1GDNA

Fusarium oxysporum trypsin at atomic resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
224
structure length
224
Chain Sequence
IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Fusarium oxysporum trypsin at atomic resolution at 100 and 283 K: a study of ligand binding.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase substrate
total genus 59
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gdnA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gdnA01
1YPMH 4BAQB 4X1PU 4X8SH 1C1QA 3VB7A 2FLBH 1TGTA 2ZU1A 1QTFA 1BTXA 5FBIA 3SORA 2ODQA 1MMJN 1TALA 2XWBI 3M7UA 4RSPA 2ZU5A 3ATKA 1DVAH 4FUIA 4OGYA 5K7RA 1FAKH 4B76A 1ZOMA 1OKXA 3RMNH 3LGYA 5DP7A 1F92A 1EZSC 1QHRB 2ZDMA 4NIWA 3RXOA 1GHBF 1TX7A 5F03A 4TPYA 2A4GA 3H7OA 4XBBA 1S84A 4XBDA 1J9CH 4NA9H 3BTKE 2H5CA 2PKSC 1XUJA 4WMFA 2XCNA 1BZXE 4KKDA 5EXLA 5EODA 3A7WA 4INKA 2H9HA 1L0ZA 3ZVGA 2WPHS 1SB1H 8LPRA 2EA3A 1PPEE 1P2NA 3PMJA 1GMHG 1BCUH 1GPZA 2BVRH 4BTIB 4Y0ZE 5T3HA 2J38A 2D8WA 5EW2H 1A0JA 3PB1E 1S6FA 1UO6A 2BDAA 1S85A 1EAWA 2P8OB 1GI4A 2P93A 3P8FA 3MNXA 2HNTC 1UTLM 2FZZA 3PWCA 2GCTB 4ISIH 1O5EH 1AFEH 1GJ4H 1PYTD 3M3SA 3UR9A 4A6LA 3RXBA 1HAHH 1N6XA 1QJ6B 3FAOA 1P03A 2OC8A 2ODPA 2BOKA 3M61U 1C1OA 1ELBA 3F6UH 6CHAC 3ZZ8A 3ODDA 2F9NA 2PFEA 6LPRA 2WYGA 2ZF0H 4ZKSU 4ABJA 2GP9B 1SQAA 1QB9A 1ZJDA 3RM2H 1G2MA 3A83A 1CHOG 3V12A 4KP0A 1O38A 1UVPA 3TJVA 1MU8B 1VITG 5CE1A 1YPLH 1P57B 1A46H 5J4SA 2P3TB 1C4Y2 1WOFA 1LHEH 2ZHQH 1G2LA 4O97A 3BTDE 2PKAA 1MTNB 2SGQE 1YPKH 3QGNB 5DPAA 1YGCH 1TBRH 4U01A 3SJKA 1ELTA 3B8JA 2QV1A 1QB1A 3UNQA 1AMHA 4UFFH 3GDSA 1MZAA 1EZXC 2XWAA 1S0QA 1B5GH 1K28D 1C1WH 1SOZA 2ANWA 3R3GB 1JMOH 1SMFE 2O8LA 1F0RA 2W7SA 1MD7A 3BTWE 1PQ5A 4ABFA 2SGFE 3UIRA 1C5NH 3Q00A 1PPHE 1F0UA 3MNBA 2A5IA 2HWLB 1TX8A 2QAAA 1P9SA 2ASUB 1HPGA 1QL8A 3ZYEA 3F9GA 2FOCA 1WYKA 1ZHPA 1GBKA 2Q6FA 4K1SA 1PPZA 2LNCA 1ZMNA 2FOBA 5EU8A 1TE0A 2V35A 3UTUH 1EQ9A 4ABGA 1LKAA 1A0HB 2PTCE 3ZVFA 1DOJA 1A3EH 3SUDA 3VB6A 1SGDE 2O8WA 1G30B 1Q31A 5L6NH 4DT7B 1C9PA 2C8XB 2ZFSA 1ELVA 1FJSA 1GL1A 1XMNB 2C90B 3UR6A 4AORA 1GBJA 2ZTXA 2FP7B 2R9PA 2Z9LA 1E0FD 1Z6EA 2OQ5A 4BNRA 1DE7H 4GHTA 4X6MA 1C1RA 5HXFA 2QIQA 2STAE 2XC5A 3EYDA 5A0AE 1Y8TA 1MKWK 5DK1A 2NU4E 3KQBA 3BG4B 1KLIH 5C5NA 1THRH 4H42U 5GDSH 2Q6DA 1EASA 1CO7E 1O3EA 2UUKB 4NFEA 1SFQB 3LPRA 1A5IA 2BXUH 1FQ3A 1XKAC 2CHAB 2Q1JA 1P09A 1Y3UA 3RXUA 1AZ8A 3K2UA 5EGMA 1V2NT 3HPTB 1J17T 3K65B 2P3FH 1PQAA 2BDBA 1OWDA 3BF6H 4OGXA 1V2VT 5LGOA 4X6PA 2WPIS 4DURA 4ABAA 3TH3H 1EOLA 1BMNH 1P8VC 2VWOA 1KXDA 1ZPBA 3A8AA 5F8XA 1Y59T 1YPEH 3CP7A 5EQQA 1HXFH 4DY7B 5DP6A 3Q3KA 1C5OH 4OS6A 1LQDB 1RXPA 5IYTA 3SUGA 3HKIB 1Y5UT 2WYJA 3TK5A 1L4DA 3LC3A 4DJZB 1C2LA 3BEIB 1BBRK 1CT2E 1HNEE 1SGCA 2JH6D 3MU1A 4YT6H 1O5AB 5FPTA 6GCHG 2FDAA 3T5FH 1MTNC 1W10U 2AH4X 2ZDAH 1FY5A 1SHYA 2FI4E 1Z8JB 3BTQE 4JZEH 1P01A 4CH8B 3QLPH 1IHTH 1O2HA 1MUEB 1DXWA 2QF0A 8ESTE 1ACBE 1XUFA 3OSYA 3RXRA 5L30H 3BTEE 3A8BA 5A2MH 3ZVCA 1BDAA 1SSXA 3RXCA 1Z6JH 1BBRE 1GI0A 2D1JA 2FIRH 2F83A 2VNTA 2AFQB 3QGJA 1LHCH 1GBAA 3MH6A 4NIYA 1GVKB 2ZTZA 1UJ1A 1UTQA 3E6PH 1F0TA 1F2SE 1UK3A 1O2JA 2B9LA 4NSVA 1AD8H 1ABJH 1HUTH 1BRCE 3BEFB 1O3AA 1SLUB 2CGAA 2Y81A 1NRPH 3ZZAA 4ABDA 1GMCG 3A87A 3NWUA 1IQHA 4AYYB 1NFYA 2CN0H 3SHAH 3BV9B 4AYVB 3QTOH 2FWWA 2TIOA 2R3UA 4O9VA 1HAZB 4JYVH 3T2NA 1W7XH 3M5NA 1O2VA 1IOEA 1YYY1 4ISLA 1QB6A 1S0RA 2GZ7A 2Y80A 3RXSA 1TGBA 3QDZB 5GCHG 2QY0B 2P95A 1MQ5A 4CBNA 1VJ9U 5EOKA 1DY9A 1QBOA 2BD4A 1AWFH 1C5YB 2Z94A 3GCHB 1DUEA 3DA9B 2ZFQH 2H5DA 3U1IB 1BTZA 3RXQA 3UQVA 1GI3A 1T32A 3AASA 4AFQA 4CRFA 1SBWA 3KCGH 2V0BA 3GY5A 1T8NA 3SU1A 2Y5HA 3LU9B 3QZRA 1O33A 1ELDE 1Z1IA 1UCYH 1EB1H 3SHCH 1Y3XA 3A7XA 3SJIA 3A8CA 1QBNA 4I32A 3R0FA 1O3KA 4OS1A 1AB9C 4K8YA 5EXMA 2OLGA 4AB8A 1LVBA 1NS3A 2BDGA 1C2FA 3GOVB 2CXVA 2ZGCA 5E2OA 1W11U 4Y76A 5BPEA 3ZV8A 1OS8A 5A8YA 1Y5AT 3K6YA 1KYNA 5DO4H 1HDTH 1MAYA 3URDA 4Y7BA 1GDUA 3RM0H 1A0LA 5AF9H 1Y3YA 2JETB 5JBTA 3L33A 1NN6A 1LHDH 1V2JT 2ZZUH 2BQ6B 1W0ZU 4Q7YA 3V7TA 1FIZA 1ZPZA 3D23A 1YM0A 1BMMH 1C1SA 1ARCA 1O2XA 2RDLA 2Z9GA 3KF2A 3S69A 3O8BA 3ZVEA 2AGGX 3VB5A 1YBWA 2PHBA 2ZKSA 7GCHG 1DXPA 1WU1A 2P59A 1C5RA 1AHTH 1SPJA 1HJAB 2QCYA 4FU8A 3NXPA 4X8VH 1FONA 5A0BA 2HVXA 2Y6TA 3E90B 4IW4E 1GBTA 1WTGH 4FUEA 3SGBE 3A85A 5LPEA 3FP7E 1MBQA 4WH6A 1EPTC 2A4RA 1TQ0B 1H4WA 1HIAB 2XW9A 2TRMA 1TNGA 4OS5A 3ZZ3A 1V2WT 2GZ9A 2IN2A 2QA9E 1K22H 2F9OA 2F9PA 1TMBH 4BAMB 2PKSB 3URCA 1ESAA 4TY7A 1CGJE 4CRDA 4TPIZ 1ZPCA 1OWHA 2PR3A 2R3YA 1GCTC 1W12U 4D7GA 2AEIH 2OXSA 3DFLA 2VIQA 3MI4A 2F3CE 4U32A 3E0PB 4F4OC 1D3DB 1K1NA 4H4FA 4NA7A 2FOAA 1YCPK 4ZHAA 1AFQC 1HAIH 3PWBA 3DFJA 4XDEA 2QGRA 1UK4A 1P12E 1P2IA 1V2MT 2OINA 1H9HE 3E0NB 3M3VA 3ZVAA 1THPB 4ISNA 1ID5H 2PLXA 3D65E 2AMPA 3PMAB 1O3GA 2A2QH 5L2YH 3ENSB 1ELCA 3SI3H 1F5KU 5EG4A 4WXVA 2A7HA 1GJ8B 1OSSA 3E8LA 2A4QA 2C8YB 3GCHC 4AB9A 4FVDA 6CHAB 3KL6A 1SGQE 3A84A 4Q80A 2Z7FE 3OY6U 2OC7A 1O3IA 1BUIA 2ZQ1A 1F0SA 2EI7A 3RXHA 3SGQE 1NRQH 1AN1E 1Y5BT 3MMGA 2BXTH 2BVSH 1HV7A 2F91A 1UVTH 3SUEA 2AYWA 4A92A 1YPJH 2ZEBA 3RXJA 2GD4B 3U9AH 2PW8H 1HYLA 3FVFB 5E0GA 3ELAH 1ANEA 1XM1A 2H1UA 4CR9A 1RTFB 1AU8A 4SGBE 3MH7A 1O2PA 4GCHG 5EXNA 4GHQA 2TGTA 1C5MD 4IS5A 1LO6A 3EGKH 5E0HA 1YKTA 4ABEA 4YOIA 1BRUP 1HXEH 4KTUA 1TGCA 3PLKA 4TWYA 4AX9H 1Z8GA 3F9HA 1NZQH 3TH4H 2ZGXH 5AFZH 1O2ZA 1MKXH 1NT1A 1KIGH 1SGFG 1XUIA 2H9EH 3A7YA 2QXIA 3DD2H 5A8ZA 2H2ZA 5F8ZA 1S82A 1QR3E 4GUXA 1O5BB 4ISHH 3RLWH 4YOGA 1HJAC 1BJVA 1GJ6A 1YF4A 2ZFTA 4CRGA 4CH2B 3P95A 2BMGB 2HLCA 1MTUA 5FPSA 1LPKB 1W14U 1SL3A 1NPMA 3NPSA 1HB0B 3UREA 1GI1A 3ZZ5A 3S0NA 4INHA 3A81A 2A2XH 3MO9A 1SQOA 4I8GA 1FNIA 3JZ2B 2PTNA 5HM9A 4D9RA 3SU4A 3LT3A 1LMWB 4FVBA 1L2EA 2BDYA 1WQSA 5CHAC 3ATLA 4BANB 1EATA 2G8TA 1GI6A 1RFNA 3IG6B 1FY3A 1S81A 4IN2A 1CA8B 1G9IE 2BY7X 2G5VA 3KNXA 1ANCA 2ZHEH 1TYNA 2WUCA 2F9UA 2GVFA 1CBWB 1HAOH 2J95A 4CRAA 3LONA 5J4QA 3A8DA 3RXGA 2TGAA 1OWKA 1BT7A 1HAGE 3LH3A 1EKBB 1ELFA 1MCTA 1BA8B 1GBFA 4UFGH 4I7YH 4CRCA 1GG6B 1Y3WA 1GHAF 2J2UA 3VPKA 1AGJA 1V2PT 2C8WB 4FUFA 1L1NA 3M7QA 4FUGA 3OU0A 1V3XA 2R0LA 4JYUH 2ZA5A 2B7DH 1RD3B 3BIVH 5EQRA 3GCOA 2FI5E 1Z7KA 5FXLA 2FX4A 2VU8E 2OQUA 3GCTG 1DICA 2BD2A 1TOCB 1V2RT 4AFSA 2JKHA 1CQQA 1CT0E 2FI3E 3BIUH 1QY6A 3SN8A 4ABIA 1TPPA 1LHGH 2C8ZB 3NK8A 1NRNH 1IQKA 1S5SA 2XCFA 4UFEH 4ZHLU 3N7OA 4D7FA 3STIA 3LJOA 1LKBA 1TAWA 4ESTE 2PSYA 4AGKA 3KN2A 3GICB 1IQNA 3NUMA 1NTPA 1QJ1B 3GY3A 3OTJE 2ZC9H 4ZXXH 1H8DH 1SGPE 2CV3A 1AO5A 1O35A 2A5AA 3AW1A 1YC0A 2HNTF 2ZDKA 1IHSH 3RMOH 1HCGA 2ZPRA 1BTUA 5F6MA 2XRCA 3ATWA 4NA8A 1O32A 2XYAA 2CMYA 1FY1A 3KQDA 1QQUA 2QC2A 2RG3A 3RDZA 5TJXA 1QNJA 2GCHF 5SGAE 1DFPA 4I8HA 3RXVA 4YLUA 4K1EA 1RGQA 5FX6A 3V13A 3RU4T 2J94A 1MTVA 2G4TA 1GWAA 4I33A 2Z9IA 1O3CA 1TRNA 1ETRH 1AI8H 2FYRA 1GMDF 3PTBA 1C1TA 3HK3B 4FU7A 4Y8XA 3MU8A 2H9TH 1IQMA 1AVXA 3MH5A 3ZYDA 3ZVBA 1RIWC 3RXKA 1AVWA 4AG1A 2UUFB 3QTVH 1O3BA 2Q6GA 2ALVA 1BJUA 1GVZA 1XKBC 4Y79A 3P8NA 1GHBG 2ZPSA 5ESBA 2ZWLH 4AGJA 5ESTE 1C1NA 1NFXA 1J8AA 5T6GA 2W5EA 2ZG0H 1DT2A 1YP9A 3QO6A 4ZHMU 4JZDH 1ZRKA 4A1XA 1TPOA 3L3TA 1EUFA 5ETXA 1NU9A 4JK5A 4D76A 3QX5H 1HLTH 2FX6A 4R0IA 2O8MA 1DS2E 1PFXC 1GHXH 4ZAEA 1K2I1 3FZZA 1CBWC 2KAIA 1FMGA 3RUOA 1C5PA 2FYQA 2Z9JA 1ELGA 1OOKB 4GSOA 3W94A 1GG6C 1ZSLA 2FOGA 4A5TS 3U8OH 1UMAH 3IITA 3SJ9A 2EC9H 1HIAA 1YPGH 1QL7A 1XXDA 3RXAA 2BZ6H 4NIVA 2CJIA 2BD7A 5AVDA 2Y5GA 1QJ7B 1WV7H 2V3HH 2GV7A 3ZZDA 1AB9B 1A3BH 4BXWA 2NU1E 1P2MA 1TQ7B 2D2DA 4MNYA 4X1NU 3RXLA 2W3IA 4X2WA 5E8EH 2SGDE 1T8OA 2QYIA 3PTNA 5C1YA 3L6PA 2WPMS 2HPQH 2ANKH 2XNIA 1SI5H 1O31A 4WWYA 1G3EA 4DCDA 2BQWB 2O9QA 1ANBA 3M5OA 1HBTH 3GY4A 1IQLA 4ABHA 1Z8IB 1OP0A 2P94A 2BVXH 1GBMA 1EB2A 1V2OT 3BTHE 2EEKA 1P0SH 1P2QA 2ILNA 1P2JA 1O3NA 1V2TT 2ANYA 2EI8A 2ZO3H 1QIXB 1IQEA 1TBZH 2FXRA 1X7AC 1IQJA 1OXGA 1EAUA 2PSXA 3PROA 4NFFA 4K3JA 3SNEA 4O3TA 1BTWA 3HGPA 3S7HB 1ZSKA 5JB9S 1C5LH 3TIUA 2OBQA 1GHWH 1V2QT 1HAYB 1GI5A 1HGTH 3F1SB 3SNDA 2AMDA 2Y7ZA 2BM2A 1EPTB 3RXEA 2W7UA 1O2IA 4UD9H 2FOEA 3EAJA 1QRWA 2GKVE 3E3TA 2G4UA 3P92A 4MPWA 4D9QA 1G32B 2BHGA 1TGSZ 2BB4A 1EJAA 1YLCA 5JYIA 5C5OA 3SV6A 1N6YA 1GCTB 1SGEE 2ANMH 3O8CA 1OYTH 2GGVB 4MVNA 1K1JA 3Q76A 2BLWA 2SNWA 1D6WA 4NZLA 1K1IA 1O3PB 1AFQB 2Z9KA 1KSNA 3NZIA 1EP6A 4YM9A 1O3FA 3RU4D 1EOJA 1OWJA 4TYDA 3TITA 2G55A 8GCHF 2IJOB 2ZP0H 3A7TA 1TA6A 2VIOA 3SV9A 3ZZ6A 3CS0A 1N8OB 4AN7A 1HAVB 2VVUA 2FOHA 1JRSA 1QA0A 4Y6DA 5JBBS 1J15A 1P3CA 1EJMA 1QRZA 1CU1A 3UQOA 3TNTA 3GY7A 3V0XA 1P3EA 2Z3DA 2BY8X 2VINA 2BX3A 2OUAA 3T28A 2GDEH 1C2EA 1OX1A 1KDQB 3MOCA 2A4OA 1MCVA 2QXJA 2A7CA 4WH8A 3MFJA 3U8RH 3ZZ7A 2BLOA 1K9OE 2WINI 2XTTB 5GJ4B 3W95A 2BZAA 4FUDA 3EA7A 5CMXH 1D6RA 4LZ4B 1AY6H 3ZVDA 4Y71A 4I8KA 4ISOA 1GJAB 1MD8A 1EAXA 5DP8A 2HPPH 1GI9B 1G3CA 1FDPA 4WXIA 2AERH 1BITA 4K2YA 1GHVH 4B71A 3UWJH 1TNLA 2FPZA 2G51A 4NGAH 1DDJA 5FPYA 4ZUHA 3MO3A 4MTBA 4GVUA 3UWIA 3MO6A 1W3CA 1EX3A 1ORFA 4XE4A 1CE5A 2BQ7B 3DT0H 2PUXB 3T26A 4BTTB 1DPOA 5C67A 1LVYA 2PGBB 1SOTA 1KXBA 2PGQB 3V3MA 3GYLB 3TH2H 1BOQA 1YPHC 1GJCB 1F5LA 2AGEX 3MHWU 2J34A 1P04A 1P06A 1PJPA 1ZHMA 5I25A 1O3JA 3F9EA 1SGIB 1MKWH 3SU5A 1C1MA 2BY5X 1T8LA 4E05H 3OYPA 2CF8H 4IMZA 2WPLS 2KAIB 3TJOA 5EPNA 1P10A 5L2ZH 1CGIE 1DSTA 5FHTA 2SNVA 1NFUA 3QN7A 4JZFH 2Z6BD 1FN6A 1UTOA 4I8LA 2BLQA 2A0QB 1TGNA 2BY6X 2W26A 4WF8A 5EQSA 1O2MA 1GBEA 4Q7XA 2HRVA 1MQ6A 5CHAB 1ESTA 4K69A 3RXMA 2XBWA 4IC5A 1EZQA 4YLQH 4KTCA 1UHBB 1CSOE 1GBBA 1VJAU 1O37A 4WMDA 2ZU3A 2D26C 1K1MA 2H6MA 3PM3A 1D4PB 3U98H 3M37A 1AUTC 1JOUB 1L1GA 1Z1JA 4B2AA 1LPZB 1AE8H 4U2WA 4O3UA 1GBDA 2AS9A 2ZNKH 1T31A 1BBRH 1KTTB 4FUJA 3UFAA 3TGIE 1A5GH 4DOQA 1F7ZA 1C5XB 1WUNH 2FOMB 2IOTA 1CT4E 1P11E 3S9AA 1T4VH 1HAXB 1TRMA 1ETSH 1N8OC 1BMAA 4AOQA 3LGTA 1O2QA 1C2KA 4MPVA 2ZGJA 2NU0E 1A5HA 1O3HA 1GJBB 3RXTA 1Z71A 2ZGBH 4U30A 1INCA 3PV4A 3TJNA 1EP5A 3SJ8A 4BOHA 1O3OA 1WCZA 3TGJE 2XBVA 1QURH 1O30A 4I31A 2OBOA 1GMHF 3UNSA 2A31A 4JCNA 1FPHH 5H4IB 2GT7A 1UTPA 2VB0A 4OS2A 3IWMA 4MNVA 4BAOB 3RXIA 1FLEE 1GDQA 1TIOA 5DKMA 3DUXH 1H1BA 2BTCE 2Z3EA 4BTUB 4DVAU 3SV7A 3C27B 3UPEA 1YCPM 1JXPA 3PMHB 1TLDA 4BXSA 1JWTA 1SQTA 1TMTH 1C2HA 3FFGA 1OP8A 1UTJA 4LOYH 5DP9A 2G5NA 1UTKA 4A7IB 2BDIA 1L4ZA 4BAHB 4H6TA 4E7RG 1PQ8A 1V2UT 1O2LA 3ZZ9A 2JH5D 2HALA 1T7CA 2SGEE 1CHOF 2VH0A 1GI8B 2BD5A 2GT8A 1C5TA 2XXLA 1O5DH 1VITF 3P17H 3MU5A 3A7VA 2PWXA 5C3NA 2HGTH 3QWCH 4CBOA 1W7GH 2DE8A 1AVGH 3LGUA 1QBVH 4GPGA 4ZMAH 2ULLA 3EDXB 5EPYA 4MNXA 1E37B 1GBCA 1RIWB 2IPHA 2TGDA 2Y82A 3SNBA 2A1DB 2ZECA 4UFDH 1TNHA 1MU6B 2F9BH 3D62A 4FUBA 3RLYH 6ESTA 2SFAA 4DGJA 3GCNA 1DANH 1TABE 1O0DH 4HI3A 5C20A 1ZRBA 2UWPA 2SGPE 1T8MA 3Q77A 3SBKA 1BB0B 1TRYA 1B7XB 1GJDB 1A4WH 1G3DA 3I78A 4ASHA 2VGCB 3M35A 3SI4H 3RXDA 3TPIZ 1WAYB 2RA0A 3SV8A 2VWLA 1EZUC 1J14A 2VIVA 4CRBA 5DG6A 4YZUA 4I8JA 2OTVA 1SGFA 1SGYE 3VGCC 1GI7B 4J1YA 4ZXYH 1GVLA 2R2WU 3KQEA 2FESH 4INLA 1JIRA 3A7ZA 1O2NA 4Y8YA 2K1QA 1E34B 1MTWA 2G00A 4IBLH 1A1RA 2BD8A 3MH4A 1TA2A 1YLDA 2NU2E 4Q7ZA 1PPFE 2QN5T 1H9LB 1MH0A 4XFQA 1EPTA 3VB3A 3T29A 3SU2A 1O3MA 1VGCC 4DG4A 1FIWA 1G3BA 1SR5C 5DJ7A 5E0JA 2A32A 4ZKNU 3O8DA 3QZQA 3PO1C 3ZZCA 1ZSJA 1TPSA 1O39A 1EAIA 4MQAA 2ZFFH 2NWNA 1ELEE 1GGDC 2TPIZ 4YT7H 2HNTE 1O3DA 2FS8A 1C4V2 4X2VA 3C1KA 1Y3VA 2ZPQA 3BEUA 8KME2 1EJNA 2M5TA 3OX7U 2UWOA 4WY3A 4X8UH 3CS7A 1FI8A 2OC0A 2Y7XA 3MU0A 4K8BA 1KXEA 1D3QB 2WV4A 1NRSH 1UVOA 1O2WA 2G81E 3GDUA 3GISB 1A7SA 1C5VA 2ZTYA 1GJ5H 1LTOA 1UVUH 1ZHRA 1DLEA 1P2KA 5FX5A 1HAVA 1EXFA 2Z3CA 3EA8A 4AFUA 1K1LA 3MTYA 3HKJB 1B0FA 1TNKA 4OS7A 2J4IA 3HK6B 2ZCKP 3LKWA 2VWMA 1NROH 1HFDA 2OCVB 1TX6A 4FUCA 1KDQA 4KGAA 2RA3A 4NZQA 1LVMA 2HOBA 1C2MA 2XC0A 1AKSB 1OWIA 1VITH 1YCPH 1V2ST 1ZR0A 1E36B 2QXGA 1ZJKA 4IGDA 1C5UA 2YNBA 2C93B 1BTPA 2CF9H 1GBLA 4LZ1H 2VWNA 2QXHA 3ZV9A 1C5QA 3RMLH 1TMUH 5FCRA 1FPCH 1CGHA 1C5ZB 2FMJA 4LXBH 2FOFA 3SQHE 1PPBH 1ZTLA 1LVOA 9LPRA 1UTNA 2GMTB 3JZ1B 3GY8A 6GCHF 4DIIH 1C5SA 1QA7A 4WMEA 4FU9A 4X6OA 1ESBA 2BOHB 3SNCA 1AQ7A 1O2KA 1TBQH 3SO3A 1P2OA 4IMQA 3VXFH 1FAXA 1TFXA 5BRRE 1QRXA 4YO9A 2FS9A 1KLJH 3GY2A 2PUQH 3ITIA 5F8TA 3QUMP 4HZHA 3A80A 2SGAA 3Q3XA 3H5CB 1GDNA 1DUAA 1ZMLA 1FUJA 1QFKH 1UCYK 3RMMH 2BD9A 3PLBA 1FZZA 3LIWA 1NC6A 1SLVB 1TNIA 2O8UA 1E35B 2VGCC 2ZU4A 3DHKH 3GYMA 1A2CH 3ZZBA 1XUGA 4FXGH 1SGRE 1XUKA 4X8TH 3GY6A 3PMBB 3I77A 2J9NA 3P70B 1JBUH 1P05A 2ZFRH 2BDHA 3LOXA 1GHAG 1BQYA 1CA0B 1XXFA 4AZ2B 3T25A 5GIBA 3LH1A 5FBEA 2ZQ2A 4B75A 1RRKA 1UCYE 4K5ZA 1VZQH 4UEHH 3HATH 1HRTH 3VXEH 5DP3A 1DWEH 7LPRA 4X1QU 1GMCF 4O03A 1GJ9B 2GX4A 3M5MA 1LDTT 1IQIA 3LGVA 1JIMA 4ZKOU 3NCLA 4MPXA 3FP6E 2AMQA 3M3TA 5A09A 1L1JA 1DM4B 1AUJA 1PYTC 1AIXH 3SQEE 4B74A 4K60A 1C4U2 1H9IE 3SV2H 5GCHF 5LPFA 1UHBA 4X1SU 5LH8A 2NU3E 3T27A 4NIXA 1BRBE 2ALPA 4RN6A 4UONA 3H7TA 2ESTE 4HFPB 1C2DA 1TWXB 4ABBA 1U6QA 1W2KH 1GBHA 2RCEA 4Q2KA 1TOMH 1QCPA 3D49H 4KELA 4F49A 4MPUA 4YTAA 5DP5A 3MWIU 1D3PB 1THSH 4JZIA 2P8OC 3BTFE 2YOLA 1J16A 3KQCA 4VGCB 1HJ8A 1BMLA 1GL0E 2DUCA 1C1UH 2BYAX 3ODFA 2GCTC 5B6OA 1WSSH 2AIPA 3M36A 3MU4A 2ZGHA 5GPIB 1DWBH 2A45B 1NU7B 1XX9A 1O5CB 1TPAE 4MNWA 2GCHG 1C2JA 3UOUA 3O8RA 2TGPZ 1K1PA 1KXFA 3AAUA 2TBSA 2WV5A 4M7GA 3FZDA 1XUHA 2FTMA 2BLVA 4B2BA 3LGWA 1ZZZA 1GJ7B 1HJ9A 1NRRH 1GMDG 2ZHWH 1NESE 3KEEA 1SLXB 3UY9A 3SU0A 3PYHA 1CHGA 1KXCA 3MNSA 5C2ZA 1OP2A 1V2KT 2THFB 2W3KA 5DGJA 1BTYA 4JMYA 1MAXA 1RTKA 5IDKA 1TB6H 2C3SA 4XSKU 4ZKRU 3VFEA 4NWLA 1Q3XA 2XBXA 4UDWH 2PV9B 5HGGA 1DWCH 4PROA 1ZLRA 2P16A 5JB8S 1NO9H 4KTSA 2GMTC 3MNCA 1C5WB 1NY22 4CHAB 1KLTA 2J92A 3ZZ4A 1O2RA 2XC4A 2STBE 1PPGE 3NKKA 7GCHF 1ANDA 1OYQA 2FEQH 3A88A 3EA9A 1UTMA 4FUHA 1GHZA 3TNSA 3F68H 5EW1H 4HGCA 3A82A 1V2LT 3SNAA 1IQGA 2FO9A 3I29A 5FCKA 4NSYA 1E38B 1SLWB 1Z8RA 4LK4A 1ZYOA 2ZDLA 5PTPA 2EI6A 1LHFH 2ZHDA 5AFYH 3RXPA 1FY8E 1PPCE 4IC6A 2A5KA 4X2YA 2FM2A 3FP8E 7ESTE 1QL9A 1T4UH 5FAHA 3GDVA 2GDDA 1A61H 1UK2A 1DY8A 4B1TA 3RC4A 1LQEA 1CA0C 4X6NA 2ZDVH 1NFWA 1P02A 4XBCA 3BN9A 2V3OH 2AGIX 4NWKA 1VR1H 3TVJB 3STJA 4MG3A 3TU7H 4Y7AA 2ZIQH 3FANA 4Y10E 1ZGIA 1O2GH 2BD3A 3K6ZA 1W8BH 1W13U 3F9FA 1F5RA 1TNJA 4Y0YE 4WJG2 1RJXB 4YOJA 4JYTA 1NM6A 5T6FA 2PKAB 1MKXK 2VVCA 3TK6A 4X2XA 4WVPE 2ZI2H 1FN8A 1BHXB 1GHYH 2VIPA 4A1TA 1PQ7A 3E1XB 5JBAS 3U69H 3BTTE 4JZ1A 5AHGH 5I46H 4ZROA 5TCCA 1BIOA 1FXYA 3T62A 1UVSH 1JRTA 1XVOA 3BG4C 1OWEA 3KIDU 4UE7H 2BDCA 3B23B 1K1OA 1DSUA 4H6SB 1ELAA 1KXAA 2ZCHP 2VH6A 4BAKB 2UUYA 1ARBA 1N1LA 1VCPA 3P8OA 1DX5M 2CHAC 4Z0KA 3U1JB 1SGNE 3BSQA 4VGCC 1AE5A 2P3UB 4AG2A 2ODYB 3SOSA 1WBGB 2G52A 3ESTA 5GXPA 2BY9X 2O8TA 3BTGE 4SGAE 3TK9A 1M9UA 1GI2A 4Z6AH 3WY8A 3U8TH 4J2YB 4X1RU 3S9BA 4NCYA 1MZDA 1G37A 5GWZA 3OY5U 3SGAE 2ZFPH 2DE9A 1O34A 1H8IH 3LGIA 9ESTA 3AW0A 1SHHB 1RS0A 4RKOB 3SUFA 1YPHE 4XOJA 4E06H 4CR5A 4GCHF 3Q3YA 4MLFB 5C1XA 1HAPH 1FV9A 2R2MB 5T6DA 2C4FH 4X0WU 1KTSB 2GZ8A 1O5GH 3LDXH 2F9VA 2I6QA 2BX4A 4K1TA 1IAUA 1VCQA 3A89A 3VGCB 1ZTJA 3VEQB 3E16B 1QGFA 4OS4A 3B9FH 1OPHB 4QT8C 2VVVA 1WTHD 4RKJB 3RU4E 1D9IA 3M5LA 4CHAC 3BG8A 1GCDA 4TY6A 5HYOA 2OC1A 1AKSA 3AVZA 3P8GA 2AIQA 3RP2A 1FY4A 1S83A 1QQ4A 8GCHG 2GTBA 2B0FA 1MTSA 4B73A 5JDUB 1ZTKA 4IN1A 2YNAA 1VGCB 3VB4A 1MBMA 2ZCLP 4DW2U 3SW2B 5E2PA 3PO1B 3RC6A 3SJOA 4Y11E 5DP4A 1O2SA 5C1UA 1SGTA 2A7JA 2FLRH 4ZH8A 1DITH 4TWWA 4NG9H 1GGDB 5HMAA 5A0CA 1LCYA 3PLPA 2VIWA 1TONA 1SFIA 2JH0D 4Y8ZA 3LC5A 1C1PA 4R8TB 5TCAA 3TJUA 1AWHB 5K0HA 4HTCH 2FODA 3SU3A 1RTLA 1S6HA 2VJ1A 3HGNA 3RC5A 2OD3B 1O5FH 3KGPA 4GLYA 2V6NA 2GV6A 3P6ZB 3AAVA 1ABIH 2B5TB 3A86A 3EQ0H 3MYWA 2FTLE 1ETTH 1XVMA 4A1VA 3UNRA 2ZDNA 4YESB 2UUJB 1AZZA 3BTME 4AFZA 2WUBA 4GAWA 2UWLA 3SZNA 1D3TB 3GCTF 1O36A 1C9TA 5JBCS 2ZU2A 1SC8U 4JK6A 3M7TA 1DWDH 1GBIA 2OP9A 3CENA 4MDSA 2B8OH 3TLOA 1LPGB 3ATIA 4B2CA 3ATMA 4DIHH 1KY9A 3EE0B 1SG8B 1ZGVA 1CVWH 1B0EA 1G36A 1O2TA 1Q2WA 1V6DA 1DLKB 3UUZA 3KHVA 1O2UA 1K21H 3SU6A 1O2YA 2ZHFH 3S7KB 5ABWA 3LJJA 7KMEH 1O3LA 1O2OA 5LPRA 3K9XB 5JPMH 5G4BA 3QK1A 1BHXF 1ZMJA 3S9CA 2Y5FA 1BRAA 2WPJS 1C2IA 2QF3A 1IQFA 1BTHH 3G01A 3TGKE 3RXFA 2XBYA 4THNH 2R0KA 1P9UA 1C2GA 1VCWA 1W0YH 3E91A 1C1VH 4D8NA 5A8XA 2JETC 1SVPA 1WQVH 2VIDA 4E7NA 2I6SA 4CREA 2LPRA 2WPKS 3UOPA 5HM2A
chains in the Genus database with same CATH superfamily
1YPMH 4BAQB 4X1PU 4X8SH 1C1QA 3VB7A 2FLBH 1TGTA 2ZU1A 4XRNA 1QTFA 1BTXA 5FBIA 3SORA 2ODQA 1MMJN 1TALA 2XWBI 3M7UA 4RSPA 2ZU5A 3ATKA 1DVAH 4FUIA 4OGYA 5K7RA 3MQKC 3F2FA 1FAKH 4B76A 1ZOMA 1OKXA 3RMNH 3LGYA 5DP7A 1F92A 1EZSC 4XD7D 1QHRB 2ZDMA 4NIWA 3RXOA 1GHBF 1TX7A 5F03A 4TPYA 2A4GA 3H7OA 4XBBA 1S84A 4XBDA 1J9CH 4NA9H 3BTKE 2H5CA 2PKSC 1XUJA 4WMFA 2XCNA 1BZXE 4KKDA 5EXLA 5EODA 3A7WA 4INKA 2H9HA 1L0ZA 3ZVGA 2WPHS 1SB1H 8LPRA 2EA3A 1PPEE 1P2NA 3PMJA 1GMHG 1BCUH 1GPZA 2BVRH 4BTIB 4Y0ZE 5T3HA 2J38A 2D8WA 5EW2H 1A0JA 3PB1E 1S6FA 1UO6A 2BDAA 1S85A 1EAWA 2P8OB 1GI4A 2P93A 3P8FA 3MNXA 2HNTC 1UTLM 2FZZA 3PWCA 2GCTB 4ISIH 1O5EH 1AFEH 1GJ4H 1PYTD 3M3SA 3UR9A 4A6LA 5CHBA 3RXBA 1HAHH 1N6XA 1QJ6B 3FAOA 1P03A 2OC8A 2ODPA 2BOKA 3M61U 4RT0A 1C1OA 1ELBA 3F6UH 6CHAC 3ZZ8A 3ZIAD 3ODDA 2F9NA 2PFEA 6LPRA 2WYGA 2ZF0H 4ZKSU 4ABJA 2GP9B 1SQAA 1QB9A 1ZJDA 3RM2H 1G2MA 3A83A 1CHOG 3V12A 4KP0A 1O38A 1UVPA 5B6LA 3TJVA 1MU8B 1VITG 5CE1A 1YPLH 1P57B 1A46H 5J4SA 2P3TB 1C4Y2 1WOFA 2KZ4A 1LHEH 1BMFD 2ZHQH 1G2LA 4O97A 3BTDE 2PKAA 1MTNB 2SGQE 1YPKH 3QGNB 5DPAA 1YGCH 1TBRH 4U01A 3SJKA 3GS9A 2RFKC 1ELTA 3B8JA 2QV1A 1QB1A 3EE7A 1AMHA 3UNQA 4UFFH 3GDSA 1MZAA 1EZXC 2XWAA 1S0QA 1B5GH 3PV5A 1K28D 1C1WH 1SOZA 2ANWA 3R3GB 1JMOH 1SMFE 2O8LA 1F0RA 2W7SA 1MD7A 3BTWE 1PQ5A 4ABFA 2SGFE 3UIRA 1C5NH 3Q00A 1PPHE 1F0UA 3MNBA 2A5IA 2HWLB 1TX8A 2QAAA 1P9SA 2ASUB 1HPGA 1QL8A 3ZYEA 3F9GA 2FOCA 1WYKA 1ZHPA 1H8HD 1GBKA 2Q6FA 4K1SA 1PPZA 2LNCA 1ZMNA 2FOBA 5EU8A 1TE0A 2V35A 3UTUH 1EQ9A 4ABGA 1LKAA 1A0HB 2PTCE 3ZVFA 1DOJA 1A3EH 3SUDA 3VB6A 1SGDE 2O8WA 1G30B 1Q31A 5L6NH 3OFND 4DT7B 1C9PA 2C8XB 2ZFSA 1ELVA 1FJSA 1GL1A 1XMNB 2J5UA 2C90B 3UR6A 4AORA 1GBJA 2ZTXA 2FP7B 2R9PA 2Z9LA 1E0FD 1Z6EA 2OQ5A 4BNRA 3N99A 1DE7H 4GHTA 4X6MA 1C1RA 2IJD1 5HXFA 2QIQA 2STAE 2XC5A 3EYDA 5A0AE 1Y8TA 1MKWK 5DK1A 2NU4E 3KQBA 3BG4B 1KLIH 5C5NA 1THRH 4H42U 5GDSH 2Q6DA 1EASA 1CO7E 1O3EA 2UUKB 4NFEA 1SFQB 3LPRA 3DSGA 1A5IA 2BXUH 1FQ3A 1XKAC 2CHAB 2Q1JA 1P09A 1Y3UA 3RXUA 1AZ8A 3K2UA 5EGMA 1V2NT 3HPTB 1J17T 2LP6A 3K65B 2P3FH 1PQAA 2BDBA 2JJ1D 1OWDA 2KCAA 3BF6H 4OGXA 1V2VT 5LGOA 4X6PA 5KEDA 2WPIS 4DURA 4ABAA 3TH3H 1EOLA 1BMNH 1P8VC 2VWOA 1KXDA 1ZPBA 3A8AA 5F8XA 1Y59T 1YPEH 2LELA 3CP7A 5EQQA 1HXFH 4DY7B 5DP6A 3Q3KA 1C5OH 4OS6A 1LQDB 1RXPA 5IYTA 3SUGA 5C0TA 3HKIB 1Y5UT 2WYJA 3TK5A 1L4DA 3LC3A 4DJZB 1C2LA 3BEIB 1BBRK 1CT2E 1HNEE 1SGCA 2JH6D 3MU1A 4YT6H 1O5AB 5FPTA 6GCHG 2FDAA 3T5FH 1MTNC 1W10U 2AH4X 2ZDAH 1FY5A 1SHYA 2FI4E 1Z8JB 3BTQE 4JZEH 1P01A 4CH8B 3QLPH 1E79D 1IHTH 1O2HA 2KX4A 1MUEB 1DXWA 2QF0A 2CK3D 8ESTE 1ACBE 1XUFA 3OSYA 3RXRA 5L30H 3BTEE 3A8BA 3H09A 5A2MH 3ZVCA 1BDAA 1SSXA 3RXCA 1Z6JH 1BBRE 1GI0A 2D1JA 2FIRH 2F83A 2VNTA 2AFQB 3QGJA 1LHCH 4F55A 1GBAA 3MH6A 4NIYA 1GVKB 2ZTZA 1UJ1A 1UTQA 3E6PH 1F0TA 1F2SE 1UK3A 1O2JA 2B9LA 4NSVA 1AD8H 1ABJH 5IK2D 1HUTH 1BRCE 2M2AA 3BEFB 1O3AA 1SLUB 2CGAA 2Y81A 1NRPH 3ZZAA 4ABDA 1GMCG 3A87A 3NWUA 1IQHA 4AYYB 1NFYA 2CN0H 3SHAH 3BV9B 4AYVB 3QTOH 2FWWA 2TIOA 2R3UA 4O9VA 1HAZB 4JYVH 3T2NA 1W7XH 3M5NA 2WZQA 1S6LA 1O2VA 1IOEA 1YYY1 3OEHD 4ISLA 1QB6A 1S0RA 2GZ7A 2Y80A 3RXSA 1TGBA 3QDZB 5GCHG 2QY0B 2P95A 1MQ5A 5C17A 4CBNA 1VJ9U 5EOKA 1DY9A 1QBOA 2BD4A 1AWFH 1C5YB 2Z94A 3GCHB 1DUEA 3DA9B 2ZFQH 2H5DA 3U1IB 1BTZA 3RXQA 3UQVA 1GI3A 1T32A 3AASA 4AFQA 4CRFA 1SBWA 3KCGH 2V0BA 2XNDD 3GY5A 1T8NA 3SU1A 3DCLA 2Y5HA 3LU9B 3QZRA 1O33A 1ELDE 1Z1IA 1UCYH 1EB1H 3SHCH 1Y3XA 3A7XA 3SJIA 3A8CA 1QBNA 4I32A 3R0FA 1O3KA 2JDID 4OS1A 1AB9C 4K8YA 5EXMA 2OLGA 4AB8A 1LVBA 1NS3A 2YMSC 2BDGA 1C2FA 3GOVB 2CXVA 2ZGCA 5E2OA 1W11U 4Y76A 5BPEA 3ZV8A 1OS8A 5A8YA 3UAIC 1Y5AT 3K6YA 1KYNA 5DO4H 1HDTH 1MAYA 2KR7A 3URDA 4Y7BA 1GDUA 3RM0H 1A0LA 5AF9H 1Y3YA 2JETB 5JBTA 3L33A 5EIYA 1NN6A 1LHDH 1V2JT 2ZZUH 4RI0A 2BQ6B 1W0ZU 4Q7YA 3V7TA 1FIZA 1ZPZA 3D23A 5EJ1A 1YM0A 1BMMH 1C1SA 1ARCA 1O2XA 2RDLA 2Z9GA 3KF2A 3S69A 3O8BA 3ZVEA 2AGGX 3VB5A 1YBWA 2PHBA 2ZKSA 3OEED 7GCHG 1DXPA 1WU1A 2P59A 1C5RA 1AHTH 1SPJA 1HJAB 2QCYA 3NRLA 4FU8A 3NXPA 4HG6A 4X8VH 1FONA 5A0BA 1WXRA 2HVXA 2Y6TA 3E90B 4IW4E 1GBTA 1WTGH 4FUEA 3SGBE 3A85A 5LPEA 3FP7E 1MBQA 4WH6A 1EPTC 2A4RA 1TQ0B 1H4WA 1HIAB 2XW9A 2TRMA 1TNGA 4OS5A 3ZZ3A 1V2WT 2GZ9A 2IN2A 2QA9E 1K22H 2F9OA 2F9PA 1TMBH 4BAMB 2PKSB 3URCA 2J98B 1ESAA 4TY7A 1CGJE 2WPDD 2QE7D 4TPIZ 4CRDA 1K0HA 1ZPCA 1OWHA 2PR3A 2R3YA 1GCTC 1W12U 4D7GA 2AEIH 2OXSA 3DFLA 2VIQA 3MI4A 2F3CE 4U32A 3E0PB 4F4OC 1D3DB 1K1NA 1EFRD 4H4FA 3SZEA 4NA7A 2FOAA 1YCPK 4ZHAA 1AFQC 1HAIH 3PWBA 3W1EA 3DFJA 4XDEA 2QGRA 1UK4A 1P12E 1P2IA 1V2MT 2OINA 1H9HE 3E0NB 3M3VA 3ZVAA 1THPB 4ISNA 1ID5H 2PLXA 3D65E 2AMPA 3PMAB 1O3GA 2A2QH 5L2YH 3ENSB 1ELCA 3SI3H 1F5KU 5EG4A 4WXVA 2A7HA 1GJ8B 1OSSA 3E8LA 2A4QA 2C8YB 3GCHC 4AB9A 4FVDA 6CHAB 3KL6A 1SGQE 3A84A 4Q80A 2Z7FE 3OY6U 2OC7A 1O3IA 1BUIA 2ZQ1A 1F0SA 2EI7A 3RXHA 3SGQE 3VG8A 1NRQH 1AN1E 1Y5BT 3MMGA 2BXTH 2BVSH 1HV7A 1NBME 2F91A 1UVTH 3SUEA 2AYWA 4A92A 1YPJH 2ZEBA 3RXJA 2GD4B 3U9AH 2PW8H 1HYLA 3FVFB 5E0GA 3ELAH 1ANEA 1XM1A 2H1UA 4CR9A 1RTFB 1AU8A 4SGBE 3MH7A 1O2PA 4GCHG 5EXNA 4GHQA 2TGTA 1C5MD 4IS5A 1LO6A 3EGKH 5E0HA 1YKTA 4ABEA 4YOIA 1BRUP 1HXEH 4KTUA 1TGCA 3PLKA 2KCOA 4TWYA 4AX9H 1Z8GA 3F9HA 1NZQH 3TH4H 2ZGXH 5AFZH 1O2ZA 1MKXH 1NT1A 1KIGH 1SGFG 1XUIA 2H9EH 3A7YA 2QXIA 3DD2H 5A8ZA 3OTPA 4F48B 2H2ZA 5F8ZA 1S82A 1QR3E 4GUXA 1O5BB 4ISHH 3RLWH 4YOGA 1HJAC 1BJVA 1GJ6A 1YF4A 2ZFTA 4CRGA 4CH2B 3P95A 2BMGB 2HLCA 1MTUA 5FPSA 1LPKB 1W14U 1SL3A 1NPMA 3NPSA 5F53A 1HB0B 3UREA 1GI1A 3ZZ5A 3S0NA 4INHA 3A81A 2A2XH 3MO9A 1SQOA 4I8GA 1FNIA 3JZ2B 2PTNA 5HM9A 4D9RA 3SU4A 3LT3A 1LMWB 4FVBA 2F43B 1L2EA 2BDYA 1WQSA 5CHAC 3ATLA 4BANB 1EATA 2G8TA 1GI6A 1RFNA 3IG6B 1FY3A 1S81A 4IN2A 1CA8B 1G9IE 2BY7X 2G5VA 3KNXA 1ANCA 2ZHEH 1TYNA 2WUCA 2F9UA 2GVFA 1CBWB 1HAOH 5EJLA 2J95A 4CRAA 3LONA 5J4QA 3A8DA 3RXGA 2TGAA 1OWKA 1BT7A 1HAGE 3LH3A 1EKBB 1ELFA 1MCTA 1BA8B 1GBFA 4UFGH 4I7YH 4CRCA 1GG6B 1Y3WA 1GHAF 2J2UA 3VPKA 1AGJA 1V2PT 1W0JD 2C8WB 4FUFA 1L1NA 3M7QA 4FUGA 3OU0A 1V3XA 2R0LA 4JYUH 2ZA5A 2B7DH 1RD3B 3BIVH 5EQRA 3GCOA 2FI5E 1Z7KA 5FXLA 2FX4A 2VU8E 2OQUA 3GCTG 1DICA 2BD2A 1TOCB 1V2RT 4AFSA 2JKHA 1CQQA 1CT0E 2FI3E 3BIUH 1QY6A 3SN8A 4ABIA 1TPPA 1LHGH 2C8ZB 3NK8A 1NRNH 1IQKA 1S5SA 2XCFA 4UFEH 4ZHLU 3N7OA 4D7FA 3STIA 3LJOA 1LKBA 1TAWA 4ESTE 2PSYA 4AGKA 3KN2A 3GICB 2J97A 1IQNA 3NUMA 1NTPA 1QJ1B 3GY3A 3OTJE 2ZC9H 4ZXXH 1H8DH 1SGPE 2CV3A 1AO5A 1O35A 2A5AA 3AW1A 4YXWD 1YC0A 2HNTF 2ZDKA 1IHSH 3RMOH 1HCGA 2ZPRA 1BTUA 5F6MA 2XRCA 3ATWA 4NA8A 1O32A 2XYAA 2CMYA 1FY1A 3KQDA 1QQUA 2QC2A 2RG3A 3RDZA 5TJXA 1QNJA 2GCHF 5SGAE 1DFPA 4I8HA 3RXVA 3U28C 4YLUA 4K1EA 1RGQA 5FX6A 3V13A 3RU4T 2J94A 1MTVA 2G4TA 1GWAA 4I33A 2V7QD 2Z9IA 2W6ID 1O3CA 1TRNA 1ETRH 1AI8H 2FYRA 1GMDF 3PTBA 1C1TA 5CDFE 3HK3B 4FU7A 4Y8XA 3MU8A 2H9TH 3F0PA 1IQMA 1AVXA 3MH5A 3ZYDA 3ZVBA 1RIWC 3RXKA 1AVWA 4AG1A 2UUFB 1KMHB 3QTVH 1O3BA 2Q6GA 2ALVA 1BJUA 1GVZA 1XKBC 4Y79A 3P8NA 1GHBG 2ZPSA 2IPQX 5ESBA 2ZWLH 4AGJA 5ESTE 1C1NA 1NFXA 1J8AA 5T6GA 2W6JD 2KFWA 2W5EA 2ZG0H 1DT2A 1YP9A 3QO6A 4OM9A 4JZDH 4ZHMU 1ZRKA 4A1XA 1TPOA 3L3TA 1EUFA 5ETXA 1NU9A 4JK5A 4D76A 3QX5H 1HLTH 2FX6A 4R0IA 2O8MA 1DS2E 1PFXC 1GHXH 4ZAEA 1K2I1 3FZZA 1CBWC 2KAIA 1FMGA 3RUOA 1C5PA 2FYQA 2Z9JA 1ELGA 1OOKB 4GSOA 3W94A 1GG6C 1ZSLA 2FOGA 4A5TS 3U8OH 1UMAH 1E1QD 3IITA 2HLDD 3SJ9A 2EC9H 1HIAA 1YPGH 1QL7A 1XXDA 3RXAA 2BZ6H 4NIVA 2CJIA 2BD7A 5AVDA 3KYGA 2Y5GA 1QJ7B 1WV7H 2J98A 2V3HH 2GV7A 3ZZDA 1AB9B 1A3BH 4BXWA 2NU1E 1P2MA 1TQ7B 2D2DA 4MNYA 4X1NU 3RXLA 2W3IA 5GNDA 2YMSB 4X2WA 5E8EH 2SGDE 1T8OA 2QYIA 3PTNA 5C1YA 3L6PA 2WPMS 2HPQH 2ANKH 2XNIA 1SI5H 1O31A 4WWYA 1G3EA 4DCDA 2BQWB 2O9QA 1ANBA 3M5OA 1HBTH 3GY4A 1IQLA 4ABHA 1Z8IB 1OP0A 2P94A 2BVXH 1GBMA 1EB2A 1V2OT 3BTHE 2EEKA 1P0SH 1P2QA 2ILNA 1P2JA 1O3NA 1V2TT 2ANYA 2EI8A 2ZO3H 1QIXB 1IQEA 1TBZH 2FXRA 2YMSD 1X7AC 1IQJA 1OXGA 2XOKD 1EAUA 2EQNA 2PSXA 3PROA 4NFFA 4K3JA 3SNEA 4O3TA 1BTWA 3HGPA 3S7HB 1ZSKA 5JB9S 1C5LH 3TIUA 2OBQA 1GHWH 1H8ED 1V2QT 1HAYB 1GI5A 1HGTH 3F1SB 3SNDA 2AMDA 2Y7ZA 2BM2A 1EPTB 1YY3A 3RXEA 2W7UA 1O2IA 4UD9H 2FOEA 3EAJA 1QRWA 2GKVE 3E3TA 2G4UA 3P92A 4MPWA 4D9QA 1G32B 2BHGA 1TGSZ 5EJZA 5HIYA 2BB4A 1EJAA 1YLCA 2K0QA 5JYIA 5C5OA 3SV6A 1N6YA 3DSPA 1GCTB 1SGEE 2ANMH 3O8CA 1OYTH 2GGVB 4MVNA 1K1JA 3Q76A 2BLWA 2SNWA 1D6WA 4NZLA 1K1IA 1O3PB 1AFQB 2Z9KA 1KSNA 3NZIA 1EP6A 4YM9A 1O3FA 3RU4D 1EOJA 1OWJA 4TYDA 1YWUA 3TITA 2G55A 8GCHF 2IJOB 2ZP0H 3A7TA 1TA6A 2VIOA 3SV9A 3ZZ6A 3CS0A 1UW7A 1N8OB 4AN7A 1HAVB 2VVUA 2FOHA 1JRSA 1QA0A 4Y6DA 5JBBS 1J15A 1P3CA 1EJMA 1QRZA 1CU1A 3UQOA 3TNTA 3GY7A 3V0XA 1P3EA 2Z3DA 2BY8X 2VINA 2BX3A 2OUAA 3T28A 2GDEH 1C2EA 1OX1A 1KDQB 3MOCA 2A4OA 4B6EA 1MCVA 2QXJA 2A7CA 4WH8A 3MFJA 3U8RH 3ZZ7A 2BLOA 1K9OE 2WINI 2XTTB 5GJ4B 3W95A 2BZAA 5DSFA 4FUDA 3EA7A 5CMXH 1D6RA 4LZ4B 1AY6H 3ZVDA 4Y71A 4I8KA 4ISOA 1GJAB 1MD8A 1EAXA 5DP8A 2HPPH 1GI9B 1G3CA 1FDPA 4WXIA 2AERH 1BITA 4K2YA 1GHVH 5HKKD 4B71A 3UWJH 1TNLA 2FPZA 2G51A 4NGAH 1DDJA 5FPYA 4ZUHA 3MO3A 4MTBA 3F2HA 4GVUA 3UWIA 3MO6A 1W3CA 1EX3A 1ORFA 4XE4A 1CE5A 2BQ7B 3DT0H 2PUXB 3T26A 4BTTB 1DPOA 5C67A 1LVYA 4RT1A 5KECA 2PGBB 1SOTA 1KXBA 2PGQB 3V3MA 3GYLB 3TH2H 1BOQA 1YPHC 1GJCB 1F5LA 2AGEX 3MHWU 2J34A 1P04A 1P06A 1PJPA 1ZHMA 5I25A 1O3JA 3F9EA 1SGIB 3F2GA 1MKWH 3SU5A 1C1MA 2BY5X 1T8LA 4E05H 3OYPA 2CF8H 4IMZA 2WPLS 2KAIB 3TJOA 5EPNA 1P10A 5L2ZH 1CGIE 1DSTA 5FHTA 2SNVA 1NFUA 3QN7A 4JZFH 2Z6BD 1FN6A 1UTOA 4I8LA 2BLQA 2A0QB 1TGNA 2BY6X 2W26A 4WF8A 5EQSA 1O2MA 1GBEA 4Q7XA 2HRVA 1MQ6A 5CHAB 1ESTA 4K69A 3RXMA 2XBWA 4IC5A 1EZQA 4YLQH 4KTCA 1UHBB 1CSOE 1GBBA 1VJAU 1O37A 4WMDA 3F3BA 2ZU3A 2D26C 1K1MA 2H6MA 3PM3A 1D4PB 3U98H 3M37A 1AUTC 2KM0A 1JOUB 1L1GA 1Z1JA 4B2AA 1LPZB 1AE8H 4U2WA 4O3UA 1GBDA 2AS9A 2ZNKH 1T31A 1BBRH 1KTTB 4FUJA 3UFAA 3TGIE 1A5GH 4DOQA 1F7ZA 1C5XB 1WUNH 2FOMB 2IOTA 1CT4E 1P11E 3S9AA 5FL7D 1T4VH 1HAXB 1TRMA 1ETSH 1N8OC 1BMAA 4AOQA 3LGTA 1O2QA 1C2KA 4MPVA 2ZGJA 2NU0E 1A5HA 1O3HA 1GJBB 3RXTA 1Z71A 2ZGBH 4U30A 1INCA 3PV4A 3TJNA 1EP5A 3SJ8A 4BOHA 1O3OA 1WCZA 3TGJE 2XBVA 1QURH 1O30A 4I31A 2OBOA 1GMHF 3UNSA 2A31A 4JCNA 1FPHH 1W0KD 5H4IB 2GT7A 1UTPA 2VB0A 4OS2A 3IWMA 4MNVA 4BAOB 3RXIA 1FLEE 1VKYA 1WDIA 1GDQA 1TIOA 5DKMA 4TT3D 3DUXH 3OE7D 1H1BA 2BTCE 2Z3EA 4BTUB 4Q63A 4DVAU 3SV7A 3C27B 3UPEA 1YCPM 1JXPA 3PMHB 5DN6D 1TLDA 4BXSA 1JWTA 1SQTA 1TMTH 1C2HA 3FFGA 1OP8A 1UTJA 4LOYH 5DP9A 2G5NA 1UTKA 4A7IB 2BDIA 1L4ZA 4BAHB 4H6TA 4E7RG 1PQ8A 1V2UT 1O2LA 3ZZ9A 2JH5D 2HALA 1T7CA 2SGEE 1CHOF 2VH0A 1GI8B 2BD5A 2GT8A 1C5TA 2XXLA 1O5DH 1VITF 3P17H 3MU5A 3A7VA 2PWXA 5C3NA 2HGTH 3QWCH 4CBOA 1W7GH 2DE8A 1AVGH 2L6OA 1QBVH 3LGUA 4GPGA 4ZMAH 2ULLA 3EDXB 5EPYA 4MNXA 1E37B 1GBCA 1RIWB 2IPHA 2TGDA 2Y82A 3OAAD 3SNBA 2A1DB 2ZECA 4UFDH 1TNHA 1MU6B 2F9BH 3D62A 4FUBA 3RLYH 6ESTA 2SFAA 4DGJA 3GCNA 1DANH 1TABE 1O0DH 4HI3A 5C20A 1ZRBA 2UWPA 2SGPE 1T8MA 3Q77A 3SBKA 2PP6A 1BB0B 1TRYA 1B7XB 1GJDB 1A4WH 1G3DA 3I78A 4ASHA 2VGCB 3M35A 3SI4H 3RXDA 3TPIZ 1WAYB 2RA0A 3SV8A 2VWLA 1EZUC 1J14A 2VIVA 3FOAA 5DG6A 4CRBA 4YZUA 4I8JA 2OTVA 1SGFA 1SGYE 3VGCC 1GI7B 4J1YA 4ZXYH 1GVLA 2R2WU 3KQEA 3N7EA 2FESH 4INLA 1JIRA 3A7ZA 1O2NA 4Y8YA 2K1QA 1E34B 1MTWA 2G00A 4IBLH 1A1RA 2BD8A 3MH4A 1TA2A 1YLDA 2NU2E 4Q7ZA 1PPFE 2QN5T 1H9LB 1MH0A 4XFQA 1EPTA 3VB3A 3T29A 3SU2A 1O3MA 1VGCC 4DG4A 1FIWA 1G3BA 1SR5C 5DJ7A 5E0JA 2A32A 4ZKNU 3O8DA 3QZQA 3PO1C 3ZZCA 1ZSJA 1TPSA 1O39A 1EAIA 4MQAA 4ASUD 2ZFFH 2NWNA 1ELEE 1GGDC 2TPIZ 4YT7H 2HNTE 1O3DA 2FS8A 1C4V2 4X2VA 3C1KA 1Y3VA 2ZPQA 3BEUA 8KME2 1EJNA 2M5TA 3OX7U 2UWOA 4WY3A 4X8UH 3CS7A 1FI8A 3KYFA 2OC0A 2Y7XA 3MU0A 4K8BA 1KXEA 1D3QB 2WV4A 1NRSH 1UVOA 5KGOA 1O2WA 2G81E 3GDUA 3GISB 1A7SA 1C5VA 2ZTYA 1GJ5H 1LTOA 1UVUH 1ZHRA 1DLEA 1P2KA 5FX5A 1HAVA 1EXFA 2Z3CA 3EA8A 4AFUA 1K1LA 3MTYA 3HKJB 1B0FA 1TNKA 4OS7A 2J4IA 3HK6B 2ZCKP 3LKWA 2VWMA 1SKYE 3FKSD 4ACBA 1NROH 1HFDA 2OCVB 1TX6A 4FUCA 1KDQA 4KGAA 2RA3A 4NZQA 1LVMA 2HOBA 1C2MA 2XC0A 2GJGA 1AKSB 3AK5A 1OWIA 1VITH 1YCPH 1V2ST 1ZR0A 1E36B 4DT4A 2QXGA 1ZJKA 3F0OA 4IGDA 1C5UA 2YNBA 4TSFD 2C93B 1BTPA 2CF9H 1GBLA 4LZ1H 2VWNA 2QXHA 3ZV9A 1C5QA 3RMLH 1TMUH 5FCRA 1FPCH 1CGHA 1C5ZB 2FMJA 4LXBH 2FOFA 3SQHE 1PPBH 1ZTLA 1LVOA 9LPRA 1UTNA 2GMTB 3JZ1B 3GY8A 6GCHF 4DIIH 1C5SA 1QA7A 4WMEA 4FU9A 4X6OA 1ESBA 2BOHB 3SNCA 1AQ7A 1O2KA 1TBQH 3SO3A 1P2OA 4IMQA 3VXFH 1FAXA 1TFXA 5BRRE 1QRXA 4YO9A 2FS9A 1KLJH 3GY2A 2PUQH 3ITIA 5F8TA 3QUMP 3KQ5A 4HZHA 3A80A 2SGAA 3Q3XA 3H5CB 1GDNA 1DUAA 1ZMLA 1FUJA 1QFKH 1UCYK 3RMMH 2BD9A 3PLBA 1FZZA 3LIWA 1NC6A 1SLVB 1TNIA 2O8UA 1E35B 2VGCC 2ZU4A 3DHKH 3GYMA 1A2CH 3ZZBA 1XUGA 4FXGH 1SGRE 1XUKA 4X8TH 3GY6A 3PMBB 3I77A 2J9NA 3P70B 1JBUH 1P05A 2ZFRH 2BDHA 3LOXA 1GHAG 1BQYA 1CA0B 1XXFA 2AHME 4AZ2B 3T25A 5GIBA 3LH1A 5FBEA 2ZQ2A 4B75A 1RRKA 1UCYE 4K5ZA 1VZQH 4UEHH 3HATH 1HRTH 3VXEH 5DP3A 1DWEH 7LPRA 4X1QU 1GMCF 4O03A 1GJ9B 2GX4A 3M5MA 1LDTT 1IQIA 4Z1MD 3LGVA 1JIMA 4ZKOU 3NCLA 3FO8D 3FP6E 2AMQA 3M3TA 4MPXA 5A09A 1L1JA 1DM4B 1AUJA 1PYTC 1AIXH 3SQEE 4B74A 4K60A 1C4U2 3WWBA 1H9IE 2EY4C 3SV2H 5GCHF 5LPFA 1UHBA 4X1SU 5LH8A 2NU3E 3T27A 4NIXA 1BRBE 2ALPA 4RN6A 4UONA 3H7TA 2ESTE 4HFPB 1C2DA 5T1VA 1TWXB 4M9FA 4ABBA 1U6QA 1W2KH 1GBHA 2RCEA 4Q2KA 1TOMH 1QCPA 3D49H 4KELA 4F49A 4MPUA 4YTAA 5DP5A 3MWIU 1D3PB 1THSH 4JZIA 2P8OC 5C0UA 3BTFE 2YOLA 2WV9A 1J16A 3KQCA 4VGCB 1HJ8A 1BMLA 1GL0E 2DUCA 1C1UH 2BYAX 3ODFA 2GCTC 5B6OA 2HVYB 1WSSH 2AIPA 5C94A 3M36A 3MU4A 2ZGHA 5GPIB 1DWBH 2A45B 1NU7B 1XX9A 2OK5A 1O5CB 1TPAE 4MNWA 2GCHG 1C2JA 3UOUA 3O8RA 2TGPZ 1K1PA 1KXFA 3AAUA 2K8IA 2TBSA 2WV5A 4M7GA 3FZDA 1XUHA 4ZCNA 2RDEA 2FTMA 2BLVA 4B2BA 3LGWA 1ZZZA 1GJ7B 1HJ9A 1NRRH 1GMDG 2ZHWH 1NESE 3KEEA 2KCYA 1SLXB 3UY9A 3SU0A 3PYHA 1CHGA 1KXCA 3MNSA 5C2ZA 1OP2A 1V2KT 2THFB 2W3KA 5DGJA 1BTYA 4JMYA 1MAXA 1RTKA 3FN8A 5IDKA 1TB6H 2C3SA 4XSKU 4ZKRU 3VFEA 4NWLA 1Q3XA 2XBXA 4UDWH 2PV9B 5HGGA 1DWCH 4PROA 1ZLRA 2P16A 5JB8S 1NO9H 4KTSA 2GMTC 3MNCA 1C5WB 1NY22 3SYJA 4CHAB 3CNRA 1KLTA 2J92A 3ZZ4A 1O2RA 2XC4A 3UB0A 2STBE 1PPGE 1MABB 3NKKA 7GCHF 1ANDA 1OYQA 2FEQH 2QF5A 3A88A 3EA9A 1UTMA 4FUHA 1GHZA 3TNSA 3F68H 5EW1H 4HGCA 3A82A 1V2LT 3SNAA 1IQGA 2FO9A 3I29A 3PRDA 5FCKA 4NSYA 1E38B 1SLWB 1Z8RA 4LK4A 1ZYOA 2ZDLA 5PTPA 2EI6A 1LHFH 2ZHDA 5AFYH 3RXPA 1FY8E 1PPCE 4IC6A 2A5KA 4X2YA 2FM2A 3FP8E 7ESTE 1QL9A 1T4UH 5FAHA 3GDVA 2GDDA 1YLNA 1A61H 1UK2A 1DY8A 4B1TA 3RC4A 1LQEA 1CA0C 4X6NA 2ZDVH 1NFWA 1P02A 4XBCA 3BN9A 2V3OH 2AGIX 4NWKA 1VR1H 3TVJB 2KCPA 4MG3A 3STJA 3TU7H 4Y7AA 2ZIQH 3FANA 4Y10E 1ZGIA 2V3MA 1O2GH 2BD3A 3K6ZA 1W8BH 1W13U 3F9FA 1F5RA 1FX0B 3PV2A 1TNJA 4Y0YE 4WJG2 1RJXB 4YOJA 4JYTA 1NM6A 5T6FA 2PKAB 1MKXK 2VVCA 3TK6A 4X2XA 4WVPE 2ZI2H 1FN8A 1BHXB 1GHYH 2VIPA 4A1TA 1PQ7A 3E1XB 5JBAS 3U69H 3BTTE 4JZ1A 5AHGH 5I46H 4ZROA 5TCCA 1BIOA 1FXYA 3T62A 1UVSH 1JRTA 1XVOA 3BG4C 1OWEA 3KIDU 3WWFA 4UE7H 2BDCA 3B23B 1K1OA 1DSUA 4H6SB 1ELAA 1KXAA 2ZCHP 2VH6A 3PRBA 4BAKB 2UUYA 1ARBA 1N1LA 1VCPA 3P8OA 1DX5M 2CHAC 4FOUC 4Z0KA 3U1JB 1SGNE 3BSQA 4VGCC 1AE5A 2P3UB 4AG2A 2ODYB 3SOSA 1WBGB 2G52A 3ESTA 5GXPA 2BY9X 2O8TA 3BTGE 4SGAE 3TK9A 4AC9A 1M9UA 1GI2A 4Z6AH 3WY8A 3U8TH 4J2YB 4X1RU 3S9BA 4NCYA 3N7DA 1MZDA 1NBMD 1G37A 5GWZA 3OY5U 1QZ8A 3SGAE 2ZFPH 2DE9A 1O34A 1H8IH 3LGIA 9ESTA 3AW0A 1SHHB 1RS0A 2WSSD 4RKOB 3SUFA 1YPHE 4XOJA 4E06H 4CR5A 4GCHF 3Q3YA 4MLFB 5C1XA 1HAPH 1FV9A 2R2MB 5T6DA 2C4FH 4X0WU 1KTSB 2GZ8A 1O5GH 3LDXH 2F9VA 2I6QA 2BX4A 4K1TA 1IAUA 1VCQA 3A89A 3VGCB 1ZTJA 3VEQB 3E16B 1QGFA 4OS4A 3B9FH 1OPHB 4QT8C 2VVVA 1WTHD 4RKJB 3RU4E 4I86A 1D9IA 3M5LA 4CHAC 3BG8A 1GCDA 4TY6A 5HYOA 2OC1A 1AKSA 2VBCA 3AVZA 3P8GA 2AIQA 3RP2A 1FY4A 4Q4LA 5HIZA 1S83A 1QQ4A 8GCHG 2GTBA 2B0FA 1MTSA 4B73A 5JDUB 1ZTKA 4IN1A 1OHHD 2YNAA 1VGCB 3VB4A 4P00A 1MBMA 2ZCLP 4DW2U 3SW2B 5E2PA 3PO1B 3RC6A 3SJOA 4Y11E 5DP4A 1O2SA 5C1UA 1SGTA 2A7JA 2FLRH 4ZH8A 1DITH 4TWWA 4NG9H 1GGDB 5HMAA 5A0CA 1LCYA 3PLPA 2VIWA 1TONA 1SFIA 2JH0D 4Y8ZA 1E1RD 3LC5A 1C1PA 4R8TB 5TCAA 4FETA 4B6FA 3TJUA 1AWHB 5K0HA 4HTCH 4ACAA 2FODA 3SU3A 1RTLA 1S6HA 2VJ1A 3HGNA 3RC5A 2L74A 2OD3B 1O5FH 3KGPA 4GLYA 2V6NA 2GV6A 3P6ZB 3AAVA 1ABIH 2B5TB 3A86A 3EQ0H 3MYWA 2FTLE 1ETTH 1XVMA 4A1VA 3UNRA 2ZDNA 4YESB 2UUJB 1AZZA 3DSOA 3BTME 4AFZA 2WUBA 4GAWA 2UWLA 3SZNA 1D3TB 3GCTF 1O36A 1C9TA 5JBCS 2ZU2A 1SC8U 4JK6A 3M7TA 1DWDH 1GBIA 2OP9A 3CENA 4MDSA 2B8OH 4P02A 3TLOA 1LPGB 3ATIA 2F4LA 4B2CA 3ATMA 4DIHH 1KY9A 3EE0B 1SG8B 1ZGVA 1CVWH 1B0EA 1G36A 1O2TA 1Q2WA 1V6DA 1DLKB 3UUZA 3KHVA 1O2UA 1K21H 3SU6A 1O2YA 2ZHFH 3S7KB 1SQRA 5ABWA 3LJJA 3WW7A 7KMEH 1O3LA 1O2OA 5LPRA 2WHXA 3K9XB 5JPMH 5G4BA 3QK1A 1BHXF 1ZMJA 3S9CA 2Y5FA 1BRAA 2WPJS 1C2IA 2QF3A 1IQFA 1BTHH 3G01A 3TGKE 3RXFA 2XBYA 4THNH 2R0KA 1P9UA 1C2GA 1VCWA 1W0YH 3E91A 1C1VH 4D8NA 5A8XA 2JETC 1SVPA 1COWD 2JJ2D 1WQVH 2QF4A 2VIDA 4E7NA 2I6SA 4CREA 2LPRA 2JIZD 2WPKS 3UOPA 5HM2A
chains in the Genus database with same CATH topology
1YPMH 4BAQB 4X1PU 4X8SH 1C1QA 3VB7A 2FLBH 1TGTA 2ZU1A 1QTFA 1BTXA 5FBIA 3SORA 2ODQA 1MMJN 1TALA 2XWBI 3M7UA 4RSPA 2ZU5A 3ATKA 1DVAH 4FUIA 4OGYA 5K7RA 1FAKH 4B76A 1ZOMA 1OKXA 3RMNH 3LGYA 5DP7A 1F92A 1EZSC 1QHRB 2ZDMA 4NIWA 3RXOA 1GHBF 1TX7A 5F03A 4TPYA 2A4GA 3H7OA 4XBBA 1S84A 4XBDA 1J9CH 4NA9H 3BTKE 2H5CA 2PKSC 1XUJA 4WMFA 2XCNA 1BZXE 4KKDA 5EXLA 5EODA 3A7WA 4INKA 2H9HA 1L0ZA 3ZVGA 2WPHS 1SB1H 8LPRA 2EA3A 1PPEE 1P2NA 3PMJA 1GMHG 1BCUH 1GPZA 2BVRH 4BTIB 4Y0ZE 5T3HA 2J38A 2D8WA 5EW2H 1A0JA 3PB1E 1S6FA 1UO6A 2BDAA 1S85A 1EAWA 2P8OB 1GI4A 2P93A 3P8FA 3MNXA 2HNTC 1UTLM 2FZZA 3PWCA 2GCTB 4ISIH 1O5EH 1AFEH 1GJ4H 1PYTD 3M3SA 3UR9A 4A6LA 3RXBA 1HAHH 1N6XA 1QJ6B 3FAOA 1P03A 2OC8A 2ODPA 2BOKA 3M61U 1C1OA 1ELBA 3F6UH 6CHAC 3ZZ8A 3ODDA 2F9NA 2PFEA 6LPRA 2WYGA 2ZF0H 4ZKSU 4ABJA 2GP9B 1SQAA 1QB9A 1ZJDA 3RM2H 1G2MA 3A83A 1CHOG 3V12A 4KP0A 1O38A 1UVPA 3TJVA 1MU8B 1VITG 5CE1A 1YPLH 1P57B 1A46H 5J4SA 2P3TB 1C4Y2 1WOFA 1LHEH 2ZHQH 1G2LA 4O97A 3BTDE 2PKAA 1MTNB 2SGQE 1YPKH 3QGNB 5DPAA 1YGCH 1TBRH 4U01A 3SJKA 1ELTA 3B8JA 2QV1A 1QB1A 3UNQA 1AMHA 4UFFH 3GDSA 1MZAA 1EZXC 2XWAA 1S0QA 1B5GH 1K28D 1C1WH 1SOZA 2ANWA 3R3GB 1JMOH 1SMFE 2O8LA 1F0RA 2W7SA 1MD7A 3BTWE 1PQ5A 4ABFA 2SGFE 3UIRA 1C5NH 3Q00A 1PPHE 1F0UA 3MNBA 2A5IA 2HWLB 1TX8A 2QAAA 1P9SA 2ASUB 1HPGA 1QL8A 3ZYEA 3F9GA 2FOCA 1WYKA 1ZHPA 1GBKA 2Q6FA 4K1SA 1PPZA 2LNCA 1ZMNA 2FOBA 5EU8A 1TE0A 2V35A 3UTUH 1EQ9A 4ABGA 1LKAA 1A0HB 2PTCE 3ZVFA 1DOJA 1A3EH 3SUDA 3VB6A 1SGDE 2O8WA 1G30B 1Q31A 5L6NH 4DT7B 1C9PA 2C8XB 2ZFSA 1ELVA 1FJSA 1GL1A 1XMNB 2C90B 3UR6A 4AORA 1GBJA 2ZTXA 2FP7B 2R9PA 2Z9LA 1E0FD 1Z6EA 2OQ5A 4BNRA 1DE7H 4GHTA 4X6MA 1C1RA 5HXFA 2QIQA 2STAE 2XC5A 3EYDA 5A0AE 1Y8TA 1MKWK 5DK1A 2NU4E 3KQBA 3BG4B 1KLIH 5C5NA 1THRH 4H42U 5GDSH 2Q6DA 1EASA 1CO7E 1O3EA 2UUKB 4NFEA 1SFQB 3LPRA 1A5IA 2BXUH 1FQ3A 1XKAC 2CHAB 2Q1JA 1P09A 1Y3UA 3RXUA 1AZ8A 3K2UA 5EGMA 1V2NT 3HPTB 1J17T 3K65B 2P3FH 1PQAA 2BDBA 1OWDA 3BF6H 4OGXA 1V2VT 5LGOA 4X6PA 2WPIS 4DURA 4ABAA 3TH3H 1EOLA 1BMNH 1P8VC 2VWOA 1KXDA 1ZPBA 3A8AA 5F8XA 1Y59T 1YPEH 3CP7A 5EQQA 1HXFH 4DY7B 5DP6A 3Q3KA 1C5OH 4OS6A 1LQDB 1RXPA 5IYTA 3SUGA 3HKIB 1Y5UT 2WYJA 3TK5A 1L4DA 3LC3A 4DJZB 1C2LA 3BEIB 1BBRK 1CT2E 1HNEE 1SGCA 2JH6D 3MU1A 4YT6H 1O5AB 5FPTA 6GCHG 2FDAA 3T5FH 1MTNC 1W10U 2AH4X 2ZDAH 1FY5A 1SHYA 2FI4E 1Z8JB 3BTQE 4JZEH 1P01A 4CH8B 3QLPH 1IHTH 1O2HA 1MUEB 1DXWA 2QF0A 8ESTE 1ACBE 1XUFA 3OSYA 3RXRA 5L30H 3BTEE 3A8BA 5A2MH 3ZVCA 1BDAA 1SSXA 3RXCA 1Z6JH 1BBRE 1GI0A 2D1JA 2FIRH 2F83A 2VNTA 2AFQB 3QGJA 1LHCH 1GBAA 3MH6A 4NIYA 1GVKB 2ZTZA 1UJ1A 1UTQA 3E6PH 1F0TA 1F2SE 1UK3A 1O2JA 2B9LA 4NSVA 1AD8H 1ABJH 1HUTH 1BRCE 3BEFB 1O3AA 1SLUB 2CGAA 2Y81A 1NRPH 3ZZAA 4ABDA 1GMCG 3A87A 3NWUA 1IQHA 4AYYB 1NFYA 2CN0H 3SHAH 3BV9B 4AYVB 3QTOH 2FWWA 2TIOA 2R3UA 4O9VA 1HAZB 4JYVH 3T2NA 1W7XH 3M5NA 1O2VA 1IOEA 1YYY1 4ISLA 1QB6A 1S0RA 2GZ7A 2Y80A 3RXSA 1TGBA 3QDZB 5GCHG 2QY0B 2P95A 1MQ5A 4CBNA 1VJ9U 5EOKA 1DY9A 1QBOA 2BD4A 1AWFH 1C5YB 2Z94A 3GCHB 1DUEA 3DA9B 2ZFQH 2H5DA 3U1IB 1BTZA 3RXQA 3UQVA 1GI3A 1T32A 3AASA 4AFQA 4CRFA 1SBWA 3KCGH 2V0BA 3GY5A 1T8NA 3SU1A 2Y5HA 3LU9B 3QZRA 1O33A 1ELDE 1Z1IA 1UCYH 1EB1H 3SHCH 1Y3XA 3A7XA 3SJIA 3A8CA 1QBNA 4I32A 3R0FA 1O3KA 4OS1A 1AB9C 4K8YA 5EXMA 2OLGA 4AB8A 1LVBA 1NS3A 2BDGA 1C2FA 3GOVB 2CXVA 2ZGCA 5E2OA 1W11U 4Y76A 5BPEA 3ZV8A 1OS8A 5A8YA 1Y5AT 3K6YA 1KYNA 5DO4H 1HDTH 1MAYA 3URDA 4Y7BA 1GDUA 3RM0H 1A0LA 5AF9H 1Y3YA 2JETB 5JBTA 3L33A 1NN6A 1LHDH 1V2JT 2ZZUH 2BQ6B 1W0ZU 4Q7YA 3V7TA 1FIZA 1ZPZA 3D23A 1YM0A 1BMMH 1C1SA 1ARCA 1O2XA 2RDLA 2Z9GA 3KF2A 3S69A 3O8BA 3ZVEA 2AGGX 3VB5A 1YBWA 2PHBA 2ZKSA 7GCHG 1DXPA 1WU1A 2P59A 1C5RA 1AHTH 1SPJA 1HJAB 2QCYA 4FU8A 3NXPA 4X8VH 1FONA 5A0BA 2HVXA 2Y6TA 3E90B 4IW4E 1GBTA 1WTGH 4FUEA 3SGBE 3A85A 5LPEA 3FP7E 1MBQA 4WH6A 1EPTC 2A4RA 1TQ0B 1H4WA 1HIAB 2XW9A 2TRMA 1TNGA 4OS5A 3ZZ3A 1V2WT 2GZ9A 2IN2A 2QA9E 1K22H 2F9OA 2F9PA 1TMBH 4BAMB 2PKSB 3URCA 1ESAA 4TY7A 1CGJE 4CRDA 4TPIZ 1ZPCA 1OWHA 2PR3A 2R3YA 1GCTC 1W12U 4D7GA 2AEIH 2OXSA 3DFLA 2VIQA 3MI4A 2F3CE 4U32A 3E0PB 4F4OC 1D3DB 1K1NA 4H4FA 4NA7A 2FOAA 1YCPK 4ZHAA 1AFQC 1HAIH 3PWBA 3DFJA 4XDEA 2QGRA 1UK4A 1P12E 1P2IA 1V2MT 2OINA 1H9HE 3E0NB 3M3VA 3ZVAA 1THPB 4ISNA 1ID5H 2PLXA 3D65E 2AMPA 3PMAB 1O3GA 2A2QH 5L2YH 3ENSB 1ELCA 3SI3H 1F5KU 5EG4A 4WXVA 2A7HA 1GJ8B 1OSSA 3E8LA 2A4QA 2C8YB 3GCHC 4AB9A 4FVDA 6CHAB 3KL6A 1SGQE 3A84A 4Q80A 2Z7FE 3OY6U 2OC7A 1O3IA 1BUIA 2ZQ1A 1F0SA 2EI7A 3RXHA 3SGQE 1NRQH 1AN1E 1Y5BT 3MMGA 2BXTH 2BVSH 1HV7A 2F91A 1UVTH 3SUEA 2AYWA 4A92A 1YPJH 2ZEBA 3RXJA 2GD4B 3U9AH 2PW8H 1HYLA 3FVFB 5E0GA 3ELAH 1ANEA 1XM1A 2H1UA 4CR9A 1RTFB 1AU8A 4SGBE 3MH7A 1O2PA 4GCHG 5EXNA 4GHQA 2TGTA 1C5MD 4IS5A 1LO6A 3EGKH 5E0HA 1YKTA 4ABEA 4YOIA 1BRUP 1HXEH 4KTUA 1TGCA 3PLKA 4TWYA 4AX9H 1Z8GA 3F9HA 1NZQH 3TH4H 2ZGXH 5AFZH 1O2ZA 1MKXH 1NT1A 1KIGH 1SGFG 1XUIA 2H9EH 3A7YA 2QXIA 3DD2H 5A8ZA 2H2ZA 5F8ZA 1S82A 1QR3E 4GUXA 1O5BB 4ISHH 3RLWH 4YOGA 1HJAC 1BJVA 1GJ6A 1YF4A 2ZFTA 4CRGA 4CH2B 3P95A 2BMGB 2HLCA 1MTUA 5FPSA 1LPKB 1W14U 1SL3A 1NPMA 3NPSA 1HB0B 3UREA 1GI1A 3ZZ5A 3S0NA 4INHA 3A81A 2A2XH 3MO9A 1SQOA 4I8GA 1FNIA 3JZ2B 2PTNA 5HM9A 4D9RA 3SU4A 3LT3A 1LMWB 4FVBA 1L2EA 2BDYA 1WQSA 5CHAC 3ATLA 4BANB 1EATA 2G8TA 1GI6A 1RFNA 3IG6B 1FY3A 1S81A 4IN2A 1CA8B 1G9IE 2BY7X 2G5VA 3KNXA 1ANCA 2ZHEH 1TYNA 2WUCA 2F9UA 2GVFA 1CBWB 1HAOH 2J95A 4CRAA 3LONA 5J4QA 3A8DA 3RXGA 2TGAA 1OWKA 1BT7A 1HAGE 3LH3A 1EKBB 1ELFA 1MCTA 1BA8B 1GBFA 4UFGH 4I7YH 4CRCA 1GG6B 1Y3WA 1GHAF 2J2UA 3VPKA 1AGJA 1V2PT 2C8WB 4FUFA 1L1NA 3M7QA 4FUGA 3OU0A 1V3XA 2R0LA 4JYUH 2ZA5A 2B7DH 1RD3B 3BIVH 5EQRA 3GCOA 2FI5E 1Z7KA 5FXLA 2FX4A 2VU8E 2OQUA 3GCTG 1DICA 2BD2A 1TOCB 1V2RT 4AFSA 2JKHA 1CQQA 1CT0E 2FI3E 3BIUH 1QY6A 3SN8A 4ABIA 1TPPA 1LHGH 2C8ZB 3NK8A 1NRNH 1IQKA 1S5SA 2XCFA 4UFEH 4ZHLU 3N7OA 4D7FA 3STIA 3LJOA 1LKBA 1TAWA 4ESTE 2PSYA 4AGKA 3KN2A 3GICB 1IQNA 3NUMA 1NTPA 1QJ1B 3GY3A 3OTJE 2ZC9H 4ZXXH 1H8DH 1SGPE 2CV3A 1AO5A 1O35A 2A5AA 3AW1A 1YC0A 2HNTF 2ZDKA 1IHSH 3RMOH 1HCGA 2ZPRA 1BTUA 5F6MA 2XRCA 3ATWA 4NA8A 1O32A 2XYAA 2CMYA 1FY1A 3KQDA 1QQUA 2QC2A 2RG3A 3RDZA 5TJXA 1QNJA 2GCHF 5SGAE 1DFPA 4I8HA 3RXVA 4YLUA 4K1EA 1RGQA 5FX6A 3V13A 3RU4T 2J94A 1MTVA 2G4TA 1GWAA 4I33A 2Z9IA 1O3CA 1TRNA 1ETRH 1AI8H 2FYRA 1GMDF 3PTBA 1C1TA 3HK3B 4FU7A 4Y8XA 3MU8A 2H9TH 1IQMA 1AVXA 3MH5A 3ZYDA 3ZVBA 1RIWC 3RXKA 1AVWA 4AG1A 2UUFB 3QTVH 1O3BA 2Q6GA 2ALVA 1BJUA 1GVZA 1XKBC 4Y79A 3P8NA 1GHBG 2ZPSA 5ESBA 2ZWLH 4AGJA 5ESTE 1C1NA 1NFXA 1J8AA 5T6GA 2W5EA 2ZG0H 1DT2A 1YP9A 3QO6A 4ZHMU 4JZDH 1ZRKA 4A1XA 1TPOA 3L3TA 1EUFA 5ETXA 1NU9A 4JK5A 4D76A 3QX5H 1HLTH 2FX6A 4R0IA 2O8MA 1DS2E 1PFXC 1GHXH 4ZAEA 1K2I1 3FZZA 1CBWC 2KAIA 1FMGA 3RUOA 1C5PA 2FYQA 2Z9JA 1ELGA 1OOKB 4GSOA 3W94A 1GG6C 1ZSLA 2FOGA 4A5TS 3U8OH 1UMAH 3IITA 3SJ9A 2EC9H 1HIAA 1YPGH 1QL7A 1XXDA 3RXAA 2BZ6H 4NIVA 2CJIA 2BD7A 5AVDA 2Y5GA 1QJ7B 1WV7H 2V3HH 2GV7A 3ZZDA 1AB9B 1A3BH 4BXWA 2NU1E 1P2MA 1TQ7B 2D2DA 4MNYA 4X1NU 3RXLA 2W3IA 4X2WA 5E8EH 2SGDE 1T8OA 2QYIA 3PTNA 5C1YA 3L6PA 2WPMS 2HPQH 2ANKH 2XNIA 1SI5H 1O31A 4WWYA 1G3EA 4DCDA 2BQWB 2O9QA 1ANBA 3M5OA 1HBTH 3GY4A 1IQLA 4ABHA 1Z8IB 1OP0A 2P94A 2BVXH 1GBMA 1EB2A 1V2OT 3BTHE 2EEKA 1P0SH 1P2QA 2ILNA 1P2JA 1O3NA 1V2TT 2ANYA 2EI8A 2ZO3H 1QIXB 1IQEA 1TBZH 2FXRA 1X7AC 1IQJA 1OXGA 1EAUA 2PSXA 3PROA 4NFFA 4K3JA 3SNEA 4O3TA 1BTWA 3HGPA 3S7HB 1ZSKA 5JB9S 1C5LH 3TIUA 2OBQA 1GHWH 1V2QT 1HAYB 1GI5A 1HGTH 3F1SB 3SNDA 2AMDA 2Y7ZA 2BM2A 1EPTB 3RXEA 2W7UA 1O2IA 4UD9H 2FOEA 3EAJA 1QRWA 2GKVE 3E3TA 2G4UA 3P92A 4MPWA 4D9QA 1G32B 2BHGA 1TGSZ 2BB4A 1EJAA 1YLCA 5JYIA 5C5OA 3SV6A 1N6YA 1GCTB 1SGEE 2ANMH 3O8CA 1OYTH 2GGVB 4MVNA 1K1JA 3Q76A 2BLWA 2SNWA 1D6WA 4NZLA 1K1IA 1O3PB 1AFQB 2Z9KA 1KSNA 3NZIA 1EP6A 4YM9A 1O3FA 3RU4D 1EOJA 1OWJA 4TYDA 3TITA 2G55A 8GCHF 2IJOB 2ZP0H 3A7TA 1TA6A 2VIOA 3SV9A 3ZZ6A 3CS0A 1N8OB 4AN7A 1HAVB 2VVUA 2FOHA 1JRSA 1QA0A 4Y6DA 5JBBS 1J15A 1P3CA 1EJMA 1QRZA 1CU1A 3UQOA 3TNTA 3GY7A 3V0XA 1P3EA