2M5A A;  3WUV A;  5CCG A;  3H1I G;  3U1A A;  1SQV E;  2OYI A;  3IN6 A;  1VQP P;  1FOS E;  3HUS C;  2L91 A;  3L72 E;  2ZXX A;  3L74 J;  1FZF A;  3CD6 P;  3E7K A;  4PV1 C;  1L4A B;  4BRY B;  1KTM A;  1FS0 E;  3W67 A;  1ZRT E;  3MTU E;  2NPS B;  1GZL A;  2BCC J;  1SQX J;  2I1K A;  4D6T G;  1T6A A;  2FKW B;  2D2C D;  3H1I E;  5AW1 B;  3T97 B;  1HJB A;  1PGJ A;  1W2E A;  3G9R A;  1NU1 E;  1JTH A;  3HD7 A;  1M8O B;  2QIW A;  2Z5H A;  4GOF A;  3TF5 A;  1S5L H;  2Q3E A;  3H6P A;  4OVN F;  3H1H D;  4H13 D;  1KQS O;  2K37 A;  3AEA C;  3CCJ P;  3D70 A;  3L70 G;  3H1J D;  1RY3 A;  1M1J C;  1PPJ E;  1SQX D;  1JY2 O;  2M3E A;  3CCL P;  3HUS B;  1ZRT D;  3P8C E;  1HVV A;  1NTM K;  2KI7 B;  2QM8 A;  2ZVN B;  5CMZ A;  1Q86 Q;  1YIT P;  1EXJ A;  3KXD A;  1EC5 A;  2WSC H;  2K3R A;  3B8E B;  5KAF H;  1IC2 A;  2KB7 P;  2HOD A;  2LKM A;  3H1K J;  3G4S P;  1K8A Q;  1IFD A;  2QJP C;  1MZ9 A;  1L4A A;  2R5B A;  4I7Z C;  1JEK A;  5KKZ C;  2KUB A;  1RF0 A;  3A0H E;  3CX5 I;  5APS A;  3RK2 D;  3WU2 E;  2Q9I A;  4L76 A;  5KLV E;  1NHL A;  1LTT C;  1L0L J;  2QA4 P;  3H1H J;  2KLU A;  1HTL C;  2QJY B;  1JY3 N;  1LT9 A;  3H32 A;  2LXB A;  3N7N A;  4H13 B;  3B5N C;  1GK4 A;  5B66 H;  1A02 F;  3HRN A;  3L71 D;  1SQB G;  4GOE A;  2LXC B;  1S72 P;  3L74 E;  5KJ7 D;  1R5L A;  2WPQ A;  3HTK B;  1N2D C;  3M91 A;  4IL6 X;  2YKP A;  5AVQ B;  1CI6 B;  1K05 A;  1NGM B;  1P84 E;  3WUT A;  1RHZ B;  1BE3 D;  2PAJ A;  1S3J A;  3BRT B;  2K9J A;  2H89 C;  2QE7 H;  2YKO A;  4K35 A;  1HH0 A;  5AVZ B;  1NTM D;  3Q2Y A;  2W6J H;  2A45 H;  2MJZ A;  3HD7 D;  3GHG B;  1PV3 A;  3R2P A;  2OTJ P;  3JSV C;  2WSF J;  3S9O A;  2UWJ E;  2VRS A;  3A5T A;  1LP1 A;  2KNC B;  2ZJS E;  5APX A;  3B5N D;  1VQ4 P;  3Q5P A;  1RE3 C;  5GTH H;  3B5N B;  4DT0 A;  1Q82 Q;  3P7K A;  4IL6 H;  1GK6 A;  3V2N A;  3ABV C;  4WWI A;  4WY4 C;  1DEE G;  1NTM E;  1IK7 A;  3B5N A;  1H0T B;  1S9K E;  1FC2 C;  1RQU A;  3HE4 A;  3B4S A;  3G71 P;  2Q7C A;  4N78 E;  1FZC B;  2FYU K;  1EDL A;  2K88 A;  1SP4 A;  4GOD A;  1HJ0 A;  2YNY A;  4PJ0 H;  1YYC A;  5AW6 B;  1IFP A;  2PFX A;  3AE9 C;  2O01 H;  1L0N K;  2P1J A;  3AE5 C;  3L71 G;  5APY A;  5BU8 B;  1ZME C;  2YXQ B;  1SQV G;  1VQ8 P;  5E79 E;  2AEF A;  1FDI A;  4JBZ A;  2HPC B;  4WVZ A;  5GTH E;  4GIF A;  4W7Z A;  2N1T D;  5KJ7 A;  2FFD B;  1KB9 I;  2C0W A;  3CL3 D;  3QH9 A;  1VF5 B;  3CC4 P;  2E5T A;  1P84 D;  5CBO A;  1X22 A;  1EDJ A;  4Z1M H;  3GF3 A;  1LT1 A;  2XND H;  4M3L A;  1X79 B;  1IFI A;  1J1D B;  2FBW C;  5AVX B;  4GT1 A;  5AVW B;  3CC2 P;  4H13 C;  4KT0 J;  2JEE A;  4RO0 A;  2OYI C;  1Q7Y Q;  1NTZ J;  1SQB D;  3G6E P;  1VQK P;  2OAR A;  2WT7 B;  2OYH A;  4GKG A;  1D7M A;  3CLQ A;  2FYN C;  1JB0 J;  4RES B;  3NTN A;  2ZFC A;  4NPD A;  2A06 E;  2E76 C;  5AVY B;  1UII A;  1SFC D;  3VN0 A;  3A0B H;  2E75 D;  5APT A;  4H44 B;  1SQV J;  1ZXG A;  2N1T C;  3L75 J;  1R8E A;  1M1K Q;  1KFN A;  1KIL A;  1N7L A;  2YXR B;  1NTK D;  2O01 N;  5APW A;  3AEE C;  5KLI C;  3LIE A;  2JDI H;  1NKZ B;  1SFC A;  4BXL A;  1H88 A;  1T3J A;  3L75 E;  3CME P;  3LID A;  1LTJ A;  1EXI A;  1H0T A;  1JO5 A;  2E74 C;  3BAS A;  3CXH I;  5H2F H;  3AEG C;  3KPE A;  1H8A A;  1GL2 B;  1URQ A;  1YQ3 C;  4LC1 A;  2XV5 A;  3CXH E;  1KYO I;  1NTK J;  3BCC G;  1Y8A A;  2CPB A;  1PPJ D;  2FFD C;  3HD7 C;  5AW8 B;  3USS A;  3OAK A;  3Q5S A;  2OTL P;  1W2B O;  2P2U A;  3L75 G;  3NFQ A;  1JM0 A;  4EDF A;  5KLV G;  5AVT B;  3CCQ P;  3OA7 A;  1FJK A;  2E5Y A;  1SLQ A;  2I8D A;  2Y0C A;  5AVU B;  2W90 A;  1JY3 O;  2YIU C;  1BCC G;  4K3A A;  1NTZ K;  1ZOY C;  1S2E A;  2R5D A;  3H1L E;  4OGQ C;  2JO1 A;  2RN0 A;  3P32 A;  4ZKU A;  1QL1 A;  4HKZ H;  4HYT B;  2FYZ A;  3VP8 A;  1AFO A;  1ZP0 C;  3A3Y B;  3AE8 C;  4B86 A;  1JY3 P;  2L5G B;  1M56 D;  4HB1 A;  1BGY G;  2W27 A;  1LP1 B;  1U7M A;  1Y47 A;  1FU1 A;  1NAY A;  1VF5 C;  2KXP B;  1J1E C;  5KAF E;  2WZ7 A;  1ZV8 A;  1L2P A;  1PGO A;  1JCC A;  2QJK B;  2SPZ A;  1GDT A;  1OX3 A;  2QVA A;  3L70 J;  5L8R J;  3T97 A;  1VQN P;  2PP6 A;  1LWU B;  2WSS H;  3FWL A;  4ZMD A;  4JPZ B;  1AQ5 A;  1BCC J;  2Q1K A;  1VQL P;  1EQ7 A;  1DD4 A;  1U7J A;  1KIL C;  2FXM A;  2ZXE B;  3HE5 B;  4WB4 A;  2O01 J;  3KQG A;  3I56 P;  1GD2 E;  4PD4 I;  3U1C A;  2R32 A;  2QM7 A;  2E43 A;  3BAT A;  1Q90 D;  3H1J G;  4JQ0 D;  2IFN A;  5AVV B;  3H32 B;  2KS1 A;  2AEJ A;  3BCC D;  3L72 G;  3NMD A;  3RBZ A;  4YXD C;  1NTK E;  5BVZ A;  1YIJ P;  2C9N Y;  2HLO A;  5KLI B;  1DIP A;  5C39 A;  3V6I A;  4EOT A;  3TGU J;  1URQ D;  1QVF O;  4H44 C;  3FXD A;  4A7P A;  3RL0 D;  1RF1 B;  2E76 B;  1IFN A;  4D6T E;  1RF1 C;  3JCU E;  2R44 A;  1N7S B;  1L0L G;  1MUU A;  3ZDM A;  4EYY Q;  1LTB C;  3H1L J;  1ZN5 A;  4PV1 D;  2V7Q J;  3BVH A;  1BSH A;  2J59 M;  1CZQ A;  4UB6 E;  1NO4 A;  4HJG H;  2BCC D;  3II6 A;  1FOS F;  2WT7 A;  2AXC A;  3CWB D;  1KD1 Q;  2PGD A;  4I7Z B;  1LWU A;  4PV1 B;  3KZI H;  1KB9 H;  1SQX E;  1NTZ E;  1OZH A;  1WMK A;  2Z5I A;  3PRJ A;  4TLF A;  4TT3 H;  2HG5 D;  2JR8 A;  2ZYG A;  1NYH A;  1NVO A;  2HOD B;  1KZU B;  5AVR B;  2N9Y B;  1AJY A;  2QJP B;  3H1L D;  1L0L E;  1WT6 A;  1KQL A;  2IYP A;  3PP5 A;  1S1C X;  3IF4 A;  3JC2 2;  3V2Q A;  4XA4 A;  1YI2 P;  3LW5 J;  3TGU G;  3CC7 P;  1OW7 A;  4W7Y A;  1NH4 A;  2W8Z A;  2WVR A;  3H1I D;  3L73 J;  4UB6 H;  2FXP A;  4H0L B;  3TSI A;  4EIJ A;  2NRG A;  1CSB A;  3KHU A;  3GHG A;  3CXH D;  5BU5 A;  2R3S A;  2W6B A;  3VP9 A;  1PP9 D;  3I5C A;  1S9K D;  1KQF B;  3G3Z A;  1SQP E;  2P10 A;  2YMK A;  3FGA D;  1T8Z A;  2A45 G;  3GF7 A;  5CCG D;  1RE4 A;  3MUD A;  5CBN A;  3TGU E;  2V7Q H;  3RL0 g;  2IX7 C;  2M8R A;  4U3F D;  1VQO P;  1L4A C;  2WPV B;  1KYO E;  4DCK A;  5B5E E;  2Y9Y A;  1LTS C;  1R5S A;  1IFM A;  1LTI C;  1HWT C;  2BCC E;  4EI2 A;  1QEX A;  3O6Q A;  3L4F A;  3H1H G;  3L70 E;  5KAI H;  1AV1 A;  2E75 C;  3E1R A;  1BCC E;  4R4M A;  5AW5 B;  5TIS E;  4AYC A;  3HE5 A;  4LLH A;  1NJI Q;  2OGU A;  1N8R Q;  4YPC A;  1P84 I;  3VYI A; 
#chains in the Genus database with same CATH homology
 3MD0 A;  2KOG A;  3TNU A;  1URQ C;  1JOC A;  3RL0 C;  5AW9 B;  4DZO A;  1HGV A;  1N73 B;  1L0L K;  1HGZ A;  3OJA B;  2KLV A;  2J58 A;  2XZR A;  5CCH C;  1J1D C;  1NU1 K;  1FBM A;  1SQQ K;  4IFM A;  3U59 A;  4I2L C;  3A2A A;  3HE4 B;  4JF7 A;  1FZE A;  2POH A;  3M06 A;  2OYH C;  2O1J A;  1CW5 A;  1LTA C;  1G1I A;  2C0X A;  1MV8 A;  2WSE H;  2O1K A;  3RK3 B;  2C9L Y;  2YO2 A;  1JY2 N;  5CJ4 A;  1LTJ C;  4N6J A;  2E42 A;  1GL2 A;  1URQ B;  1GL2 C;  1SFC C;  3CI9 A;  2WIT A;  3SWF A;  1FZG A;  3VMX A;  5CCH D;  1J2J B;  1FZC A;  5KJ7 C;  1KIL B;  1KIL D;  1M1J A;  2WWW A;  2YKQ A;  4Y99 B;  4JYC A;  3MGN A;  4N78 D;  1X9V A;  2OYH B;  4WY4 B;  1IO4 A;  3VMZ A;  1PFI A;  3TYY A;  5KLV K;  1JUN A;  4WY4 A;  5KTB A;  4C7R A;  1T2K C;  1G2C B;  3M9Q A;  4C46 A;  3L35 A;  2Q5U A;  1JMM A;  1N7S D;  1OWA A;  1FDM A;  1FZB A;  3C9I A;  4KHX A;  2IPP A;  1OXZ A;  3RL0 B;  4C7N A;  1ZR2 A;  3P8C D;  1LWU C;  1DEB A;  2I1J A;  2H8P D;  1SVF A;  1XTC C;  1ZLL A;  1NOH A;  1FZC C;  3GHG C;  1VPC A;  1GTW A;  1T2K D;  3P8M C;  5AVS B;  4JYB A;  3LW5 H;  2XDJ A;  5APW A;  1T3U A;  3NXS A;  5CHX A;  2YO3 A;  3N4X A;  2H7H A;  3M0D A;  3O8Z A;  1SFC B;  2KP8 A;  1WRG A;  3UIA A;  1LTJ B;  1GU5 A;  5AW3 B;  4WY4 D;  1ZR4 A;  1LGH B;  1LT9 C;  2NPS C;  1LTG C;  3IFM A;  3V2P A;  3KDP B;  2YMY A;  1N73 A;  1NKN A;  3BRV B;  3M9B A;  2WSF H;  1GL2 D;  1RF1 A;  1M1J B;  1MFZ A;  5CCH A;  1SQB K;  1Z56 A;  3M9H A;  2KSJ A;  5APQ A;  1A02 J;  4IFD K;  5CJ0 A;  1FZA A;  1FAV A;  3EFG A;  3HUS A;  4OH8 B;  2XKM A;  5APU A;  2GUV A;  3V2R A;  5AW4 B;  1YTZ I;  2HPC A;  2HYN A;  2P67 A;  3HD7 B;  1N86 A;  4O9B A;  1JCD A;  2WPR A;  1SQX K;  4N3Y B;  2N1T A;  3WMM 0;  5APV A;  2WPS A;  1HUC A;  2BAS A;  2N1T B;  1N73 C;  1GW4 A;  2Q3I A;  1JTH B;  1RE4 C;  3HTK A;  2IFM A;  1J1E B;  3EQ2 A;  4AQR D;  3TNU B;  1H89 A;  5AW0 B;  1JNM A;  4WBA A;  1HBW A;  2A45 I;  2KYV A;  2P7J A;  2W6A A;  4DOJ A;  1LT9 B;  1NWQ A;  1N7S A;  3VTP C;  1E5W A;  1N7S C;  1X8Y A;  3L36 A;  1GU4 A;  1G2C A;  2WTY A;  4LGD E;  1VDF A;  2JJL A;  4I1L A;  4W80 A;  1IFJ A;  3V5B A;  5AW7 B;  3IR9 A;  1DX7 A;  2HFE D;  1IJD B;  3A7O A;  1IK9 A;  1SQV K;  2FFD A;  3M0D C;  4AUW A;  1XTG B;  1L4A D;  5AW2 B;  2N9B A;  3M0A A;  3L37 A;  4IFF A;  2H43 A;  1KFM A;  4ZKP A;  1GW3 A;  3KYQ A;  1M7L A;  1DH3 A;  1RE3 A;  3RK3 C;  4C7N B;  2CPS A;  4I6M C;  3SWY A;  1JY2 P;  1CI6 A;  3VOP A;  1RF0 C;  2XNX A;  1SQP K;  1NTK K;  4Y99 C;  2NPS A;  1QL2 A;  1FJP A;  2R3C A;  4HH2 A;  1YTZ T;  3RK3 D;  3V4Q A;  3TK1 A;  2NPS D;  1NAF A;  2GUS A;  2M3B A;  2XU6 A;  3E1I A;  2OYI B;  2Z4E A;  5CCG C;  2GM4 A;  1G1J A;  4XE5 B;  3MIW A;  5CCG A;  3U1A A;  2OYI A;  1FOS E;  3HUS C;  1FZF A;  1L4A B;  3MTU E;  2NPS B;  1GZL A;  2I1K A;  2FKW B;  5AW1 B;  1HJB A;  1W2E A;  1JTH A;  3HD7 A;  2Z5H A;  1AQ5 A;  3H6P A;  1RY3 A;  1M1J C;  1JY2 O;  3HUS B;  3P8C E;  1HVV A;  1NTM K;  2QM8 A;  5CMZ A;  2WSC H;  3B8E B;  1IC2 A;  2KB7 P;  2HOD A;  2LKM A;  1IFD A;  1MZ9 A;  1L4A A;  2R5B A;  1RF0 A;  5APS A;  3RK2 D;  2Q9I A;  1NHL A;  1LTT C;  1HTL C;  3N7N A;  1JY3 N;  1LT9 A;  3H32 A;  1A02 F;  3B5N C;  1GK4 A;  3HRN A;  5KJ7 D;  2WPQ A;  3HTK B;  1N2D C;  3M91 A;  5AVQ B;  2YKP A;  1CI6 B;  2PAJ A;  3BRT B;  5AVZ B;  2YKO A;  1HH0 A;  2A45 H;  2MJZ A;  3HD7 D;  3GHG B;  3R2P A;  2VRS A;  3A5T A;  3B5N D;  1RE3 C;  3B5N B;  3P7K A;  1GK6 A;  3V2N A;  4WY4 C;  3B5N A;  1S9K E;  1FZC B;  3HE4 A;  2Q7C A;  4N78 E;  2FYU K;  1SP4 A;  2YNY A;  1YYC A;  5AW6 B;  2O01 H;  1L0N K;  2P1J A;  5APY A;  5BU8 B;  2HPC B;  4GIF A;  4W7Z A;  2N1T D;  5KJ7 A;  2FFD B;  2C0W A;  3CL3 D;  4M3L A;  1X79 B;  1IFI A;  1J1D B;  5AVX B;  4GT1 A;  5AVW B;  2JEE A;  2OYI C;  2OAR A;  2WT7 B;  2OYH A;  4GKG A;  3CLQ A;  4RES B;  3NTN A;  2ZFC A;  5AVY B;  1SFC D;  3VN0 A;  5APT A;  2N1T C;  1KFN A;  1KIL A;  1N7L A;  3LIE A;  1NKZ B;  1SFC A;  1H88 A;  1T3J A;  3LID A;  1LTJ A;  1JO5 A;  3BAS A;  3KPE A;  1H8A A;  1GL2 B;  1URQ A;  4LC1 A;  2XV5 A;  2FFD C;  2CPB A;  3HD7 C;  5AW8 B;  3OAK A;  2P2U A;  3NFQ A;  5AVT B;  3OA7 A;  1FJK A;  3RK2 B;  1SLQ A;  5AVU B;  4ZKU A;  1JY3 O;  5APX A;  1NTZ K;  1RF1 C;  2R5D A;  3P32 A;  1QL1 A;  4HYT B;  2FYZ A;  3VP8 A;  1AFO A;  3A3Y B;  4B86 A;  1JY3 P;  2L5G B;  3V4W A;  2W27 A;  1FU1 A;  1J1E C;  2WZ7 A;  1ZV8 A;  1JCC A;  1GDT A;  3T97 A;  2PP6 A;  1LWU B;  1EQ7 A;  2ZXE B;  1KIL C;  2FXM A;  3HE5 B;  4WB4 A;  1GD2 E;  3KQG A;  3U1C A;  2R32 A;  2QM7 A;  2E43 A;  3BAT A;  3RK2 C;  2IFN A;  5AVV B;  3H32 B;  3NMD A;  5BVZ A;  2C9N Y;  2HLO A;  4EOT A;  1URQ D;  3RL0 D;  1RF1 B;  1IFN A;  1N7S B;  1MUU A;  3BVH A;  1LTB C;  1ZN5 A;  2J59 M;  1CZQ A;  1NO4 A;  3II6 A;  1FOS F;  2WT7 A;  1LWU A;  2Z5I A;  3VMY A;  2HG5 D;  5AVR B;  2HOD B;  1KZU B;  1WT6 A;  1KQL A;  3PP5 A;  3V2Q A;  4XA4 A;  4W7Y A;  1NH4 A;  4EIJ A;  3TSI A;  1CSB A;  3GHG A;  5BU5 A;  2W6B A;  3VP9 A;  3I5C A;  1S9K D;  3G3Z A;  1T8Z A;  2A45 G;  5CCG D;  1RE4 A;  3MUD A;  2IX7 C;  2M8R A;  1L4A C;  1LTS C;  1IFM A;  1LTI C;  1HWT C;  3L4F A;  5AW5 B;  4AYC A;  3HE5 A;  4LLH A;  3VYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...