The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
59
|
sequence length |
224
|
structure length |
224
|
Chain Sequence |
b'IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Fusarium oxysporum trypsin at atomic resolution at 100 and 283 K: a study of ligand binding.
pubmed doi rcsb |
molecule keywords |
TRYPSIN
|
molecule tags |
Hydrolase/hydrolase substrate
|
total genus |
59
|
structure length |
224
|
sequence length |
224
|
ec nomenclature |
ec
3.4.21.4: Trypsin. |
pdb deposition date | 2000-09-28 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00089 | Trypsin | Trypsin |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | Thrombin, subunit H | Trypsin-like serine proteases | ||
Mainly Beta | Beta Barrel | Thrombin, subunit H | Trypsin-like serine proteases |