1GD4A

Solution structure of p25s cystatin a
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
MIPGGLSEAKPATPEIQEIVDKVKSQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYLHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTATIN A
publication title Structural comparison between wild-type and P25S human cystatin A by NMR spectroscopy. Does this mutation affect the a-helix conformation ?
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2000-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1gd4A00
3PS8A 1STFI 4TX4A 3UL5A 3PXMA 1CYVA 1KWIA 4N6MA 1WNHA 3SVAA 2O9UX 1GD4A 1M9GA 2BO9B 1LXEA 1N5PA 1NB5I 1A90A 4IT7A 1RN7A 5LC6A 1DVCA 1PFPA 2KXGA 4EYCA 2CH9A 1IV9A 1CYUA 1TIJA 1N5HA 3LH4A 2W9PA 4N6LA 5ELUA 5EQLA 1A67A 3PYJA 3UL6A 1MOLA 1CEWI 3IMAB 4N6TA 1DVDA 1NB3I 4CCVA 3NX0A 3K9MC 1MNLA 1EQKA 1FA3A 5ELJA 1ROAA 4N6V0 3GAXA 4N6UA 1YVBI 5LC7A 4LZIA 4N6NB 2W9QA 1N9JA 3QRDA 1G96A 5A0OB 1GD3A 3KSED 4N6OB 4ZM8A 1R4CA 3KFQC 3L0RA 1IV7A 3MWZA 3Q2PA 2OCTA 1FUWA 3S67A
chains in the Genus database with same CATH superfamily
1Q814 1QAKA 3DGMA 7RNTA 2ZHXB 4GL6A 1RLSA 1STDA 4EV5A 1RTUA 2AAEA 4HYZA 2L1SA 3BNCA 1VQM3 1KC84 1YNVX 4JF8A 5IG4A 3GRDA 2W6JH 3UL5A 4EXRA 3STDA 3FZWA 1ROVA 3F14A 1B2UA 4NHFA 4HM1B 4L7KA 1I2GA 1DETA 5G2GA 2GBWB 3OXAA 1O7WB 4N6MA 5AIFA 3CPW2 4K90B 4NPBA 3H51A 3RDEA 4DKIA 3BNBA 1GD4A 1IVUA 1N9EA 3KCHA 2GEXA 4OVMA 1Q40A 1BNEA 1F8NA 1O7PB 2F99A 2K0MA 3CCJ3 2BO9B 2Z76A 1W02A 1X1YA 1W2ZA 5CLKA 3GZYB 3KE7A 1NNVA 3FH1A 1GY7A 2P05A 3MSOA 2HMLB 4AKYA 2GBXB 1LRAA 1BSCA 2P09A 3EN8A 3GWRA 1NO3A 4GB5A 2O3OA 3D79A 2OQEA 5DREA 1BRNL 3J7Yd 1W01A 1ISKA 3H3HA 2BT3A 2GU1A 5AI1A 3ECFA 4XBTA 5D83A 3VSYA 1JBSA 2W0QA 3CCE3 1VQ93 1CYUA 1TIJA 1N5HA 4FCJA 2OOVC 1FGTA 1GSPA 1K28A 3LZAA 3LH4A 4WFOA 1FZUA 2L4VA 1W5ZA 1AVLA 1RGCA 3GSPA 1MWRA 2P0MA 1FGOA 1FUSA 3M8CA 2HMKB 3JUQA 1NWWA 1VQ73 1A67A 1LNHA 1PYLA 1GOVA 3NHXA 1GY6A 3LT8A 3HZPA 3NBJA 3UL6A 1JV2B 3DMCA 1OH0A 2E2TA 2XFSA 4KT3B 2B1XB 3NXJA 3BLZA 4GSPA 5D81A 2GSPA 1SIHA 3RNTA 1YJW3 1FGRA 1D6ZA 1TJDA 2JDIH 3D9RA 4J9AA 3K9MC 1S5AA 2UGIA 1I70A 3NBBA 1QAFA 1RGHA 2CFGA 1MNLA 1BNSA 3NQYA 3ZG5A 4H3UA 3EBTA 5RNTA 2CWVA 3PCSA 1BOXA 1HKXA 1ROAA 2W03A 4NREA 4N6V0 3CD63 4N3VA 2HMMB 3FG1A 2LQVA 2C4BA 4XDWA 1CH0A 1RGKA 1EG9B 1VQN3 4J5GA 2CG1A 1PU4A 1C7HA 1RN4A 5CK6A 2E2UA 3LOYA 5GSPA 1SIIA 5FW5A 5JBSA 3FF2A 1W4NA 4FCMA 4CDLA 2R41A 4LEHA 4HBRA 1BGSA 1Q824 4FMAA 3V99A 1RCLA 3MPHA 5KP4A 3CU3A 1OCVA 2CWTA 3KKGA 3NV0B 4ORLA 1K8A4 5AIHA 1YJ93 2XGLA 3NV0A 3VGNA 2B24B 1E3RA 2WOHA 1FGMA 3FG4A 3GZBA 3SOAA 1I3IA 3CCL3 2Y74A 1UUWB 3HIGA 5AEUB 2I9WA 1NJI4 1QJGA 2F4YA 1K9M4 1LVNA 1VQQA 1YIJ3 1GOYA 2RBIA 1BRGA 1OHSA 1M1XB 4LGQA 1D6YA 1Y4KA 1D6UA 1TTOA 2XFTA 3Q3FA 2F56A 3AGNA 3F7SA 1BVIA 3U97A 1CYVA 3X41A 1KSIA 1A2PA 1BSBA 1KWIA 4O2HA 5G1LA 1BRKA 3D5IA 4CPKA 1FUTA 3K0ZA 2XGNA 3OW22 1VQP3 3BNDA 3D5GA 1RJOA 1JRQA 2HMOB 4FMBA 2YFLB 1I2EA 2CFLA 2BU4A 3DZLA 1GY5A 1AY7A 1HYFA 5FGOA 1UCKA 1BNIA 3DUKA 3EN1B 3S28A 1US1A 1BRJA 4BIRA 1IK3A 1DVCA 3CCV3 3CCM3 1DMQA 1IT7A 4RNZA 3MHEA 5CXOA 4EYCA 5IG0A 1X1UA 2Z7AA 4PEJA 3V92A 4XDVA 1RRHA 4FR9A 2QGUA 3JUOA 2WO0A 3LXUX 1RCKA 2J8XB 3SOYA 2CHCA 1DYUA 2IA7A 2P0XA 3KIIA 2HMNB 1GOUA 1VZZA 4LMIA 3LTBA 3UJMA 2W56B 4HM2B 3U1WA 3CPOA 3D4AA 1PY3A 5G1KA 4N6LA 2CC3A 1BU4A 1O7HB 1WQLB 2STDA 3FKAA 4STDA 5EQLA 1GMQA 1RMSA 1T5YA 4BTWA 1TU5A 3O8YA 4FMCA 1UCLA 4HM3B 1TRQA 1YGWA 3G16A 1BUJA 3WHOA 1I3FA 4X2HA 3I0YA 2CW9A 4X2OA 1DVDA 4LYLB 3AMOB 3WOEB 2FXTA 5AIIA 3B8LA 5IEPA 4R80A 3DY5A 1X1XA 3AMOA 3NX0A 1K41A 3GZXB 1UW1A 2OTJ3 4HZBB 1HU9A 1SJWA 3I563 4JRFA 1JKGB 3HI7A 1FGQA 2KF5A 3DM8A 3DXOA 2PZVA 5ELJA 1OACA 1JKGA 3CNXA 1ASKA 1YVSA 3X42A 3X3YA 1UGHI 3F7XA 1YVBI 1SPUA 4EV2A 3SLUA 4RNTA 1KQS2 1RNBA 5LC7A 3OWUA 4MJDA 1R4YA 1BSAA 4LZIA 1VQO3 2W9QA 4MEIA 1G96A 2YFIB 2W04A 3KSPA 1A2VA 1GS3A 4O02B 5A0OB 2XH9A 1BAOA 3MYTA 3JUPA 3VF1A 3S27A 3KSED 1AQZA 1TP6A 1R4CA 1BNGA 3KFQC 3LMLA 3LTAA 1Q7HA 3NBRA 2AADA 1BRSA 3NM2A 4U13A 2BMRB 3Q2PA 4XBXA 1JB2A 1VQ63 1G02A 8CHOA 3FF0A 3HK4A 1B21A 1O7MB 1OPYA 3RGAA 2CFDA 2WGQA 1FUWA 3DGYA 2IMJA 2GEYA 2OTL3 1BSDA 2HMJB 3DGLA 5AYSC 2QIYA 5JPUA 4K1VA 1RKYA 1EKMA 3PS8A 1ULJB 1STFI 3EQQB 2BHMA 1O7GB 2FGTA 2JQ5A 2Z6BA 9RNTA 3CNMA 2FNQA 3EF8A 4RNYA 5BIRA 4WYKB 2E2VA 2KRTA 3WA2X 5AEWB 3SEDA 3T0UA 3CCS3 2XSHB 1A2KA 4BU4A 5KP3A 5STDA 1AV4A 3PXMA 4XM4A 3UNLA 1U8CB 2ZA4A 4G1MB 2R4IA 1IQ8A 2OQEC 3URPA 1YJN3 1B2SA 1BUQA 1W6YA 1OF5B 3SVAA 2RCDA 5IENA 1AVKA 1C54A 2O9UX 5TGNA 1OUNA 1RHLA 3K5TA 1K734 1M1K4 2CX1A 4IIAA 4LSOA 1OF5A 3CC73 1U5OA 5I97A 2YX9A 3K7CA 3FLJA 2UX0A 3NQZA 1W6GA 3A5EA 4HVNA 4MMXB 1NB5I 1RNTA 3B7CA 1SARA 1MGWA 3T8NA 1IQYA 3CC43 1RN7A 2D1WA 1Z1SA 1RGFA 2XRXB 4HM7B 3WDGB 4BL3A 3ER7A 2CX0A 4WWUC 1PFPA 4MMYB 5BVBA 2KXGA 3X40A 7STDA 3EHCA 1UCIA 2CH9A 1HZ1A 1DMNA 4FCZA 1W2B2 1B3SA 1I0VA 4AEQA 1LNIA 2Q07A 3LYGA 1IV9A 3BIRA 1BNFA 3E99A 1Q42A 1UUVB 1WMPA 2XF3A 3OWSA 1OGZA 3D3LA 1LOWA 1WTHA 3LT9A 1YGEA 1RGAA 2CKFB 3MKIA 3TDGA 5IG3A 1FYSA 1RRLA 2F5MA 3X3XA 3AHSA 1IQXA 5IG5A 2KF6A 3LTCA 1UCJA 2C10A 3BB9A 5ELUA 1S723 4L8OA 5HGRA 2QEX3 1JBTA 1GMRA 3N8BA 1T3BA 2ZL8A 2A15A 1V58A 5BU4A 3HX8A 3EE1A 3MG3A 1RGEA 1UI7A 3T8UA 2OOVA 5AIGA 2KCDA 4WHAA 1IVXA 1MOLA 2RFRA 3QK9A 1ZX2A 4BTXA 6GSPA 1E3VA 2PNCA 2KAAA 3PZWA 3DH2A 3CMA3 3CC23 2MC8A 4CCVA 3ZG0A 4K1UA 1BSEA 1LOYA 3HOHA 2F5WA 1VQL3 1V57A 3EB8A 1RGLA 3FG3A 1KD14 2XSOB 2H0IA 1FA3A 4WP5A 4BTYA 5M18A 1I2FA 4EC6A 4H61A 2RGQA 2WOFA 3WR2A 5AYRB 2CK3H 2W56A 3Q1CA 4KFDA 4O8SA 1T2IA 2GU3A 4HM0B 4HM8B 1RSNA 1VQK3 3SYUA 1QVF2 1BNRA 5IEOA 2W2CA 4OK0A 3WA3A 4I4KA 3FSDA 4N6NB 5EVHA 1QALA 2C11A 4FMDA 1BANA 2Y73A 3MG2A 3F9SA 2V1LA 1ZS7A 3NUVA 1GD3A 4HAAA 3OX9A 6STDA 5HOHA 3RGRA 2OWPA 1IV7A 3MWZA 4O3VA 3EJVA 4KFFA 4J8TA 1NDOB 1OHOA 2CWUA 2OCTA 3AHWA 1Q40B 3PGBA 4KZ1A 2YFJB 3A76A 1V74A 2RSXA 2H0GA 1LOVA 2P38A 5JPPA 3IPTA 1T2HA 1L5GB 3G8ZA 1TRPA 1YIT3 1UI8A 3FCSB 3ALAA 2LYXA 1IU7A 1IVWA 1DMMA 1LQMB 1IVVA 1OGXA 2H0HA 3F8XA 4ILFA 1NU3A 1EA2A 1QMAA 2M7OA 1IT8A 4TX4A 4EBGA 1X1WA 3GZRA 4IPBA 4R4KA 3I553 1B2ZA 3CCQ3 1TFKA 2BMOB 2F86B 3EBYA 1YI23 4Q53A 2F98A 3CCR3 2KF4A 1IDPA 6RNTA 1N8R4 1WNHA 4K61A 2ML6A 1G0TA 1GMPA 5CF1A 3OV4A 1O7NB 1TUHA 1M9GA 3F8HA 3X3ZA 1LXEA 2SARA 1N5PA 4HM6B 1A90A 1JN5B 1ZO2A 4MMZB 5CF2A 4IT7A 2QA43 1DE3A 1RDSA 3CCU3 5LC6A 3B4OA 3G713 1JZDA 1JN5A 1QVG2 1SQWA 1WMOA 1Q864 1JB4A 1MWUA 1LQGC 2ML5A 3BU4A 3KN4A 3FGYA 4WYKA 3KZTA 3AGOA 3V98A 1BRIA 1J2BA 3WMDA 3UB1A 1JBRA 5M19A 3ROBA 7GSPA 4RBNA 3LTDA 1LOXA 1AR0A 2W9PA 3G4S3 1CQSA 1TFOA 3BNEA 1B2MA 3MG1A 4GHOA 5IF6A 4HZ9B 2IUKA 1UDII 1W6CA 3NM7A 2XEPA 1N8QA 1RN1A 3DGOA 3CXC2 5DRVA 2UUGC 4R9KA 2BIRA 5IW9A 8RNTA 3PYJA 3JUMA 1BNJA 2WGOA 1EEJA 4J5KA 3S5CA 2SBLA 2K54A 3SXXA 1EUIC 3ZFZA 1CEWI 3N9HA 3WODG 4XB5A 1VQ43 1RGGA 2IY2A 3IMAB 1VQ83 1B20A 2RNTA 4N6TA 2CFWA 5M1AA 5BXQA 1NB3I 1M904 4HOHA 1B27A 4XBYA 4HM5B 4BL2A 1UGIA 1JB5A 2GXFA 4HM4B 1EQKA 1IYYA 3OWYA 3WOFB 1OHPA 2CFKA 2K3DA 3IJEB 1VQ53 1UUGB 1ZGXA 3PCRA 3GAXA 1MWTA 1JNQA 2XR8B 2HOHA 4N6UA 1JJ22 4CJNA 1B2XA 2BNGA 4OUQA 1Q9EA 2IUJA 4HKVB 1E97A 5EEOA 2ZDJA 3N54B 4HJLB 2IYJA 4R9LA 1Q7Y4 1MGRA 1JZOA 2BMQB 1N9JA 1FW7A 2D42A 3QRDA 1BRHA 1GYBA 1I0XA 1I8VA 4EW5A 1MWSA 4L8PA 5KP1A 2MF7A 4KVHA 3JUNA 3G0KA 4N6OB 4QWTA 5D82A 4ZM8A 3EX9A 3L0RA 4RZMA 3G6E3 3B4PA 2INXA 2KF3A 2CIUA 5IERA 1ULIB 4KFEA 2Z77A 3JVCA 4R1KA 1BIRA 1WMNA 3EC9A 3HIIA 3S67A 3SX1A 4AKZA 3CME3 1YHQ3 3K63A 3DGNA 3F40A 4I5QA 3S29A 1W00A 2CG0A 1W7CA 3Q90A
chains in the Genus database with same CATH topology
1Q814 1QAKA 3DGMA 4GL6A 1STDA 4EV5A 1VQM3 4HYZA 3BNCA 1KC84 4JF8A 5IG4A 3GRDA 2W6JH 3UL5A 4EXRA 3STDA 3FZWA 1ROVA 3F14A 4NHFA 4HM1B 4L7KA 5G2GA 2GBWB 3OXAA 1O7WB 4N6MA 5AIFA 3CPW2 4K90B 3H51A 3RDEA 3BNBA 1GD4A 1IVUA 1N9EA 2GEXA 4OVMA 1Q40A 1F8NA 1O7PB 2F99A 2K0MA 3CCJ3 2BO9B 2Z76A 1W02A 1W2ZA 5CLKA 3GZYB 3KE7A 3FH1A 1GY7A 2P05A 3MSOA 2HMLB 4AKYA 2GBXB 2P09A 3GWRA 3EN8A 4GB5A 1NO3A 2OQEA 2O3OA 5DREA 3J7Yd 1W01A 1ISKA 3H3HA 2BT3A 2GU1A 5AI1A 3ECFA 4XBTA 5D83A 3VSYA 2W0QA 3CCE3 1VQ93 1CYUA 1TIJA 1N5HA 4FCJA 2OOVC 1FGTA 1K28A 3LZAA 3LH4A 4WFOA 2L4VA 1W5ZA 1AVLA 2P0MA 1FGOA 3M8CA 2HMKB 3JUQA 1NWWA 1VQ73 1A67A 1LNHA 3NHXA 1GY6A 3LT8A 3HZPA 3NBJA 3UL6A 1JV2B 3DMCA 1OH0A 2E2TA 2XFSA 2B1XB 3NXJA 3BLZA 5D81A 1SIHA 1YJW3 1FGRA 1D6ZA 2JDIH 3D9RA 4J9AA 3K9MC 1S5AA 3NBBA 1QAFA 2CFGA 1MNLA 3NQYA 4H3UA 3EBTA 2CWVA 3PCSA 1HKXA 1ROAA 2W03A 4NREA 4N6V0 3CD63 4N3VA 2HMMB 3FG1A 2LQVA 4XDWA 1EG9B 1VQN3 2CG1A 1PU4A 1C7HA 5CK6A 2E2UA 3LOYA 1SIIA 5FW5A 5JBSA 3FF2A 1W4NA 4FCMA 4CDLA 4LEHA 1Q824 4HBRA 4FMAA 3V99A 3MPHA 5KP4A 3CU3A 1OCVA 2CWTA 3KKGA 3NV0B 4ORLA 1K8A4 5AIHA 1YJ93 2XGLA 3NV0A 3VGNA 2WOHA 2B24B 1E3RA 1FGMA 3FG4A 3GZBA 3SOAA 3CCL3 2Y74A 1UUWB 3HIGA 5AEUB 2I9WA 1NJI4 1QJGA 1K9M4 1LVNA 1YIJ3 1OHSA 1M1XB 4LGQA 1D6YA 1Y4KA 1D6UA 2XFTA 3F7SA 3U97A 1CYVA 3X41A 1KSIA 1KWIA 4O2HA 3K0ZA 3OW22 2XGNA 1VQP3 3BNDA 1RJOA 1JRQA 2HMOB 4FMBA 2YFLB 2CFLA 3DZLA 1GY5A 3DUKA 3EN1B 3S28A 1US1A 1IK3A 1DVCA 3CCV3 3CCM3 1DMQA 1IT7A 4RNZA 3MHEA 5CXOA 4EYCA 5IG0A 2Z7AA 4PEJA 3V92A 4XDVA 1RRHA 4FR9A 2QGUA 3JUOA 2WO0A 3LXUX 3SOYA 2CHCA 1DYUA 2P0XA 2IA7A 3KIIA 2HMNB 1VZZA 4LMIA 3LTBA 3UJMA 2W56B 4HM2B 3U1WA 3CPOA 4N6LA 2CC3A 1O7HB 1WQLB 2STDA 3FKAA 4STDA 5EQLA 4BTWA 1T5YA 1TU5A 3O8YA 4FMCA 4HM3B 3G16A 4X2HA 3I0YA 2CW9A 4X2OA 1DVDA 3AMOB 3WOEB 2FXTA 5AIIA 3B8LA 5IEPA 4R80A 3DY5A 3NX0A 3AMOA 1K41A 3GZXB 1UW1A 2OTJ3 4HZBB 1HU9A 1SJWA 3I563 4JRFA 1JKGB 3HI7A 1FGQA 3DM8A 3DXOA 2PZVA 5ELJA 1OACA 1JKGA 3CNXA 1ASKA 3X42A 3X3YA 3F7XA 1YVBI 1SPUA 4EV2A 3SLUA 1KQS2 5LC7A 3OWUA 4MJDA 4LZIA 1VQO3 2W9QA 4MEIA 1G96A 2YFIB 2W04A 3KSPA 1A2VA 1GS3A 4O02B 5A0OB 2XH9A 3MYTA 3JUPA 3VF1A 3S27A 3KSED 1TP6A 5FGOA 1R4CA 3LMLA 3KFQC 3LTAA 3NM2A 3NBRA 4U13A 2BMRB 3Q2PA 4XBXA 1JB2A 1VQ63 8CHOA 3FF0A 3HK4A 1O7MB 1OPYA 3RGAA 2CFDA 2WGQA 1FUWA 2IMJA 2GEYA 2OTL3 2HMJB 3DGLA 5AYSC 2QIYA 5JPUA 4K1VA 1RKYA 1EKMA 3PS8A 1ULJB 1STFI 3EQQB 2BHMA 1O7GB 2FGTA 2JQ5A 2Z6BA 3CNMA 2FNQA 3EF8A 4RNYA 4WYKB 2E2VA 2KRTA 3WA2X 5AEWB 3SEDA 3T0UA 3CCS3 2XSHB 1A2KA 5KP3A 5STDA 1AV4A 3PXMA 4XM4A 3UNLA 1U8CB 4G1MB 2R4IA 1IQ8A 2OQEC 1YJN3 1BUQA 1W6YA 1OF5B 3SVAA 2RCDA 5IENA 1AVKA 2O9UX 5TGNA 1OUNA 3K5TA 1M1K4 1K734 4IIAA 4LSOA 1OF5A 3CC73 1U5OA 5I97A 2YX9A 3K7CA 3FLJA 2UX0A 3NQZA 1W6GA 4HVNA 4MMXB 1NB5I 3T8NA 3B7CA 1IQYA 3CC43 1RN7A 2D1WA 1Z1SA 2XRXB 4HM7B 3WDGB 3ER7A 4WWUC 1PFPA 4MMYB 5BVBA 2KXGA 3X40A 7STDA 3EHCA 2CH9A 4FCZA 1DMNA 1W2B2 4AEQA 2Q07A 3LYGA 1IV9A 3E99A 1Q42A 1UUVB 2XF3A 1WMPA 3OWSA 1OGZA 3D3LA 1WTHA 3LT9A 1YGEA 2CKFB 3MKIA 3TDGA 5IG3A 1RRLA 3X3XA 1IQXA 5IG5A 3LTCA 5ELUA 2C10A 3BB9A 1S723 4L8OA 5HGRA 2QEX3 3N8BA 2ZL8A 2A15A 3HX8A 3EE1A 3MG3A 1UI7A 3T8UA 2OOVA 5AIGA 2KCDA 4WHAA 1IVXA 1MOLA 2RFRA 3QK9A 1ZX2A 4BTXA 1E3VA 2PNCA 3PZWA 3CMA3 3CC23 2MC8A 4CCVA 4K1UA 1VQL3 3FG3A 3EB8A 1KD14 2XSOB 1FA3A 4WP5A 4BTYA 4EC6A 4H61A 2RGQA 2WOFA 5AYRB 2CK3H 2W56A 3Q1CA 4KFDA 4O8SA 2GU3A 4HM0B 4HM8B 1VQK3 1QVF2 5IEOA 2W2CA 4OK0A 3WA3A 4I4KA 3FSDA 4N6NB 5EVHA 1QALA 2C11A 4FMDA 2Y73A 3MG2A 3F9SA 2V1LA 3NUVA 1GD3A 6STDA 3OX9A 3RGRA 2OWPA 1IV7A 3MWZA 4O3VA 3EJVA 4KFFA 4J8TA 1NDOB 1OHOA 2CWUA 2OCTA 4KZ1A 1Q40B 3PGBA 2YFJB 3A76A 1V74A 2RSXA 2P38A 5JPPA 3IPTA 1L5GB 3G8ZA 1YIT3 1UI8A 3FCSB 3ALAA 2LYXA 1IU7A 1IVWA 1DMMA 1IVVA 1OGXA 3F8XA 1NU3A 1EA2A 1QMAA 2M7OA 1IT8A 4TX4A 4EBGA 3GZRA 4IPBA 4R4KA 3I553 3CCQ3 1TFKA 2BMOB 2F86B 3EBYA 1YI23 4Q53A 2F98A 3CCR3 1IDPA 1N8R4 1WNHA 4K61A 2ML6A 5CF1A 3OV4A 1O7NB 1TUHA 1M9GA 3F8HA 3X3ZA 1LXEA 1N5PA 4HM6B 1A90A 1JN5B 1ZO2A 4MMZB 5CF2A 4IT7A 2QA43 3CCU3 5LC6A 3B4OA 3G713 1QVG2 1JN5A 1SQWA 1WMOA 1Q864 1JB4A 2ML5A 3KN4A 4WYKA 3V98A 3FGYA 3KZTA 1J2BA 3WMDA 3UB1A 3ROBA 4RBNA 3LTDA 1LOXA 1AR0A 2W9PA 3G4S3 1CQSA 1TFOA 3BNEA 3MG1A 5IF6A 4HZ9B 2IUKA 1W6CA 3NM7A 2XEPA 1N8QA 3DGOA 3CXC2 5DRVA 4R9KA 5IW9A 3PYJA 3JUMA 2WGOA 3S5CA 2SBLA 2K54A 3SXXA 1CEWI 3N9HA 3WODG 4XB5A 1VQ43 3IMAB 1VQ83 4N6TA 2CFWA 5BXQA 1NB3I 1M904 4XBYA 4HM5B 1JB5A 2GXFA 4HM4B 1EQKA 3OWYA 3WOFB 1OHPA 2CFKA 3IJEB 1VQ53 3PCRA 3GAXA 1JNQA 2XR8B 4N6UA 1JJ22 2BNGA 4OUQA 2IUJA 4HKVB 1E97A 5EEOA 2ZDJA 3N54B 4HJLB 4R9LA 1Q7Y4 2BMQB 1N9JA 2D42A 3QRDA 1GYBA 5KP1A 4L8PA 2MF7A 4KVHA 3JUNA 3G0KA 4N6OB 4QWTA 5D82A 4ZM8A 3EX9A 3L0RA 4RZMA 3G6E3 3B4PA 2INXA 2CIUA 5IERA 1ULIB 4KFEA 2Z77A 3JVCA 4R1KA 1WMNA 3EC9A 3SX1A 3HIIA 3S67A 4AKZA 3CME3 1YHQ3 3K63A 3DGNA 3F40A 3S29A 1W00A 2CG0A 1W7CA 3Q90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PS8 A;  1STF I;  4TX4 A;  3UL5 A;  3PXM A;  1CYV A;  1KWI A;  4N6M A;  1WNH A;  3SVA A;  2O9U X;  1GD4 A;  1M9G A;  2BO9 B;  1LXE A;  1N5P A;  1NB5 I;  1A90 A;  4IT7 A;  1RN7 A;  5LC6 A;  1DVC A;  1PFP A;  2KXG A;  4EYC A;  2CH9 A;  1IV9 A;  1CYU A;  1TIJ A;  1N5H A;  3LH4 A;  2W9P A;  4N6L A;  5ELU A;  5EQL A;  1A67 A;  3PYJ A;  3UL6 A;  1MOL A;  1CEW I;  3IMA B;  4N6T A;  1DVD A;  1NB3 I;  4CCV A;  3NX0 A;  3K9M C;  1MNL A;  1EQK A;  1FA3 A;  5ELJ A;  1ROA A;  4N6V 0;  3GAX A;  4N6U A;  1YVB I;  5LC7 A;  4LZI A;  4N6N B;  2W9Q A;  1N9J A;  3QRD A;  1G96 A;  5A0O B;  1GD3 A;  3KSE D;  4N6O B;  4ZM8 A;  1R4C A;  3KFQ C;  3L0R A;  1IV7 A;  3MWZ A;  3Q2P A;  2OCT A;  1FUW A;  3S67 A; 
#chains in the Genus database with same CATH topology
 1Q81 4;  1QAK A;  3DGM A;  7RNT A;  2ZHX B;  4GL6 A;  1RLS A;  1STD A;  4EV5 A;  1RTU A;  2AAE A;  4HYZ A;  2L1S A;  3BNC A;  1VQM 3;  1KC8 4;  1YNV X;  4JF8 A;  5IG4 A;  3GRD A;  2W6J H;  3UL5 A;  4EXR A;  3STD A;  3FZW A;  1ROV A;  3F14 A;  1B2U A;  4NHF A;  4HM1 B;  4L7K A;  1I2G A;  1DET A;  5G2G A;  2GBW B;  3OXA A;  1O7W B;  4N6M A;  5AIF A;  3CPW 2;  4K90 B;  4NPB A;  3H51 A;  3RDE A;  4DKI A;  3BNB A;  1GD4 A;  1IVU A;  1N9E A;  3KCH A;  2GEX A;  4OVM A;  1Q40 A;  1BNE A;  1F8N A;  1O7P B;  2F99 A;  2K0M A;  3CCJ 3;  2BO9 B;  2Z76 A;  1W02 A;  1X1Y A;  1W2Z A;  5CLK A;  3GZY B;  3KE7 A;  1NNV A;  3FH1 A;  1GY7 A;  2P05 A;  3MSO A;  2HML B;  4AKY A;  2GBX B;  1LRA A;  1BSC A;  2P09 A;  3EN8 A;  3GWR A;  1NO3 A;  4GB5 A;  2O3O A;  3D79 A;  2OQE A;  5DRE A;  1BRN L;  3J7Y d;  1W01 A;  1ISK A;  3H3H A;  2BT3 A;  2GU1 A;  5AI1 A;  3ECF A;  4XBT A;  5D83 A;  3VSY A;  1JBS A;  2W0Q A;  3CCE 3;  1VQ9 3;  1CYU A;  1TIJ A;  1N5H A;  4FCJ A;  2OOV C;  1FGT A;  1GSP A;  1K28 A;  3LZA A;  3LH4 A;  4WFO A;  1FZU A;  2L4V A;  1W5Z A;  1AVL A;  1RGC A;  3GSP A;  1MWR A;  2P0M A;  1FGO A;  1FUS A;  3M8C A;  2HMK B;  3JUQ A;  1NWW A;  1VQ7 3;  1A67 A;  1LNH A;  1PYL A;  1GOV A;  3NHX A;  1GY6 A;  3LT8 A;  3HZP A;  3NBJ A;  3UL6 A;  1JV2 B;  3DMC A;  1OH0 A;  2E2T A;  2XFS A;  4KT3 B;  2B1X B;  3NXJ A;  3BLZ A;  4GSP A;  5D81 A;  2GSP A;  1SIH A;  3RNT A;  1YJW 3;  1FGR A;  1D6Z A;  1TJD A;  2JDI H;  3D9R A;  4J9A A;  3K9M C;  1S5A A;  2UGI A;  1I70 A;  3NBB A;  1QAF A;  1RGH A;  2CFG A;  1MNL A;  1BNS A;  3NQY A;  3ZG5 A;  4H3U A;  3EBT A;  5RNT A;  2CWV A;  3PCS A;  1BOX A;  1HKX A;  1ROA A;  2W03 A;  4NRE A;  4N6V 0;  3CD6 3;  4N3V A;  2HMM B;  3FG1 A;  2LQV A;  2C4B A;  4XDW A;  1CH0 A;  1RGK A;  1EG9 B;  1VQN 3;  4J5G A;  2CG1 A;  1PU4 A;  1C7H A;  1RN4 A;  5CK6 A;  2E2U A;  3LOY A;  5GSP A;  1SII A;  5FW5 A;  5JBS A;  3FF2 A;  1W4N A;  4FCM A;  4CDL A;  2R41 A;  4LEH A;  4HBR A;  1BGS A;  1Q82 4;  4FMA A;  3V99 A;  1RCL A;  3MPH A;  5KP4 A;  3CU3 A;  1OCV A;  2CWT A;  3KKG A;  3NV0 B;  4ORL A;  1K8A 4;  5AIH A;  1YJ9 3;  2XGL A;  3NV0 A;  3VGN A;  2B24 B;  1E3R A;  2WOH A;  1FGM A;  3FG4 A;  3GZB A;  3SOA A;  1I3I A;  3CCL 3;  2Y74 A;  1UUW B;  3HIG A;  5AEU B;  2I9W A;  1NJI 4;  1QJG A;  2F4Y A;  1K9M 4;  1LVN A;  1VQQ A;  1YIJ 3;  1GOY A;  2RBI A;  1BRG A;  1OHS A;  1M1X B;  4LGQ A;  1D6Y A;  1Y4K A;  1D6U A;  1TTO A;  2XFT A;  3Q3F A;  2F56 A;  3AGN A;  3F7S A;  1BVI A;  3U97 A;  1CYV A;  3X41 A;  1KSI A;  1A2P A;  1BSB A;  1KWI A;  4O2H A;  5G1L A;  1BRK A;  3D5I A;  4CPK A;  1FUT A;  3K0Z A;  2XGN A;  3OW2 2;  1VQP 3;  3BND A;  3D5G A;  1RJO A;  1JRQ A;  2HMO B;  4FMB A;  2YFL B;  1I2E A;  2CFL A;  2BU4 A;  3DZL A;  1GY5 A;  1AY7 A;  1HYF A;  5FGO A;  1UCK A;  1BNI A;  3DUK A;  3EN1 B;  3S28 A;  1US1 A;  1BRJ A;  4BIR A;  1IK3 A;  1DVC A;  3CCV 3;  3CCM 3;  1DMQ A;  1IT7 A;  4RNZ A;  3MHE A;  5CXO A;  4EYC A;  5IG0 A;  1X1U A;  2Z7A A;  4PEJ A;  3V92 A;  4XDV A;  1RRH A;  4FR9 A;  2QGU A;  3JUO A;  2WO0 A;  3LXU X;  1RCK A;  2J8X B;  3SOY A;  2CHC A;  1DYU A;  2IA7 A;  2P0X A;  3KII A;  2HMN B;  1GOU A;  1VZZ A;  4LMI A;  3LTB A;  3UJM A;  2W56 B;  4HM2 B;  3U1W A;  3CPO A;  3D4A A;  1PY3 A;  5G1K A;  4N6L A;  2CC3 A;  1BU4 A;  1O7H B;  1WQL B;  2STD A;  3FKA A;  4STD A;  5EQL A;  1GMQ A;  1RMS A;  1T5Y A;  4BTW A;  1TU5 A;  3O8Y A;  4FMC A;  1UCL A;  4HM3 B;  1TRQ A;  1YGW A;  3G16 A;  1BUJ A;  3WHO A;  1I3F A;  4X2H A;  3I0Y A;  2CW9 A;  4X2O A;  1DVD A;  4LYL B;  3AMO B;  3WOE B;  2FXT A;  5AII A;  3B8L A;  5IEP A;  4R80 A;  3DY5 A;  1X1X A;  3AMO A;  3NX0 A;  1K41 A;  3GZX B;  1UW1 A;  2OTJ 3;  4HZB B;  1HU9 A;  1SJW A;  3I56 3;  4JRF A;  1JKG B;  3HI7 A;  1FGQ A;  2KF5 A;  3DM8 A;  3DXO A;  2PZV A;  5ELJ A;  1OAC A;  1JKG A;  3CNX A;  1ASK A;  1YVS A;  3X42 A;  3X3Y A;  1UGH I;  3F7X A;  1YVB I;  1SPU A;  4EV2 A;  3SLU A;  4RNT A;  1KQS 2;  1RNB A;  5LC7 A;  3OWU A;  4MJD A;  1R4Y A;  1BSA A;  4LZI A;  1VQO 3;  2W9Q A;  4MEI A;  1G96 A;  2YFI B;  2W04 A;  3KSP A;  1A2V A;  1GS3 A;  4O02 B;  5A0O B;  2XH9 A;  1BAO A;  3MYT A;  3JUP A;  3VF1 A;  3S27 A;  3KSE D;  1AQZ A;  1TP6 A;  1R4C A;  1BNG A;  3KFQ C;  3LML A;  3LTA A;  1Q7H A;  3NBR A;  2AAD A;  1BRS A;  3NM2 A;  4U13 A;  2BMR B;  3Q2P A;  4XBX A;  1JB2 A;  1VQ6 3;  1G02 A;  8CHO A;  3FF0 A;  3HK4 A;  1B21 A;  1O7M B;  1OPY A;  3RGA A;  2CFD A;  2WGQ A;  1FUW A;  3DGY A;  2IMJ A;  2GEY A;  2OTL 3;  1BSD A;  2HMJ B;  3DGL A;  5AYS C;  2QIY A;  5JPU A;  4K1V A;  1RKY A;  1EKM A;  3PS8 A;  1ULJ B;  1STF I;  3EQQ B;  2BHM A;  1O7G B;  2FGT A;  2JQ5 A;  2Z6B A;  9RNT A;  3CNM A;  2FNQ A;  3EF8 A;  4RNY A;  5BIR A;  4WYK B;  2E2V A;  2KRT A;  3WA2 X;  5AEW B;  3SED A;  3T0U A;  3CCS 3;  2XSH B;  1A2K A;  4BU4 A;  5KP3 A;  5STD A;  1AV4 A;  3PXM A;  4XM4 A;  3UNL A;  1U8C B;  2ZA4 A;  4G1M B;  2R4I A;  1IQ8 A;  2OQE C;  3URP A;  1YJN 3;  1B2S A;  1BUQ A;  1W6Y A;  1OF5 B;  3SVA A;  2RCD A;  5IEN A;  1AVK A;  1C54 A;  2O9U X;  5TGN A;  1OUN A;  1RHL A;  3K5T A;  1K73 4;  1M1K 4;  2CX1 A;  4IIA A;  4LSO A;  1OF5 A;  3CC7 3;  1U5O A;  5I97 A;  2YX9 A;  3K7C A;  3FLJ A;  2UX0 A;  3NQZ A;  1W6G A;  3A5E A;  4HVN A;  4MMX B;  1NB5 I;  1RNT A;  3B7C A;  1SAR A;  1MGW A;  3T8N A;  1IQY A;  3CC4 3;  1RN7 A;  2D1W A;  1Z1S A;  1RGF A;  2XRX B;  4HM7 B;  3WDG B;  4BL3 A;  3ER7 A;  2CX0 A;  4WWU C;  1PFP A;  4MMY B;  5BVB A;  2KXG A;  3X40 A;  7STD A;  3EHC A;  1UCI A;  2CH9 A;  1HZ1 A;  1DMN A;  4FCZ A;  1W2B 2;  1B3S A;  1I0V A;  4AEQ A;  1LNI A;  2Q07 A;  3LYG A;  1IV9 A;  3BIR A;  1BNF A;  3E99 A;  1Q42 A;  1UUV B;  1WMP A;  2XF3 A;  3OWS A;  1OGZ A;  3D3L A;  1LOW A;  1WTH A;  3LT9 A;  1YGE A;  1RGA A;  2CKF B;  3MKI A;  3TDG A;  5IG3 A;  1FYS A;  1RRL A;  2F5M A;  3X3X A;  3AHS A;  1IQX A;  5IG5 A;  2KF6 A;  3LTC A;  1UCJ A;  2C10 A;  3BB9 A;  5ELU A;  1S72 3;  4L8O A;  5HGR A;  2QEX 3;  1JBT A;  1GMR A;  3N8B A;  1T3B A;  2ZL8 A;  2A15 A;  1V58 A;  5BU4 A;  3HX8 A;  3EE1 A;  3MG3 A;  1RGE A;  1UI7 A;  3T8U A;  2OOV A;  5AIG A;  2KCD A;  4WHA A;  1IVX A;  1MOL A;  2RFR A;  3QK9 A;  1ZX2 A;  4BTX A;  6GSP A;  1E3V A;  2PNC A;  2KAA A;  3PZW A;  3DH2 A;  3CMA 3;  3CC2 3;  2MC8 A;  4CCV A;  3ZG0 A;  4K1U A;  1BSE A;  1LOY A;  3HOH A;  2F5W A;  1VQL 3;  1V57 A;  3EB8 A;  1RGL A;  3FG3 A;  1KD1 4;  2XSO B;  2H0I A;  1FA3 A;  4WP5 A;  4BTY A;  5M18 A;  1I2F A;  4EC6 A;  4H61 A;  2RGQ A;  2WOF A;  3WR2 A;  5AYR B;  2CK3 H;  2W56 A;  3Q1C A;  4KFD A;  4O8S A;  1T2I A;  2GU3 A;  4HM0 B;  4HM8 B;  1RSN A;  1VQK 3;  3SYU A;  1QVF 2;  1BNR A;  5IEO A;  2W2C A;  4OK0 A;  3WA3 A;  4I4K A;  3FSD A;  4N6N B;  5EVH A;  1QAL A;  2C11 A;  4FMD A;  1BAN A;  2Y73 A;  3MG2 A;  3F9S A;  2V1L A;  1ZS7 A;  3NUV A;  1GD3 A;  4HAA A;  3OX9 A;  6STD A;  5HOH A;  3RGR A;  2OWP A;  1IV7 A;  3MWZ A;  4O3V A;  3EJV A;  4KFF A;  4J8T A;  1NDO B;  1OHO A;  2CWU A;  2OCT A;  3AHW A;  1Q40 B;  3PGB A;  4KZ1 A;  2YFJ B;  3A76 A;  1V74 A;  2RSX A;  2H0G A;  1LOV A;  2P38 A;  5JPP A;  3IPT A;  1T2H A;  1L5G B;  3G8Z A;  1TRP A;  1YIT 3;  1UI8 A;  3FCS B;  3ALA A;  2LYX A;  1IU7 A;  1IVW A;  1DMM A;  1LQM B;  1IVV A;  1OGX A;  2H0H A;  3F8X A;  4ILF A;  1NU3 A;  1EA2 A;  1QMA A;  2M7O A;  1IT8 A;  4TX4 A;  4EBG A;  1X1W A;  3GZR A;  4IPB A;  4R4K A;  3I55 3;  1B2Z A;  3CCQ 3;  1TFK A;  2BMO B;  2F86 B;  3EBY A;  1YI2 3;  4Q53 A;  2F98 A;  3CCR 3;  2KF4 A;  1IDP A;  6RNT A;  1N8R 4;  1WNH A;  4K61 A;  2ML6 A;  1G0T A;  1GMP A;  5CF1 A;  3OV4 A;  1O7N B;  1TUH A;  1M9G A;  3F8H A;  3X3Z A;  1LXE A;  2SAR A;  1N5P A;  4HM6 B;  1A90 A;  1JN5 B;  1ZO2 A;  4MMZ B;  5CF2 A;  4IT7 A;  2QA4 3;  1DE3 A;  1RDS A;  3CCU 3;  5LC6 A;  3B4O A;  3G71 3;  1JZD A;  1JN5 A;  1QVG 2;  1SQW A;  1WMO A;  1Q86 4;  1JB4 A;  1MWU A;  1LQG C;  2ML5 A;  3BU4 A;  3KN4 A;  3FGY A;  4WYK A;  3KZT A;  3AGO A;  3V98 A;  1BRI A;  1J2B A;  3WMD A;  3UB1 A;  1JBR A;  5M19 A;  3ROB A;  7GSP A;  4RBN A;  3LTD A;  1LOX A;  1AR0 A;  2W9P A;  3G4S 3;  1CQS A;  1TFO A;  3BNE A;  1B2M A;  3MG1 A;  4GHO A;  5IF6 A;  4HZ9 B;  2IUK A;  1UDI I;  1W6C A;  3NM7 A;  2XEP A;  1N8Q A;  1RN1 A;  3DGO A;  3CXC 2;  5DRV A;  2UUG C;  4R9K A;  2BIR A;  5IW9 A;  8RNT A;  3PYJ A;  3JUM A;  1BNJ A;  2WGO A;  1EEJ A;  4J5K A;  3S5C A;  2SBL A;  2K54 A;  3SXX A;  1EUI C;  3ZFZ A;  1CEW I;  3N9H A;  3WOD G;  4XB5 A;  1VQ4 3;  1RGG A;  2IY2 A;  3IMA B;  1VQ8 3;  1B20 A;  2RNT A;  4N6T A;  2CFW A;  5M1A A;  5BXQ A;  1NB3 I;  1M90 4;  4HOH A;  1B27 A;  4XBY A;  4HM5 B;  4BL2 A;  1UGI A;  1JB5 A;  2GXF A;  4HM4 B;  1EQK A;  1IYY A;  3OWY A;  3WOF B;  1OHP A;  2CFK A;  2K3D A;  3IJE B;  1VQ5 3;  1UUG B;  1ZGX A;  3PCR A;  3GAX A;  1MWT A;  1JNQ A;  2XR8 B;  2HOH A;  4N6U A;  1JJ2 2;  4CJN A;  1B2X A;  2BNG A;  4OUQ A;  1Q9E A;  2IUJ A;  4HKV B;  1E97 A;  5EEO A;  2ZDJ A;  3N54 B;  4HJL B;  2IYJ A;  4R9L A;  1Q7Y 4;  1MGR A;  1JZO A;  2BMQ B;  1N9J A;  1FW7 A;  2D42 A;  3QRD A;  1BRH A;  1GYB A;  1I0X A;  1I8V A;  4EW5 A;  1MWS A;  4L8P A;  5KP1 A;  2MF7 A;  4KVH A;  3JUN A;  3G0K A;  4N6O B;  4QWT A;  5D82 A;  4ZM8 A;  3EX9 A;  3L0R A;  4RZM A;  3G6E 3;  3B4P A;  2INX A;  2KF3 A;  2CIU A;  5IER A;  1ULI B;  4KFE A;  2Z77 A;  3JVC A;  4R1K A;  1BIR A;  1WMN A;  3EC9 A;  3HII A;  3S67 A;  3SX1 A;  4AKZ A;  3CME 3;  1YHQ 3;  3K63 A;  3DGN A;  3F40 A;  4I5Q A;  3S29 A;  1W00 A;  2CG0 A;  1W7C A;  3Q90 A; 
#chains in the Genus database with same CATH homology
 1Q81 4;  1QAK A;  3DGM A;  4GL6 A;  1STD A;  4EV5 A;  1VQM 3;  4HYZ A;  3BNC A;  1KC8 4;  4JF8 A;  5IG4 A;  3GRD A;  2W6J H;  3UL5 A;  4EXR A;  3STD A;  3FZW A;  1ROV A;  3F14 A;  4NHF A;  4HM1 B;  4L7K A;  5G2G A;  2GBW B;  3OXA A;  1O7W B;  4N6M A;  5AIF A;  3CPW 2;  4K90 B;  3H51 A;  3RDE A;  3BNB A;  1GD4 A;  1IVU A;  1N9E A;  2GEX A;  4OVM A;  1Q40 A;  1F8N A;  1O7P B;  2F99 A;  2K0M A;  3CCJ 3;  2BO9 B;  2Z76 A;  1W02 A;  1W2Z A;  5CLK A;  3GZY B;  3KE7 A;  3FH1 A;  1GY7 A;  2P05 A;  3MSO A;  2HML B;  4AKY A;  2GBX B;  2P09 A;  3GWR A;  3EN8 A;  4GB5 A;  1NO3 A;  2OQE A;  2O3O A;  5DRE A;  3J7Y d;  1W01 A;  1ISK A;  3H3H A;  2BT3 A;  2GU1 A;  5AI1 A;  3ECF A;  4XBT A;  5D83 A;  3VSY A;  2W0Q A;  3CCE 3;  1VQ9 3;  1CYU A;  1TIJ A;  1N5H A;  4FCJ A;  2OOV C;  1FGT A;  1K28 A;  3LZA A;  3LH4 A;  4WFO A;  2L4V A;  1W5Z A;  1AVL A;  2P0M A;  1FGO A;  3M8C A;  2HMK B;  3JUQ A;  1NWW A;  1VQ7 3;  1A67 A;  1LNH A;  3NHX A;  1GY6 A;  3LT8 A;  3HZP A;  3NBJ A;  3UL6 A;  1JV2 B;  3DMC A;  1OH0 A;  2E2T A;  2XFS A;  2B1X B;  3NXJ A;  3BLZ A;  5D81 A;  1SIH A;  1YJW 3;  1FGR A;  1D6Z A;  2JDI H;  3D9R A;  4J9A A;  3K9M C;  1S5A A;  3NBB A;  1QAF A;  2CFG A;  1MNL A;  3NQY A;  4H3U A;  3EBT A;  2CWV A;  3PCS A;  1HKX A;  1ROA A;  2W03 A;  4NRE A;  4N6V 0;  3CD6 3;  4N3V A;  2HMM B;  3FG1 A;  2LQV A;  4XDW A;  1EG9 B;  1VQN 3;  2CG1 A;  1PU4 A;  1C7H A;  5CK6 A;  2E2U A;  3LOY A;  1SII A;  5FW5 A;  5JBS A;  3FF2 A;  1W4N A;  4FCM A;  4CDL A;  4LEH A;  1Q82 4;  4HBR A;  4FMA A;  3V99 A;  3MPH A;  5KP4 A;  3CU3 A;  1OCV A;  2CWT A;  3KKG A;  3NV0 B;  4ORL A;  1K8A 4;  5AIH A;  1YJ9 3;  2XGL A;  3NV0 A;  3VGN A;  2WOH A;  2B24 B;  1E3R A;  1FGM A;  3FG4 A;  3GZB A;  3SOA A;  3CCL 3;  2Y74 A;  1UUW B;  3HIG A;  5AEU B;  2I9W A;  1NJI 4;  1QJG A;  1K9M 4;  1LVN A;  1YIJ 3;  1OHS A;  1M1X B;  4LGQ A;  1D6Y A;  1Y4K A;  1D6U A;  2XFT A;  3F7S A;  3U97 A;  1CYV A;  3X41 A;  1KSI A;  1KWI A;  4O2H A;  3K0Z A;  3OW2 2;  2XGN A;  1VQP 3;  3BND A;  1RJO A;  1JRQ A;  2HMO B;  4FMB A;  2YFL B;  2CFL A;  3DZL A;  1GY5 A;  3DUK A;  3EN1 B;  3S28 A;  1US1 A;  1IK3 A;  1DVC A;  3CCV 3;  3CCM 3;  1DMQ A;  1IT7 A;  4RNZ A;  3MHE A;  5CXO A;  4EYC A;  5IG0 A;  2Z7A A;  4PEJ A;  3V92 A;  4XDV A;  1RRH A;  4FR9 A;  2QGU A;  3JUO A;  2WO0 A;  3LXU X;  3SOY A;  2CHC A;  1DYU A;  2P0X A;  2IA7 A;  3KII A;  2HMN B;  1VZZ A;  4LMI A;  3LTB A;  3UJM A;  2W56 B;  4HM2 B;  3U1W A;  3CPO A;  4N6L A;  2CC3 A;  1O7H B;  1WQL B;  2STD A;  3FKA A;  4STD A;  5EQL A;  4BTW A;  1T5Y A;  1TU5 A;  3O8Y A;  4FMC A;  4HM3 B;  3G16 A;  4X2H A;  3I0Y A;  2CW9 A;  4X2O A;  1DVD A;  3AMO B;  3WOE B;  2FXT A;  5AII A;  3B8L A;  5IEP A;  4R80 A;  3DY5 A;  3NX0 A;  3AMO A;  1K41 A;  3GZX B;  1UW1 A;  2OTJ 3;  4HZB B;  1HU9 A;  1SJW A;  3I56 3;  4JRF A;  1JKG B;  3HI7 A;  1FGQ A;  3DM8 A;  3DXO A;  2PZV A;  5ELJ A;  1OAC A;  1JKG A;  3CNX A;  1ASK A;  3X42 A;  3X3Y A;  3F7X A;  1YVB I;  1SPU A;  4EV2 A;  3SLU A;  1KQS 2;  5LC7 A;  3OWU A;  4MJD A;  4LZI A;  1VQO 3;  2W9Q A;  4MEI A;  1G96 A;  2YFI B;  2W04 A;  3KSP A;  1A2V A;  1GS3 A;  4O02 B;  5A0O B;  2XH9 A;  3MYT A;  3JUP A;  3VF1 A;  3S27 A;  3KSE D;  1TP6 A;  5FGO A;  1R4C A;  3LML A;  3KFQ C;  3LTA A;  3NM2 A;  3NBR A;  4U13 A;  2BMR B;  3Q2P A;  4XBX A;  1JB2 A;  1VQ6 3;  8CHO A;  3FF0 A;  3HK4 A;  1O7M B;  1OPY A;  3RGA A;  2CFD A;  2WGQ A;  1FUW A;  2IMJ A;  2GEY A;  2OTL 3;  2HMJ B;  3DGL A;  5AYS C;  2QIY A;  5JPU A;  4K1V A;  1RKY A;  1EKM A;  3PS8 A;  1ULJ B;  1STF I;  3EQQ B;  2BHM A;  1O7G B;  2FGT A;  2JQ5 A;  2Z6B A;  3CNM A;  2FNQ A;  3EF8 A;  4RNY A;  4WYK B;  2E2V A;  2KRT A;  3WA2 X;  5AEW B;  3SED A;  3T0U A;  3CCS 3;  2XSH B;  1A2K A;  5KP3 A;  5STD A;  1AV4 A;  3PXM A;  4XM4 A;  3UNL A;  1U8C B;  4G1M B;  2R4I A;  1IQ8 A;  2OQE C;  1YJN 3;  1BUQ A;  1W6Y A;  1OF5 B;  3SVA A;  2RCD A;  5IEN A;  1AVK A;  2O9U X;  5TGN A;  1OUN A;  3K5T A;  1M1K 4;  1K73 4;  4IIA A;  4LSO A;  1OF5 A;  3CC7 3;  1U5O A;  5I97 A;  2YX9 A;  3K7C A;  3FLJ A;  2UX0 A;  3NQZ A;  1W6G A;  4HVN A;  4MMX B;  1NB5 I;  3T8N A;  3B7C A;  1IQY A;  3CC4 3;  1RN7 A;  2D1W A;  1Z1S A;  2XRX B;  4HM7 B;  3WDG B;  3ER7 A;  4WWU C;  1PFP A;  4MMY B;  5BVB A;  2KXG A;  3X40 A;  7STD A;  3EHC A;  2CH9 A;  4FCZ A;  1DMN A;  1W2B 2;  4AEQ A;  2Q07 A;  3LYG A;  1IV9 A;  3E99 A;  1Q42 A;  1UUV B;  2XF3 A;  1WMP A;  3OWS A;  1OGZ A;  3D3L A;  1WTH A;  3LT9 A;  1YGE A;  2CKF B;  3MKI A;  3TDG A;  5IG3 A;  1RRL A;  3X3X A;  1IQX A;  5IG5 A;  3LTC A;  5ELU A;  2C10 A;  3BB9 A;  1S72 3;  4L8O A;  5HGR A;  2QEX 3;  3N8B A;  2ZL8 A;  2A15 A;  3HX8 A;  3EE1 A;  3MG3 A;  1UI7 A;  3T8U A;  2OOV A;  5AIG A;  2KCD A;  4WHA A;  1IVX A;  1MOL A;  2RFR A;  3QK9 A;  1ZX2 A;  4BTX A;  1E3V A;  2PNC A;  3PZW A;  3CMA 3;  3CC2 3;  2MC8 A;  4CCV A;  4K1U A;  1VQL 3;  3FG3 A;  3EB8 A;  1KD1 4;  2XSO B;  1FA3 A;  4WP5 A;  4BTY A;  4EC6 A;  4H61 A;  2RGQ A;  2WOF A;  5AYR B;  2CK3 H;  2W56 A;  3Q1C A;  4KFD A;  4O8S A;  2GU3 A;  4HM0 B;  4HM8 B;  1VQK 3;  1QVF 2;  5IEO A;  2W2C A;  4OK0 A;  3WA3 A;  4I4K A;  3FSD A;  4N6N B;  5EVH A;  1QAL A;  2C11 A;  4FMD A;  2Y73 A;  3MG2 A;  3F9S A;  2V1L A;  3NUV A;  1GD3 A;  6STD A;  3OX9 A;  3RGR A;  2OWP A;  1IV7 A;  3MWZ A;  4O3V A;  3EJV A;  4KFF A;  4J8T A;  1NDO B;  1OHO A;  2CWU A;  2OCT A;  4KZ1 A;  1Q40 B;  3PGB A;  2YFJ B;  3A76 A;  1V74 A;  2RSX A;  2P38 A;  5JPP A;  3IPT A;  1L5G B;  3G8Z A;  1YIT 3;  1UI8 A;  3FCS B;  3ALA A;  2LYX A;  1IU7 A;  1IVW A;  1DMM A;  1IVV A;  1OGX A;  3F8X A;  1NU3 A;  1EA2 A;  1QMA A;  2M7O A;  1IT8 A;  4TX4 A;  4EBG A;  3GZR A;  4IPB A;  4R4K A;  3I55 3;  3CCQ 3;  1TFK A;  2BMO B;  2F86 B;  3EBY A;  1YI2 3;  4Q53 A;  2F98 A;  3CCR 3;  1IDP A;  1N8R 4;  1WNH A;  4K61 A;  2ML6 A;  5CF1 A;  3OV4 A;  1O7N B;  1TUH A;  1M9G A;  3F8H A;  3X3Z A;  1LXE A;  1N5P A;  4HM6 B;  1A90 A;  1JN5 B;  1ZO2 A;  4MMZ B;  5CF2 A;  4IT7 A;  2QA4 3;  3CCU 3;  5LC6 A;  3B4O A;  3G71 3;  1QVG 2;  1JN5 A;  1SQW A;  1WMO A;  1Q86 4;  1JB4 A;  2ML5 A;  3KN4 A;  4WYK A;  3V98 A;  3FGY A;  3KZT A;  1J2B A;  3WMD A;  3UB1 A;  3ROB A;  4RBN A;  3LTD A;  1LOX A;  1AR0 A;  2W9P A;  3G4S 3;  1CQS A;  1TFO A;  3BNE A;  3MG1 A;  5IF6 A;  4HZ9 B;  2IUK A;  1W6C A;  3NM7 A;  2XEP A;  1N8Q A;  3DGO A;  3CXC 2;  5DRV A;  4R9K A;  5IW9 A;  3PYJ A;  3JUM A;  2WGO A;  3S5C A;  2SBL A;  2K54 A;  3SXX A;  1CEW I;  3N9H A;  3WOD G;  4XB5 A;  1VQ4 3;  3IMA B;  1VQ8 3;  4N6T A;  2CFW A;  5BXQ A;  1NB3 I;  1M90 4;  4XBY A;  4HM5 B;  1JB5 A;  2GXF A;  4HM4 B;  1EQK A;  3OWY A;  3WOF B;  1OHP A;  2CFK A;  3IJE B;  1VQ5 3;  3PCR A;  3GAX A;  1JNQ A;  2XR8 B;  4N6U A;  1JJ2 2;  2BNG A;  4OUQ A;  2IUJ A;  4HKV B;  1E97 A;  5EEO A;  2ZDJ A;  3N54 B;  4HJL B;  4R9L A;  1Q7Y 4;  2BMQ B;  1N9J A;  2D42 A;  3QRD A;  1GYB A;  5KP1 A;  4L8P A;  2MF7 A;  4KVH A;  3JUN A;  3G0K A;  4N6O B;  4QWT A;  5D82 A;  4ZM8 A;  3EX9 A;  3L0R A;  4RZM A;  3G6E 3;  3B4P A;  2INX A;  2CIU A;  5IER A;  1ULI B;  4KFE A;  2Z77 A;  3JVC A;  4R1K A;  1WMN A;  3EC9 A;  3SX1 A;  3HII A;  3S67 A;  4AKZ A;  3CME 3;  1YHQ 3;  3K63 A;  3DGN A;  3F40 A;  3S29 A;  1W00 A;  2CG0 A;  1W7C A;  3Q90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...