1GDNA

Fusarium oxysporum trypsin at atomic resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
224
structure length
224
Chain Sequence
IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fusarium oxysporum trypsin at atomic resolution at 100 and 283 K: a study of ligand binding.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase substrate
molecule keywords TRYPSIN
total genus 59
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gdnA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gdnA01
3ATWA 5CHAC 8LPRA 4FU8A 3SGBE 2PKSC 2TIOA 4K69A 4ISHH 5JYIA 3S9BA 1ZOMA 2BDIA 1GJCB 4WF8A 1YGCH 1ZMLA 4Y0YE 1RTFB 2VGCC 1L0ZA 3GY6A 2UUYA 4IC5A 4ZHLU 4AYVB 3W94A 2QF3A 1F5LA 2A7HA 3TNSA 3CS0A 3ELAH 4D7FA 3LGUA 3QLPH 3MNBA 2VB0A 4FXGH 4GSOA 2J94A 2XBXA 3PROA 1O32A 2ZGBH 3IITA 5FBEA 2BQ6B 5C5NA 2P93A 3ZV9A 3FAOA 3U9AH 2ZTYA 1ZR0A 1RIWC 3ZV8A 4CH8B 1DOJA 3RC6A 3SOSA 1O38A 3MTYA 1FY3A 3KF2A 1KXAA 4I8JA 3K65B 1BTYA 1O35A 1UMAH 4KKDA 1OWEA 5A0CA 3LDXH 1MD8A 5A8ZA 1GL0E 2TGDA 2ZQ2A 4GCHG 3TVJB 3HGPA 1V2UT 1W3CA 3F9FA 5AHGH 2QN5T 1GDNA 1O30A 2C8WB 2K1QA 1AE8H 1MTVA 3NWUA 2I6SA 1GBDA 2CN0H 3EE0B 3AVZA 3QDZB 1Z71A 3SQHE 2GCHG 2TBSA 3GCHB 1K1OA 4X2WA 2FI5E 1MQ6A 5FBIA 1O3PB 5A09A 1PPFE 4UE7H 1WCZA 1P57B 1ZRBA 1O5AB 1V2MT 2ZGHA 3P8GA 3UUZA 1G3BA 4RKOB 3TH4H 3WY8A 2BLWA 2DUCA 2Y82A 1D6WA 1AKSA 3PO1B 1ESAA 3BIUH 3U8RH 1DITH 1P2JA 1TGTA 2G00A 1ZHRA 1WTHD 2VVCA 1O3FA 3UOPA 3E0NB 1ETTH 3RM2H 1TBRH 2C8YB 1LTOA 3KHVA 3A83A 4TY7A 2ZPSA 2XYAA 3RP2A 2W3KA 3DFLA 1J9CH 1FAXA 1HJ9A 1BBRH 2ANMH 4WXVA 1IQEA 1BMMH 2P95A 4LOYH 3TK6A 1TGBA 1AB9C 4H6SB 3S0NA 2BY8X 1Z6EA 5ETXA 1IQLA 1EPTB 1QURH 3GCTG 1VGCB 4TPIZ 1BJVA 2ZFQH 3PTNA 1JRSA 1CBWC 3LH1A 4CHAB 1ARCA 2ULLA 2H2ZA 2C93B 1AWFH 2F9PA 1DPOA 1E35B 1PPBH 3FANA 3SV9A 3ZVAA 3ZVEA 2EA3A 1SL3A 4MNYA 4YT6H 1SOZA 5E0GA 1LHFH 3SNAA 1RJXB 1SG8B 1PJPA 1CGIE 1L1NA 1GBTA 1BCUH 1Y5AT 2BQ7B 2A2XH 5DP7A 2ZU5A 4IS5A 1UO6A 2GV6A 5FX5A 1FNIA 4O3UA 2ZHWH 4UFEH 1XM1A 2Y5FA 1GVLA 1DFPA 1P12E 3EDXB 1EJNA 4DOQA 2BB4A 4K60A 2AMQA 5E0JA 4Y76A 3I78A 3SU2A 2YOLA 1L2EA 1OXGA 2IPHA 3I77A 1CHOG 4X8TH 1Q2WA 3FFGA 1QA0A 4X1SU 2C90B 3RC4A 1LHCH 1T4UH 4IN1A 1UTQA 3V0XA 2SGFE 2UWPA 1LPKB 6GCHG 1AN1E 1OWHA 4BAOB 1O3OA 4NSVA 2XXLA 2ALPA 4Y8ZA 3K6YA 4O97A 2ZHQH 3QWCH 3BEUA 3MNXA 4B1TA 4NA8A 4MNXA 1A5GH 3RLYH 1GHWH 3TLOA 4X1QU 1HAVA 1O2XA 1V2OT 3ZVFA 4AFSA 4XSKU 3URCA 1CT4E 5DO4H 3PLPA 1UTNA 4BAQB 3M7QA 1AFQB 1FI8A 1KIGH 7ESTE 1O5CB 2F9VA 3ZYDA 2G51A 2SGPE 2BY5X 1LKBA 1WV7H 4MPWA 2WV4A 3A86A 4WJG2 1O3CA 1OWKA 1UVPA 3LGYA 5TCAA 1GL1A 2ZCKP 2A5KA 2GKVE 2PSYA 4MPUA 1H9HE 3RXIA 2ZPRA 2ZFSA 2FYRA 1ESTA 1XX9A 4Z6AH 2FOBA 1GHYH 3SORA 1G3DA 1PQ8A 1UHBA 3E16B 3VB7A 5J4QA 1C5PA 4YZUA 1Y3XA 4FUFA 6ESTA 2P16A 3RXBA 3RMLH 5DKMA 1O2ZA 1O3EA 2VNTA 3M5OA 1YPJH 3MH6A 4R8TB 1E0FD 4BOHA 1GDUA 1NT1A 1TAWA 2ZFPH 7GCHF 1FMGA 1GGDB 1PPHE 2PGBB 3RXUA 3ZZDA 5CHAB 1RGQA 1DLEA 1JWTA 8KME2 2FI3E 2A7JA 5C3NA 3EA7A 1CBWB 3U8OH 1UCYH 2ZHDA 2CJIA 1ETSH 1ELVA 2STAE 4X6NA 2P3TB 1HYLA 1FONA 2FWWA 3FP8E 3M5LA 4BAKB 4BTTB 1KLTA 1XUJA 5A0AE 1Z8JB 2VINA 1C2FA 4IGDA 4ZKSU 3IWMA 1QL7A 3MH7A 3F9EA 1ELDE 3BTHE 1TMBH 2R2MB 2RA3A 5EQSA 2D1JA 2WUCA 1JOUB 2P3UB 1SGEE 1NO9H 3KIDU 4MNVA 3A81A 3LIWA 4R0IA 3LC3A 5C20A 1S83A 2ZU2A 3HK3B 1YPHE 1TLDA 1CHOF 1EZXC 2ZECA 1TA6A 2A5IA 4Q2KA 1YPHC 2WPHS 1DXWA 3VEQB 4AFUA 2B5TB 2P94A 3KQBA 3M5MA 2GMTB 6GCHF 1DSUA 1CT2E 2F9NA 1K1IA 1QRZA 8ESTE 4KTCA 3TJVA 1QHRB 1P2NA 4AG1A 1W7XH 2PUQH 1OP0A 3ZZBA 3M7TA 1SGYE 1S82A 1J16A 1SGIB 2BD5A 4I32A 2KAIB 1C2EA 2Q6FA 1S0RA 1XUKA 4YM9A 1B0EA 5C2ZA 1S81A 1AWHB 2ZC9H 3P95A 4UFDH 1EUFA 4BAHB 3VPKA 2VWNA 1PQ7A 1TE0A 3UNSA 1FXYA 1EAUA 3PO1C 1CVWH 1BBRE 3MU5A 2BDBA 2SGEE 2FLRH 1KLJH 1GJ7B 1TNJA 4K2YA 4A1VA 1O33A 1RD3B 4ZROA 1C2DA 3MWIU 3C27B 1MTNC 1OPHB 2UUFB 2FLBH 3RC5A 1UTPA 4D7GA 1E38B 3RXFA 1P2QA 3MMGA 3A89A 1MZDA 2WV5A 1ZGVA 4JMYA 1IHSH 1P2KA 1V2RT 1T4VH 2FS9A 2Z9KA 1SLXB 1BDAA 3D23A 2BY6X 1CT0E 4X1NU 2PUXB 5FX6A 1C1MA 1XKBC 1JBUH 3OY5U 1A46H 4B73A 2W5EA 1SI5H 1IQMA 5JPMH 1EPTC 1GHXH 4WH6A 2VWLA 4AORA 3DFJA 2HGTH 3S7HB 2W26A 3UPEA 1A7SA 3GY2A 3LOXA 4FVBA 1F0TA 1IHTH 1P8VC 3LJOA 4TPYA 3B8JA 1KTTB 5EPYA 2HOBA 4ZKNU 1TGNA 1T7CA 2A4OA 3M5NA 2ZDNA 2VGCB 4MLFB 4WMDA 2BVXH 1O31A 2ZTZA 1TNHA 1ELTA 3VB3A 2NU0E 1C1WH 2IJOB 1MQ5A 1QJ7B 2B0FA 1C4Y2 2VVUA 2Z9LA 1A0LA 2J38A 2ZGCA 5LPEA 5GCHF 2G8TA 4ZHMU 1LQDB 3V12A 1C2MA 1GJ6A 1UTKA 3OYPA 4CREA 1TGSZ 2D2DA 1RS0A 1EQ9A 1UHBB 4O03A 4M7GA 2BXTH 2GP9B 3KEEA 5E2OA 3PMJA 3E0PB 5BPEA 4QT8C 4TYDA 4ZKRU 1NM6A 4B2AA 1TRMA 2BOHB 2V35A 3MFJA 1P3EA 2BMGB 3ZZ9A 1YYY1 1GCTB 3UWIA 2TGTA 1TOMH 1C1VH 1ZJKA 2SGDE 1GBBA 3SJKA 1NC6A 4OS2A 2F83A 1ID5H 1HAHH 1L1JA 2HRVA 1KXFA 1SSXA 5K0HA 1THSH 3UQOA 4YT7H 2NU3E 2A31A 4I31A 2BDCA 6CHAC 2ZU1A 1FY5A 1HAZB 4XBDA 2XCNA 1IOEA 4A7IB 1AUTC 2SGQE 2FOAA 1ACBE 1INCA 1T31A 1K1LA 2WPMS 2ZTXA 2O8UA 3TJOA 1BTXA 3RMOH 1ELCA 2JETC 4INKA 4ABDA 2CF9H 2F9UA 1MU6B 4H42U 3SI4H 1O2PA 4IW4E 3SUDA 1KXCA 1BUIA 1UTOA 1XUGA 1PPZA 1AUJA 3N7OA 2QIQA 3A80A 2F3CE 2ZU3A 1TNIA 1BHXF 4NWKA 2WUBA 3P70B 3RU4E 3A84A 2FTLE 1PYTC 1O2QA 1DUAA 1XUFA 4FUBA 1L4DA 1CGJE 3BTGE 1O5FH 1GI9B 1FJSA 1TOCB 1CU1A 1DY9A 1ELFA 1SLVB 3RXQA 2LPRA 4NIWA 3QGNB 1RTKA 1LVOA 4B76A 1FPHH 4A1TA 1THRH 4DURA 1DT2A 1QCPA 1AKSB 2A4GA 4X1RU 4CHAC 5DK1A 1DVAH 2W3IA 1FN8A 2UWLA 1O3IA 1JXPA 4Y11E 2QA9E 1W13U 3FZZA 1K22H 1XUHA 3K2UA 3O8DA 4FUDA 3PLKA 1LVYA 5G4BA 3S9CA 1UTMA 1EPTA 1OYTH 3MU8A 2YNAA 1RRKA 3EA9A 3PWCA 4CRAA 1ZHPA 2F9OA 1SGDE 4ISOA 6LPRA 1V2PT 1LHDH 3DA9B 2H6MA 1W2KH 1QGFA 1EZQA 4OS6A 3ZZ4A 4WY3A 4VGCC 5JBAS 4JYTA 1BTWA 1QJ6B 3P8FA 1A4WH 5K7RA 1TX7A 1T8OA 3NK8A 5DG6A 4THNH 5E2PA 5EU8A 5JB8S 1G2LA 3BF6H 2GT7A 1BOQA 3U1JB 1C9PA 2P59A 2SNWA 1GCDA 2VIDA 1SR5C 3MO9A 4WMEA 2FTMA 2ZCHP 2Z9GA 3UTUH 2RA0A 3NUMA 4ABHA 1P3CA 2O9QA 1P0SH 1C4V2 4CR9A 1BA8B 5EXLA 1KXEA 1ZTLA 3SV7A 1WUNH 3ITIA 3TITA 2H5CA 4JZDH 2G55A 1V2TT 2QXGA 1G30B 1MCTA 1LHGH 8GCHF 2BD7A 3SI3H 3M3VA 1PPEE 1O36A 3M61U 1O3NA 1YCPH 2OP9A 5FPYA 3HK6B 4X2VA 1Y3UA 5HM9A 1XUIA 2ZA5A 3AAUA 1EZUC 1QY6A 2O8TA 4NFFA 1V2QT 3MU0A 1LDTT 1Z8GA 2A4QA 3DD2H 1NY22 4ZXYH 5PTPA 2ZDKA 3SQEE 3A8AA 4E7NA 2WYGA 1UVTH 2WYJA 1MKWH 4B2BA 2OC7A 1TA2A 2BLVA 1HNEE 1LO6A 1ZTKA 2XW9A 2AGIX 3F6UH 1UVUH 1A3BH 2V3HH 4F4OC 1NZQH 5C1YA 4XDEA 3MU4A 3U1IB 4INHA 4NZLA 3V13A 3ZZ5A 2R2WU 4J2YB 1A1RA 3EA8A 3Q3XA 1N6XA 3RXGA 3OTJE 3P8NA 1H8DH 1V2JT 2O8LA 3GDUA 4UONA 1ANCA 1N1LA 3UIRA 1MTSA 3SO3A 3LT3A 2BD9A 5GIBA 2HPQH 3CENA 1AVWA 4RSPA 4E05H 1HDTH 1TGCA 2VIOA 1C9TA 1PFXC 3UY9A 4BANB 2BLOA 1C5QA 4AB9A 4ZMAH 1BMAA 2THFB 2FOMB 5HYOA 3LJJA 4K1TA 3PB1E 1TBZH 3SNEA 1TQ7B 2EI8A 1C1NA 4JZFH 2PSXA 2FOGA 2ZGXH 4OS7A 1C2IA 3QZRA 2LNCA 1J14A 2GMTC 1T8LA 5GPIB 2Z6BD 1IAUA 1VITG 1DWDH 1GHBF 1SFQB 1ZMJA 2HNTC 3TH2H 3SBKA 2ZHEH 1DUEA 1EAIA 1GJ5H 1S6HA 5T6DA 2FZZA 4NSYA 5SGAE 5EXNA 1FLEE 1O37A 1WBGB 1O2VA 3L3TA 1FAKH 5GXPA 3LH3A 1TABE 3SU6A 4D76A 1D3PB 1SQTA 5A2MH 3GISB 4PROA 3TU7H 4Y10E 2P8OC 2AGEX 1C5VA 1HIAB 1QIXB 1C2JA 1V6DA 1LMWB 1EP6A 5B6OA 1IQNA 1THPB 3TGJE 4YESB 5L2YH 1OP2A 1DSTA 1FY4A 1GBJA 3NPSA 1KDQB 2BD4A 1X7AC 4NA9H 4KP0A 1HAXB 4GUXA 2AH4X 3ODFA 4DCDA 3Q3YA 2FI4E 2FX6A 2G4UA 5EW2H 1HLTH 1YLCA 1GBAA 3OSYA 5F03A 5CMXH 1V2ST 4DIIH 2ZZUH 1ANBA 1TMUH 3D49H 1DWEH 1BB0B 1BTPA 2Q6GA 4X8UH 1V2VT 4A6LA 5JBTA 1H4WA 1N8OC 1HPGA 3SU3A 2A2QH 5EW1H 5I46H 4X1PU 1TPOA 5A8XA 1HAOH 1O2SA 1QRXA 4TWWA 1C2KA 1IQGA 1H8IH 2ZFFH 4CRCA 4JK6A 1AD8H 2G81E 2XBWA 3MH5A 1G37A 3RXMA 1FIZA 4MPXA 5DP6A 2HVXA 2ANKH 5FCRA 1TYNA 1P11E 3BTKE 2FM2A 2NU1E 4CBOA 3NKKA 4CRGA 1BMLA 5DP8A 1UTLM 3ZVDA 1NRPH 2P3FH 2UUKB 3LGWA 2ZDVH 1Z7KA 1O3AA 3I29A 5L2ZH 2GCHF 1Z1IA 1A61H 1QBNA 2J4IA 3A7VA 1F5RA 2AIPA 2JH0D 2V6NA 3A82A 4AG2A 1NFUA 1H9IE 5F8XA 7GCHG 4H6TA 1GVZA 1EOLA 4FU9A 2GDDA 1A0JA 1TMTH 1BTZA 2AEIH 4CBNA 3ENSB 2FOCA 1AIXH 1GMDF 4VGCB 4DT7B 3A7XA 2OD3B 1KDQA 2SGAA 1Q31A 1PPGE 5EQQA 1C5WB 4CRDA 2KAIA 4ISIH 1HBTH 2BM2A 4X6MA 1ELGA 2XCFA 1ANEA 3AW0A 1MMJN 2JH6D 1ANDA 2G52A 3UREA 1MAYA 1C1RA 4RKJB 3TK5A 1B7XB 2FMJA 1P01A 3R0FA 1GJBB 5DGJA 1C5UA 1NRQH 1HFDA 2A32A 4ESTE 2EC9H 1ZSLA 3GCOA 1EASA 1MKXH 1B0FA 1QBVH 1SBWA 1C2HA 2FS8A 1WQSA 5ABWA 1AZZA 1K1JA 3ESTA 3SU1A 2Y6TA 1L4ZA 4HGCA 2GZ7A 4AX9H 2QXIA 1GCTC 3PMBB 1SHHB 3ATIA 1A5IA 1AGJA 2BTCE 1ORFA 1OP8A 1GJ8B 2ASUB 1DLKB 4F49A 1YCPM 4NGAH 2AYWA 3O8BA 5E8EH 4XFQA 1QR3E 1BBRK 3P92A 4DJZB 2ODPA 6CHAB 2QC2A 1D9IA 1SLUB 1F5KU 4Y7AA 4FUCA 3Q3KA 5LPRA 1G9IE 1GHBG 1JIMA 3TNTA 4WMFA 3UQVA 2XTTB 4Y0ZE 2BLQA 4GAWA 1O2WA 3BG4C 3GDSA 1O5EH 1YP9A 1P03A 2OLGA 3MOCA 5HXFA 3QGJA 3EGKH 3SUFA 3RXKA 1TRYA 3T28A 2FO9A 4D9QA 1C1SA 1U6QA 2QY0B 2Z3DA 2Z3CA 1XVMA 3ZZCA 1FY8E 2BY9X 3GY4A 4AGKA 1V2WT 4YOGA 2PKSB 1E34B 1ZSKA 4Y79A 2FOFA 5EGMA 1YKTA 2DE8A 3MHWU 4I8HA 1DY8A 1D4PB 4DVAU 4Y6DA 3ZVBA 1NFWA 1GBKA 1TX8A 2B8OH 4IMQA 4RN6A 1BHXB 1A2CH 3B9FH 1O5GH 3ATMA 4ABAA 2TRMA 4ABEA 4GLYA 5C67A 2PHBA 3BTEE 2WPKS 1Y5BT 2J34A 1QRWA 3GY8A 2XBVA 1DM4B 1GMHF 3RXCA 4NIXA 5BRRE 3PMAB 4DW2U 1MUEB 1QJ1B 2ILNA 5EOKA 1GMDG 4HI3A 5C5OA 3ZVGA 2G5VA 2ZKSA 4KTSA 2R3YA 4X8SH 3MO6A 2PKAA 2SFAA 1HUTH 1GI0A 2VIPA 2PV9B 1Z8IB 1ZRKA 5A0BA 1EOJA 4I8LA 3UOUA 1F0RA 4X8VH 4IMZA 2AERH 2V0BA 3QX5H 1TPPA 3O8RA 2NU4E 2QF0A 2ZFTA 1GG6C 1O2HA 1HAPH 2FEQH 1AE5A 2Y7ZA 4WVPE 3VXEH 1CQQA 2VVVA 3GY7A 3Q76A 4DIHH 3SGAE 3TPIZ 3PTBA 1F2SE 2OBOA 5FXLA 4ISNA 1W8BH 1GBIA 2BXUH 3LGIA 2J95A 3ZZ7A 2GT8A 1IQKA 4I8GA 3RXPA 1C5LH 4BNRA 3GCHC 2ZPQA 1OS8A 3ZZAA 5JBBS 3TJUA 1MZAA 5C1UA 1O3KA 3UR9A 4D8NA 3HKJB 3BTME 1O3DA 4UEHH 1GJ9B 3TGIE 2XNIA 1AI8H 3PM3A 1AVGH 1YPEH 1K21H 1D3TB 3SJIA 2NU2E 2ALVA 1ZSJA 2OBQA 3HPTB 3RXTA 4AFQA 3SUGA 2GVFA 3FZDA 4MNWA 1GI6A 2B9LA 3FP7E 4TWYA 1C1PA 4FUHA 4DY7B 1W12U 1ABIH 2GTBA 2CXVA 3SU5A 3AASA 2ODYB 4JZEH 1O2NA 1GWAA 1O2UA 2PW8H 1GJ4H 2OC8A 4GVUA 4YOJA 2BDGA 2BX3A 1BRCE 3QUMP 7KMEH 1FN6A 1ZYOA 2Q1JA 1K2I1 1O2LA 1FV9A 1O3HA 1H9LB 1LKAA 1KYNA 1C5NH 1K1MA 1OX1A 4NZQA 4Q7XA 1TRNA 2AIQA 3F1SB 4KELA 1D3QB 4ZXXH 1AQ7A 4E06H 1AB9B 1TQ0B 3T2NA 2A5AA 1KLIH 1SGCA 3BEIB 2A45B 1SQAA 1SLWB 1EXFA 2VIWA 1UVSH 1YC0A 4ABFA 2O8WA 4O3TA 2G4TA 3ZZ8A 3A7ZA 5ESTE 1ELEE 4A1XA 1HXEH 2FDAA 1CA0C 3SJ9A 1SC8U 1ZTJA 5EXMA 1Y3YA 1VZQH 4K1EA 3SN8A 1LCYA 1C5SA 1FDPA 2VIQA 2ZP0H 3UNRA 1NN6A 2Y7XA 1OKXA 3CP7A 3ATLA 1QB1A 2HPPH 4NWLA 1YPMH 3EAJA 1MKXK 2ODQA 3GDVA 2GD4B 5F6MA 4CH2B 1DANH 3F68H 5CE1A 1S0QA 2BD2A 3LC5A 3PV4A 2FODA 2UWOA 5IDKA 4FUGA 1HGTH 2ZGJA 2WPJS 1EKBB 1HAYB 3Q77A 4FUEA 2FPZA 1YPGH 3ZZ3A 3KQEA 1DWBH 4MG3A 4D9RA 3RMNH 3B23B 1TB6H 2ZG0H 2P8OB 3ZYEA 4YOIA 1FUJA 3BTTE 3LGVA 3UWJH 4ABIA 4GPGA 4AN7A 2F91A 1NS3A 1O3MA 3E91A 3JZ2B 1VITH 3RXJA 3W95A 4K8YA 2ZEBA 5DP4A 1LHEH 2Z3EA 1D3DB 3TIUA 3AAVA 5EQRA 3H7OA 3U69H 1HAGE 1YBWA 1MTNB 1B5GH 2QXJA 3E3TA 1SGFA 3H5CB 2TPIZ 1GHAF 4BTUB 1BRAA 2BHGA 1BITA 2ZF0H 2H9HA 2RCEA 1SGRE 1EP5A 1ARBA 4LZ1H 1GI4A 1MBQA 2ZWLH 3A7TA 5GCHG 2JKHA 3ZZ6A 3UNQA 4FUJA 4GCHF 2RDLA 3RM0H 2UUJB 2YNBA 1RTLA 3O8CA 1XKAC 4KGAA 4K1SA 2NWNA 4ZHAA 2ZQ1A 4ISLA 4MDSA 2FOHA 3RXRA 3RXLA 2GX4A 1KY9A 1CO7E 1P06A 1YCPK 1UK2A 5E0HA 1BQYA 5FPTA 5FAHA 4SGBE 1GMHG 1NU7B 5C1XA 5AF9H 3SV6A 1F0UA 1V2NT 1EB1H 3FP6E 1O2OA 1GMCG 2Z9IA 2ZI2H 3PLBA 1W14U 1NROH 4LK4A 4CRBA 5LH8A 1W0ZU 4X2YA 1TNKA 3HKIB 5AFYH 3UFAA 4U30A 4ABBA 1QQ4A 1Z8RA 3BEFB 2A7CA 3A8BA 4JK5A 2WPLS 2OC0A 2OCVB 3KCGH 4K5ZA 1K1PA 5DP5A 3M3TA 1ZGIA 1OSSA 4DGJA 4B74A 1HIAA 4LZ4B 1K1NA 1H1BA 1GMCF 1WYKA 4BXWA 2GCTB 1O2JA 1NRRH 1GG6B 1MBMA 2EEKA 2BDAA 1O3BA 3A7YA 4UFFH 1SB1H 2WINI 2AMDA 3MH4A 2EI6A 3SW2B 1P09A 2PKAB 2VU8E 3TJNA 4U01A 3V7TA 5GWZA 1GBHA 1EAWA 1O5DH 3JZ1B 3LONA 3A7WA 1QBOA 1ZMNA 1Y3WA 3SUEA 3SNCA 2CHAB 1K28D 1S85A 3GY3A 4I33A 3A88A 4JYVH 5FPSA 2CGAA 4B75A 3LGTA 1MAXA 3BV9B 5EPNA 1ZPZA 2XC5A 1JIRA 1O3GA 1OOKB 2R9PA 2IN2A 4ZAEA 1YPKH 3M37A 2ZDLA 1Z1JA 2ZFRH 1YF4A 1E36B 2ZIQH 2BX4A 1AMHA 4XBBA 3S9AA 2AMPA 4Y71A 1DDJA 2GZ9A 1CGHA 2FIRH 1EB2A 1G32B 3MI4A 1WOFA 1CA8B 1LPGB 3HGNA 3SGQE 2QV1A 4OS1A 2AFQB 1T8MA 2FXRA 4GHQA 1NU9A 2ZCLP 4AFZA 1SFIA 1DS2E 1BIOA 1GPZA 2BVSH 1O0DH 1Y3VA 1GI5A 1GI1A 4KTUA 2FOEA 1VCQA 3SU4A 5J4SA 1QNJA 2OINA 4FVDA 1NTPA 4BAMB 1IQHA 1SGFG 1NFXA 4H4FA 3VB5A 4NCYA 1JRTA 2Y5HA 5HMAA 1G36A 2JH5D 3CS7A 2ANWA 1P04A 2A0QB 3OX7U 1O5BB 1TBQH 1VJAU 5T6GA 1C2GA 1ZLRA 1ETRH 2OTVA 1V3XA 3M3SA 2GGVB 1HRTH 5DP3A 1VR1H 2R0LA 2Y80A 1MCVA 3SHAH 1NESE 1P2IA 4XBCA 1UK3A 2VWMA 3DUXH 1F7ZA 4OGYA 4NFEA 2PGQB 3SJOA 1GI3A 3STIA 1GJDB 1XMNB 1DE7H 3F9HA 3GYMA 3VXFH 5GDSH 1O2TA 2D26C 3GICB 4AOQA 1Y59T 3RXSA 1TNLA 3RXEA 4AGJA 3GYLB 5JDUB 2FYQA 3PWBA 5JBCS 1CHGA 3MU1A 1AZ8A 1IQJA 1EJAA 1HV7A 4K8BA 2C4FH 4K3JA 4XOJA 1J8AA 2QGRA 3M36A 1RIWB 1O2RA 1LVBA 1O2YA 1DWCH 4HFPB 1L1GA 1S84A 5LPFA 1LVMA 1MH0A 2GCTC 3KGPA 3ODDA 2ANYA 1VCPA 3E1XB 1BRUP 3KQCA 2BD3A 2EI7A 1W11U 4AZ2B 4Q7ZA 3A87A 4CRFA 2J92A 1AFEH 1TX6A 1VITF 2H9EH 2BOKA 1CSOE 4BXSA 3KQDA 4IN2A 1BJUA 3MO3A 3SNDA 1SGTA 2BDHA 3DHKH 2XWBI 5DP9A 3TK9A 4BTIB 3BN9A 5FCKA 1T32A 3BSQA 4B71A 4UDWH 1AU8A 1BRBE 3VFEA 2O8MA 1QFKH 1EX3A 1UCYE 1YPLH 3BTWE 1GVKB 2D8WA 2XWAA 1EATA 2CF8H 1WTGH 1C5YB 2ZDMA 3VGCB 1PYTD 3TGKE 1G3CA 1C2LA 2A1DB 4X6PA 4X0WU 2W7UA 2ZHFH 3K6ZA 3SZNA 1MTWA 1GHZA 3T25A 2HWLB 3A8DA 3GOVB 2F9BH 4CR5A 1MD7A 1A3EH 1EAXA 2BVRH 3TH3H 1MKWK 1O39A 4MTBA 2TGPZ 4I7YH 1XXDA 2QYIA 3MNSA 1HAVB 1ZHMA 4X2XA 1XVOA 1KXBA 2Z7FE 3PYHA 1W7GH 2QAAA 1AVXA 1ELBA 4O9VA 2I6QA 5F8TA 1HB0B 1UTJA 5HGGA 1C5RA 4HTCH 5A8YA 4ABJA 4A5TS 1WU1A 4JZ1A 1G3EA 2Z9JA 5AVDA 4TY6A 1FIWA 5I25A 3GCTF 4UD9H 2W7SA 4I8KA 8GCHG 2H9TH 1RFNA 1DX5M 2XC4A 3L6PA 2DE9A 3BTQE 3M35A 1N6YA 4YO9A 1G2MA 2OQUA 1NFYA 2J2UA 1O2GH 2PWXA 1O2IA 4AB8A 5LGOA 4OS4A 3SV2H 2C3SA 3MNCA 1W0YH 3QTVH 2OXSA 1SMFE 5DPAA 2QCYA 4OS5A 1QQUA 3LPRA 1GBLA 5GJ4B 1TALA 5DJ7A 5HM2A 1IQFA 4SGAE 1A5HA 3P8OA 1CA0B 1GBEA 3OU0A 1GDQA 2GV7A 1C1TA 1K9OE 3AW1A 1OWIA 3G01A 4Z0KA 1HAIH 1IQIA 1SGPE 2H1UA 1P02A 2BQWB 4HZHA 1GI8B 3S69A 1BZXE 4Y7BA 3FVFB 2VIVA 4NIYA 1FZZA 4YLUA 2XC0A 1KXDA 3BTDE 3VB6A 3PMHB 2ZU4A 1HXFH 4X6OA 3S7KB 3T27A 3QN7A 3QO6A 3RDZA 1C4U2 1QTFA 9LPRA 1QA7A 3STJA 1O2MA 1EJMA 2V3OH 1WQVH 3LU9B 1RXPA 3C1KA 1HJ8A 1AFQC 1OWDA 4U2WA 1D6RA 4MPVA 2BZ6H 3QTOH 4YTAA 1SHYA 1GBFA 3EYDA 1FY1A 3SV8A 1DICA 2FP7B 1Y5UT 4UFGH 5EODA 1VCWA 1UJ1A 1GI2A 1QB9A 4INLA 3GY5A 3ATKA 3QZQA 4AYYB 1ABJH 1ZJDA 2HLCA 2R0KA 1AO5A 2Z94A 1HJAB 2B7DH 1J15A 4Q80A 2BZAA 2BDYA 2HNTF 3SNBA 1FQ3A 2ZDAH 1BMNH 1PQAA 3T26A 2JETB 1YM0A 1KTSB 1ESBA 4NIVA 3SJ8A 2PTCE 2H5DA 2A4RA 3URDA 1O3LA 3UR6A 1OYQA 2ESTE 3V3MA 4J1YA 3KNXA 2VJ1A 1T8NA 1C5XB 3RXVA 3NCLA 1SOTA 1TPSA 3D62A 1SGNE 4WH8A 4ZKOU 2SNVA 1LQEA 1V2LT 2R3UA 3T29A 4IBLH 1Z6JH 4LXBH 2PFEA 1UVOA 2OQ5A 1GHVH 2RG3A 2STBE 1SVPA 1PPCE 1M9UA 5T3HA 1QL8A 3BG8A 1NRNH 4JYUH 4GHTA 2HALA 1O3JA 1P05A 1Q3XA 2OUAA 1GI7B 1C1QA 1NPMA 3U8TH 4IC6A 4ASHA 3T5FH 2CMYA 3A85A 4XE4A 1C1UH 2J9NA 4WWYA 1Y8TA 4B2CA 1BTHH 1P2OA 1P2MA 1TWXB 1FPCH 3SU0A 2G5NA 1O34A 3R3GB 1HCGA 1KSNA 1SGQE 1W10U 5ESBA 1JMOH 1DXPA 1NRSH 4Y8XA 1J17T 3RU4D 1C5TA 2HNTE 2QXHA 1QL9A 4YLQH 1A0HB 1MTUA 5TCCA 2Y5GA 2Q6DA 1ZPCA 3BTFE 2GDEH 2PTNA 2TGAA 3D65E 2BYAX 1SPJA 2IOTA 1S6FA 1MU8B 1EZSC 4ABGA 3HATH 2C8ZB 4JCNA 5TJXA 3P6ZB 3H7TA 1C5MD 1CE5A 3F9GA 4E7RG 2VH6A 1E37B 3T62A 1BTUA 5F8ZA 5L30H 3OY6U 3RXOA 1TFXA 3NXPA 2VWOA 9ESTA 2CHAC 3KN2A 1TONA 1SQOA 3RU4T 2Y81A 1ELAA 1C5ZB 2C8XB 3E90B 3DT0H 3QK1A 4Q7YA 1AY6H 3ZVCA 3BIVH 4WXIA 2ZO3H 1GBMA 2PLXA 4DG4A 1GJAB 3VB4A 1F0SA 3P17H 4ZH8A 3RXHA 1O2KA 1VJ9U 1P9SA 3RUOA 3VGCC 3Q00A 3A8CA 5H4IB 1V2KT 2FX4A 3L33A 1OWJA 1ZPBA 1C5OH 3RMMH 1WAYB 1HJAC 3M7UA 3GCNA 5FHTA 1AHTH 4FU7A 4MQAA 2AS9A 3EQ0H 3MYWA 1UCYK 1BT7A 1ZZZA 3RXAA 2WPIS 1XXFA 3E6PH 2PR3A 4JZIA 3E8LA 1TIOA 1TPAE 4FUIA 1UK4A 4A92A 3K9XB 2FESH 4Y8YA 2BY7X 7LPRA 1QB6A 5IYTA 3RXDA 4ZUHA 5JB9S 4OGXA 1S5SA 1YLDA 1GGDC 3SHCH 1LPZB 4NG9H 1N8OB 1P10A 1P9UA 3BG4B 2VH0A 5EG4A 2CV3A 2OC1A 4NA7A 1GBCA 1TNGA 1VGCC 2XBYA 5T6FA 1C1OA 1PQ5A 2XRCA 4U32A 2BD8A 2ZNKH 5L6NH 1GHAG 2M5TA 3NZIA 4MVNA 3U98H 3KL6A 2AGGX 3IG6B 5AFZH 3LKWA 1F92A 2GZ8A 1WSSH 3RLWH
chains in the Genus database with same CATH superfamily
3ATWA 5CHAC 8LPRA 4FU8A 3SGBE 2PKSC 2TIOA 4K69A 4ISHH 5JYIA 3S9BA 1ZOMA 2BDIA 1GJCB 4WF8A 1YGCH 1ZMLA 4Y0YE 1RTFB 2VGCC 1L0ZA 3GY6A 2UUYA 4IC5A 4ZHLU 4AYVB 3W94A 2QF3A 1F5LA 2A7HA 4TT3D 3TNSA 1YLNA 3CS0A 3ELAH 4D7FA 3LGUA 3QLPH 3MNBA 2VB0A 4FXGH 4GSOA 2J94A 2XBXA 3PROA 1O32A 1W0KD 2ZGBH 3IITA 5FBEA 2BQ6B 5C5NA 2P93A 3ZV9A 3FAOA 3U9AH 2ZTYA 5HKKD 1ZR0A 1RIWC 2QF5A 3ZV8A 4CH8B 1DOJA 3RC6A 3SOSA 1O38A 2F4LA 3MTYA 1WXRA 1FY3A 3KF2A 1KXAA 4I8JA 3K65B 1BTYA 1O35A 1UMAH 4KKDA 1OWEA 5A0CA 3LDXH 1MD8A 5A8ZA 1GL0E 2TGDA 2ZQ2A 4GCHG 3TVJB 3HGPA 1V2UT 1W3CA 3F9FA 5AHGH 2QN5T 1GDNA 1O30A 2C8WB 2K1QA 1AE8H 1MTVA 3NWUA 2I6SA 1GBDA 1E79D 2CN0H 3EE0B 3AVZA 3QDZB 1Z71A 3SQHE 2GCHG 2TBSA 3GCHB 1K1OA 4X2WA 2FI5E 2KCAA 1MQ6A 5FBIA 1O3PB 5A09A 1PPFE 4UE7H 1WCZA 1P57B 1ZRBA 1O5AB 1V2MT 2ZGHA 3P8GA 3MQKC 3UUZA 1G3BA 4RKOB 3TH4H 3WY8A 1VKYA 2BLWA 2DUCA 2Y82A 1D6WA 1AKSA 3PO1B 1ESAA 3BIUH 3U8RH 1DITH 1P2JA 1TGTA 2G00A 1ZHRA 1WTHD 2VVCA 1O3FA 3UOPA 3E0NB 1ETTH 3RM2H 1TBRH 2C8YB 1LTOA 3KHVA 3A83A 3F0OA 4TY7A 2ZPSA 2XYAA 5KEDA 3RP2A 2W3KA 3DFLA 1J9CH 1FAXA 1HJ9A 1BBRH 2ANMH 4WXVA 1IQEA 1BMMH 2P95A 3KYFA 4LOYH 3TK6A 1MABB 1TGBA 1AB9C 4H6SB 3S0NA 2BY8X 1Z6EA 5ETXA 1IQLA 1EPTB 1QURH 3GCTG 1VGCB 4TPIZ 1BJVA 2ZFQH 3PTNA 1JRSA 1CBWC 3LH1A 4CHAB 1ARCA 2ULLA 2H2ZA 2C93B 5C0UA 1AWFH 2F9PA 1DPOA 1E35B 1PPBH 3FANA 3SV9A 3ZVAA 3ZVEA 2EA3A 1SL3A 4MNYA 4YT6H 1SOZA 5E0GA 1LHFH 5EJ1A 3SNAA 1RJXB 1SG8B 1PJPA 2JIZD 1CGIE 1L1NA 1GBTA 1BCUH 1Y5AT 2BQ7B 2A2XH 5DP7A 2ZU5A 4IS5A 1UO6A 2GV6A 5FX5A 1FNIA 4O3UA 2ZHWH 4UFEH 1XM1A 2Y5FA 1GVLA 2W6JD 1DFPA 1P12E 3EDXB 1EJNA 4DOQA 2BB4A 4K60A 2AMQA 5E0JA 4Y76A 3I78A 3SU2A 2YOLA 1L2EA 1OXGA 2IPHA 3I77A 1CHOG 4X8TH 1Q2WA 3FFGA 1QA0A 3GS9A 4X1SU 2C90B 3RC4A 1LHCH 1T4UH 4IN1A 1UTQA 3V0XA 2SGFE 2GJGA 2UWPA 1LPKB 6GCHG 1AN1E 1OWHA 4BAOB 1O3OA 4NSVA 2XXLA 2ALPA 4XRNA 4Y8ZA 3K6YA 4O97A 2ZHQH 3QWCH 3BEUA 3MNXA 2WZQA 3OE7D 4NA8A 4B1TA 4MNXA 1A5GH 3RLYH 1GHWH 3TLOA 4X1QU 1HAVA 1O2XA 1V2OT 3ZVFA 4AFSA 4XSKU 3URCA 1CT4E 5DO4H 3PLPA 1UTNA 4BAQB 3M7QA 1AFQB 1FI8A 1KIGH 7ESTE 1O5CB 2F9VA 3ZYDA 2G51A 2SGPE 2BY5X 2K8IA 1LKBA 1WV7H 4MPWA 2WV4A 3A86A 4WJG2 1O3CA 1OWKA 1UVPA 3LGYA 5TCAA 1GL1A 1K0HA 2ZCKP 2A5KA 2GKVE 2PSYA 4MPUA 1H9HE 3RXIA 2F43B 2ZPRA 2ZFSA 2FYRA 1ESTA 1XX9A 4Z6AH 2FOBA 1GHYH 3SORA 1G3DA 1PQ8A 1UHBA 3E16B 3VB7A 5J4QA 1C5PA 4YZUA 1Y3XA 4FUFA 6ESTA 2P16A 3RXBA 3RMLH 5DKMA 1O2ZA 1O3EA 2VNTA 3M5OA 1YPJH 3MH6A 4R8TB 1E0FD 4BOHA 4F55A 1GDUA 1NT1A 1TAWA 2ZFPH 7GCHF 1FMGA 1GGDB 1PPHE 2PGBB 3RXUA 3ZZDA 5CHAB 1RGQA 3DSGA 1DLEA 1JWTA 8KME2 4YXWD 2FI3E 2A7JA 5C3NA 3EA7A 1CBWB 3U8OH 1UCYH 2ZHDA 2CJIA 1ETSH 1ELVA 2STAE 4X6NA 3NRLA 2P3TB 1HYLA 1FONA 2FWWA 3FP8E 3M5LA 4BAKB 4BTTB 1KLTA 1XUJA 4RI0A 5A0AE 1Z8JB 2VINA 1C2FA 4IGDA 4ZKSU 3IWMA 3OEHD 1QL7A 3MH7A 3F9EA 1ELDE 3BTHE 1TMBH 2R2MB 2RA3A 2LP6A 5EQSA 2D1JA 2WUCA 1JOUB 2P3UB 1SGEE 1NO9H 3KIDU 4MNVA 1H8HD 3A81A 3LIWA 4R0IA 3LC3A 5C20A 1S83A 2ZU2A 3HK3B 1YPHE 1TLDA 1CHOF 1EZXC 2IJD1 2ZECA 1TA6A 2A5IA 4Q2KA 1YPHC 2WPHS 1DXWA 3VEQB 4AFUA 2B5TB 2P94A 4ASUD 3KQBA 3M5MA 2GMTB 6GCHF 1DSUA 1CT2E 2F9NA 1K1IA 1QRZA 8ESTE 4KTCA 3TJVA 1QHRB 1P2NA 4AG1A 1W7XH 2PUQH 1OP0A 3F0PA 3ZZBA 3M7TA 1SGYE 1S82A 1J16A 1SGIB 2BD5A 4I32A 2V7QD 2KAIB 1C2EA 2Q6FA 1S0RA 1XUKA 4YM9A 1B0EA 5C2ZA 1S81A 1AWHB 2ZC9H 3P95A 4UFDH 1EUFA 4BAHB 3VPKA 2VWNA 1PQ7A 1TE0A 3UNSA 1FXYA 1EAUA 3PO1C 1CVWH 1BBRE 3MU5A 2BDBA 2SGEE 2FLRH 1KLJH 1GJ7B 1TNJA 4K2YA 4A1VA 1O33A 1RD3B 4ZROA 1C2DA 3MWIU 3C27B 1MTNC 1OPHB 2UUFB 3PV2A 2FLBH 3RC5A 1UTPA 4D7GA 1E38B 3RXFA 4P02A 1P2QA 3MMGA 3A89A 1MZDA 2WV5A 1ZGVA 4JMYA 1IHSH 1P2KA 1V2RT 1T4VH 2FS9A 2Z9KA 1SLXB 1BDAA 3D23A 2BY6X 1CT0E 4X1NU 2PUXB 5FX6A 1C1MA 1XKBC 1JBUH 3OY5U 1A46H 4B73A 2W5EA 3OTPA 1SI5H 1IQMA 5JPMH 1EPTC 1GHXH 4WH6A 2VWLA 4AORA 3DFJA 2HGTH 3S7HB 2W26A 3UPEA 1A7SA 3GY2A 3LOXA 4FVBA 1F0TA 1IHTH 1P8VC 3LJOA 4TPYA 3B8JA 1KTTB 5EPYA 2HOBA 4ZKNU 1TGNA 1T7CA 2A4OA 3M5NA 2ZDNA 2VGCB 4MLFB 4WMDA 2BVXH 1O31A 2ZTZA 1TNHA 1ELTA 3VB3A 2NU0E 1C1WH 2IJOB 1MQ5A 1QJ7B 2B0FA 1C4Y2 2VVUA 2Z9LA 1A0LA 2J38A 2ZGCA 5LPEA 5GCHF 2G8TA 4ZHMU 1LQDB 3V12A 1C2MA 1GJ6A 1UTKA 3OYPA 4CREA 1TGSZ 2D2DA 1RS0A 1EQ9A 1UHBB 4O03A 4M7GA 2BXTH 2GP9B 3KEEA 5E2OA 3PMJA 3E0PB 5BPEA 4QT8C 4TYDA 1QZ8A 4ZKRU 1NM6A 4B2AA 1TRMA 2BOHB 2V35A 3MFJA 1P3EA 2BMGB 3ZZ9A 1YYY1 1GCTB 3UWIA 2TGTA 1TOMH 1C1VH 1ZJKA 2SGDE 1GBBA 3SJKA 1NC6A 4OS2A 2F83A 1ID5H 1HAHH 1L1JA 2HRVA 1KXFA 1SSXA 5K0HA 1THSH 3UQOA 2J97A 4YT7H 2NU3E 2A31A 4I31A 2BDCA 6CHAC 2ZU1A 1FY5A 1HAZB 4XBDA 2XCNA 1IOEA 4A7IB 1AUTC 2SGQE 5FL7D 2FOAA 1ACBE 1INCA 1T31A 1K1LA 2WPMS 2ZTXA 2O8UA 3TJOA 1BTXA 3RMOH 1ELCA 2JETC 4INKA 4ABDA 2CF9H 2F9UA 1MU6B 2WV9A 4H42U 3SI4H 1O2PA 4IW4E 3SUDA 1KXCA 1BUIA 4RT0A 1UTOA 1XUGA 1PPZA 1AUJA 3N7OA 2QIQA 3A80A 2F3CE 2ZU3A 1TNIA 1BHXF 4NWKA 2WUBA 3P70B 3RU4E 3A84A 2FTLE 1PYTC 1O2QA 1DUAA 1XUFA 4FUBA 1L4DA 1CGJE 3BTGE 1O5FH 1GI9B 1FJSA 1TOCB 1CU1A 1DY9A 1ELFA 1SLVB 3RXQA 4P00A 2LPRA 4NIWA 3QGNB 1RTKA 1LVOA 4B76A 1FPHH 4A1TA 1THRH 4DURA 1DT2A 1QCPA 1AKSB 2A4GA 4X1RU 4CHAC 5DK1A 1DVAH 2W3IA 1FN8A 2UWLA 1O3IA 1JXPA 4Y11E 2QA9E 1W13U 3FZZA 1K22H 1XUHA 3K2UA 3O8DA 4FUDA 3PLKA 1LVYA 5G4BA 3S9CA 1UTMA 1EPTA 3PRBA 1OYTH 3MU8A 2YNAA 1RRKA 3EA9A 3PWCA 3WWFA 4CRAA 1ZHPA 2F9OA 1SGDE 4ISOA 6LPRA 1V2PT 1LHDH 1YWUA 3DA9B 4AC9A 2H6MA 1W2KH 1QGFA 1EZQA 4OS6A 3ZZ4A 4WY3A 4VGCC 5JBAS 4JYTA 1BTWA 1E1QD 1QJ6B 3P8FA 1A4WH 5K7RA 1TX7A 1T8OA 3NK8A 5DG6A 5HIZA 4THNH 5E2PA 5EU8A 5JB8S 1G2LA 3BF6H 2GT7A 2YMSD 1BOQA 3U1JB 1C9PA 2P59A 2SNWA 1GCDA 2VIDA 1SR5C 3MO9A 4WMEA 2FTMA 2ZCHP 2Z9GA 3UTUH 2RA0A 3NUMA 4ABHA 1P3CA 2O9QA 1P0SH 1C4V2 4CR9A 1BA8B 5EXLA 2J98B 1KXEA 1ZTLA 3SV7A 1WUNH 3ITIA 3TITA 2H5CA 4JZDH 2G55A 1V2TT 2QXGA 2KR7A 3FO8D 1G30B 5IK2D 1MCTA 1LHGH 8GCHF 2BD7A 3SI3H 3M3VA 1PPEE 1O36A 2KCYA 3M61U 1O3NA 1YCPH 2OP9A 1E1RD 5FPYA 3HK6B 4X2VA 1Y3UA 5HM9A 1XUIA 2ZA5A 3AAUA 1EZUC 1QY6A 2O8TA 4NFFA 1V2QT 3MU0A 1LDTT 1Z8GA 2A4QA 3DD2H 3DSOA 3W1EA 1NY22 4ZXYH 5PTPA 2ZDKA 3SQEE 3A8AA 4E7NA 1UVTH 2WYJA 2WYGA 1MKWH 4B2BA 2OC7A 1TA2A 2AHME 2BLVA 3H09A 1HNEE 1LO6A 1ZTKA 2XW9A 2AGIX 3F6UH 1UVUH 1A3BH 2V3HH 4F4OC 1NZQH 5C1YA 4XDEA 3MU4A 3U1IB 4INHA 4NZLA 3V13A 3ZZ5A 4ZCNA 2R2WU 4ACBA 4J2YB 1A1RA 3EA8A 3Q3XA 1N6XA 3RXGA 3OTJE 3P8NA 1H8DH 1V2JT 4B6FA 2O8LA 3GDUA 4UONA 1ANCA 3F3BA 1N1LA 3UIRA 1MTSA 3SO3A 3LT3A 2BD9A 5GIBA 2KX4A 2HPQH 3CENA 1AVWA 4RSPA 4E05H 3WW7A 1HDTH 1TGCA 2VIOA 1C9TA 2JJ2D 1PFXC 3UY9A 4BANB 2BLOA 1C5QA 4AB9A 4ZMAH 1BMAA 2THFB 2FOMB 5HYOA 3LJJA 4K1TA 3PB1E 1TBZH 3SNEA 1TQ7B 2EI8A 1C1NA 4JZFH 2PSXA 5EIYA 2FOGA 2ZGXH 4OS7A 1C2IA 3QZRA 2LNCA 1J14A 2GMTC 1T8LA 5GPIB 2Z6BD 1IAUA 1VITG 1DWDH 1GHBF 1SFQB 1ZMJA 2HNTC 2KCOA 3TH2H 3SBKA 2ZHEH 3SZEA 1DUEA 1EAIA 1GJ5H 1S6HA 5T6DA 2FZZA 4NSYA 5SGAE 2WPDD 5EXNA 1FLEE 1O37A 1WBGB 1O2VA 3L3TA 1FAKH 5GXPA 3LH3A 1TABE 3SU6A 4D76A 1D3PB 1SQTA 5A2MH 3GISB 4PROA 3TU7H 4Y10E 2P8OC 2AGEX 1C5VA 1HIAB 1QIXB 1C2JA 1V6DA 1LMWB 1EP6A 5B6OA 1IQNA 1THPB 3TGJE 4YESB 5L2YH 1OP2A 1DSTA 5EJZA 1FY4A 1GBJA 3NPSA 1KDQB 2BD4A 2J98A 1X7AC 4NA9H 4KP0A 1HAXB 4GUXA 2AH4X 3ODFA 4DCDA 3Q3YA 2FI4E 2FX6A 2G4UA 5EW2H 4HG6A 1HLTH 1YLCA 1GBAA 3OSYA 5F03A 5CMXH 1V2ST 4DIIH 2ZZUH 1ANBA 1TMUH 3D49H 1DWEH 1BB0B 1BTPA 2Q6GA 4X8UH 1V2VT 4A6LA 5JBTA 1H4WA 1N8OC 1HPGA 3SU3A 3OFND 2A2QH 5EW1H 5I46H 4X1PU 1TPOA 5A8XA 1HAOH 1O2SA 1QRXA 4TWWA 1C2KA 1IQGA 1H8IH 2ZFFH 4CRCA 4JK6A 1AD8H 2G81E 2XBWA 3MH5A 3DCLA 1G37A 3RXMA 1FIZA 4MPXA 5DP6A 2HVXA 2ANKH 5FCRA 1TYNA 1P11E 3BTKE 2FM2A 2NU1E 4CBOA 3NKKA 4CRGA 1BMLA 5DP8A 1UTLM 3ZVDA 1NRPH 2P3FH 2UUKB 5KECA 2EQNA 3LGWA 4TSFD 2ZDVH 1Z7KA 1O3AA 3I29A 5L2ZH 1YY3A 2GCHF 1Z1IA 1A61H 1QBNA 2J4IA 3A7VA 1F5RA 2AIPA 2JH0D 2V6NA 2KZ4A 3A82A 4AG2A 1NFUA 1H9IE 5F8XA 7GCHG 4H6TA 1GVZA 1EOLA 4FETA 4FU9A 2GDDA 1A0JA 1OHHD 1TMTH 1BTZA 2AEIH 4CBNA 3ENSB 2FOCA 1AIXH 1GMDF 4VGCB 4DT7B 3A7XA 2OD3B 1KDQA 2SGAA 1Q31A 5HIYA 1PPGE 5EQQA 1C5WB 4CRDA 2KAIA 4ISIH 3SYJA 1HBTH 2BM2A 4X6MA 1ELGA 2XCFA 1EFRD 2K0QA 1ANEA 4OM9A 3AW0A 1MMJN 2JH6D 1ANDA 2G52A 3UREA 1MAYA 1C1RA 4RKJB 3TK5A 1B7XB 2FMJA 1P01A 3R0FA 1GJBB 5DGJA 1C5UA 1NRQH 1HFDA 2A32A 4ESTE 2EC9H 1ZSLA 3GCOA 1EASA 1MKXH 1B0FA 1QBVH 1SBWA 1C2HA 2FS8A 1WQSA 5ABWA 1AZZA 1K1JA 3ESTA 3SU1A 2Y6TA 1L4ZA 4HGCA 2GZ7A 4AX9H 2QXIA 1GCTC 4B6EA 3PMBB 1NBMD 1SHHB 3ATIA 1A5IA 1AGJA 2BTCE 1ORFA 1OP8A 1GJ8B 2ASUB 1DLKB 4F49A 1YCPM 4NGAH 2AYWA 3O8BA 5E8EH 4XFQA 1QR3E 1BBRK 3P92A 4DJZB 2ODPA 6CHAB 2QC2A 1D9IA 1SLUB 1F5KU 4Y7AA 4FUCA 3Q3KA 5EJLA 5LPRA 1G9IE 1SKYE 1GHBG 1JIMA 3TNTA 4WMFA 3UQVA 2XTTB 4Y0ZE 2BLQA 4GAWA 1O2WA 2KM0A 3BG4C 3GDSA 1O5EH 3N7EA 1YP9A 1P03A 2OLGA 3MOCA 5HXFA 3QGJA 3EGKH 3SUFA 1UW7A 3RXKA 1TRYA 3T28A 2FO9A 4D9QA 1C1SA 3AK5A 1U6QA 2QY0B 2Z3DA 2Z3CA 1XVMA 3ZZCA 1FY8E 2BY9X 3GY4A 4AGKA 1V2WT 4YOGA 2PKSB 1E34B 1ZSKA 4Y79A 2FOFA 5EGMA 1YKTA 2DE8A 3MHWU 4I8HA 1DY8A 1D4PB 4DVAU 4Y6DA 3ZVBA 1NFWA 1GBKA 1TX8A 2B8OH 4IMQA 2EY4C 4RN6A 1BHXB 1A2CH 3B9FH 1O5GH 3ATMA 4ABAA 2YMSC 2TRMA 4ABEA 4GLYA 5C67A 2PHBA 3BTEE 2WPKS 1Y5BT 2J34A 1QRWA 3GY8A 2XBVA 1DM4B 1GMHF 3RXCA 4NIXA 5BRRE 1NBME 3PMAB 4DW2U 1MUEB 1QJ1B 2ILNA 5EOKA 1GMDG 4HI3A 5C5OA 3ZVGA 2G5VA 2ZKSA 4KTSA 2R3YA 4X8SH 3MO6A 2PKAA 2SFAA 1HUTH 1GI0A 2VIPA 2VBCA 2PV9B 1Z8IB 1ZRKA 5A0BA 1EOJA 4I8LA 3UOUA 1F0RA 4X8VH 4IMZA 2AERH 2V0BA 3QX5H 1TPPA 3O8RA 2NU4E 2QF0A 2ZFTA 1GG6C 1O2HA 1HAPH 2FEQH 1AE5A 2Y7ZA 4WVPE 2PP6A 3VXEH 1CQQA 2VVVA 3GY7A 3Q76A 4DIHH 3SGAE 3TPIZ 3PTBA 1F2SE 2OBOA 5FXLA 4ISNA 1W8BH 1GBIA 2BXUH 3LGIA 2J5UA 2J95A 3ZZ7A 2GT8A 1IQKA 4I8GA 3RXPA 1C5LH 4BNRA 4Q4LA 3GCHC 2ZPQA 1OS8A 3ZZAA 5JBBS 3FOAA 3TJUA 1MZAA 5C1UA 1O3KA 3UR9A 4D8NA 3HKJB 3BTME 1O3DA 4UEHH 1GJ9B 3TGIE 2XNIA 4ACAA 1AI8H 3PM3A 1AVGH 1YPEH 1K21H 1D3TB 3SJIA 2NU2E 2ALVA 1ZSJA 2OBQA 3HPTB 3RXTA 4AFQA 3SUGA 2GVFA 3FZDA 4MNWA 1GI6A 2B9LA 3FP7E 4TWYA 1C1PA 4FUHA 4DY7B 1W12U 1ABIH 2GTBA 2CXVA 3SU5A 3AASA 2ODYB 4JZEH 1O2NA 1GWAA 1O2UA 2PW8H 2HVYB 1GJ4H 2OC8A 4GVUA 4YOJA 2BDGA 2HLDD 4DT4A 2BX3A 1BRCE 3QUMP 7KMEH 1FN6A 1ZYOA 2Q1JA 1K2I1 1O2LA 1FV9A 1O3HA 1H9LB 1LKAA 1KYNA 1C5NH 1K1MA 1OX1A 4NZQA 4Q7XA 1TRNA 2AIQA 3F1SB 4KELA 1D3QB 4ZXXH 1AQ7A 4E06H 1AB9B 1TQ0B 3T2NA 2A5AA 1KLIH 1SGCA 3BEIB 2A45B 1SQAA 1SLWB 1EXFA 1WDIA 2VIWA 1UVSH 1YC0A 4XD7D 2O8WA 4O3TA 4ABFA 2G4TA 3ZZ8A 3A7ZA 2KCPA 1ELEE 5ESTE 4A1XA 1HXEH 2FDAA 1CA0C 3SJ9A 1SC8U 1ZTJA 5EXMA 1Y3YA 1VZQH 4K1EA 3SN8A 1LCYA 1C5SA 1FDPA 2VIQA 2ZP0H 3UNRA 1NN6A 2Y7XA 1OKXA 3CP7A 3ATLA 1QB1A 2HPPH 1FX0B 4NWLA 1YPMH 3EAJA 1MKXK 2ODQA 3GDVA 2GD4B 5F6MA 4CH2B 1DANH 2V3MA 3F68H 5CE1A 1S0QA 2BD2A 3LC5A 3PV4A 2FODA 2UWOA 5IDKA 4FUGA 1HGTH 2ZGJA 2WPJS 1EKBB 1HAYB 3Q77A 2OK5A 4FUEA 2FPZA 1YPGH 3ZZ3A 1SQRA 3KQEA 1DWBH 4MG3A 4D9RA 3RMNH 3B23B 1TB6H 2ZG0H 2P8OB 3ZYEA 4YOIA 1FUJA 3BTTE 3LGVA 3UWJH 4ABIA 4GPGA 4AN7A 2F91A 1NS3A 1O3MA 3E91A 3JZ2B 1VITH 3RXJA 3W95A 4K8YA 2ZEBA 5DP4A 1LHEH 2Z3EA 1D3DB 3TIUA 3AAVA 5EQRA 3H7OA 3U69H 1HAGE 1YBWA 1MTNB 1B5GH 2QXJA 3E3TA 1SGFA 3H5CB 2TPIZ 1GHAF 4BTUB 1BRAA 2BHGA 1BITA 2ZF0H 3N7DA 2H9HA 2RCEA 1SGRE 1EP5A 1ARBA 4LZ1H 1GI4A 1MBQA 2ZWLH 3A7TA 5GCHG 2JKHA 3ZZ6A 3UNQA 4Z1MD 4FUJA 4GCHF 2RDLA 3RM0H 5B6LA 2UUJB 2YNBA 1RTLA 3O8CA 1XKAC 4KGAA 4K1SA 2NWNA 4ZHAA 2ZQ1A 4ISLA 4MDSA 2FOHA 3RXRA 3RXLA 2GX4A 1KY9A 1CO7E 1P06A 1YCPK 1UK2A 5E0HA 1BQYA 5FPTA 5FAHA 4SGBE 1GMHG 1NU7B 5C1XA 5AF9H 4F48B 3SV6A 1F0UA 1V2NT 1EB1H 3FP6E 1O2OA 1GMCG 2Z9IA 2JDID 2ZI2H 3PLBA 1W14U 1NROH 4LK4A 4CRBA 5LH8A 3EE7A 1W0ZU 4X2YA 1TNKA 3HKIB 5AFYH 3UFAA 2RDEA 4U30A 4ABBA 1QQ4A 1Z8RA 3BEFB 2A7CA 3A8BA 4JK5A 2RFKC 2WPLS 2OC0A 2OCVB 3KCGH 4K5ZA 1K1PA 5DP5A 4M9FA 3M3TA 1ZGIA 1OSSA 4DGJA 2YMSB 3N99A 4B74A 1HIAA 4LZ4B 5GNDA 1K1NA 1H1BA 1GMCF 1WYKA 4BXWA 2GCTB 1O2JA 1NRRH 1GG6B 1MBMA 2EEKA 2BDAA 1O3BA 3A7YA 4UFFH 1SB1H 2WINI 2AMDA 3MH4A 2EI6A 3SW2B 1P09A 2PKAB 2VU8E 3TJNA 4U01A 3V7TA 5GWZA 1GBHA 1EAWA 1O5DH 3JZ1B 3LONA 3A7WA 1QBOA 1ZMNA 1Y3WA 3SUEA 3SNCA 2CHAB 1K28D 1S85A 3GY3A 4I33A 3OAAD 3A88A 4JYVH 5FPSA 2CGAA 4B75A 3LGTA 1MAXA 3BV9B 5EPNA 1ZPZA 2XC5A 1JIRA 1O3GA 2QE7D 1OOKB 2R9PA 2IN2A 4ZAEA 1YPKH 3M37A 2ZDLA 3ZIAD 1Z1JA 2ZFRH 1YF4A 2L74A 1E36B 3KYGA 2ZIQH 2BX4A 1AMHA 4XBBA 3S9AA 2AMPA 4Y71A 1DDJA 2GZ9A 1CGHA 2FIRH 1EB2A 1G32B 3MI4A 1WOFA 1CA8B 1LPGB 5C94A 3HGNA 3F2GA 3SGQE 2QV1A 4OS1A 2AFQB 1T8MA 2FXRA 4GHQA 1NU9A 2ZCLP 4AFZA 3CNRA 1SFIA 1DS2E 1BIOA 1GPZA 2BVSH 1O0DH 1Y3VA 1GI5A 1GI1A 4KTUA 2FOEA 1VCQA 3SU4A 5J4SA 1QNJA 2OINA 4FVDA 1NTPA 4BAMB 1IQHA 1SGFG 1NFXA 4H4FA 3VB5A 4NCYA 1JRTA 2Y5HA 5HMAA 1G36A 2JH5D 3CS7A 2ANWA 1P04A 2A0QB 3OX7U 1O5BB 1TBQH 1VJAU 5T6GA 1C2GA 1ZLRA 1ETRH 2OTVA 1V3XA 3M3SA 2GGVB 1HRTH 5DP3A 1VR1H 2R0LA 2Y80A 1MCVA 3SHAH 1NESE 1P2IA 4XBCA 1UK3A 2VWMA 3DUXH 1F7ZA 4OGYA 4NFEA 2PGQB 3SJOA 1GI3A 3STIA 1GJDB 1XMNB 1DE7H 2L6OA 3F9HA 3GYMA 3VXFH 5GDSH 1O2TA 2D26C 3GICB 3PRDA 4AOQA 1Y59T 3RXSA 3WWBA 1TNLA 3RXEA 4AGJA 3GYLB 5JDUB 2FYQA 3PWBA 5JBCS 1CHGA 3MU1A 1AZ8A 1IQJA 1EJAA 1HV7A 4K8BA 2C4FH 4K3JA 4XOJA 1J8AA 2QGRA 3M36A 1RIWB 1O2RA 1LVBA 1O2YA 1DWCH 4HFPB 2IPQX 1L1GA 1S84A 5LPFA 1LVMA 1MH0A 2GCTC 4I86A 3KGPA 3ODDA 2ANYA 1VCPA 3E1XB 1BRUP 3KQCA 2BD3A 2EI7A 1W11U 4AZ2B 4Q7ZA 3A87A 4CRFA 2J92A 1AFEH 1TX6A 1VITF 2H9EH 2BOKA 1CSOE 4BXSA 3KQDA 4IN2A 1BJUA 3MO3A 3SNDA 1SGTA 2BDHA 3DHKH 2XWBI 5DP9A 3TK9A 4BTIB 3BN9A 5FCKA 1T32A 3BSQA 5KGOA 2XNDD 4B71A 4UDWH 1AU8A 1BRBE 3VFEA 2O8MA 1QFKH 1EX3A 1UCYE 1YPLH 3BTWE 1GVKB 2D8WA 2XWAA 1EATA 2CF8H 1WTGH 1C5YB 2ZDMA 3U28C 3VGCB 1PYTD 3TGKE 3DSPA 1G3CA 1C2LA 2A1DB 4X6PA 4X0WU 2W7UA 2ZHFH 3K6ZA 3SZNA 1MTWA 1GHZA 3T25A 2HWLB 3PV5A 3A8DA 3GOVB 2F9BH 4CR5A 1MD7A 1A3EH 1EAXA 2BVRH 3TH3H 1MKWK 1O39A 4MTBA 2TGPZ 4I7YH 1XXDA 2QYIA 3MNSA 3OEED 1HAVB 1ZHMA 4X2XA 5T1VA 1XVOA 1KXBA 2Z7FE 3PYHA 1W7GH 2QAAA 1AVXA 1ELBA 2QF4A 2I6QA 4O9VA 5F8TA 1HB0B 1UTJA 5HGGA 1C5RA 2WHXA 3FN8A 4HTCH 5A8YA 4ABJA 4A5TS 1WU1A 4JZ1A 1G3EA 2Z9JA 5AVDA 4TY6A 1FIWA 5I25A 3GCTF 4UD9H 2LELA 2W7SA 4I8KA 8GCHG 2H9TH 1RFNA 1DX5M 2XC4A 3L6PA 2DE9A 3BTQE 3M35A 1N6YA 4YO9A 1G2MA 2OQUA 1NFYA 2J2UA 1O2GH 2PWXA 1O2IA 4AB8A 5LGOA 4OS4A 3SV2H 2C3SA 3MNCA 1W0YH 3QTVH 2OXSA 1SMFE 5DPAA 2QCYA 4OS5A 1QQUA 3LPRA 1GBLA 5GJ4B 1TALA 5DJ7A 5HM2A 1IQFA 4SGAE 1A5HA 3P8OA 1CA0B 1GBEA 3OU0A 1GDQA 2GV7A 1C1TA 1K9OE 3AW1A 5DN6D 1OWIA 3G01A 4Z0KA 1HAIH 1IQIA 1SGPE 2H1UA 1P02A 2BQWB 4HZHA 1GI8B 2WSSD 3S69A 1BZXE 4Y7BA 3FVFB 2VIVA 4NIYA 1FZZA 4YLUA 2XC0A 1KXDA 3BTDE 3VB6A 3PMHB 2ZU4A 4RT1A 1HXFH 4X6OA 3S7KB 3T27A 3QN7A 3QO6A 3RDZA 1C4U2 1QTFA 9LPRA 1QA7A 3STJA 1O2MA 1EJMA 2V3OH 1WQVH 3LU9B 3UAIC 1RXPA 3C1KA 1HJ8A 1AFQC 1OWDA 4U2WA 1D6RA 4MPVA 2BZ6H 3QTOH 2M2AA 4YTAA 1SHYA 1GBFA 3EYDA 1FY1A 3SV8A 1DICA 2FP7B 1Y5UT 4UFGH 5EODA 1VCWA 1UJ1A 5C0TA 1GI2A 1QB9A 4INLA 3GY5A 3ATKA 3QZQA 4AYYB 1ABJH 1ZJDA 2HLCA 2R0KA 1AO5A 2Z94A 1HJAB 2B7DH 1J15A 4Q80A 2BZAA 2BDYA 2HNTF 5F53A 1FQ3A 3SNBA 2ZDAH 1BMNH 1PQAA 3T26A 2JETB 1YM0A 1KTSB 1ESBA 4NIVA 3SJ8A 2PTCE 2H5DA 1KMHB 2A4RA 3URDA 3F2FA 1O3LA 3UR6A 1OYQA 2ESTE 3V3MA 4J1YA 3KNXA 2XOKD 2VJ1A 1T8NA 1C5XB 3RXVA 3NCLA 1SOTA 1TPSA 3D62A 1SGNE 4WH8A 4ZKOU 2SNVA 1LQEA 1V2LT 2R3UA 3T29A 4IBLH 1Z6JH 4LXBH 2PFEA 1UVOA 2OQ5A 2RG3A 1GHVH 2STBE 1SVPA 1PPCE 1M9UA 5T3HA 1QL8A 3BG8A 1NRNH 4JYUH 4GHTA 2HALA 1O3JA 1P05A 1Q3XA 2OUAA 1GI7B 1C1QA 1NPMA 3U8TH 1S6LA 4IC6A 4ASHA 3T5FH 2CMYA 3A85A 4XE4A 1C1UH 2J9NA 4WWYA 1Y8TA 4B2CA 1BTHH 1P2OA 1P2MA 1TWXB 1FPCH 3SU0A 2G5NA 1O34A 3R3GB 1HCGA 1KSNA 1SGQE 1W10U 3FKSD 5ESBA 1JMOH 1DXPA 1NRSH 4Y8XA 1W0JD 1J17T 3RU4D 1C5TA 2CK3D 2HNTE 2QXHA 1QL9A 4YLQH 3UB0A 1A0HB 1MTUA 5TCCA 2Y5GA 1H8ED 2Q6DA 1ZPCA 1BMFD 5CHBA 3BTFE 2GDEH 2PTNA 2KFWA 5C17A 2TGAA 3D65E 2BYAX 1SPJA 2IOTA 1S6FA 1MU8B 1EZSC 4ABGA 5CDFE 5DSFA 3HATH 2C8ZB 4JCNA 5TJXA 3P6ZB 3H7TA 1C5MD 1CE5A 3F9GA 4E7RG 2VH6A 1E37B 3T62A 1BTUA 5F8ZA 5L30H 2JJ1D 3OY6U 3RXOA 1TFXA 3NXPA 2VWOA 4FOUC 9ESTA 2CHAC 3KN2A 1TONA 1SQOA 3RU4T 2Y81A 1ELAA 1C5ZB 3F2HA 2C8XB 3E90B 3DT0H 3QK1A 4Q7YA 1AY6H 3ZVCA 3BIVH 4WXIA 2ZO3H 1GBMA 4Q63A 2PLXA 4DG4A 1GJAB 3VB4A 1F0SA 3P17H 4ZH8A 3RXHA 1O2KA 1VJ9U 1P9SA 3RUOA 3VGCC 3Q00A 3A8CA 5H4IB 1V2KT 2FX4A 3L33A 1OWJA 1ZPBA 1C5OH 3RMMH 1WAYB 1HJAC 3M7UA 3GCNA 5FHTA 1AHTH 4FU7A 4MQAA 2AS9A 2W6ID 3EQ0H 3MYWA 1UCYK 1BT7A 1ZZZA 3RXAA 2WPIS 1XXFA 3E6PH 2PR3A 4JZIA 3E8LA 1TIOA 1TPAE 4FUIA 1UK4A 4A92A 3K9XB 2FESH 3KQ5A 4Y8YA 2BY7X 7LPRA 1QB6A 5IYTA 3RXDA 4ZUHA 5JB9S 4OGXA 1S5SA 1YLDA 1GGDC 3SHCH 1LPZB 4NG9H 1N8OB 1P10A 1P9UA 3BG4B 2VH0A 5EG4A 2CV3A 2OC1A 4NA7A 1GBCA 1TNGA 1VGCC 2XBYA 5T6FA 1C1OA 1PQ5A 2XRCA 4U32A 2BD8A 2ZNKH 5L6NH 1GHAG 2M5TA 1COWD 3NZIA 4MVNA 3U98H 3KL6A 2AGGX 3IG6B 3VG8A 5AFZH 3LKWA 1F92A 2GZ8A 1WSSH 3RLWH
chains in the Genus database with same CATH topology
3ATWA 5CHAC 8LPRA 4FU8A 3SGBE 2PKSC 2TIOA 4K69A 4ISHH 5JYIA 3S9BA 1ZOMA 2BDIA 1GJCB 4WF8A 1YGCH 1ZMLA 4Y0YE 1RTFB 2VGCC 1L0ZA 3GY6A 2UUYA 4IC5A 4ZHLU 4AYVB 3W94A 2QF3A 1F5LA 2A7HA 3TNSA 3CS0A 3ELAH 4D7FA 3LGUA 3QLPH 3MNBA 2VB0A 4FXGH 4GSOA 2J94A 2XBXA 3PROA 1O32A 2ZGBH 3IITA 5FBEA 2BQ6B 5C5NA 2P93A 3ZV9A 3FAOA 3U9AH 2ZTYA 1ZR0A 1RIWC 3ZV8A 4CH8B 1DOJA 3RC6A 3SOSA 1O38A 3MTYA 1FY3A 3KF2A 1KXAA 4I8JA 3K65B 1BTYA 1O35A 1UMAH 4KKDA 1OWEA 5A0CA 3LDXH 1MD8A 5A8ZA 1GL0E 2TGDA 2ZQ2A 4GCHG 3TVJB 3HGPA 1V2UT 1W3CA 3F9FA 5AHGH 2QN5T 1GDNA 1O30A 2C8WB 2K1QA 1AE8H 1MTVA 3NWUA 2I6SA 1GBDA 2CN0H 3EE0B 3AVZA 3QDZB 1Z71A 3SQHE 2GCHG 2TBSA 3GCHB 1K1OA 4X2WA 2FI5E 1MQ6A 5FBIA 1O3PB 5A09A 1PPFE 4UE7H 1WCZA 1P57B 1ZRBA 1O5AB 1V2MT 2ZGHA 3P8GA 3UUZA 1G3BA 4RKOB 3TH4H 3WY8A 2BLWA 2DUCA 2Y82A 1D6WA 1AKSA 3PO1B 1ESAA 3BIUH 3U8RH 1DITH 1P2JA 1TGTA 2G00A 1ZHRA 1WTHD 2VVCA 1O3FA 3UOPA 3E0NB 1ETTH 3RM2H 1TBRH 2C8YB 1LTOA 3KHVA 3A83A 4TY7A 2ZPSA 2XYAA 3RP2A 2W3KA 3DFLA 1J9CH 1FAXA 1HJ9A 1BBRH 2ANMH 4WXVA 1IQEA 1BMMH 2P95A 4LOYH 3TK6A 1TGBA 1AB9C 4H6SB 3S0NA 2BY8X 1Z6EA 5ETXA 1IQLA 1EPTB 1QURH 3GCTG 1VGCB 4TPIZ 1BJVA 2ZFQH 3PTNA 1JRSA 1CBWC 3LH1A 4CHAB 1ARCA 2ULLA 2H2ZA 2C93B 1AWFH 2F9PA 1DPOA 1E35B 1PPBH 3FANA 3SV9A 3ZVAA 3ZVEA 2EA3A 1SL3A 4MNYA 4YT6H 1SOZA 5E0GA 1LHFH 3SNAA 1RJXB 1SG8B 1PJPA 1CGIE 1L1NA 1GBTA 1BCUH 1Y5AT 2BQ7B 2A2XH 5DP7A 2ZU5A 4IS5A 1UO6A 2GV6A 5FX5A 1FNIA 4O3UA 2ZHWH 4UFEH 1XM1A 2Y5FA 1GVLA 1DFPA 1P12E 3EDXB 1EJNA 4DOQA 2BB4A 4K60A 2AMQA 5E0JA 4Y76A 3I78A 3SU2A 2YOLA 1L2EA 1OXGA 2IPHA 3I77A 1CHOG 4X8TH 1Q2WA 3FFGA 1QA0A 4X1SU 2C90B 3RC4A 1LHCH 1T4UH 4IN1A 1UTQA 3V0XA 2SGFE 2UWPA 1LPKB 6GCHG 1AN1E 1OWHA 4BAOB 1O3OA 4NSVA 2XXLA 2ALPA 4Y8ZA 3K6YA 4O97A 2ZHQH 3QWCH 3BEUA 3MNXA 4B1TA 4NA8A 4MNXA 1A5GH 3RLYH 1GHWH 3TLOA 4X1QU 1HAVA 1O2XA 1V2OT 3ZVFA 4AFSA 4XSKU 3URCA 1CT4E 5DO4H 3PLPA 1UTNA 4BAQB 3M7QA 1AFQB 1FI8A 1KIGH 7ESTE 1O5CB 2F9VA 3ZYDA 2G51A 2SGPE 2BY5X 1LKBA 1WV7H 4MPWA 2WV4A 3A86A 4WJG2 1O3CA 1OWKA 1UVPA 3LGYA 5TCAA 1GL1A 2ZCKP 2A5KA 2GKVE 2PSYA 4MPUA 1H9HE 3RXIA 2ZPRA 2ZFSA 2FYRA 1ESTA 1XX9A 4Z6AH 2FOBA 1GHYH 3SORA 1G3DA 1PQ8A 1UHBA 3E16B 3VB7A 5J4QA 1C5PA 4YZUA 1Y3XA 4FUFA 6ESTA 2P16A 3RXBA 3RMLH 5DKMA 1O2ZA 1O3EA 2VNTA 3M5OA 1YPJH 3MH6A 4R8TB 1E0FD 4BOHA 1GDUA 1NT1A 1TAWA 2ZFPH 7GCHF 1FMGA 1GGDB 1PPHE 2PGBB 3RXUA 3ZZDA 5CHAB 1RGQA 1DLEA 1JWTA 8KME2 2FI3E 2A7JA 5C3NA 3EA7A 1CBWB 3U8OH 1UCYH 2ZHDA 2CJIA 1ETSH 1ELVA 2STAE 4X6NA 2P3TB 1HYLA 1FONA 2FWWA 3FP8E 3M5LA 4BAKB 4BTTB 1KLTA 1XUJA 5A0AE 1Z8JB 2VINA 1C2FA 4IGDA 4ZKSU 3IWMA 1QL7A 3MH7A 3F9EA 1ELDE 3BTHE 1TMBH 2R2MB 2RA3A 5EQSA 2D1JA 2WUCA 1JOUB 2P3UB 1SGEE 1NO9H 3KIDU 4MNVA 3A81A 3LIWA 4R0IA 3LC3A 5C20A 1S83A 2ZU2A 3HK3B 1YPHE 1TLDA 1CHOF 1EZXC 2ZECA 1TA6A 2A5IA 4Q2KA 1YPHC 2WPHS 1DXWA 3VEQB 4AFUA 2B5TB 2P94A 3KQBA 3M5MA 2GMTB 6GCHF 1DSUA 1CT2E 2F9NA 1K1IA 1QRZA 8ESTE 4KTCA 3TJVA 1QHRB 1P2NA 4AG1A 1W7XH 2PUQH 1OP0A 3ZZBA 3M7TA 1SGYE 1S82A 1J16A 1SGIB 2BD5A 4I32A 2KAIB 1C2EA 2Q6FA 1S0RA 1XUKA 4YM9A 1B0EA 5C2ZA 1S81A 1AWHB 2ZC9H 3P95A 4UFDH 1EUFA 4BAHB 3VPKA 2VWNA 1PQ7A 1TE0A 3UNSA 1FXYA 1EAUA 3PO1C 1CVWH 1BBRE 3MU5A 2BDBA 2SGEE 2FLRH 1KLJH 1GJ7B 1TNJA 4K2YA 4A1VA 1O33A 1RD3B 4ZROA 1C2DA 3MWIU 3C27B 1MTNC 1OPHB 2UUFB 2FLBH 3RC5A 1UTPA 4D7GA 1E38B 3RXFA 1P2QA 3MMGA 3A89A 1MZDA 2WV5A 1ZGVA 4JMYA 1IHSH 1P2KA 1V2RT 1T4VH 2FS9A 2Z9KA 1SLXB 1BDAA 3D23A 2BY6X 1CT0E 4X1NU 2PUXB 5FX6A 1C1MA 1XKBC 1JBUH 3OY5U 1A46H 4B73A 2W5EA 1SI5H 1IQMA 5JPMH 1EPTC 1GHXH 4WH6A 2VWLA 4AORA 3DFJA 2HGTH 3S7HB 2W26A 3UPEA 1A7SA 3GY2A 3LOXA 4FVBA 1F0TA 1IHTH 1P8VC 3LJOA 4TPYA 3B8JA 1KTTB 5EPYA 2HOBA 4ZKNU 1TGNA 1T7CA 2A4OA 3M5NA 2ZDNA 2VGCB 4MLFB 4WMDA 2BVXH 1O31A 2ZTZA 1TNHA 1ELTA 3VB3A 2NU0E 1C1WH 2IJOB 1MQ5A 1QJ7B 2B0FA 1C4Y2 2VVUA 2Z9LA 1A0LA 2J38A 2ZGCA 5LPEA 5GCHF 2G8TA 4ZHMU 1LQDB 3V12A 1C2MA 1GJ6A 1UTKA 3OYPA 4CREA 1TGSZ 2D2DA 1RS0A 1EQ9A 1UHBB 4O03A 4M7GA 2BXTH 2GP9B 3KEEA 5E2OA 3PMJA 3E0PB 5BPEA 4QT8C 4TYDA 4ZKRU 1NM6A 4B2AA 1TRMA 2BOHB 2V35A 3MFJA 1P3EA 2BMGB 3ZZ9A 1YYY1 1GCTB 3UWIA 2TGTA 1TOMH 1C1VH 1ZJKA 2SGDE 1GBBA 3SJKA 1NC6A 4OS2A 2F83A 1ID5H 1HAHH 1L1JA 2HRVA 1KXFA 1SSXA 5K0HA 1THSH 3UQOA 4YT7H 2NU3E 2A31A 4I31A 2BDCA 6CHAC 2ZU1A 1FY5A 1HAZB 4XBDA 2XCNA 1IOEA 4A7IB 1AUTC 2SGQE 2FOAA 1ACBE 1INCA 1T31A 1K1LA 2WPMS 2ZTXA 2O8UA 3TJOA 1BTXA 3RMOH 1ELCA 2JETC 4INKA 4ABDA 2CF9H 2F9UA 1MU6B 4H42U 3SI4H 1O2PA 4IW4E 3SUDA 1KXCA 1BUIA 1UTOA 1XUGA 1PPZA 1AUJA 3N7OA 2QIQA 3A80A 2F3CE 2ZU3A 1TNIA 1BHXF 4NWKA 2WUBA 3P70B 3RU4E 3A84A 2FTLE 1PYTC 1O2QA 1DUAA 1XUFA 4FUBA 1L4DA 1CGJE 3BTGE 1O5FH 1GI9B 1FJSA 1TOCB 1CU1A 1DY9A 1ELFA 1SLVB 3RXQA 2LPRA 4NIWA 3QGNB 1RTKA 1LVOA 4B76A 1FPHH 4A1TA 1THRH 4DURA 1DT2A 1QCPA 1AKSB 2A4GA 4X1RU 4CHAC 5DK1A 1DVAH 2W3IA 1FN8A 2UWLA 1O3IA 1JXPA 4Y11E 2QA9E 1W13U 3FZZA 1K22H 1XUHA 3K2UA 3O8DA 4FUDA 3PLKA 1LVYA 5G4BA 3S9CA 1UTMA 1EPTA 1OYTH 3MU8A 2YNAA 1RRKA 3EA9A 3PWCA 4CRAA 1ZHPA 2F9OA 1SGDE 4ISOA 6LPRA 1V2PT 1LHDH 3DA9B 2H6MA 1W2KH 1QGFA 1EZQA 4OS6A 3ZZ4A 4WY3A 4VGCC 5JBAS 4JYTA 1BTWA 1QJ6B 3P8FA 1A4WH 5K7RA 1TX7A 1T8OA 3NK8A 5DG6A 4THNH 5E2PA 5EU8A 5JB8S 1G2LA 3BF6H 2GT7A 1BOQA 3U1JB 1C9PA 2P59A 2SNWA 1GCDA 2VIDA 1SR5C 3MO9A 4WMEA 2FTMA 2ZCHP 2Z9GA 3UTUH 2RA0A 3NUMA 4ABHA 1P3CA 2O9QA 1P0SH 1C4V2 4CR9A 1BA8B 5EXLA 1KXEA 1ZTLA 3SV7A 1WUNH 3ITIA 3TITA 2H5CA 4JZDH 2G55A 1V2TT 2QXGA 1G30B 1MCTA 1LHGH 8GCHF 2BD7A 3SI3H 3M3VA 1PPEE 1O36A 3M61U 1O3NA 1YCPH 2OP9A 5FPYA 3HK6B 4X2VA 1Y3UA 5HM9A 1XUIA 2ZA5A 3AAUA 1EZUC 1QY6A 2O8TA 4NFFA 1V2QT 3MU0A 1LDTT 1Z8GA 2A4QA 3DD2H 1NY22 4ZXYH 5PTPA 2ZDKA 3SQEE 3A8AA 4E7NA 2WYGA 1UVTH 2WYJA 1MKWH 4B2BA 2OC7A 1TA2A 2BLVA 1HNEE 1LO6A 1ZTKA 2XW9A 2AGIX 3F6UH 1UVUH 1A3BH 2V3HH 4F4OC 1NZQH 5C1YA 4XDEA 3MU4A 3U1IB 4INHA 4NZLA 3V13A 3ZZ5A 2R2WU 4J2YB 1A1RA 3EA8A 3Q3XA 1N6XA 3RXGA 3OTJE 3P8NA 1H8DH 1V2JT 2O8LA 3GDUA 4UONA 1ANCA 1N1LA 3UIRA 1MTSA 3SO3A 3LT3A 2BD9A 5GIBA 2HPQH 3CENA 1AVWA 4RSPA 4E05H 1HDTH 1TGCA 2VIOA 1C9TA 1PFXC 3UY9A 4BANB 2BLOA 1C5QA 4AB9A 4ZMAH 1BMAA 2THFB 2FOMB 5HYOA 3LJJA 4K1TA 3PB1E 1TBZH 3SNEA 1TQ7B 2EI8A 1C1NA 4JZFH 2PSXA 2FOGA 2ZGXH 4OS7A 1C2IA 3QZRA 2LNCA 1J14A 2GMTC 1T8LA 5GPIB 2Z6BD 1IAUA 1VITG 1DWDH 1GHBF 1SFQB 1ZMJA 2HNTC 3TH2H 3SBKA 2ZHEH 1DUEA 1EAIA 1GJ5H 1S6HA 5T6DA 2FZZA 4NSYA 5SGAE 5EXNA 1FLEE 1O37A 1WBGB 1O2VA 3L3TA 1FAKH 5GXPA 3LH3A 1TABE 3SU6A 4D76A 1D3PB 1SQTA 5A2MH 3GISB 4PROA 3TU7H 4Y10E 2P8OC 2AGEX 1C5VA 1HIAB 1QIXB 1C2JA 1V6DA 1LMWB 1EP6A 5B6OA 1IQNA 1THPB 3TGJE 4YESB 5L2YH 1OP2A 1DSTA 1FY4A 1GBJA 3NPSA 1KDQB 2BD4A 1X7AC 4NA9H 4KP0A 1HAXB 4GUXA 2AH4X 3ODFA 4DCDA 3Q3YA 2FI4E 2FX6A 2G4UA 5EW2H 1HLTH 1YLCA 1GBAA 3OSYA 5F03A 5CMXH 1V2ST 4DIIH 2ZZUH 1ANBA 1TMUH 3D49H 1DWEH 1BB0B 1BTPA 2Q6GA 4X8UH 1V2VT 4A6LA 5JBTA 1H4WA 1N8OC 1HPGA 3SU3A 2A2QH 5EW1H 5I46H 4X1PU 1TPOA 5A8XA 1HAOH 1O2SA 1QRXA 4TWWA 1C2KA 1IQGA 1H8IH 2ZFFH 4CRCA 4JK6A 1AD8H 2G81E 2XBWA 3MH5A 1G37A 3RXMA 1FIZA 4MPXA 5DP6A 2HVXA 2ANKH 5FCRA 1TYNA 1P11E 3BTKE 2FM2A 2NU1E 4CBOA 3NKKA 4CRGA 1BMLA 5DP8A 1UTLM 3ZVDA 1NRPH 2P3FH 2UUKB 3LGWA 2ZDVH 1Z7KA 1O3AA 3I29A 5L2ZH 2GCHF 1Z1IA 1A61H 1QBNA 2J4IA 3A7VA 1F5RA 2AIPA 2JH0D 2V6NA 3A82A 4AG2A 1NFUA 1H9IE 5F8XA 7GCHG 4H6TA 1GVZA 1EOLA 4FU9A 2GDDA 1A0JA 1TMTH 1BTZA 2AEIH 4CBNA 3ENSB 2FOCA 1AIXH 1GMDF 4VGCB 4DT7B 3A7XA 2OD3B 1KDQA 2SGAA 1Q31A 1PPGE 5EQQA 1C5WB 4CRDA 2KAIA 4ISIH 1HBTH 2BM2A 4X6MA 1ELGA 2XCFA 1ANEA 3AW0A 1MMJN 2JH6D 1ANDA 2G52A 3UREA 1MAYA 1C1RA 4RKJB 3TK5A 1B7XB 2FMJA 1P01A 3R0FA 1GJBB 5DGJA 1C5UA 1NRQH 1HFDA 2A32A 4ESTE 2EC9H 1ZSLA 3GCOA 1EASA 1MKXH 1B0FA 1QBVH 1SBWA 1C2HA 2FS8A 1WQSA 5ABWA 1AZZA 1K1JA 3ESTA 3SU1A 2Y6TA 1L4ZA 4HGCA 2GZ7A 4AX9H 2QXIA 1GCTC 3PMBB 1SHHB 3ATIA 1A5IA 1AGJA 2BTCE 1ORFA 1OP8A 1GJ8B 2ASUB 1DLKB 4F49A 1YCPM 4NGAH 2AYWA 3O8BA 5E8EH 4XFQA 1QR3E 1BBRK 3P92A 4DJZB 2ODPA 6CHAB 2QC2A 1D9IA 1SLUB 1F5KU 4Y7AA 4FUCA 3Q3KA