1GD4A

Solution structure of p25s cystatin a
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
b'MIPGGLSEAKPATPEIQEIVDKVKSQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYLHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTATIN A
molecule tags Protein binding
source organism Homo sapiens
publication title Structural comparison between wild-type and P25S human cystatin A by NMR spectroscopy. Does this mutation affect the a-helix conformation ?
pubmed doi rcsb
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2000-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1gd4A00
1MOLA 3PXMA 1G96A 4CCVA 1CYVA 3KSED 1LXEA 4N6MA 5EQLA 1KWIA 4N6TA 5A0OB 1FA3A 1ROAA 4LZIA 4N6NB 1R4CA 4ZM8A 1NB5I 3GAXA 3QRDA 1A90A 1YVBI 5ELJA 3S67A 1WNHA 2W9PA 1CEWI 1GD3A 1NB3I 5LC7A 3PYJA 1GD4A 1DVDA 3Q2PA 3L0RA 2OCTA 1EQKA 3PS8A 3UL6A 4TX4A 4EYCA 1TIJA 2BO9B 1CYUA 1FUWA 2CH9A 1M9GA 3IMAB 3MWZA 3NX0A 3KFQC 3LH4A 1MNLA 1PFPA 4N6V0 1N9JA 2W9QA 1N5PA 1IV7A 1STFI 1DVCA 2O9UX 1A67A 3UL5A 4N6LA 5ELUA 1RN7A 4N6OB 4N6UA 2KXGA 1N5HA 1IV9A 5LC6A 3K9MC 3SVAA 4IT7A
chains in the Genus database with same CATH superfamily
4HM1B 2CFGA 4MMYB 1ZGXA 2WO0A 3FLJA 1KWIA 4O3VA 3HOHA 2OOVC 1V58A 2BMOB 3QRDA 4WYKB 4FCMA 1GD3A 3LTDA 1DVDA 3Q3FA 1I2EA 2BU4A 3K63A 4G1MB 4LMIA 4EYCA 1OGZA 1WQLB 1I2GA 3LH4A 1JBTA 3KIIA 1BVIA 2IUKA 3F9SA 4R9LA 3U97A 1N5PA 1VQQA 2O9UX 1DMNA 4RNZA 1FGMA 2R41A 3I0YA 1U5OA 3PCRA 4XBYA 1W6CA 3RNTA 2GU3A 2P05A 1LVNA 5AYRB 1OGXA 4BTXA 1MWRA 2O3OA 3NUVA 5M18A 1YI23 1G96A 1X1YA 1CYVA 3GRDA 1M1XB 1O7HB 2XGLA 4HM6B 1TFOA 5KP4A 4EW5A 5CF1A 1JRQA 1SQWA 2HOHA 1RRHA 2HMJB 1OHOA 4HM4B 3ALAA 1QAKA 1GY6A 1W6YA 3L0RA 1OHPA 1K9M4 4FMDA 1O7NB 2OQEC 3MSOA 1VQ43 1WMPA 4J5GA 2CG0A 1LQMB 4EBGA 2MC8A 2F4YA 4FMBA 1OCVA 1ROVA 1L5GB 2W6JH 1BRKA 1LQGC 3CCS3 1IV9A 4K90B 6STDA 2AADA 3MG3A 3HIGA 1E97A 1RN4A 2C11A 1V74A 2UGIA 1D6YA 2CWUA 5EQLA 2CWVA 3SEDA 1BAOA 2E2UA 2CFKA 2RCDA 3KCHA 5IG5A 4I5QA 1J2BA 5HGRA 4X2HA 3LZAA 3S67A 1RN1A 5G2GA 5G1KA 1RCKA 1BRIA 1GOUA 1RGAA 4AKZA 3MKIA 3HX8A 3PZWA 3Q90A 2W0QA 3X40A 3K5TA 2PNCA 2KF4A 5D82A 1B20A 4JRFA 1KC84 1DMMA 1K8A4 1CYUA 4HOHA 4HVNA 1JN5B 5IG0A 3LT9A 1STDA 1EUIC 3NHXA 4KT3B 3EBTA 1BIRA 1I3FA 1RN7A 2K0MA 4X2OA 1VQ53 4RNYA 2L1SA 3LXUX 4GHOA 3AHSA 3FF0A 1AV4A 4CCVA 4BL3A 1MWSA 5IEPA 2HMNB 1O7PB 1M904 4N6TA 3SX1A 1ISKA 4FCJA 5A0OB 4LZIA 1I0VA 1LNIA 2ZDJA 4R80A 3X42A 1JNQA 3X3ZA 1HKXA 1GMQA 2KRTA 1FW7A 3JUMA 4HYZA 2IY2A 2ML6A 6GSPA 3BLZA 2ZL8A 4IPBA 4NPBA 3DM8A 1RJOA 1IVWA 5RNTA 1BSEA 1UI8A 1BNJA 3NX0A 4U13A 3BNDA 2XGNA 1VQ93 1N9JA 2GEYA 2XRXB 3A5EA 1BNFA 2XEPA 4R9KA 4O8SA 4RNTA 3WA2X 1TU5A 1AQZA 1QJGA 3FGYA 1NJI4 1IQYA 3NV0B 1Q42A 4XDVA 1Y4KA 1C7HA 3EJVA 5AIIA 1CQSA 1VQO3 1UW1A 1MOLA 5AIGA 5KP1A 3Q1CA 1UDII 1IT8A 1AY7A 2XR8B 1W5ZA 1IYYA 4R4KA 4N6NB 3EN1B 1RGHA 3AGOA 1UUGB 4XBTA 1N9EA 3T8UA 3MPHA 2CK3H 1EQKA 1UI7A 3KZTA 3G0KA 4BTYA 3SOYA 3GZXB 1BNEA 1IDPA 1VQ73 3DUKA 4STDA 3S5CA 1OUNA 3UL5A 4N6LA 4MJDA 3K0ZA 3H3HA 3D79A 3IJEB 3EBYA 1MWUA 4BL2A 1EA2A 1JB4A 1V57A 1M1K4 1GSPA 4K61A 1BOXA 2UUGC 4WHAA 1YJ93 1WTHA 1CH0A 7RNTA 1BRJA 3CPW2 2F56A 1YNVX 1GOVA 3A76A 1OF5A 2P0MA 1FGTA 3GZRA 3RGRA 3F8HA 2I9WA 2AAEA 5AEWB 1GYBA 4MMXB 1LNHA 1SIIA 3FSDA 4FMCA 3DXOA 1UCKA 4HBRA 5FW5A 3PYJA 5LC7A 1QVG2 2OQEA 3EQQB 3KSPA 1GOYA 4DKIA 2CH9A 5IG4A 2JDIH 1SIHA 2KF5A 3BB9A 3FH1A 3EF8A 1VQK3 4HM8B 3BIRA 1ULIB 3EN8A 4ILFA 4K1VA 3WOFB 1DVCA 1UUVB 5IF6A 3NM2A 2YFLB 3DMCA 4KZ1A 1MGRA 3DGNA 3VF1A 3CCU3 1BRNL 1RGLA 3BNCA 5BVBA 3S27A 2B24B 2RBIA 3OX9A 2CW9A 4R1KA 4ORLA 5STDA 3BU4A 4L7KA 1W02A 2CWTA 3FG4A 3EC9A 3CCR3 3CCV3 5BU4A 4LSOA 1IQ8A 5D83A 2W2CA 2RSXA 1BRSA 3CXC2 2Z77A 2W04A 3N54B 1VZZA 2F99A 2WOHA 4KFFA 1G0TA 4JF8A 3U1WA 4HJLB 3VGNA 1YJW3 5JPUA 1KQS2 1VQ83 1A2KA 2XF3A 1BU4A 3CCJ3 1S723 3JUOA 3IMAB 3QK9A 3URPA 1US1A 1LRAA 2CC3A 3B8LA 5EEOA 5IW9A 3FZWA 1W00A 3NV0A 1D6UA 2Z76A 1RGKA 4MMZB 2L4VA 1YGEA 5ELUA 4RBNA 1QALA 2P38A 4N6UA 1RNTA 1O7WB 1W2B2 1JZOA 2ZHXB 3UNLA 1JN5A 1ZS7A 2BMRB 2IUJA 1AR0A 2F5WA 1RMSA 4AKYA 2BHMA 3AMOB 4I4KA 4O2HA 1YIJ3 1FA3A 3CME3 1ROAA 1QVF2 3PCSA 3NBRA 3GAXA 1NB5I 1EEJA 4BIRA 3JUPA 1WNHA 1BNSA 3LTAA 3CCQ3 4EV5A 1GD4A 3D9RA 4XBXA 4EV2A 3BNEA 2BO9B 2INXA 3CPOA 4J8TA 5AYSC 1A2PA 2XFSA 4N6V0 2WGQA 1Q7Y4 4J5KA 1IV7A 3D5IA 1B2SA 1RTUA 3DGMA 3TDGA 1HU9A 4BU4A 3V92A 4HM5B 5EVHA 3K7CA 2YFJB 1LOYA 1S5AA 1RGCA 1BSAA 5LC6A 1B2UA 3RGAA 1DE3A 3STDA 5M1AA 3G6E3 3D3LA 2PZVA 3GWRA 3UB1A 9RNTA 1BNGA 4WFOA 4HM0B 1RHLA 3JVCA 1I0XA 1SJWA 3NBBA 5ELJA 3CC23 3V98A 2P09A 3Q2PA 1VQ63 2WOFA 4NREA 5M19A 1LOVA 1FUWA 3MG2A 2M7OA 2XFTA 6RNTA 1KD14 1I70A 1AVKA 4HAAA 2D42A 1STFI 3GZYB 3NBJA 3FKAA 2SARA 2KF6A 4GB5A 1B2ZA 4N6OB 5CK6A 5CLKA 1E3RA 3CCL3 5IERA 1NNVA 1RGEA 4IT7A 4WWUC 2C10A 3AHWA 8RNTA 1OHSA 5AIFA 1FGQA 4HZ9B 1IU7A 1IT7A 1YIT3 3JUQA 1R4CA 3EX9A 1TRQA 1Q40A 2V1LA 1YVBI 2E2VA 2RFRA 1I2FA 1FGRA 7STDA 4OUQA 1YVSA 4GL6A 4XM4A 1UGHI 2Y73A 5BXQA 3WR2A 4KVHA 3BNBA 2ML5A 4CDLA 5JBSA 1EKMA 1N8R4 2IA7A 2R4IA 3KFQC 1K41A 1RDSA 1VQP3 3SXXA 3OWYA 2W9QA 1JB2A 5AEUB 4FCZA 1ZO2A 5AIHA 1GY7A 3V99A 1RSNA 3N8BA 2J8XB 3FG1A 2ZA4A 2WGOA 2LQVA 1EG9B 2IYJA 3KKGA 2IMJA 2A15A 2OTJ3 3AMOA 5JPPA 3S28A 1NU3A 1U8CB 5HOHA 1N8QA 3NXJA 1UGIA 3OXAA 1GMPA 3EE1A 1BRGA 4ZM8A 1IK3A 1BSCA 4HZBB 1BGSA 3LT8A 3WMDA 3I563 1RNBA 4HM2B 2CG1A 1NO3A 4H3UA 4WYKA 3G713 2LYXA 3WA3A 4OK0A 3CC73 3MWZA 2GU1A 2H0IA 1ASKA 1Q40B 5CF2A 1JV2B 3CC43 1C54A 4OVMA 4IIAA 4J9AA 1YHQ3 1OACA 4HM7B 1VQL3 3MHEA 3ECFA 1K734 3AGNA 3ER7A 4LEHA 3SLUA 1O7GB 1JJ22 1JBSA 3WDGB 2F5MA 3DGYA 2GBXB 3PGBA 2CIUA 4EXRA 1UCIA 2BIRA 3OV4A 2CFLA 3J7Yd 1OF5B 1W2ZA 1MGWA 3H51A 3HIIA 1G02A 5TGNA 3LMLA 3LYGA 1SPUA 1W6GA 1B27A 1MWTA 1CEWI 2Z7AA 2FXTA 2RGQA 1I8VA 2HMMB 2W56A 3O8YA 5FGOA 2OCTA 1HYFA 1SARA 3G4S3 1Q9EA 1TJDA 2XSOB 5I97A 3CU3A 1Q824 1MNLA 2OOVA 1NWWA 1T3BA 3WODG 4L8OA 4RZMA 1RKYA 4CJNA 4O02B 3G16A 1VQM3 1X1WA 5G1LA 2B1XB 1RGFA 2STDA 3G8ZA 4PEJA 5IEOA 1JKGA 1N5HA 1Q7HA 3B4OA 1JBRA 3SVAA 1TP6A 2HMKB 1TFKA 1BSDA 1LOXA 1QAFA 4K1UA 1YJN3 4KFDA 2BNGA 1PY3A 2GBWB 1O7MB 2JQ5A 4BTWA 1BANA 1WMOA 1LOWA 1A90A 1OPYA 2W9PA 3S29A 3OWSA 1FUSA 1BNRA 1BUJA 3KE7A 2QA43 1DMQA 1AVLA 1DYUA 4EC6A 2Z6BA 3CD63 1GY5A 2CX1A 3GZBA 1R4YA 1RGGA 1M9GA 3DY5A 3HK4A 3LTBA 5DRVA 1FUTA 1ULJB 1IQXA 2D1WA 3EB8A 2F98A 3RDEA 3B4PA 1BUQA 2GEXA 3FCSB 3KN4A 1B21A 5KP3A 1JB5A 2HMLB 3DGLA 2Q07A 3CNMA 1T2HA 5AI1A 3CCE3 1ZX2A 2KXGA 3K9MC 3HI7A 2GSPA 3DGOA 4FMAA 3X3XA 1TUHA 4N6MA 1T5YA 2YX9A 3ZG5A 7GSPA 1HZ1A 2CHCA 1X1UA 2KCDA 2MF7A 3D4AA 3F7SA 3MG1A 4H61A 1I3IA 4Q53A 3F8XA 1T2IA 2E2TA 2P0XA 2BMQB 3DZLA 2FNQA 2CFWA 1YGWA 2QEX3 2KF3A 3VSYA 5DREA 3NM7A 2RNTA 4MEIA 3HZPA 1FGOA 1KSIA 2H0HA 2SBLA 2YFIB 3LOYA 3NQYA 4FR9A 1UUWB 2FGTA 1B3SA 2QGUA 2XH9A 3N9HA 4WP5A 4XB5A 3UJMA 3X3YA 1BNIA 3EHCA 1W4NA 1JZDA 2K3DA 1DETA 1QMAA 3IPTA 2XSHB 4KFEA 2C4BA 3KSED 1W01A 1LXEA 2CKFB 1K28A 2W03A 3ROBA 5IG3A 1GS3A 3F14A 3SYUA 4NHFA 1FYSA 1F8NA 2W56B 4HM3B 1FZUA 2BT3A 3CNXA 5BIRA 1A2VA 1RLSA 2Y74A 5D81A 1Q864 3M8CA 1PYLA 3F7XA 3WOEB 3PS8A 4HKVB 3UL6A 2F86B 2CFDA 1GMRA 1TIJA 1IVVA 2HMOB 3NQZA 4TX4A 1B2XA 5IENA 3ZG0A 1Q814 1PFPA 3B7CA 3D5GA 3DH2A 3I553 3ZFZA 1A67A 1JKGB 3OW22 2OTL3 1Z1SA 3CCM3 3E99A 1D6ZA 3JUNA 2CX0A 4GSPA 4L8PA 3CMA3 1UCJA 2H0GA 2QIYA 3PXMA 3WHOA 2UX0A 3T8NA 1IVXA 3FG3A 4XDWA 1UCLA 3MYTA 1B2MA 2K54A 1NB3I 2KAAA 4QWTA 1BRHA 3SOAA 3LTCA 1RRLA 3GSPA 4LYLB 3T0UA 1OH0A 1VQN3 2OWPA 8CHOA 1WMNA 5GSPA 4CPKA 1BSBA 1NDOB 1PU4A 3F40A 1E3VA 1RCLA 4LGQA 1IVUA 3OWUA 1TRPA 5CXOA 1X1XA 2GXFA 3FF2A 1TTOA 1W7CA 3X41A 4AEQA 4N3VA
chains in the Genus database with same CATH topology
4HM1B 2CFGA 4MMYB 2WO0A 3FLJA 4O3VA 1KWIA 2OOVC 2BMOB 3QRDA 4WYKB 4FCMA 1GD3A 3LTDA 1DVDA 4G1MB 3K63A 4LMIA 4EYCA 1OGZA 1WQLB 3LH4A 3KIIA 2IUKA 3F9SA 4R9LA 3U97A 1N5PA 2O9UX 1DMNA 4RNZA 1FGMA 3PCRA 3I0YA 1U5OA 4XBYA 1W6CA 2GU3A 2P05A 1LVNA 5AYRB 1OGXA 4BTXA 2O3OA 3NUVA 1YI23 1G96A 1CYVA 3GRDA 1M1XB 1O7HB 2XGLA 4HM6B 1TFOA 5KP4A 5CF1A 1JRQA 1SQWA 1RRHA 2HMJB 1OHOA 4HM4B 3ALAA 1QAKA 1GY6A 1W6YA 3L0RA 1OHPA 1K9M4 4FMDA 1O7NB 2OQEC 3MSOA 1VQ43 1WMPA 2CG0A 4EBGA 2MC8A 4FMBA 1OCVA 1ROVA 1L5GB 2W6JH 3CCS3 1IV9A 4K90B 6STDA 3MG3A 3HIGA 1E97A 2C11A 1V74A 1D6YA 2CWUA 5EQLA 2CWVA 3SEDA 2E2UA 2CFKA 2RCDA 5IG5A 1J2BA 5HGRA 4X2HA 3LZAA 3S67A 5G2GA 4AKZA 3MKIA 3HX8A 3PZWA 3Q90A 2W0QA 3X40A 3K5TA 2PNCA 5D82A 1CYUA 4JRFA 1KC84 1DMMA 1K8A4 4HVNA 1JN5B 5IG0A 3LT9A 1STDA 3NHXA 3EBTA 1RN7A 2K0MA 4X2OA 1VQ53 4RNYA 3LXUX 3FF0A 1AV4A 4CCVA 5IEPA 2HMNB 1O7PB 1M904 4N6TA 3SX1A 1ISKA 4FCJA 5A0OB 4LZIA 2ZDJA 4R80A 3X42A 1JNQA 3X3ZA 1HKXA 2KRTA 3JUMA 4HYZA 2ML6A 3BLZA 2ZL8A 4IPBA 3DM8A 1RJOA 1IVWA 1UI8A 3NX0A 4U13A 3BNDA 2XGNA 1VQ93 1N9JA 2GEYA 2XRXB 4R9KA 3WA2X 2XEPA 4O8SA 1TU5A 1QJGA 3FGYA 1NJI4 1IQYA 3NV0B 1Q42A 4XDVA 1Y4KA 3EJVA 1C7HA 5AIIA 1CQSA 1VQO3 1UW1A 1MOLA 5AIGA 5KP1A 3Q1CA 1IT8A 2XR8B 1W5ZA 4R4KA 4N6NB 3EN1B 4XBTA 1N9EA 3T8UA 3MPHA 2CK3H 1EQKA 1UI7A 3KZTA 3G0KA 4BTYA 3SOYA 3GZXB 1IDPA 1VQ73 3DUKA 4STDA 3S5CA 1OUNA 3UL5A 4N6LA 4MJDA 3K0ZA 3H3HA 3IJEB 3EBYA 1EA2A 1JB4A 1M1K4 4K61A 4WHAA 1YJ93 1WTHA 3CPW2 3A76A 1OF5A 2P0MA 1FGTA 3GZRA 3RGRA 3F8HA 2I9WA 5AEWB 1GYBA 4MMXB 1LNHA 1SIIA 3FSDA 4FMCA 3DXOA 4HBRA 5FW5A 5LC7A 3PYJA 1QVG2 2OQEA 3EQQB 3KSPA 2CH9A 5IG4A 2JDIH 1SIHA 3FH1A 3BB9A 3EF8A 1VQK3 4HM8B 3EN8A 1ULIB 3WOFB 4K1VA 1DVCA 1UUVB 5IF6A 3NM2A 2YFLB 3DMCA 4KZ1A 3DGNA 3VF1A 3CCU3 3BNCA 5BVBA 3S27A 2B24B 3OX9A 2CW9A 4R1KA 4ORLA 5STDA 4L7KA 1W02A 2CWTA 3FG4A 3EC9A 3CCR3 3CCV3 4LSOA 1IQ8A 5D83A 2W2CA 2RSXA 3CXC2 2Z77A 2W04A 3N54B 1VZZA 2F99A 2WOHA 4KFFA 4JF8A 3U1WA 4HJLB 3VGNA 1YJW3 5JPUA 1KQS2 1VQ83 1A2KA 2XF3A 1S723 3CCJ3 3JUOA 3IMAB 3QK9A 1US1A 2CC3A 3B8LA 5EEOA 5IW9A 3FZWA 1W00A 3NV0A 1D6UA 2Z76A 4MMZB 2L4VA 1YGEA 5ELUA 4RBNA 1QALA 2P38A 4N6UA 1O7WB 1W2B2 3UNLA 1JN5A 2BMRB 2IUJA 1AR0A 1YIJ3 4AKYA 2BHMA 3AMOB 4I4KA 4O2HA 1FA3A 3CME3 1ROAA 1QVF2 3PCSA 3NBRA 3GAXA 1NB5I 3JUPA 1WNHA 3LTAA 3CCQ3 4EV5A 1GD4A 3D9RA 4XBXA 4EV2A 3BNEA 2BO9B 2INXA 3CPOA 4J8TA 5AYSC 2XFSA 4N6V0 2WGQA 1Q7Y4 1IV7A 3TDGA 3DGMA 1HU9A 3V92A 4HM5B 5EVHA 3K7CA 2YFJB 1S5AA 5LC6A 3RGAA 3STDA 3G6E3 3D3LA 2PZVA 3GWRA 3UB1A 4WFOA 4HM0B 3JVCA 1SJWA 3NBBA 5ELJA 3CC23 3V98A 2P09A 3Q2PA 1VQ63 2WOFA 4NREA 1FUWA 3MG2A 2M7OA 2XFTA 1KD14 1AVKA 2D42A 1STFI 3GZYB 3NBJA 3FKAA 5CLKA 4GB5A 4N6OB 5CK6A 1E3RA 3CCL3 5IERA 4IT7A 4WWUC 2C10A 1OHSA 5AIFA 1FGQA 4HZ9B 1IU7A 1IT7A 1YIT3 3JUQA 1R4CA 3EX9A 2V1LA 1Q40A 1YVBI 2RFRA 2E2VA 1FGRA 7STDA 4OUQA 4GL6A 4XM4A 2Y73A 5BXQA 4KVHA 3BNBA 2ML5A 4CDLA 5JBSA 1EKMA 1N8R4 2IA7A 2R4IA 3KFQC 1K41A 1VQP3 3SXXA 3OWYA 2W9QA 1JB2A 5AEUB 4FCZA 1ZO2A 5AIHA 1GY7A 3V99A 3N8BA 3FG1A 2WGOA 2LQVA 1EG9B 3KKGA 2IMJA 2A15A 2OTJ3 3AMOA 5JPPA 3S28A 1NU3A 1U8CB 1N8QA 3NXJA 3OXAA 3EE1A 4ZM8A 1IK3A 4HZBB 3LT8A 3WMDA 3I563 4HM2B 2CG1A 1NO3A 4H3UA 4WYKA 3G713 2LYXA 3WA3A 4OK0A 3CC73 3MWZA 2GU1A 1ASKA 1Q40B 5CF2A 1JV2B 3CC43 4OVMA 4IIAA 4J9AA 1YHQ3 1OACA 4HM7B 1VQL3 3MHEA 3ECFA 1K734 3ER7A 4LEHA 3SLUA 1O7GB 1JJ22 3WDGB 2GBXB 3PGBA 2CIUA 4EXRA 3OV4A 2CFLA 3J7Yd 1OF5B 1W2ZA 3H51A 3HIIA 5TGNA 3LMLA 3LYGA 1SPUA 1W6GA 2Z7AA 1CEWI 2FXTA 2RGQA 2HMMB 2W56A 3O8YA 5FGOA 2OCTA 3G4S3 2XSOB 5I97A 3CU3A 1Q824 1MNLA 2OOVA 1NWWA 3WODG 4L8OA 4RZMA 1RKYA 4O02B 3G16A 1VQM3 2B1XB 3G8ZA 2STDA 4PEJA 5IEOA 1JKGA 1N5HA 3B4OA 3SVAA 1TP6A 2HMKB 1TFKA 1QAFA 1LOXA 4K1UA 1YJN3 4KFDA 2BNGA 2GBWB 1O7MB 2JQ5A 4BTWA 1WMOA 1A90A 1OPYA 2W9PA 3S29A 3OWSA 3KE7A 2QA43 1DMQA 1AVLA 1DYUA 4EC6A 2Z6BA 3CD63 1GY5A 3GZBA 3HK4A 1M9GA 3DY5A 3LTBA 5DRVA 2D1WA 1ULJB 1IQXA 3EB8A 2F98A 3RDEA 3B4PA 1BUQA 2GEXA 3FCSB 3KN4A 5KP3A 1JB5A 2HMLB 3DGLA 2Q07A 3CNMA 5AI1A 3CCE3 1ZX2A 2KXGA 3K9MC 3HI7A 3DGOA 4FMAA 3X3XA 1TUHA 4N6MA 1T5YA 2YX9A 2CHCA 2KCDA 2MF7A 3F7SA 3MG1A 4H61A 4Q53A 3F8XA 2E2TA 2P0XA 2BMQB 3DZLA 2FNQA 2CFWA 2QEX3 3VSYA 5DREA 3NM7A 4MEIA 3HZPA 1FGOA 1KSIA 2SBLA 2YFIB 3LOYA 3NQYA 4FR9A 1UUWB 2FGTA 2QGUA 3N9HA 2XH9A 4WP5A 4XB5A 3UJMA 3X3YA 3EHCA 1W4NA 1QMAA 3IPTA 2XSHB 4KFEA 3KSED 1W01A 1LXEA 2CKFB 2W03A 1K28A 3ROBA 5IG3A 1GS3A 3F14A 4NHFA 1F8NA 2W56B 4HM3B 2BT3A 3CNXA 1A2VA 2Y74A 5D81A 1Q864 3M8CA 3F7XA 3WOEB 3PS8A 4HKVB 3UL6A 2F86B 2CFDA 1TIJA 2HMOB 1IVVA 3NQZA 4TX4A 5IENA 1Q814 1PFPA 3B7CA 3I553 1A67A 1JKGB 3OW22 2OTL3 1Z1SA 3CCM3 3E99A 1D6ZA 3JUNA 4L8PA 3CMA3 2QIYA 3PXMA 2UX0A 3T8NA 1IVXA 3FG3A 4XDWA 3MYTA 2K54A 1NB3I 4QWTA 3SOAA 3LTCA 1RRLA 3T0UA 1OH0A 1VQN3 2OWPA 8CHOA 1WMNA 1NDOB 1PU4A 3F40A 1E3VA 4LGQA 1IVUA 3OWUA 5CXOA 3FF2A 2GXFA 1W7CA 3X41A 4AEQA 4N3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MOL A;  3PXM A;  1G96 A;  4CCV A;  1CYV A;  3KSE D;  1LXE A;  4N6M A;  5EQL A;  1KWI A;  4N6T A;  5A0O B;  1FA3 A;  1ROA A;  4LZI A;  4N6N B;  1R4C A;  4ZM8 A;  1NB5 I;  3GAX A;  3QRD A;  1A90 A;  1YVB I;  5ELJ A;  3S67 A;  1WNH A;  2W9P A;  1CEW I;  1GD3 A;  1NB3 I;  5LC7 A;  3PYJ A;  1GD4 A;  1DVD A;  3Q2P A;  3L0R A;  2OCT A;  1EQK A;  3PS8 A;  3UL6 A;  4TX4 A;  4EYC A;  1TIJ A;  2BO9 B;  1CYU A;  1FUW A;  2CH9 A;  1M9G A;  3IMA B;  3MWZ A;  3NX0 A;  3KFQ C;  3LH4 A;  1MNL A;  1PFP A;  4N6V 0;  1N9J A;  2W9Q A;  1N5P A;  1IV7 A;  1STF I;  1DVC A;  2O9U X;  1A67 A;  3UL5 A;  4N6L A;  5ELU A;  1RN7 A;  4N6O B;  4N6U A;  2KXG A;  1N5H A;  1IV9 A;  5LC6 A;  3K9M C;  3SVA A;  4IT7 A; 
#chains in the Genus database with same CATH topology
 4HM1 B;  2CFG A;  4MMY B;  1ZGX A;  2WO0 A;  3FLJ A;  1KWI A;  4O3V A;  3HOH A;  2OOV C;  1V58 A;  2BMO B;  3QRD A;  4WYK B;  4FCM A;  1GD3 A;  3LTD A;  1DVD A;  3Q3F A;  1I2E A;  2BU4 A;  3K63 A;  4G1M B;  4LMI A;  4EYC A;  1OGZ A;  1WQL B;  1I2G A;  3LH4 A;  1JBT A;  3KII A;  1BVI A;  2IUK A;  3F9S A;  4R9L A;  3U97 A;  1N5P A;  1VQQ A;  2O9U X;  1DMN A;  4RNZ A;  1FGM A;  2R41 A;  3I0Y A;  1U5O A;  3PCR A;  4XBY A;  1W6C A;  3RNT A;  2GU3 A;  2P05 A;  1LVN A;  5AYR B;  1OGX A;  4BTX A;  1MWR A;  2O3O A;  3NUV A;  5M18 A;  1YI2 3;  1G96 A;  1X1Y A;  1CYV A;  3GRD A;  1M1X B;  1O7H B;  2XGL A;  4HM6 B;  1TFO A;  5KP4 A;  4EW5 A;  5CF1 A;  1JRQ A;  1SQW A;  2HOH A;  1RRH A;  2HMJ B;  1OHO A;  4HM4 B;  3ALA A;  1QAK A;  1GY6 A;  1W6Y A;  3L0R A;  1OHP A;  1K9M 4;  4FMD A;  1O7N B;  2OQE C;  3MSO A;  1VQ4 3;  1WMP A;  4J5G A;  2CG0 A;  1LQM B;  4EBG A;  2MC8 A;  2F4Y A;  4FMB A;  1OCV A;  1ROV A;  1L5G B;  2W6J H;  1BRK A;  1LQG C;  3CCS 3;  1IV9 A;  4K90 B;  6STD A;  2AAD A;  3MG3 A;  3HIG A;  1E97 A;  1RN4 A;  2C11 A;  1V74 A;  2UGI A;  1D6Y A;  2CWU A;  5EQL A;  2CWV A;  3SED A;  1BAO A;  2E2U A;  2CFK A;  2RCD A;  3KCH A;  5IG5 A;  4I5Q A;  1J2B A;  5HGR A;  4X2H A;  3LZA A;  3S67 A;  1RN1 A;  5G2G A;  5G1K A;  1RCK A;  1BRI A;  1GOU A;  1RGA A;  4AKZ A;  3MKI A;  3HX8 A;  3PZW A;  3Q90 A;  2W0Q A;  3X40 A;  3K5T A;  2PNC A;  2KF4 A;  5D82 A;  1B20 A;  4JRF A;  1KC8 4;  1DMM A;  1K8A 4;  1CYU A;  4HOH A;  4HVN A;  1JN5 B;  5IG0 A;  3LT9 A;  1STD A;  1EUI C;  3NHX A;  4KT3 B;  3EBT A;  1BIR A;  1I3F A;  1RN7 A;  2K0M A;  4X2O A;  1VQ5 3;  4RNY A;  2L1S A;  3LXU X;  4GHO A;  3AHS A;  3FF0 A;  1AV4 A;  4CCV A;  4BL3 A;  1MWS A;  5IEP A;  2HMN B;  1O7P B;  1M90 4;  4N6T A;  3SX1 A;  1ISK A;  4FCJ A;  5A0O B;  4LZI A;  1I0V A;  1LNI A;  2ZDJ A;  4R80 A;  3X42 A;  1JNQ A;  3X3Z A;  1HKX A;  1GMQ A;  2KRT A;  1FW7 A;  3JUM A;  4HYZ A;  2IY2 A;  2ML6 A;  6GSP A;  3BLZ A;  2ZL8 A;  4IPB A;  4NPB A;  3DM8 A;  1RJO A;  1IVW A;  5RNT A;  1BSE A;  1UI8 A;  1BNJ A;  3NX0 A;  4U13 A;  3BND A;  2XGN A;  1VQ9 3;  1N9J A;  2GEY A;  2XRX B;  3A5E A;  1BNF A;  2XEP A;  4R9K A;  4O8S A;  4RNT A;  3WA2 X;  1TU5 A;  1AQZ A;  1QJG A;  3FGY A;  1NJI 4;  1IQY A;  3NV0 B;  1Q42 A;  4XDV A;  1Y4K A;  1C7H A;  3EJV A;  5AII A;  1CQS A;  1VQO 3;  1UW1 A;  1MOL A;  5AIG A;  5KP1 A;  3Q1C A;  1UDI I;  1IT8 A;  1AY7 A;  2XR8 B;  1W5Z A;  1IYY A;  4R4K A;  4N6N B;  3EN1 B;  1RGH A;  3AGO A;  1UUG B;  4XBT A;  1N9E A;  3T8U A;  3MPH A;  2CK3 H;  1EQK A;  1UI7 A;  3KZT A;  3G0K A;  4BTY A;  3SOY A;  3GZX B;  1BNE A;  1IDP A;  1VQ7 3;  3DUK A;  4STD A;  3S5C A;  1OUN A;  3UL5 A;  4N6L A;  4MJD A;  3K0Z A;  3H3H A;  3D79 A;  3IJE B;  3EBY A;  1MWU A;  4BL2 A;  1EA2 A;  1JB4 A;  1V57 A;  1M1K 4;  1GSP A;  4K61 A;  1BOX A;  2UUG C;  4WHA A;  1YJ9 3;  1WTH A;  1CH0 A;  7RNT A;  1BRJ A;  3CPW 2;  2F56 A;  1YNV X;  1GOV A;  3A76 A;  1OF5 A;  2P0M A;  1FGT A;  3GZR A;  3RGR A;  3F8H A;  2I9W A;  2AAE A;  5AEW B;  1GYB A;  4MMX B;  1LNH A;  1SII A;  3FSD A;  4FMC A;  3DXO A;  1UCK A;  4HBR A;  5FW5 A;  3PYJ A;  5LC7 A;  1QVG 2;  2OQE A;  3EQQ B;  3KSP A;  1GOY A;  4DKI A;  2CH9 A;  5IG4 A;  2JDI H;  1SIH A;  2KF5 A;  3BB9 A;  3FH1 A;  3EF8 A;  1VQK 3;  4HM8 B;  3BIR A;  1ULI B;  3EN8 A;  4ILF A;  4K1V A;  3WOF B;  1DVC A;  1UUV B;  5IF6 A;  3NM2 A;  2YFL B;  3DMC A;  4KZ1 A;  1MGR A;  3DGN A;  3VF1 A;  3CCU 3;  1BRN L;  1RGL A;  3BNC A;  5BVB A;  3S27 A;  2B24 B;  2RBI A;  3OX9 A;  2CW9 A;  4R1K A;  4ORL A;  5STD A;  3BU4 A;  4L7K A;  1W02 A;  2CWT A;  3FG4 A;  3EC9 A;  3CCR 3;  3CCV 3;  5BU4 A;  4LSO A;  1IQ8 A;  5D83 A;  2W2C A;  2RSX A;  1BRS A;  3CXC 2;  2Z77 A;  2W04 A;  3N54 B;  1VZZ A;  2F99 A;  2WOH A;  4KFF A;  1G0T A;  4JF8 A;  3U1W A;  4HJL B;  3VGN A;  1YJW 3;  5JPU A;  1KQS 2;  1VQ8 3;  1A2K A;  2XF3 A;  1BU4 A;  3CCJ 3;  1S72 3;  3JUO A;  3IMA B;  3QK9 A;  3URP A;  1US1 A;  1LRA A;  2CC3 A;  3B8L A;  5EEO A;  5IW9 A;  3FZW A;  1W00 A;  3NV0 A;  1D6U A;  2Z76 A;  1RGK A;  4MMZ B;  2L4V A;  1YGE A;  5ELU A;  4RBN A;  1QAL A;  2P38 A;  4N6U A;  1RNT A;  1O7W B;  1W2B 2;  1JZO A;  2ZHX B;  3UNL A;  1JN5 A;  1ZS7 A;  2BMR B;  2IUJ A;  1AR0 A;  2F5W A;  1RMS A;  4AKY A;  2BHM A;  3AMO B;  4I4K A;  4O2H A;  1YIJ 3;  1FA3 A;  3CME 3;  1ROA A;  1QVF 2;  3PCS A;  3NBR A;  3GAX A;  1NB5 I;  1EEJ A;  4BIR A;  3JUP A;  1WNH A;  1BNS A;  3LTA A;  3CCQ 3;  4EV5 A;  1GD4 A;  3D9R A;  4XBX A;  4EV2 A;  3BNE A;  2BO9 B;  2INX A;  3CPO A;  4J8T A;  5AYS C;  1A2P A;  2XFS A;  4N6V 0;  2WGQ A;  1Q7Y 4;  4J5K A;  1IV7 A;  3D5I A;  1B2S A;  1RTU A;  3DGM A;  3TDG A;  1HU9 A;  4BU4 A;  3V92 A;  4HM5 B;  5EVH A;  3K7C A;  2YFJ B;  1LOY A;  1S5A A;  1RGC A;  1BSA A;  5LC6 A;  1B2U A;  3RGA A;  1DE3 A;  3STD A;  5M1A A;  3G6E 3;  3D3L A;  2PZV A;  3GWR A;  3UB1 A;  9RNT A;  1BNG A;  4WFO A;  4HM0 B;  1RHL A;  3JVC A;  1I0X A;  1SJW A;  3NBB A;  5ELJ A;  3CC2 3;  3V98 A;  2P09 A;  3Q2P A;  1VQ6 3;  2WOF A;  4NRE A;  5M19 A;  1LOV A;  1FUW A;  3MG2 A;  2M7O A;  2XFT A;  6RNT A;  1KD1 4;  1I70 A;  1AVK A;  4HAA A;  2D42 A;  1STF I;  3GZY B;  3NBJ A;  3FKA A;  2SAR A;  2KF6 A;  4GB5 A;  1B2Z A;  4N6O B;  5CK6 A;  5CLK A;  1E3R A;  3CCL 3;  5IER A;  1NNV A;  1RGE A;  4IT7 A;  4WWU C;  2C10 A;  3AHW A;  8RNT A;  1OHS A;  5AIF A;  1FGQ A;  4HZ9 B;  1IU7 A;  1IT7 A;  1YIT 3;  3JUQ A;  1R4C A;  3EX9 A;  1TRQ A;  1Q40 A;  2V1L A;  1YVB I;  2E2V A;  2RFR A;  1I2F A;  1FGR A;  7STD A;  4OUQ A;  1YVS A;  4GL6 A;  4XM4 A;  1UGH I;  2Y73 A;  5BXQ A;  3WR2 A;  4KVH A;  3BNB A;  2ML5 A;  4CDL A;  5JBS A;  1EKM A;  1N8R 4;  2IA7 A;  2R4I A;  3KFQ C;  1K41 A;  1RDS A;  1VQP 3;  3SXX A;  3OWY A;  2W9Q A;  1JB2 A;  5AEU B;  4FCZ A;  1ZO2 A;  5AIH A;  1GY7 A;  3V99 A;  1RSN A;  3N8B A;  2J8X B;  3FG1 A;  2ZA4 A;  2WGO A;  2LQV A;  1EG9 B;  2IYJ A;  3KKG A;  2IMJ A;  2A15 A;  2OTJ 3;  3AMO A;  5JPP A;  3S28 A;  1NU3 A;  1U8C B;  5HOH A;  1N8Q A;  3NXJ A;  1UGI A;  3OXA A;  1GMP A;  3EE1 A;  1BRG A;  4ZM8 A;  1IK3 A;  1BSC A;  4HZB B;  1BGS A;  3LT8 A;  3WMD A;  3I56 3;  1RNB A;  4HM2 B;  2CG1 A;  1NO3 A;  4H3U A;  4WYK A;  3G71 3;  2LYX A;  3WA3 A;  4OK0 A;  3CC7 3;  3MWZ A;  2GU1 A;  2H0I A;  1ASK A;  1Q40 B;  5CF2 A;  1JV2 B;  3CC4 3;  1C54 A;  4OVM A;  4IIA A;  4J9A A;  1YHQ 3;  1OAC A;  4HM7 B;  1VQL 3;  3MHE A;  3ECF A;  1K73 4;  3AGN A;  3ER7 A;  4LEH A;  3SLU A;  1O7G B;  1JJ2 2;  1JBS A;  3WDG B;  2F5M A;  3DGY A;  2GBX B;  3PGB A;  2CIU A;  4EXR A;  1UCI A;  2BIR A;  3OV4 A;  2CFL A;  3J7Y d;  1OF5 B;  1W2Z A;  1MGW A;  3H51 A;  3HII A;  1G02 A;  5TGN A;  3LML A;  3LYG A;  1SPU A;  1W6G A;  1B27 A;  1MWT A;  1CEW I;  2Z7A A;  2FXT A;  2RGQ A;  1I8V A;  2HMM B;  2W56 A;  3O8Y A;  5FGO A;  2OCT A;  1HYF A;  1SAR A;  3G4S 3;  1Q9E A;  1TJD A;  2XSO B;  5I97 A;  3CU3 A;  1Q82 4;  1MNL A;  2OOV A;  1NWW A;  1T3B A;  3WOD G;  4L8O A;  4RZM A;  1RKY A;  4CJN A;  4O02 B;  3G16 A;  1VQM 3;  1X1W A;  5G1L A;  2B1X B;  1RGF A;  2STD A;  3G8Z A;  4PEJ A;  5IEO A;  1JKG A;  1N5H A;  1Q7H A;  3B4O A;  1JBR A;  3SVA A;  1TP6 A;  2HMK B;  1TFK A;  1BSD A;  1LOX A;  1QAF A;  4K1U A;  1YJN 3;  4KFD A;  2BNG A;  1PY3 A;  2GBW B;  1O7M B;  2JQ5 A;  4BTW A;  1BAN A;  1WMO A;  1LOW A;  1A90 A;  1OPY A;  2W9P A;  3S29 A;  3OWS A;  1FUS A;  1BNR A;  1BUJ A;  3KE7 A;  2QA4 3;  1DMQ A;  1AVL A;  1DYU A;  4EC6 A;  2Z6B A;  3CD6 3;  1GY5 A;  2CX1 A;  3GZB A;  1R4Y A;  1RGG A;  1M9G A;  3DY5 A;  3HK4 A;  3LTB A;  5DRV A;  1FUT A;  1ULJ B;  1IQX A;  2D1W A;  3EB8 A;  2F98 A;  3RDE A;  3B4P A;  1BUQ A;  2GEX A;  3FCS B;  3KN4 A;  1B21 A;  5KP3 A;  1JB5 A;  2HML B;  3DGL A;  2Q07 A;  3CNM A;  1T2H A;  5AI1 A;  3CCE 3;  1ZX2 A;  2KXG A;  3K9M C;  3HI7 A;  2GSP A;  3DGO A;  4FMA A;  3X3X A;  1TUH A;  4N6M A;  1T5Y A;  2YX9 A;  3ZG5 A;  7GSP A;  1HZ1 A;  2CHC A;  1X1U A;  2KCD A;  2MF7 A;  3D4A A;  3F7S A;  3MG1 A;  4H61 A;  1I3I A;  4Q53 A;  3F8X A;  1T2I A;  2E2T A;  2P0X A;  2BMQ B;  3DZL A;  2FNQ A;  2CFW A;  1YGW A;  2QEX 3;  2KF3 A;  3VSY A;  5DRE A;  3NM7 A;  2RNT A;  4MEI A;  3HZP A;  1FGO A;  1KSI A;  2H0H A;  2SBL A;  2YFI B;  3LOY A;  3NQY A;  4FR9 A;  1UUW B;  2FGT A;  1B3S A;  2QGU A;  2XH9 A;  3N9H A;  4WP5 A;  4XB5 A;  3UJM A;  3X3Y A;  1BNI A;  3EHC A;  1W4N A;  1JZD A;  2K3D A;  1DET A;  1QMA A;  3IPT A;  2XSH B;  4KFE A;  2C4B A;  3KSE D;  1W01 A;  1LXE A;  2CKF B;  1K28 A;  2W03 A;  3ROB A;  5IG3 A;  1GS3 A;  3F14 A;  3SYU A;  4NHF A;  1FYS A;  1F8N A;  2W56 B;  4HM3 B;  1FZU A;  2BT3 A;  3CNX A;  5BIR A;  1A2V A;  1RLS A;  2Y74 A;  5D81 A;  1Q86 4;  3M8C A;  1PYL A;  3F7X A;  3WOE B;  3PS8 A;  4HKV B;  3UL6 A;  2F86 B;  2CFD A;  1GMR A;  1TIJ A;  1IVV A;  2HMO B;  3NQZ A;  4TX4 A;  1B2X A;  5IEN A;  3ZG0 A;  1Q81 4;  1PFP A;  3B7C A;  3D5G A;  3DH2 A;  3I55 3;  3ZFZ A;  1A67 A;  1JKG B;  3OW2 2;  2OTL 3;  1Z1S A;  3CCM 3;  3E99 A;  1D6Z A;  3JUN A;  2CX0 A;  4GSP A;  4L8P A;  3CMA 3;  1UCJ A;  2H0G A;  2QIY A;  3PXM A;  3WHO A;  2UX0 A;  3T8N A;  1IVX A;  3FG3 A;  4XDW A;  1UCL A;  3MYT A;  1B2M A;  2K54 A;  1NB3 I;  2KAA A;  4QWT A;  1BRH A;  3SOA A;  3LTC A;  1RRL A;  3GSP A;  4LYL B;  3T0U A;  1OH0 A;  1VQN 3;  2OWP A;  8CHO A;  1WMN A;  5GSP A;  4CPK A;  1BSB A;  1NDO B;  1PU4 A;  3F40 A;  1E3V A;  1RCL A;  4LGQ A;  1IVU A;  3OWU A;  1TRP A;  5CXO A;  1X1X A;  2GXF A;  3FF2 A;  1TTO A;  1W7C A;  3X41 A;  4AEQ A;  4N3V A; 
#chains in the Genus database with same CATH homology
 4HM1 B;  2CFG A;  4MMY B;  2WO0 A;  3FLJ A;  4O3V A;  1KWI A;  2OOV C;  2BMO B;  3QRD A;  4WYK B;  4FCM A;  1GD3 A;  3LTD A;  1DVD A;  4G1M B;  3K63 A;  4LMI A;  4EYC A;  1OGZ A;  1WQL B;  3LH4 A;  3KII A;  2IUK A;  3F9S A;  4R9L A;  3U97 A;  1N5P A;  2O9U X;  1DMN A;  4RNZ A;  1FGM A;  3PCR A;  3I0Y A;  1U5O A;  4XBY A;  1W6C A;  2GU3 A;  2P05 A;  1LVN A;  5AYR B;  1OGX A;  4BTX A;  2O3O A;  3NUV A;  1YI2 3;  1G96 A;  1CYV A;  3GRD A;  1M1X B;  1O7H B;  2XGL A;  4HM6 B;  1TFO A;  5KP4 A;  5CF1 A;  1JRQ A;  1SQW A;  1RRH A;  2HMJ B;  1OHO A;  4HM4 B;  3ALA A;  1QAK A;  1GY6 A;  1W6Y A;  3L0R A;  1OHP A;  1K9M 4;  4FMD A;  1O7N B;  2OQE C;  3MSO A;  1VQ4 3;  1WMP A;  2CG0 A;  4EBG A;  2MC8 A;  4FMB A;  1OCV A;  1ROV A;  1L5G B;  2W6J H;  3CCS 3;  1IV9 A;  4K90 B;  6STD A;  3MG3 A;  3HIG A;  1E97 A;  2C11 A;  1V74 A;  1D6Y A;  2CWU A;  5EQL A;  2CWV A;  3SED A;  2E2U A;  2CFK A;  2RCD A;  5IG5 A;  1J2B A;  5HGR A;  4X2H A;  3LZA A;  3S67 A;  5G2G A;  4AKZ A;  3MKI A;  3HX8 A;  3PZW A;  3Q90 A;  2W0Q A;  3X40 A;  3K5T A;  2PNC A;  5D82 A;  1CYU A;  4JRF A;  1KC8 4;  1DMM A;  1K8A 4;  4HVN A;  1JN5 B;  5IG0 A;  3LT9 A;  1STD A;  3NHX A;  3EBT A;  1RN7 A;  2K0M A;  4X2O A;  1VQ5 3;  4RNY A;  3LXU X;  3FF0 A;  1AV4 A;  4CCV A;  5IEP A;  2HMN B;  1O7P B;  1M90 4;  4N6T A;  3SX1 A;  1ISK A;  4FCJ A;  5A0O B;  4LZI A;  2ZDJ A;  4R80 A;  3X42 A;  1JNQ A;  3X3Z A;  1HKX A;  2KRT A;  3JUM A;  4HYZ A;  2ML6 A;  3BLZ A;  2ZL8 A;  4IPB A;  3DM8 A;  1RJO A;  1IVW A;  1UI8 A;  3NX0 A;  4U13 A;  3BND A;  2XGN A;  1VQ9 3;  1N9J A;  2GEY A;  2XRX B;  4R9K A;  3WA2 X;  2XEP A;  4O8S A;  1TU5 A;  1QJG A;  3FGY A;  1NJI 4;  1IQY A;  3NV0 B;  1Q42 A;  4XDV A;  1Y4K A;  3EJV A;  1C7H A;  5AII A;  1CQS A;  1VQO 3;  1UW1 A;  1MOL A;  5AIG A;  5KP1 A;  3Q1C A;  1IT8 A;  2XR8 B;  1W5Z A;  4R4K A;  4N6N B;  3EN1 B;  4XBT A;  1N9E A;  3T8U A;  3MPH A;  2CK3 H;  1EQK A;  1UI7 A;  3KZT A;  3G0K A;  4BTY A;  3SOY A;  3GZX B;  1IDP A;  1VQ7 3;  3DUK A;  4STD A;  3S5C A;  1OUN A;  3UL5 A;  4N6L A;  4MJD A;  3K0Z A;  3H3H A;  3IJE B;  3EBY A;  1EA2 A;  1JB4 A;  1M1K 4;  4K61 A;  4WHA A;  1YJ9 3;  1WTH A;  3CPW 2;  3A76 A;  1OF5 A;  2P0M A;  1FGT A;  3GZR A;  3RGR A;  3F8H A;  2I9W A;  5AEW B;  1GYB A;  4MMX B;  1LNH A;  1SII A;  3FSD A;  4FMC A;  3DXO A;  4HBR A;  5FW5 A;  5LC7 A;  3PYJ A;  1QVG 2;  2OQE A;  3EQQ B;  3KSP A;  2CH9 A;  5IG4 A;  2JDI H;  1SIH A;  3FH1 A;  3BB9 A;  3EF8 A;  1VQK 3;  4HM8 B;  3EN8 A;  1ULI B;  3WOF B;  4K1V A;  1DVC A;  1UUV B;  5IF6 A;  3NM2 A;  2YFL B;  3DMC A;  4KZ1 A;  3DGN A;  3VF1 A;  3CCU 3;  3BNC A;  5BVB A;  3S27 A;  2B24 B;  3OX9 A;  2CW9 A;  4R1K A;  4ORL A;  5STD A;  4L7K A;  1W02 A;  2CWT A;  3FG4 A;  3EC9 A;  3CCR 3;  3CCV 3;  4LSO A;  1IQ8 A;  5D83 A;  2W2C A;  2RSX A;  3CXC 2;  2Z77 A;  2W04 A;  3N54 B;  1VZZ A;  2F99 A;  2WOH A;  4KFF A;  4JF8 A;  3U1W A;  4HJL B;  3VGN A;  1YJW 3;  5JPU A;  1KQS 2;  1VQ8 3;  1A2K A;  2XF3 A;  1S72 3;  3CCJ 3;  3JUO A;  3IMA B;  3QK9 A;  1US1 A;  2CC3 A;  3B8L A;  5EEO A;  5IW9 A;  3FZW A;  1W00 A;  3NV0 A;  1D6U A;  2Z76 A;  4MMZ B;  2L4V A;  1YGE A;  5ELU A;  4RBN A;  1QAL A;  2P38 A;  4N6U A;  1O7W B;  1W2B 2;  3UNL A;  1JN5 A;  2BMR B;  2IUJ A;  1AR0 A;  1YIJ 3;  4AKY A;  2BHM A;  3AMO B;  4I4K A;  4O2H A;  1FA3 A;  3CME 3;  1ROA A;  1QVF 2;  3PCS A;  3NBR A;  3GAX A;  1NB5 I;  3JUP A;  1WNH A;  3LTA A;  3CCQ 3;  4EV5 A;  1GD4 A;  3D9R A;  4XBX A;  4EV2 A;  3BNE A;  2BO9 B;  2INX A;  3CPO A;  4J8T A;  5AYS C;  2XFS A;  4N6V 0;  2WGQ A;  1Q7Y 4;  1IV7 A;  3TDG A;  3DGM A;  1HU9 A;  3V92 A;  4HM5 B;  5EVH A;  3K7C A;  2YFJ B;  1S5A A;  5LC6 A;  3RGA A;  3STD A;  3G6E 3;  3D3L A;  2PZV A;  3GWR A;  3UB1 A;  4WFO A;  4HM0 B;  3JVC A;  1SJW A;  3NBB A;  5ELJ A;  3CC2 3;  3V98 A;  2P09 A;  3Q2P A;  1VQ6 3;  2WOF A;  4NRE A;  1FUW A;  3MG2 A;  2M7O A;  2XFT A;  1KD1 4;  1AVK A;  2D42 A;  1STF I;  3GZY B;  3NBJ A;  3FKA A;  5CLK A;  4GB5 A;  4N6O B;  5CK6 A;  1E3R A;  3CCL 3;  5IER A;  4IT7 A;  4WWU C;  2C10 A;  1OHS A;  5AIF A;  1FGQ A;  4HZ9 B;  1IU7 A;  1IT7 A;  1YIT 3;  3JUQ A;  1R4C A;  3EX9 A;  2V1L A;  1Q40 A;  1YVB I;  2RFR A;  2E2V A;  1FGR A;  7STD A;  4OUQ A;  4GL6 A;  4XM4 A;  2Y73 A;  5BXQ A;  4KVH A;  3BNB A;  2ML5 A;  4CDL A;  5JBS A;  1EKM A;  1N8R 4;  2IA7 A;  2R4I A;  3KFQ C;  1K41 A;  1VQP 3;  3SXX A;  3OWY A;  2W9Q A;  1JB2 A;  5AEU B;  4FCZ A;  1ZO2 A;  5AIH A;  1GY7 A;  3V99 A;  3N8B A;  3FG1 A;  2WGO A;  2LQV A;  1EG9 B;  3KKG A;  2IMJ A;  2A15 A;  2OTJ 3;  3AMO A;  5JPP A;  3S28 A;  1NU3 A;  1U8C B;  1N8Q A;  3NXJ A;  3OXA A;  3EE1 A;  4ZM8 A;  1IK3 A;  4HZB B;  3LT8 A;  3WMD A;  3I56 3;  4HM2 B;  2CG1 A;  1NO3 A;  4H3U A;  4WYK A;  3G71 3;  2LYX A;  3WA3 A;  4OK0 A;  3CC7 3;  3MWZ A;  2GU1 A;  1ASK A;  1Q40 B;  5CF2 A;  1JV2 B;  3CC4 3;  4OVM A;  4IIA A;  4J9A A;  1YHQ 3;  1OAC A;  4HM7 B;  1VQL 3;  3MHE A;  3ECF A;  1K73 4;  3ER7 A;  4LEH A;  3SLU A;  1O7G B;  1JJ2 2;  3WDG B;  2GBX B;  3PGB A;  2CIU A;  4EXR A;  3OV4 A;  2CFL A;  3J7Y d;  1OF5 B;  1W2Z A;  3H51 A;  3HII A;  5TGN A;  3LML A;  3LYG A;  1SPU A;  1W6G A;  2Z7A A;  1CEW I;  2FXT A;  2RGQ A;  2HMM B;  2W56 A;  3O8Y A;  5FGO A;  2OCT A;  3G4S 3;  2XSO B;  5I97 A;  3CU3 A;  1Q82 4;  1MNL A;  2OOV A;  1NWW A;  3WOD G;  4L8O A;  4RZM A;  1RKY A;  4O02 B;  3G16 A;  1VQM 3;  2B1X B;  3G8Z A;  2STD A;  4PEJ A;  5IEO A;  1JKG A;  1N5H A;  3B4O A;  3SVA A;  1TP6 A;  2HMK B;  1TFK A;  1QAF A;  1LOX A;  4K1U A;  1YJN 3;  4KFD A;  2BNG A;  2GBW B;  1O7M B;  2JQ5 A;  4BTW A;  1WMO A;  1A90 A;  1OPY A;  2W9P A;  3S29 A;  3OWS A;  3KE7 A;  2QA4 3;  1DMQ A;  1AVL A;  1DYU A;  4EC6 A;  2Z6B A;  3CD6 3;  1GY5 A;  3GZB A;  3HK4 A;  1M9G A;  3DY5 A;  3LTB A;  5DRV A;  2D1W A;  1ULJ B;  1IQX A;  3EB8 A;  2F98 A;  3RDE A;  3B4P A;  1BUQ A;  2GEX A;  3FCS B;  3KN4 A;  5KP3 A;  1JB5 A;  2HML B;  3DGL A;  2Q07 A;  3CNM A;  5AI1 A;  3CCE 3;  1ZX2 A;  2KXG A;  3K9M C;  3HI7 A;  3DGO A;  4FMA A;  3X3X A;  1TUH A;  4N6M A;  1T5Y A;  2YX9 A;  2CHC A;  2KCD A;  2MF7 A;  3F7S A;  3MG1 A;  4H61 A;  4Q53 A;  3F8X A;  2E2T A;  2P0X A;  2BMQ B;  3DZL A;  2FNQ A;  2CFW A;  2QEX 3;  3VSY A;  5DRE A;  3NM7 A;  4MEI A;  3HZP A;  1FGO A;  1KSI A;  2SBL A;  2YFI B;  3LOY A;  3NQY A;  4FR9 A;  1UUW B;  2FGT A;  2QGU A;  3N9H A;  2XH9 A;  4WP5 A;  4XB5 A;  3UJM A;  3X3Y A;  3EHC A;  1W4N A;  1QMA A;  3IPT A;  2XSH B;  4KFE A;  3KSE D;  1W01 A;  1LXE A;  2CKF B;  2W03 A;  1K28 A;  3ROB A;  5IG3 A;  1GS3 A;  3F14 A;  4NHF A;  1F8N A;  2W56 B;  4HM3 B;  2BT3 A;  3CNX A;  1A2V A;  2Y74 A;  5D81 A;  1Q86 4;  3M8C A;  3F7X A;  3WOE B;  3PS8 A;  4HKV B;  3UL6 A;  2F86 B;  2CFD A;  1TIJ A;  2HMO B;  1IVV A;  3NQZ A;  4TX4 A;  5IEN A;  1Q81 4;  1PFP A;  3B7C A;  3I55 3;  1A67 A;  1JKG B;  3OW2 2;  2OTL 3;  1Z1S A;  3CCM 3;  3E99 A;  1D6Z A;  3JUN A;  4L8P A;  3CMA 3;  2QIY A;  3PXM A;  2UX0 A;  3T8N A;  1IVX A;  3FG3 A;  4XDW A;  3MYT A;  2K54 A;  1NB3 I;  4QWT A;  3SOA A;  3LTC A;  1RRL A;  3T0U A;  1OH0 A;  1VQN 3;  2OWP A;  8CHO A;  1WMN A;  1NDO B;  1PU4 A;  3F40 A;  1E3V A;  4LGQ A;  1IVU A;  3OWU A;  5CXO A;  3FF2 A;  2GXF A;  1W7C A;  3X41 A;  4AEQ A;  4N3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...