1GE5A

Zinc peptidase from grifola frondosa
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
167
structure length
167
Chain Sequence
b'TYNGCSSSEQSALAAAASAAQSYVAESLSYLQTHTAATPRYTTWFGSYISSRHSTVLQHYTDMNSNDFSSYSFDCTCTAAGTFAYVYPNRFGTVYLCGAFWKAPTTGTDSQAGTLVHESSHFTRNGGTKDYAYGQAAAKSLATMDPDKAVMNADNHEYFSENNPAQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-LYS METALLOENDOPEPTIDASE
publication title Structure of a new 'aspzincin' metalloendopeptidase from Grifola frondosa: implications for the catalytic mechanism and substrate specificity based on several different crystal forms.
pubmed doi rcsb
molecule tags Hydrolase
total genus 64
structure length 167
sequence length 167
ec nomenclature ec 3.4.24.20: Peptidyl-Lys metalloendopeptidase.
pdb deposition date 2000-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14521 Aspzincin_M35 Lysine-specific metallo-endopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1ge5A00
3SHIA 4XBHA 1C3IA 3RTSA 1R1IA 3G5CA 4H76A 3LUNA 5I2ZA 4XM7A 1EUBA 4IJOA 3EHYA 3Q2GA 1K7IA 4Q1LA 966CA 1RMZA 3OHLA 3WV1A 3LMCA 1KUGA 1WNIA 4WF6A 4FVLA 3LUMA 1FM1A 2AIGP 4A3WA 1IABA 1HOVA 3USNA 4ZR5A 3LE9A 3F1AA 2A8HA 3F19A 1KAPP 1MNCA 3MA2A 4GWNA 3U1RA 3F15A 3B92A 3RTTA 1CQRA 1GE6A 1D7XA 1CK7A 1R1JA 2XS4A 1C8TA 3UVCA 830CA 2RJPA 2OW0A 1UMTA 1HV5A 2WO8A 2D1OA 5D2BA 1Y8JA 4GUYA 1BSWA 1JAOA 1MMPA 3KMCA 1BZSA 3LGPA 1QJIA 1RM8A 3LJTA 4DPEA 3AYKA 3F16A 5I12A 3G42A 5I4OA 1A85A 1G12A 5BPAA 1OM6A 2ERQA 3CKIA 3O64A 4PKSA 5CUHA 1XFZA 2Y6CA 1Y0VA 1OS2A 1Y93A 1XFUA 3DPFA 1I1IP 2TCLA 3L0TA 1XFYA 1UEAA 2EROA 1C7KA 1OS9A 1G9KA 2WO9A 4R3VA 4CTHA 1HFCA 1HTDA 1O0TA 1BQOA 3KEKA 1K7GA 5I3MA 3KECA 3GBOA 2E3XA 4G0DA 3LJZA 5D3CA 3K7NA 3KMEA 1JJ9A 1AYKA 1PWWA 1ATLA 4H84A 1SATA 3DSLA 1O0QA 2QPJA 3LK8A 1XFXA 1R1HA 3P24A 1D8MA 2POJA 1YP1A 4DD8A 4PKWA 1KUKA 3HBUP 5BOTA 1SRPA 2WOAA 1QIBA 4FXYP 4HMAA 3B2ZA 2JSDA 5H8XA 3TVCA 4AUOA 3ZVSA 1CGEA 1SMPA 4FXQA 1GKDA 1I73A 1R55A 4PKVA 1ZXCA 2KRJA 2DW1A 1CAQA 3BA0A 2Z2DA 3Q2HA 1QICA 1CXVA 2OVZA 1AF0A 5L79A 3L0VA 2JIHA 1D8FA 4J4MA 2OY2A 2D1NA 1MMBA 4GR8A 1ZP5A 4H30A 1BIWA 1JIWP 1USNA 1GO7P 1ZXVA 4H1QA 1BQQM 4A7BA 3EDGA 1K7QA 3KRYA 1JKYA 4PKTA 3P1VA 1FLSA 2XS3A 1GE7A 1UTZA 3VTGA 3HBVP 2USNA 2OVXA 3E8RA 4L6TA 1BKCE 4H2EA 1BKCA 3LEAA 2MLRA 4WKIA 5D1UA 2I47A 3LKAA 3LILA 1PWVA 2J83A 1D5JA 4JQGA 4L63A 5D1TA 4DV8A 3B8ZA 2E2DA 4PKRA 1KUIA 1KBCA 3HB2P 1XFWA 1A86A 1JIZA 4IUWA 5L7FA 1YCMA 5D7WA 1SU3A 5I43A 1CGLA 1ASTA 2OW1A 3N2VA 1J7NA 5D1SA 4JPAA 1FBLA 2MZEA 3I7GA 4L19A 1Z3JA 4IN9A 4JIJA 4AYKA 1B3DA 3TS4A 3K7LA 3WV2A 1GKCA 2FV5A 4AXQA 1L6JA 456CA 2MZIA 1GE5A 1IAGA 5JMYA 3KWVC 1ND1A 3LJGA 3HYGA 1PWQA 4GF1A 4XM8A 1HY7A 3AYUA 3TSKA 5I0LA 3DWBA 3EDHA 4QKZA 1UTTA 2OW2A 1DMTA 4WKEA 1YQYA 1MMRA 2JT6A 3EHXA 5B5OA 2CLTA 2OXZA 1IACA 3HY9A 1KUHA 1JH1A 3F18A 4JA1A 1UMSA 4GWMA 2N8RA 3OHOA 2K2GA 1G4KA 2W13A 2X3BA 3N2UA 1IAEA 2O36A 3I7IA 3AIGA 2L0RA 2OI0A 1Q3AA 1B8YA 4AIGA 4GQLA 5LABA 4H82A 1H71P 1JAPA 4PKQA 1GXDA 2AYKA 4ILWD 3DNGA 2J0TA 3ZXHA 2SRTA 1QJJA 3KHIA 4GR3A 2W0DA 3ELMA 4XM6A 3HY7A 1BUVM 4WK7A 1JANA 3V96B 2ERPA 1QUAA 3LIKA 4ON1A 1XUCA 1R54A 2OY4A 2DW0A 3ZUKA 3WV3A 1CIZA 2CKIA 4I03A 4JP4A 1XFVA 1EB6A 2JT5A 1XURA 1GO8P 2DDYA 2OW9A 1SLMA 3HDBA 5CZMA 1EAKA 3EDIA 4G9LA 4WZVA 2YIGA 1MMQA 2MZHA 2JNPA 2FV9A 1G05A 2MLSA 1YOUA 3LQBA 3DPEA 1CGFA 4DF9A 3KEJA 2OZRA 2W12A 1OM8A 1PWPA 5BOYA 2DW2A 1QIAA 2Y6DA 1BUDA 1ROSA 2HU6A 1ZVXA 1OMJA 5CXAA 1OO9A 1JAQA 4PKUA 2OXUA 2V4BA 3DL1A 4EFSA 4GR0A 2OXWA 2X7MA 4HX3A 2W14A 1SLNA 2O3EA 3HDAP 2DDFA 2X3CA 2K9CA 3TT4A 1KUFA 1DTHA 2PJTA 3VI1A 4XCTA 3LQ0A 1PWUA 1BKCI 2YB9A 2X3AA 1BM6A 3LIRA 1JK3A 3F17A 1AKLA 1OM7A 1ZTQA 4FU4A 1G49A 3EDZA 1IADA 1ZS0A 4H3XA 1XUDA 2W15A 5B5PA 1HFSA 3NX7A 1IAAA 1I76A 3EWJA 3O2XA 4H49A 4I35A 1S4BP 2RJQA
chains in the Genus database with same CATH superfamily
3SHIA 4XBHA 1C3IA 3RTSA 1R1IA 3G5CA 4H76A 3LUNA 5I2ZA 4XM7A 1EUBA 4IJOA 3EHYA 3Q2GA 1K7IA 4Q1LA 966CA 1RMZA 3OHLA 3WV1A 3LMCA 1KUGA 1WNIA 4WF6A 4FVLA 3LUMA 1FM1A 2AIGP 4A3WA 1IABA 3DTIA 1HOVA 3USNA 4ZR5A 3LE9A 3F1AA 2A8HA 3F19A 1KAPP 1MNCA 3MA2A 4GWNA 3U1RA 3F15A 3B92A 3RTTA 1CQRA 1GE6A 1D7XA 1CK7A 1R1JA 2XS4A 1C8TA 3UVCA 830CA 2RJPA 2OW0A 1OZ9A 1UMTA 1HV5A 2WO8A 2D1OA 5D2BA 1Y8JA 4GUYA 1BSWA 1JAOA 1MMPA 3KMCA 1BZSA 3LGPA 1QJIA 1RM8A 3LJTA 4DPEA 3AYKA 3F16A 5I12A 3G42A 5I4OA 1A85A 1G12A 5BPAA 1OM6A 2ERQA 3CKIA 3O64A 4PKSA 5CUHA 1XFZA 2Y6CA 1Y0VA 1OS2A 1Y93A 1XFUA 3DPFA 1I1IP 2TCLA 3L0TA 1XFYA 1UEAA 2EROA 1C7KA 1OS9A 1G9KA 2WO9A 4R3VA 4CTHA 1HFCA 1HTDA 1O0TA 1BQOA 3KEKA 1K7GA 5I3MA 3KECA 3GBOA 2E3XA 4G0DA 3LJZA 5D3CA 3K7NA 3KMEA 1JJ9A 1AYKA 1PWWA 1ATLA 4H84A 1SATA 3DSLA 1O0QA 2QPJA 3LK8A 1XFXA 1R1HA 3P24A 1D8MA 2POJA 1YP1A 4DD8A 4PKWA 1KUKA 3HBUP 5BOTA 1SRPA 2WOAA 1QIBA 4FXYP 4HMAA 3B2ZA 2JSDA 5H8XA 3TVCA 4AUOA 3ZVSA 1CGEA 1SMPA 4FXQA 1GKDA 1I73A 1R55A 4PKVA 1ZXCA 2KRJA 2DW1A 1TVIA 1CAQA 3BA0A 2Z2DA 3Q2HA 1QICA 1CXVA 2OVZA 1AF0A 5L79A 3L0VA 2JIHA 1D8FA 4J4MA 2OY2A 2D1NA 1MMBA 4GR8A 1ZP5A 4H30A 1BIWA 1JIWP 1USNA 1GO7P 1ZXVA 4H1QA 1BQQM 4A7BA 3EDGA 1XM5A 1K7QA 3KRYA 1JKYA 4PKTA 3P1VA 1FLSA 2XS3A 1GE7A 1UTZA 3VTGA 3HBVP 2USNA 2OVXA 3E8RA 4L6TA 1BKCE 4H2EA 1BKCA 3LEAA 2MLRA 4WKIA 5D1UA 2I47A 3LKAA 3LILA 1PWVA 2J83A 1D5JA 4JQGA 4L63A 5D1TA 4DV8A 3B8ZA 2E2DA 4PKRA 1KUIA 1KBCA 3HB2P 1XFWA 1A86A 1JIZA 4IUWA 5L7FA 1YCMA 5D7WA 1SU3A 5I43A 1CGLA 1ASTA 2OW1A 3N2VA 1J7NA 5D1SA 4JPAA 1FBLA 2MZEA 3I7GA 4L19A 1Z3JA 4IN9A 4JIJA 4AYKA 1B3DA 3TS4A 3K7LA 3WV2A 1GKCA 2FV5A 2YUFA 4AXQA 1L6JA 456CA 2MZIA 1GE5A 1IAGA 5JMYA 3KWVC 1ND1A 3LJGA 3HYGA 1PWQA 4GF1A 4XM8A 1HY7A 3AYUA 3TSKA 5I0LA 3DWBA 3EDHA 4QKZA 1UTTA 2OW2A 1DMTA 4WKEA 1YQYA 1MMRA 2JT6A 3EHXA 5B5OA 2CLTA 2OXZA 1IACA 3HY9A 1KUHA 1JH1A 3F18A 4JA1A 1UMSA 4GWMA 2N8RA 3OHOA 2K2GA 1G4KA 2W13A 2X3BA 3N2UA 1IAEA 2O36A 3I7IA 3AIGA 2L0RA 2OI0A 1Q3AA 1B8YA 4AIGA 3DTKA 4GQLA 4H82A 5LABA 1H71P 1JAPA 4PKQA 1GXDA 2AYKA 4ILWD 3DNGA 2J0TA 3ZXHA 2SRTA 1QJJA 3KHIA 4GR3A 2W0DA 3ELMA 4XM6A 3HY7A 1BUVM 4WK7A 1JANA 3V96B 2ERPA 1QUAA 3LIKA 4ON1A 1XUCA 1R54A 2OY4A 2DW0A 3ZUKA 3WV3A 1CIZA 2CKIA 4I03A 4JP4A 1XFVA 1EB6A 2JT5A 1XURA 1GO8P 2DDYA 2OW9A 1SLMA 3HDBA 5CZMA 1EAKA 3EDIA 4G9LA 4WZVA 2YIGA 1MMQA 2MZHA 2JNPA 2FV9A 1G05A 2MLSA 1XAXA 1YOUA 4L7AA 3LQBA 3DPEA 1CGFA 4DF9A 3KEJA 2OZRA 2W12A 1OM8A 1PWPA 5BOYA 2DW2A 1QIAA 2Y6DA 1BUDA 1ROSA 2HU6A 1ZVXA 1OMJA 5CXAA 1OO9A 1JAQA 4PKUA 2OXUA 2V4BA 3DL1A 4EFSA 4GR0A 2OXWA 2X7MA 4HX3A 2W14A 1SLNA 2O3EA 3HDAP 2DDFA 2X3CA 3DTEA 2K9CA 3TT4A 1KUFA 1DTHA 2PJTA 3VI1A 4XCTA 3LQ0A 1PWUA 1BKCI 2YB9A 2X3AA 1BM6A 3LIRA 1JK3A 3F17A 1AKLA 1OM7A 1ZTQA 4FU4A 1G49A 3EDZA 1IADA 1ZS0A 4H3XA 1XUDA 2W15A 5B5PA 1HFSA 3NX7A 1IAAA 1I76A 3EWJA 3O2XA 4H49A 4I35A 1S4BP 2RJQA
chains in the Genus database with same CATH topology
3SHIA 4XBHA 1C3IA 3RTSA 1R1IA 3G5CA 4H76A 3LUNA 5I2ZA 4XM7A 1EUBA 4IJOA 3EHYA 3Q2GA 1K7IA 4Q1LA 966CA 1RMZA 3OHLA 3WV1A 3LMCA 1KUGA 1WNIA 4WF6A 4FVLA 3LUMA 1FM1A 2AIGP 4A3WA 1IABA 3DTIA 1HOVA 3USNA 4ZR5A 3LE9A 3F1AA 2A8HA 3F19A 1KAPP 1MNCA 3MA2A 4GWNA 3U1RA 3F15A 3B92A 3RTTA 1CQRA 1GE6A 1D7XA 1CK7A 1R1JA 2XS4A 1C8TA 3UVCA 830CA 2RJPA 2OW0A 1UMTA 1HV5A 2WO8A 2D1OA 5D2BA 1Y8JA 4GUYA 1BSWA 1JAOA 1MMPA 3KMCA 1BZSA 3LGPA 1QJIA 1RM8A 3LJTA 4DPEA 3AYKA 3F16A 5I12A 3G42A 5I4OA 1A85A 1G12A 5BPAA 1OM6A 2ERQA 3CKIA 3O64A 4PKSA 5CUHA 1XFZA 2Y6CA 1Y0VA 1OS2A 1Y93A 1XFUA 3DPFA 1I1IP 2TCLA 3L0TA 1XFYA 1UEAA 2EROA 1C7KA 1OS9A 1G9KA 2WO9A 4R3VA 4CTHA 1HFCA 1HTDA 1O0TA 1BQOA 3KEKA 1K7GA 5I3MA 3KECA 3GBOA 2E3XA 4G0DA 3LJZA 5D3CA 3K7NA 3KMEA 1JJ9A 1AYKA 1PWWA 1ATLA 4H84A 1SATA 3DSLA 1O0QA 2QPJA 3LK8A 1XFXA 1R1HA 3P24A 1D8MA 2POJA 1YP1A 4DD8A 4PKWA 1KUKA 3HBUP 5BOTA 1SRPA 2WOAA 1QIBA 4FXYP 4HMAA 3B2ZA 2JSDA 5H8XA 3TVCA 4AUOA 3ZVSA 1CGEA 1SMPA 4FXQA 1GKDA 1I73A 1R55A 4PKVA 1ZXCA 2KRJA 2DW1A 1CAQA 3BA0A 2Z2DA 3Q2HA 1QICA 1CXVA 2OVZA 1AF0A 5L79A 3L0VA 2JIHA 1D8FA 4J4MA 2OY2A 2D1NA 1MMBA 4GR8A 1ZP5A 4H30A 1BIWA 1JIWP 1USNA 1GO7P 1ZXVA 4H1QA 1BQQM 4A7BA 3EDGA 1K7QA 3KRYA 1JKYA 4PKTA 3P1VA 1FLSA 2XS3A 1GE7A 1UTZA 3VTGA 3HBVP 2USNA 2OVXA 3E8RA 4L6TA 1BKCE 4H2EA 1BKCA 3LEAA 2MLRA 4WKIA 5D1UA 2I47A 3LKAA 3LILA 1PWVA 2J83A 1D5JA 4JQGA 4L63A 5D1TA 4DV8A 3B8ZA 2E2DA 4PKRA 1KUIA 1KBCA 3HB2P 1XFWA 1A86A 1JIZA 4IUWA 5L7FA 1YCMA 5D7WA 1SU3A 5I43A 1CGLA 1ASTA 2OW1A 3N2VA 1J7NA 5D1SA 4JPAA 1FBLA 2MZEA 3I7GA 4L19A 1Z3JA 4IN9A 4JIJA 4AYKA 1B3DA 3TS4A 3K7LA 3WV2A 1GKCA 2FV5A 2YUFA 4AXQA 1L6JA 456CA 2MZIA 1GE5A 1IAGA 5JMYA 3KWVC 1ND1A 3LJGA 3HYGA 1PWQA 4GF1A 4XM8A 1HY7A 3AYUA 3TSKA 5I0LA 3DWBA 3EDHA 4QKZA 1UTTA 2OW2A 1DMTA 4WKEA 1YQYA 1MMRA 2JT6A 3EHXA 5B5OA 2CLTA 2OXZA 1IACA 3HY9A 1KUHA 1JH1A 3F18A 4JA1A 1UMSA 4GWMA 2N8RA 3OHOA 2K2GA 1G4KA 2W13A 2X3BA 3N2UA 1IAEA 2O36A 3I7IA 3AIGA 2L0RA 2OI0A 1Q3AA 1B8YA 4AIGA 3DTKA 4GQLA 4H82A 5LABA 1H71P 1JAPA 4PKQA 1GXDA 2AYKA 4ILWD 3DNGA 2J0TA 3ZXHA 2SRTA 1QJJA 3KHIA 4GR3A 2W0DA 3ELMA 4XM6A 3HY7A 1BUVM 4WK7A 1JANA 3V96B 2ERPA 1QUAA 3LIKA 4ON1A 1XUCA 1R54A 2OY4A 2DW0A 3ZUKA 3WV3A 1CIZA 2CKIA 4I03A 4JP4A 1XFVA 1EB6A 2JT5A 1XURA 1GO8P 2DDYA 2OW9A 1SLMA 3HDBA 5CZMA 1EAKA 3EDIA 4G9LA 4WZVA 2YIGA 1MMQA 2MZHA 2JNPA 2FV9A 1G05A 2MLSA 1YOUA 4L7AA 3LQBA 3DPEA 1CGFA 4DF9A 3KEJA 2OZRA 2W12A 1OM8A 1PWPA 5BOYA 2DW2A 1QIAA 2Y6DA 1BUDA 1ROSA 2HU6A 1ZVXA 1OMJA 5CXAA 1OO9A 1JAQA 4PKUA 2OXUA 2V4BA 3DL1A 4EFSA 4GR0A 2OXWA 2X7MA 4HX3A 2W14A 1SLNA 2O3EA 3HDAP 2DDFA 2X3CA 3DTEA 2K9CA 3TT4A 1KUFA 1DTHA 2PJTA 3VI1A 4XCTA 3LQ0A 1PWUA 1BKCI 2YB9A 2X3AA 1BM6A 3LIRA 1JK3A 3F17A 1AKLA 1OM7A 1ZTQA 4FU4A 1G49A 3EDZA 1IADA 1ZS0A 4H3XA 1XUDA 2W15A 5B5PA 1HFSA 3NX7A 1IAAA 1I76A 3EWJA 3O2XA 4H49A 4I35A 1S4BP 2RJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SHI A;  4XBH A;  1C3I A;  3RTS A;  1R1I A;  3G5C A;  4H76 A;  3LUN A;  5I2Z A;  4XM7 A;  1EUB A;  4IJO A;  3EHY A;  3Q2G A;  1K7I A;  4Q1L A;  966C A;  1RMZ A;  3OHL A;  3WV1 A;  3LMC A;  1KUG A;  1WNI A;  4WF6 A;  4FVL A;  3LUM A;  1FM1 A;  2AIG P;  4A3W A;  1IAB A;  1HOV A;  3USN A;  4ZR5 A;  3LE9 A;  3F1A A;  2A8H A;  3F19 A;  1KAP P;  1MNC A;  3MA2 A;  4GWN A;  3U1R A;  3F15 A;  3B92 A;  3RTT A;  1CQR A;  1GE6 A;  1D7X A;  1CK7 A;  1R1J A;  2XS4 A;  1C8T A;  3UVC A;  830C A;  2RJP A;  2OW0 A;  1UMT A;  1HV5 A;  2WO8 A;  2D1O A;  5D2B A;  1Y8J A;  4GUY A;  1BSW A;  1JAO A;  1MMP A;  3KMC A;  1BZS A;  3LGP A;  1QJI A;  1RM8 A;  3LJT A;  4DPE A;  3AYK A;  3F16 A;  5I12 A;  3G42 A;  5I4O A;  1A85 A;  1G12 A;  5BPA A;  1OM6 A;  2ERQ A;  3CKI A;  3O64 A;  4PKS A;  5CUH A;  1XFZ A;  2Y6C A;  1Y0V A;  1OS2 A;  1Y93 A;  1XFU A;  3DPF A;  1I1I P;  2TCL A;  3L0T A;  1XFY A;  1UEA A;  2ERO A;  1C7K A;  1OS9 A;  1G9K A;  2WO9 A;  4R3V A;  4CTH A;  1HFC A;  1HTD A;  1O0T A;  1BQO A;  3KEK A;  1K7G A;  5I3M A;  3KEC A;  3GBO A;  2E3X A;  4G0D A;  3LJZ A;  5D3C A;  3K7N A;  3KME A;  1JJ9 A;  1AYK A;  1PWW A;  1ATL A;  4H84 A;  1SAT A;  3DSL A;  1O0Q A;  2QPJ A;  3LK8 A;  1XFX A;  1R1H A;  3P24 A;  1D8M A;  2POJ A;  1YP1 A;  4DD8 A;  4PKW A;  1KUK A;  3HBU P;  5BOT A;  1SRP A;  2WOA A;  1QIB A;  4FXY P;  4HMA A;  3B2Z A;  2JSD A;  5H8X A;  3TVC A;  4AUO A;  3ZVS A;  1CGE A;  1SMP A;  4FXQ A;  1GKD A;  1I73 A;  1R55 A;  4PKV A;  1ZXC A;  2KRJ A;  2DW1 A;  1CAQ A;  3BA0 A;  2Z2D A;  3Q2H A;  1QIC A;  1CXV A;  2OVZ A;  1AF0 A;  5L79 A;  3L0V A;  2JIH A;  1D8F A;  4J4M A;  2OY2 A;  2D1N A;  1MMB A;  4GR8 A;  1ZP5 A;  4H30 A;  1BIW A;  1JIW P;  1USN A;  1GO7 P;  1ZXV A;  4H1Q A;  1BQQ M;  4A7B A;  3EDG A;  1K7Q A;  3KRY A;  1JKY A;  4PKT A;  3P1V A;  1FLS A;  2XS3 A;  1GE7 A;  1UTZ A;  3VTG A;  3HBV P;  2USN A;  2OVX A;  3E8R A;  4L6T A;  1BKC E;  4H2E A;  1BKC A;  3LEA A;  2MLR A;  4WKI A;  5D1U A;  2I47 A;  3LKA A;  3LIL A;  1PWV A;  2J83 A;  1D5J A;  4JQG A;  4L63 A;  5D1T A;  4DV8 A;  3B8Z A;  2E2D A;  4PKR A;  1KUI A;  1KBC A;  3HB2 P;  1XFW A;  1A86 A;  1JIZ A;  4IUW A;  5L7F A;  1YCM A;  5D7W A;  1SU3 A;  5I43 A;  1CGL A;  1AST A;  2OW1 A;  3N2V A;  1J7N A;  5D1S A;  4JPA A;  1FBL A;  2MZE A;  3I7G A;  4L19 A;  1Z3J A;  4IN9 A;  4JIJ A;  4AYK A;  1B3D A;  3TS4 A;  3K7L A;  3WV2 A;  1GKC A;  2FV5 A;  4AXQ A;  1L6J A;  456C A;  2MZI A;  1GE5 A;  1IAG A;  5JMY A;  3KWV C;  1ND1 A;  3LJG A;  3HYG A;  1PWQ A;  4GF1 A;  4XM8 A;  1HY7 A;  3AYU A;  3TSK A;  5I0L A;  3DWB A;  3EDH A;  4QKZ A;  1UTT A;  2OW2 A;  1DMT A;  4WKE A;  1YQY A;  1MMR A;  2JT6 A;  3EHX A;  5B5O A;  2CLT A;  2OXZ A;  1IAC A;  3HY9 A;  1KUH A;  1JH1 A;  3F18 A;  4JA1 A;  1UMS A;  4GWM A;  2N8R A;  3OHO A;  2K2G A;  1G4K A;  2W13 A;  2X3B A;  3N2U A;  1IAE A;  2O36 A;  3I7I A;  3AIG A;  2L0R A;  2OI0 A;  1Q3A A;  1B8Y A;  4AIG A;  4GQL A;  5LAB A;  4H82 A;  1H71 P;  1JAP A;  4PKQ A;  1GXD A;  2AYK A;  4ILW D;  3DNG A;  2J0T A;  3ZXH A;  2SRT A;  1QJJ A;  3KHI A;  4GR3 A;  2W0D A;  3ELM A;  4XM6 A;  3HY7 A;  1BUV M;  4WK7 A;  1JAN A;  3V96 B;  2ERP A;  1QUA A;  3LIK A;  4ON1 A;  1XUC A;  1R54 A;  2OY4 A;  2DW0 A;  3ZUK A;  3WV3 A;  1CIZ A;  2CKI A;  4I03 A;  4JP4 A;  1XFV A;  1EB6 A;  2JT5 A;  1XUR A;  1GO8 P;  2DDY A;  2OW9 A;  1SLM A;  3HDB A;  5CZM A;  1EAK A;  3EDI A;  4G9L A;  4WZV A;  2YIG A;  1MMQ A;  2MZH A;  2JNP A;  2FV9 A;  1G05 A;  2MLS A;  1YOU A;  3LQB A;  3DPE A;  1CGF A;  4DF9 A;  3KEJ A;  2OZR A;  2W12 A;  1OM8 A;  1PWP A;  5BOY A;  2DW2 A;  1QIA A;  2Y6D A;  1BUD A;  1ROS A;  2HU6 A;  1ZVX A;  1OMJ A;  5CXA A;  1OO9 A;  1JAQ A;  4PKU A;  2OXU A;  2V4B A;  3DL1 A;  4EFS A;  4GR0 A;  2OXW A;  2X7M A;  4HX3 A;  2W14 A;  1SLN A;  2O3E A;  3HDA P;  2DDF A;  2X3C A;  2K9C A;  3TT4 A;  1KUF A;  1DTH A;  2PJT A;  3VI1 A;  4XCT A;  3LQ0 A;  1PWU A;  1BKC I;  2YB9 A;  2X3A A;  1BM6 A;  3LIR A;  1JK3 A;  3F17 A;  1AKL A;  1OM7 A;  1ZTQ A;  4FU4 A;  1G49 A;  3EDZ A;  1IAD A;  1ZS0 A;  4H3X A;  1XUD A;  2W15 A;  5B5P A;  1HFS A;  3NX7 A;  1IAA A;  1I76 A;  3EWJ A;  3O2X A;  4H49 A;  4I35 A;  1S4B P;  2RJQ A; 
#chains in the Genus database with same CATH topology
 3SHI A;  4XBH A;  1C3I A;  3RTS A;  1R1I A;  3G5C A;  4H76 A;  3LUN A;  5I2Z A;  4XM7 A;  1EUB A;  4IJO A;  3EHY A;  3Q2G A;  1K7I A;  4Q1L A;  966C A;  1RMZ A;  3OHL A;  3WV1 A;  3LMC A;  1KUG A;  1WNI A;  4WF6 A;  4FVL A;  3LUM A;  1FM1 A;  2AIG P;  4A3W A;  1IAB A;  3DTI A;  1HOV A;  3USN A;  4ZR5 A;  3LE9 A;  3F1A A;  2A8H A;  3F19 A;  1KAP P;  1MNC A;  3MA2 A;  4GWN A;  3U1R A;  3F15 A;  3B92 A;  3RTT A;  1CQR A;  1GE6 A;  1D7X A;  1CK7 A;  1R1J A;  2XS4 A;  1C8T A;  3UVC A;  830C A;  2RJP A;  2OW0 A;  1OZ9 A;  1UMT A;  1HV5 A;  2WO8 A;  2D1O A;  5D2B A;  1Y8J A;  4GUY A;  1BSW A;  1JAO A;  1MMP A;  3KMC A;  1BZS A;  3LGP A;  1QJI A;  1RM8 A;  3LJT A;  4DPE A;  3AYK A;  3F16 A;  5I12 A;  3G42 A;  5I4O A;  1A85 A;  1G12 A;  5BPA A;  1OM6 A;  2ERQ A;  3CKI A;  3O64 A;  4PKS A;  5CUH A;  1XFZ A;  2Y6C A;  1Y0V A;  1OS2 A;  1Y93 A;  1XFU A;  3DPF A;  1I1I P;  2TCL A;  3L0T A;  1XFY A;  1UEA A;  2ERO A;  1C7K A;  1OS9 A;  1G9K A;  2WO9 A;  4R3V A;  4CTH A;  1HFC A;  1HTD A;  1O0T A;  1BQO A;  3KEK A;  1K7G A;  5I3M A;  3KEC A;  3GBO A;  2E3X A;  4G0D A;  3LJZ A;  5D3C A;  3K7N A;  3KME A;  1JJ9 A;  1AYK A;  1PWW A;  1ATL A;  4H84 A;  1SAT A;  3DSL A;  1O0Q A;  2QPJ A;  3LK8 A;  1XFX A;  1R1H A;  3P24 A;  1D8M A;  2POJ A;  1YP1 A;  4DD8 A;  4PKW A;  1KUK A;  3HBU P;  5BOT A;  1SRP A;  2WOA A;  1QIB A;  4FXY P;  4HMA A;  3B2Z A;  2JSD A;  5H8X A;  3TVC A;  4AUO A;  3ZVS A;  1CGE A;  1SMP A;  4FXQ A;  1GKD A;  1I73 A;  1R55 A;  4PKV A;  1ZXC A;  2KRJ A;  2DW1 A;  1TVI A;  1CAQ A;  3BA0 A;  2Z2D A;  3Q2H A;  1QIC A;  1CXV A;  2OVZ A;  1AF0 A;  5L79 A;  3L0V A;  2JIH A;  1D8F A;  4J4M A;  2OY2 A;  2D1N A;  1MMB A;  4GR8 A;  1ZP5 A;  4H30 A;  1BIW A;  1JIW P;  1USN A;  1GO7 P;  1ZXV A;  4H1Q A;  1BQQ M;  4A7B A;  3EDG A;  1XM5 A;  1K7Q A;  3KRY A;  1JKY A;  4PKT A;  3P1V A;  1FLS A;  2XS3 A;  1GE7 A;  1UTZ A;  3VTG A;  3HBV P;  2USN A;  2OVX A;  3E8R A;  4L6T A;  1BKC E;  4H2E A;  1BKC A;  3LEA A;  2MLR A;  4WKI A;  5D1U A;  2I47 A;  3LKA A;  3LIL A;  1PWV A;  2J83 A;  1D5J A;  4JQG A;  4L63 A;  5D1T A;  4DV8 A;  3B8Z A;  2E2D A;  4PKR A;  1KUI A;  1KBC A;  3HB2 P;  1XFW A;  1A86 A;  1JIZ A;  4IUW A;  5L7F A;  1YCM A;  5D7W A;  1SU3 A;  5I43 A;  1CGL A;  1AST A;  2OW1 A;  3N2V A;  1J7N A;  5D1S A;  4JPA A;  1FBL A;  2MZE A;  3I7G A;  4L19 A;  1Z3J A;  4IN9 A;  4JIJ A;  4AYK A;  1B3D A;  3TS4 A;  3K7L A;  3WV2 A;  1GKC A;  2FV5 A;  2YUF A;  4AXQ A;  1L6J A;  456C A;  2MZI A;  1GE5 A;  1IAG A;  5JMY A;  3KWV C;  1ND1 A;  3LJG A;  3HYG A;  1PWQ A;  4GF1 A;  4XM8 A;  1HY7 A;  3AYU A;  3TSK A;  5I0L A;  3DWB A;  3EDH A;  4QKZ A;  1UTT A;  2OW2 A;  1DMT A;  4WKE A;  1YQY A;  1MMR A;  2JT6 A;  3EHX A;  5B5O A;  2CLT A;  2OXZ A;  1IAC A;  3HY9 A;  1KUH A;  1JH1 A;  3F18 A;  4JA1 A;  1UMS A;  4GWM A;  2N8R A;  3OHO A;  2K2G A;  1G4K A;  2W13 A;  2X3B A;  3N2U A;  1IAE A;  2O36 A;  3I7I A;  3AIG A;  2L0R A;  2OI0 A;  1Q3A A;  1B8Y A;  4AIG A;  3DTK A;  4GQL A;  4H82 A;  5LAB A;  1H71 P;  1JAP A;  4PKQ A;  1GXD A;  2AYK A;  4ILW D;  3DNG A;  2J0T A;  3ZXH A;  2SRT A;  1QJJ A;  3KHI A;  4GR3 A;  2W0D A;  3ELM A;  4XM6 A;  3HY7 A;  1BUV M;  4WK7 A;  1JAN A;  3V96 B;  2ERP A;  1QUA A;  3LIK A;  4ON1 A;  1XUC A;  1R54 A;  2OY4 A;  2DW0 A;  3ZUK A;  3WV3 A;  1CIZ A;  2CKI A;  4I03 A;  4JP4 A;  1XFV A;  1EB6 A;  2JT5 A;  1XUR A;  1GO8 P;  2DDY A;  2OW9 A;  1SLM A;  3HDB A;  5CZM A;  1EAK A;  3EDI A;  4G9L A;  4WZV A;  2YIG A;  1MMQ A;  2MZH A;  2JNP A;  2FV9 A;  1G05 A;  2MLS A;  1XAX A;  1YOU A;  4L7A A;  3LQB A;  3DPE A;  1CGF A;  4DF9 A;  3KEJ A;  2OZR A;  2W12 A;  1OM8 A;  1PWP A;  5BOY A;  2DW2 A;  1QIA A;  2Y6D A;  1BUD A;  1ROS A;  2HU6 A;  1ZVX A;  1OMJ A;  5CXA A;  1OO9 A;  1JAQ A;  4PKU A;  2OXU A;  2V4B A;  3DL1 A;  4EFS A;  4GR0 A;  2OXW A;  2X7M A;  4HX3 A;  2W14 A;  1SLN A;  2O3E A;  3HDA P;  2DDF A;  2X3C A;  3DTE A;  2K9C A;  3TT4 A;  1KUF A;  1DTH A;  2PJT A;  3VI1 A;  4XCT A;  3LQ0 A;  1PWU A;  1BKC I;  2YB9 A;  2X3A A;  1BM6 A;  3LIR A;  1JK3 A;  3F17 A;  1AKL A;  1OM7 A;  1ZTQ A;  4FU4 A;  1G49 A;  3EDZ A;  1IAD A;  1ZS0 A;  4H3X A;  1XUD A;  2W15 A;  5B5P A;  1HFS A;  3NX7 A;  1IAA A;  1I76 A;  3EWJ A;  3O2X A;  4H49 A;  4I35 A;  1S4B P;  2RJQ A; 
#chains in the Genus database with same CATH homology
 3SHI A;  4XBH A;  1C3I A;  3RTS A;  1R1I A;  3G5C A;  4H76 A;  3LUN A;  5I2Z A;  4XM7 A;  1EUB A;  4IJO A;  3EHY A;  3Q2G A;  1K7I A;  4Q1L A;  966C A;  1RMZ A;  3OHL A;  3WV1 A;  3LMC A;  1KUG A;  1WNI A;  4WF6 A;  4FVL A;  3LUM A;  1FM1 A;  2AIG P;  4A3W A;  1IAB A;  3DTI A;  1HOV A;  3USN A;  4ZR5 A;  3LE9 A;  3F1A A;  2A8H A;  3F19 A;  1KAP P;  1MNC A;  3MA2 A;  4GWN A;  3U1R A;  3F15 A;  3B92 A;  3RTT A;  1CQR A;  1GE6 A;  1D7X A;  1CK7 A;  1R1J A;  2XS4 A;  1C8T A;  3UVC A;  830C A;  2RJP A;  2OW0 A;  1UMT A;  1HV5 A;  2WO8 A;  2D1O A;  5D2B A;  1Y8J A;  4GUY A;  1BSW A;  1JAO A;  1MMP A;  3KMC A;  1BZS A;  3LGP A;  1QJI A;  1RM8 A;  3LJT A;  4DPE A;  3AYK A;  3F16 A;  5I12 A;  3G42 A;  5I4O A;  1A85 A;  1G12 A;  5BPA A;  1OM6 A;  2ERQ A;  3CKI A;  3O64 A;  4PKS A;  5CUH A;  1XFZ A;  2Y6C A;  1Y0V A;  1OS2 A;  1Y93 A;  1XFU A;  3DPF A;  1I1I P;  2TCL A;  3L0T A;  1XFY A;  1UEA A;  2ERO A;  1C7K A;  1OS9 A;  1G9K A;  2WO9 A;  4R3V A;  4CTH A;  1HFC A;  1HTD A;  1O0T A;  1BQO A;  3KEK A;  1K7G A;  5I3M A;  3KEC A;  3GBO A;  2E3X A;  4G0D A;  3LJZ A;  5D3C A;  3K7N A;  3KME A;  1JJ9 A;  1AYK A;  1PWW A;  1ATL A;  4H84 A;  1SAT A;  3DSL A;  1O0Q A;  2QPJ A;  3LK8 A;  1XFX A;  1R1H A;  3P24 A;  1D8M A;  2POJ A;  1YP1 A;  4DD8 A;  4PKW A;  1KUK A;  3HBU P;  5BOT A;  1SRP A;  2WOA A;  1QIB A;  4FXY P;  4HMA A;  3B2Z A;  2JSD A;  5H8X A;  3TVC A;  4AUO A;  3ZVS A;  1CGE A;  1SMP A;  4FXQ A;  1GKD A;  1I73 A;  1R55 A;  4PKV A;  1ZXC A;  2KRJ A;  2DW1 A;  1CAQ A;  3BA0 A;  2Z2D A;  3Q2H A;  1QIC A;  1CXV A;  2OVZ A;  1AF0 A;  5L79 A;  3L0V A;  2JIH A;  1D8F A;  4J4M A;  2OY2 A;  2D1N A;  1MMB A;  4GR8 A;  1ZP5 A;  4H30 A;  1BIW A;  1JIW P;  1USN A;  1GO7 P;  1ZXV A;  4H1Q A;  1BQQ M;  4A7B A;  3EDG A;  1K7Q A;  3KRY A;  1JKY A;  4PKT A;  3P1V A;  1FLS A;  2XS3 A;  1GE7 A;  1UTZ A;  3VTG A;  3HBV P;  2USN A;  2OVX A;  3E8R A;  4L6T A;  1BKC E;  4H2E A;  1BKC A;  3LEA A;  2MLR A;  4WKI A;  5D1U A;  2I47 A;  3LKA A;  3LIL A;  1PWV A;  2J83 A;  1D5J A;  4JQG A;  4L63 A;  5D1T A;  4DV8 A;  3B8Z A;  2E2D A;  4PKR A;  1KUI A;  1KBC A;  3HB2 P;  1XFW A;  1A86 A;  1JIZ A;  4IUW A;  5L7F A;  1YCM A;  5D7W A;  1SU3 A;  5I43 A;  1CGL A;  1AST A;  2OW1 A;  3N2V A;  1J7N A;  5D1S A;  4JPA A;  1FBL A;  2MZE A;  3I7G A;  4L19 A;  1Z3J A;  4IN9 A;  4JIJ A;  4AYK A;  1B3D A;  3TS4 A;  3K7L A;  3WV2 A;  1GKC A;  2FV5 A;  2YUF A;  4AXQ A;  1L6J A;  456C A;  2MZI A;  1GE5 A;  1IAG A;  5JMY A;  3KWV C;  1ND1 A;  3LJG A;  3HYG A;  1PWQ A;  4GF1 A;  4XM8 A;  1HY7 A;  3AYU A;  3TSK A;  5I0L A;  3DWB A;  3EDH A;  4QKZ A;  1UTT A;  2OW2 A;  1DMT A;  4WKE A;  1YQY A;  1MMR A;  2JT6 A;  3EHX A;  5B5O A;  2CLT A;  2OXZ A;  1IAC A;  3HY9 A;  1KUH A;  1JH1 A;  3F18 A;  4JA1 A;  1UMS A;  4GWM A;  2N8R A;  3OHO A;  2K2G A;  1G4K A;  2W13 A;  2X3B A;  3N2U A;  1IAE A;  2O36 A;  3I7I A;  3AIG A;  2L0R A;  2OI0 A;  1Q3A A;  1B8Y A;  4AIG A;  3DTK A;  4GQL A;  4H82 A;  5LAB A;  1H71 P;  1JAP A;  4PKQ A;  1GXD A;  2AYK A;  4ILW D;  3DNG A;  2J0T A;  3ZXH A;  2SRT A;  1QJJ A;  3KHI A;  4GR3 A;  2W0D A;  3ELM A;  4XM6 A;  3HY7 A;  1BUV M;  4WK7 A;  1JAN A;  3V96 B;  2ERP A;  1QUA A;  3LIK A;  4ON1 A;  1XUC A;  1R54 A;  2OY4 A;  2DW0 A;  3ZUK A;  3WV3 A;  1CIZ A;  2CKI A;  4I03 A;  4JP4 A;  1XFV A;  1EB6 A;  2JT5 A;  1XUR A;  1GO8 P;  2DDY A;  2OW9 A;  1SLM A;  3HDB A;  5CZM A;  1EAK A;  3EDI A;  4G9L A;  4WZV A;  2YIG A;  1MMQ A;  2MZH A;  2JNP A;  2FV9 A;  1G05 A;  2MLS A;  1YOU A;  4L7A A;  3LQB A;  3DPE A;  1CGF A;  4DF9 A;  3KEJ A;  2OZR A;  2W12 A;  1OM8 A;  1PWP A;  5BOY A;  2DW2 A;  1QIA A;  2Y6D A;  1BUD A;  1ROS A;  2HU6 A;  1ZVX A;  1OMJ A;  5CXA A;  1OO9 A;  1JAQ A;  4PKU A;  2OXU A;  2V4B A;  3DL1 A;  4EFS A;  4GR0 A;  2OXW A;  2X7M A;  4HX3 A;  2W14 A;  1SLN A;  2O3E A;  3HDA P;  2DDF A;  2X3C A;  3DTE A;  2K9C A;  3TT4 A;  1KUF A;  1DTH A;  2PJT A;  3VI1 A;  4XCT A;  3LQ0 A;  1PWU A;  1BKC I;  2YB9 A;  2X3A A;  1BM6 A;  3LIR A;  1JK3 A;  3F17 A;  1AKL A;  1OM7 A;  1ZTQ A;  4FU4 A;  1G49 A;  3EDZ A;  1IAD A;  1ZS0 A;  4H3X A;  1XUD A;  2W15 A;  5B5P A;  1HFS A;  3NX7 A;  1IAA A;  1I76 A;  3EWJ A;  3O2X A;  4H49 A;  4I35 A;  1S4B P;  2RJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...