1GE5A

Zinc peptidase from grifola frondosa
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
167
structure length
167
Chain Sequence
TYNGCSSSEQSALAAAASAAQSYVAESLSYLQTHTAATPRYTTWFGSYISSRHSTVLQHYTDMNSNDFSSYSFDCTCTAAGTFAYVYPNRFGTVYLCGAFWKAPTTGTDSQAGTLVHESSHFTRNGGTKDYAYGQAAAKSLATMDPDKAVMNADNHEYFSENNPAQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-LYS METALLOENDOPEPTIDASE
publication title Structure of a new 'aspzincin' metalloendopeptidase from Grifola frondosa: implications for the catalytic mechanism and substrate specificity based on several different crystal forms.
pubmed doi rcsb
molecule tags Hydrolase
total genus 64
structure length 167
sequence length 167
ec nomenclature ec 3.4.24.20: Peptidyl-Lys metalloendopeptidase.
pdb deposition date 2000-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14521 Aspzincin_M35 Lysine-specific metallo-endopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1ge5A00
1ATLA 3KWVC 3F16A 3EHYA 3KRYA 4GF1A 1H71P 4H2EA 5L79A 2XS4A 1MMRA 1HOVA 4XM6A 3KEKA 2O3EA 1R1JA 4XCTA 1ZXVA 2J83A 2OW9A 3KECA 3LJTA 1ZTQA 1XURA 2DW0A 2W14A 3NX7A 1SLNA 1O0TA 3LILA 2OW2A 2AYKA 1UTTA 4FXQA 3V96B 3E8RA 2E3XA 1C8TA 1BQOA 1IACA 1JH1A 1D5JA 830CA 2X3AA 4FU4A 4PKVA 3LK8A 1R54A 4CTHA 3AYKA 2JT6A 2QPJA 3LE9A 3N2UA 2MLRA 4XM8A 1OO9A 1XUCA 2MZHA 1AYKA 1BKCI 4XM7A 3N2VA 1Q3AA 1OM6A 3K7NA 2WO8A 1ZP5A 4PKSA 1D7XA 2N8RA 1CGLA 2OW0A 3ELMA 1OS2A 3OHOA 4WK7A 1QICA 1GXDA 1KUGA 1SLMA 5B5PA 3F1AA 4WZVA 3DWBA 1QIAA 1SMPA 3F19A 1JKYA 2OXUA 1KUFA 5D1TA 2JT5A 2USNA 4PKUA 2JSDA 3AYUA 1L6JA 3EWJA 1I1IP 1K7GA 1D8MA 3KMEA 3ZVSA 2MZEA 5I12A 4H30A 1HFSA 3DPEA 4DPEA 1RM8A 3K7LA 1UMTA 1G9KA 1J7NA 2TCLA 2DW2A 1BKCE 1BIWA 3O64A 3P24A 1R1IA 1GKDA 1BUVM 2I47A 4H82A 1JANA 4PKTA 5JMYA 4L63A 1USNA 4PKWA 2OY4A 2WO9A 3TS4A 1HY7A 4WKIA 2DDYA 1C3IA 1UTZA 2DDFA 1ND1A 5BOTA 1BUDA 1GO7P 4G0DA 3DL1A 1QUAA 2W0DA 4PKQA 1SRPA 2WOAA 4WF6A 1JJ9A 1PWPA 3O2XA 1FLSA 1YQYA 3HY7A 3EDGA 1GO8P 3G5CA 3LUNA 1IADA 4GR3A 3F15A 1EB6A 4FVLA 1G4KA 1IAEA 4I03A 1OM8A 1R55A 3DNGA 4GQLA 1XFUA 4H1QA 2YB9A 3L0VA 4DV8A 1ROSA 1XFXA 2J0TA 4DD8A 3WV3A 1HV5A 3HB2P 4AIGA 3DPFA 3I7GA 1WNIA 1OMJA 3EDZA 3USNA 5D2BA 5CXAA 1JK3A 1A86A 1O0QA 3P1VA 2OW1A 1JAPA 4H3XA 1KUHA 1AF0A 1XUDA 3Q2HA 1CQRA 1SATA 4ON1A 1YCMA 3BA0A 2ERQA 4ILWD 3F18A 1G05A 1R1HA 2OVXA 3MA2A 5BPAA 3VTGA 5D3CA 5I4OA 4EFSA 2OZRA 3LGPA 4HX3A 1CK7A 1CXVA 3WV1A 3ZXHA 5CUHA 4H84A 1K7QA 1GKCA 2AIGP 4GWMA 1IAGA 1IAAA 1XFZA 2W12A 3B92A 1EUBA 3AIGA 4PKRA 1Y93A 3HBVP 4GR8A 3EDIA 5D1SA 2E2DA 5D7WA 3ZUKA 2JIHA 5CZMA 1B8YA 2FV9A 3RTTA 3VI1A 1EAKA 4G9LA 1BSWA 4DF9A 1CAQA 5I3MA 2OI0A 1MMPA 1BQQM 1ZS0A 4A3WA 1XFVA 1UEAA 4L6TA 1C7KA 1AKLA 1Z3JA 1XFWA 1PWVA 3LUMA 3SHIA 3EHXA 1SU3A 2O36A 1ASTA 4IN9A 1IABA 3UVCA 1I76A 2X3CA 1CGEA 1OM7A 1XFYA 5B5OA 2RJQA 1YOUA 1OS9A 4JQGA 3TVCA 4AXQA 1GE5A 456CA 1BZSA 4I35A 1A85A 2CLTA 2Z2DA 4ZR5A 3LQBA 1JAOA 3LJZA 4QKZA 1QIBA 5I0LA 2K2GA 3KHIA 4IUWA 2D1OA 1ZXCA 3B8ZA 4JA1A 1ZVXA 3HY9A 5LABA 1K7IA 1UMSA 2OVZA 2X3BA 3LJGA 3HDAP 4AUOA 3HBUP 1Y8JA 2ERPA 4R3VA 1KAPP 4JPAA 1RMZA 1CGFA 1QJIA 1QJJA 5I43A 4Q1LA 3KMCA 1MMBA 2DW1A 2W15A 1FBLA 4GR0A 2MLSA 2PJTA 4WKEA 3B2ZA 966CA 1DMTA 1KUIA 4AYKA 2OY2A 3LIKA 2X7MA 4L19A 1B3DA 2W13A 3EDHA 3I7IA 4H49A 1CIZA 5L7FA 4HMAA 4J4MA 1HTDA 3LKAA 3KEJA 3TSKA 3G42A 1PWUA 3F17A 1KBCA 3LIRA 5BOYA 2RJPA 2FV5A 4JP4A 1MNCA 3GBOA 2KRJA 1KUKA 3U1RA 2OXWA 4JIJA 4H76A 3RTSA 2SRTA 4GWNA 2Y6CA 1G49A 3HDBA 1D8FA 1FM1A 1JIZA 1DTHA 3LQ0A 5H8XA 3Q2GA 1PWWA 2XS3A 1BM6A 2D1NA 3TT4A 1BKCA 5D1UA 3OHLA 3LMCA 3CKIA 4XBHA 3WV2A 2OXZA 1GE7A 1YP1A 2L0RA 2JNPA 2MZIA 4FXYP 1GE6A 2A8HA 1JIWP 1Y0VA 2K9CA 3HYGA 5I2ZA 2HU6A 2V4BA 1S4BP 2YIGA 2POJA 1MMQA 4IJOA 2Y6DA 3LEAA 4A7BA 2EROA 3DSLA 1JAQA 1I73A 4GUYA 1G12A 1PWQA 1HFCA 3L0TA 2CKIA
chains in the Genus database with same CATH superfamily
1ATLA 3KWVC 3F16A 3EHYA 3DTEA 3KRYA 4GF1A 1H71P 4H2EA 5L79A 2XS4A 1MMRA 1HOVA 4XM6A 3KEKA 2O3EA 1R1JA 4XCTA 1ZXVA 2J83A 2OW9A 3KECA 3LJTA 1ZTQA 1XURA 2DW0A 2W14A 3NX7A 1SLNA 1O0TA 3LILA 2OW2A 2AYKA 1UTTA 4FXQA 3V96B 3E8RA 2E3XA 1C8TA 1BQOA 1IACA 1JH1A 1D5JA 830CA 2X3AA 4FU4A 4PKVA 3LK8A 1R54A 4CTHA 3AYKA 2JT6A 2QPJA 3LE9A 3N2UA 2MLRA 4XM8A 1OO9A 1XUCA 2MZHA 1AYKA 1BKCI 1OZ9A 4XM7A 3N2VA 1Q3AA 1OM6A 3K7NA 2WO8A 1ZP5A 4PKSA 1D7XA 2N8RA 1CGLA 2OW0A 3ELMA 1OS2A 3OHOA 4WK7A 1QICA 1GXDA 1KUGA 1SLMA 4L7AA 5B5PA 3F1AA 4WZVA 3DWBA 1QIAA 1SMPA 3F19A 1JKYA 2OXUA 1KUFA 5D1TA 2JT5A 2USNA 4PKUA 2JSDA 3AYUA 1L6JA 3EWJA 1I1IP 1K7GA 1D8MA 3KMEA 3ZVSA 2MZEA 5I12A 4H30A 1HFSA 3DPEA 4DPEA 1RM8A 3K7LA 1UMTA 1G9KA 1J7NA 2TCLA 2DW2A 1BKCE 1BIWA 3O64A 3P24A 1R1IA 1GKDA 1BUVM 2I47A 4H82A 1JANA 4PKTA 5JMYA 4L63A 1USNA 4PKWA 2OY4A 2WO9A 3TS4A 1HY7A 4WKIA 2DDYA 1C3IA 1UTZA 2DDFA 1ND1A 5BOTA 1BUDA 1GO7P 4G0DA 3DL1A 1QUAA 2W0DA 4PKQA 1SRPA 2WOAA 4WF6A 1JJ9A 1PWPA 3O2XA 1FLSA 1YQYA 3HY7A 3EDGA 1GO8P 3G5CA 3LUNA 1IADA 4GR3A 3F15A 1EB6A 4FVLA 1G4KA 1IAEA 4I03A 1OM8A 1R55A 3DNGA 4GQLA 1XFUA 4H1QA 2YB9A 3L0VA 4DV8A 1ROSA 1XFXA 2J0TA 4DD8A 3WV3A 1HV5A 3HB2P 4AIGA 3DPFA 3I7GA 1WNIA 1OMJA 3EDZA 3USNA 5D2BA 5CXAA 1JK3A 1A86A 1O0QA 3P1VA 2OW1A 1JAPA 4H3XA 1KUHA 1AF0A 1XUDA 3Q2HA 1CQRA 3DTIA 1SATA 4ON1A 1YCMA 3BA0A 2ERQA 4ILWD 3F18A 1G05A 1R1HA 2OVXA 3MA2A 5BPAA 3VTGA 5D3CA 5I4OA 4EFSA 2OZRA 3LGPA 4HX3A 1CK7A 1CXVA 3WV1A 3ZXHA 5CUHA 4H84A 1K7QA 1GKCA 2AIGP 4GWMA 1IAGA 1IAAA 1XFZA 2W12A 3B92A 1EUBA 1TVIA 3AIGA 4PKRA 1Y93A 3HBVP 4GR8A 3EDIA 5D1SA 2E2DA 5D7WA 3ZUKA 2JIHA 5CZMA 1XM5A 1B8YA 2FV9A 3RTTA 3VI1A 1EAKA 4G9LA 1BSWA 4DF9A 1CAQA 5I3MA 2OI0A 1MMPA 1BQQM 1ZS0A 4A3WA 1XFVA 1UEAA 4L6TA 1C7KA 1AKLA 1Z3JA 1XFWA 1PWVA 3LUMA 3SHIA 3EHXA 1SU3A 2O36A 1ASTA 4IN9A 1IABA 3UVCA 1I76A 2X3CA 1CGEA 1OM7A 1XFYA 5B5OA 2RJQA 1YOUA 1OS9A 4JQGA 3TVCA 4AXQA 1GE5A 456CA 1BZSA 4I35A 1A85A 2CLTA 2Z2DA 4ZR5A 3LQBA 1JAOA 2YUFA 3LJZA 4QKZA 1QIBA 5I0LA 2K2GA 3KHIA 4IUWA 2D1OA 1ZXCA 3B8ZA 4JA1A 1ZVXA 3HY9A 5LABA 1K7IA 1UMSA 2OVZA 2X3BA 3LJGA 3HDAP 4AUOA 3HBUP 1Y8JA 2ERPA 4R3VA 1KAPP 4JPAA 1RMZA 1CGFA 1QJIA 1QJJA 5I43A 4Q1LA 3KMCA 1MMBA 2DW1A 2W15A 1FBLA 4GR0A 2MLSA 2PJTA 4WKEA 3B2ZA 966CA 1DMTA 1KUIA 4AYKA 2OY2A 3LIKA 2X7MA 4L19A 1B3DA 2W13A 3EDHA 3I7IA 4H49A 1CIZA 5L7FA 4HMAA 4J4MA 1HTDA 3LKAA 3KEJA 3TSKA 3G42A 1PWUA 3F17A 1KBCA 3LIRA 5BOYA 2RJPA 1XAXA 2FV5A 4JP4A 1MNCA 3GBOA 2KRJA 1KUKA 3U1RA 2OXWA 4JIJA 4H76A 3RTSA 2SRTA 4GWNA 2Y6CA 1G49A 3HDBA 1D8FA 1FM1A 1JIZA 1DTHA 3LQ0A 5H8XA 3Q2GA 1PWWA 2XS3A 1BM6A 2D1NA 3TT4A 1BKCA 5D1UA 3OHLA 3LMCA 3CKIA 4XBHA 3WV2A 2OXZA 1GE7A 1YP1A 2L0RA 2JNPA 2MZIA 4FXYP 1GE6A 2A8HA 1JIWP 1Y0VA 2K9CA 3HYGA 5I2ZA 2HU6A 2V4BA 1S4BP 2YIGA 3DTKA 2POJA 1MMQA 4IJOA 2Y6DA 3LEAA 4A7BA 2EROA 3DSLA 1JAQA 1I73A 4GUYA 1G12A 1PWQA 1HFCA 3L0TA 2CKIA
chains in the Genus database with same CATH topology
1ATLA 3KWVC 3F16A 3EHYA 3DTEA 3KRYA 4GF1A 1H71P 4H2EA 5L79A 2XS4A 1MMRA 1HOVA 4XM6A 3KEKA 2O3EA 1R1JA 4XCTA 1ZXVA 2J83A 2OW9A 3KECA 3LJTA 1ZTQA 1XURA 2DW0A 2W14A 3NX7A 1SLNA 1O0TA 3LILA 2OW2A 2AYKA 1UTTA 4FXQA 3V96B 3E8RA 2E3XA 1C8TA 1BQOA 1IACA 1JH1A 1D5JA 830CA 2X3AA 4FU4A 4PKVA 3LK8A 1R54A 4CTHA 3AYKA 2JT6A 2QPJA 3LE9A 3N2UA 2MLRA 4XM8A 1OO9A 1XUCA 2MZHA 1AYKA 1BKCI 4XM7A 3N2VA 1Q3AA 1OM6A 3K7NA 2WO8A 1ZP5A 4PKSA 1D7XA 2N8RA 1CGLA 2OW0A 3ELMA 1OS2A 3OHOA 4WK7A 1QICA 1GXDA 1KUGA 1SLMA 4L7AA 5B5PA 3F1AA 4WZVA 3DWBA 1QIAA 1SMPA 3F19A 1JKYA 2OXUA 1KUFA 5D1TA 2JT5A 2USNA 4PKUA 2JSDA 3AYUA 1L6JA 3EWJA 1I1IP 1K7GA 1D8MA 3KMEA 3ZVSA 2MZEA 5I12A 4H30A 1HFSA 3DPEA 4DPEA 1RM8A 3K7LA 1UMTA 1G9KA 1J7NA 2TCLA 2DW2A 1BKCE 1BIWA 3O64A 3P24A 1R1IA 1GKDA 1BUVM 2I47A 4H82A 1JANA 4PKTA 5JMYA 4L63A 1USNA 4PKWA 2OY4A 2WO9A 3TS4A 1HY7A 4WKIA 2DDYA 1C3IA 1UTZA 2DDFA 1ND1A 5BOTA 1BUDA 1GO7P 4G0DA 3DL1A 1QUAA 2W0DA 4PKQA 1SRPA 2WOAA 4WF6A 1JJ9A 1PWPA 3O2XA 1FLSA 1YQYA 3HY7A 3EDGA 1GO8P 3G5CA 3LUNA 1IADA 4GR3A 3F15A 1EB6A 4FVLA 1G4KA 1IAEA 4I03A 1OM8A 1R55A 3DNGA 4GQLA 1XFUA 4H1QA 2YB9A 3L0VA 4DV8A 1ROSA 1XFXA 2J0TA 4DD8A 3WV3A 1HV5A 3HB2P 4AIGA 3DPFA 3I7GA 1WNIA 1OMJA 3EDZA 3USNA 5D2BA 5CXAA 1JK3A 1A86A 1O0QA 3P1VA 2OW1A 1JAPA 4H3XA 1KUHA 1AF0A 1XUDA 3Q2HA 1CQRA 3DTIA 1SATA 4ON1A 1YCMA 3BA0A 2ERQA 4ILWD 3F18A 1G05A 1R1HA 2OVXA 3MA2A 5BPAA 3VTGA 5D3CA 5I4OA 4EFSA 2OZRA 3LGPA 4HX3A 1CK7A 1CXVA 3WV1A 3ZXHA 5CUHA 4H84A 1K7QA 1GKCA 2AIGP 4GWMA 1IAGA 1IAAA 1XFZA 2W12A 3B92A 1EUBA 3AIGA 4PKRA 1Y93A 3HBVP 4GR8A 3EDIA 5D1SA 2E2DA 5D7WA 3ZUKA 2JIHA 5CZMA 1B8YA 2FV9A 3RTTA 3VI1A 1EAKA 4G9LA 1BSWA 4DF9A 1CAQA 5I3MA 2OI0A 1MMPA 1BQQM 1ZS0A 4A3WA 1XFVA 1UEAA 4L6TA 1C7KA 1AKLA 1Z3JA 1XFWA 1PWVA 3LUMA 3SHIA 3EHXA 1SU3A 2O36A 1ASTA 4IN9A 1IABA 3UVCA 1I76A 2X3CA 1CGEA 1OM7A 1XFYA 5B5OA 2RJQA 1YOUA 1OS9A 4JQGA 3TVCA 4AXQA 1GE5A 456CA 1BZSA 4I35A 1A85A 2CLTA 2Z2DA 4ZR5A 3LQBA 1JAOA 2YUFA 3LJZA 4QKZA 1QIBA 5I0LA 2K2GA 3KHIA 4IUWA 2D1OA 1ZXCA 3B8ZA 4JA1A 1ZVXA 3HY9A 5LABA 1K7IA 1UMSA 2OVZA 2X3BA 3LJGA 3HDAP 4AUOA 3HBUP 1Y8JA 2ERPA 4R3VA 1KAPP 4JPAA 1RMZA 1CGFA 1QJIA 1QJJA 5I43A 4Q1LA 3KMCA 1MMBA 2DW1A 2W15A 1FBLA 4GR0A 2MLSA 2PJTA 4WKEA 3B2ZA 966CA 1DMTA 1KUIA 4AYKA 2OY2A 3LIKA 2X7MA 4L19A 1B3DA 2W13A 3EDHA 3I7IA 4H49A 1CIZA 5L7FA 4HMAA 4J4MA 1HTDA 3LKAA 3KEJA 3TSKA 3G42A 1PWUA 3F17A 1KBCA 3LIRA 5BOYA 2RJPA 2FV5A 4JP4A 1MNCA 3GBOA 2KRJA 1KUKA 3U1RA 2OXWA 4JIJA 4H76A 3RTSA 2SRTA 4GWNA 2Y6CA 1G49A 3HDBA 1D8FA 1FM1A 1JIZA 1DTHA 3LQ0A 5H8XA 3Q2GA 1PWWA 2XS3A 1BM6A 2D1NA 3TT4A 1BKCA 5D1UA 3OHLA 3LMCA 3CKIA 4XBHA 3WV2A 2OXZA 1GE7A 1YP1A 2L0RA 2JNPA 2MZIA 4FXYP 1GE6A 2A8HA 1JIWP 1Y0VA 2K9CA 3HYGA 5I2ZA 2HU6A 2V4BA 1S4BP 2YIGA 3DTKA 2POJA 1MMQA 4IJOA 2Y6DA 3LEAA 4A7BA 2EROA 3DSLA 1JAQA 1I73A 4GUYA 1G12A 1PWQA 1HFCA 3L0TA 2CKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ATL A;  3KWV C;  3F16 A;  3EHY A;  3KRY A;  4GF1 A;  1H71 P;  4H2E A;  5L79 A;  2XS4 A;  1MMR A;  1HOV A;  4XM6 A;  3KEK A;  2O3E A;  1R1J A;  4XCT A;  1ZXV A;  2J83 A;  2OW9 A;  3KEC A;  3LJT A;  1ZTQ A;  1XUR A;  2DW0 A;  2W14 A;  3NX7 A;  1SLN A;  1O0T A;  3LIL A;  2OW2 A;  2AYK A;  1UTT A;  4FXQ A;  3V96 B;  3E8R A;  2E3X A;  1C8T A;  1BQO A;  1IAC A;  1JH1 A;  1D5J A;  830C A;  2X3A A;  4FU4 A;  4PKV A;  3LK8 A;  1R54 A;  4CTH A;  3AYK A;  2JT6 A;  2QPJ A;  3LE9 A;  3N2U A;  2MLR A;  4XM8 A;  1OO9 A;  1XUC A;  2MZH A;  1AYK A;  1BKC I;  4XM7 A;  3N2V A;  1Q3A A;  1OM6 A;  3K7N A;  2WO8 A;  1ZP5 A;  4PKS A;  1D7X A;  2N8R A;  1CGL A;  2OW0 A;  3ELM A;  1OS2 A;  3OHO A;  4WK7 A;  1QIC A;  1GXD A;  1KUG A;  1SLM A;  5B5P A;  3F1A A;  4WZV A;  3DWB A;  1QIA A;  1SMP A;  3F19 A;  1JKY A;  2OXU A;  1KUF A;  5D1T A;  2JT5 A;  2USN A;  4PKU A;  2JSD A;  3AYU A;  1L6J A;  3EWJ A;  1I1I P;  1K7G A;  1D8M A;  3KME A;  3ZVS A;  2MZE A;  5I12 A;  4H30 A;  1HFS A;  3DPE A;  4DPE A;  1RM8 A;  3K7L A;  1UMT A;  1G9K A;  1J7N A;  2TCL A;  2DW2 A;  1BKC E;  1BIW A;  3O64 A;  3P24 A;  1R1I A;  1GKD A;  1BUV M;  2I47 A;  4H82 A;  1JAN A;  4PKT A;  5JMY A;  4L63 A;  1USN A;  4PKW A;  2OY4 A;  2WO9 A;  3TS4 A;  1HY7 A;  4WKI A;  2DDY A;  1C3I A;  1UTZ A;  2DDF A;  1ND1 A;  5BOT A;  1BUD A;  1GO7 P;  4G0D A;  3DL1 A;  1QUA A;  2W0D A;  4PKQ A;  1SRP A;  2WOA A;  4WF6 A;  1JJ9 A;  1PWP A;  3O2X A;  1FLS A;  1YQY A;  3HY7 A;  3EDG A;  1GO8 P;  3G5C A;  3LUN A;  1IAD A;  4GR3 A;  3F15 A;  1EB6 A;  4FVL A;  1G4K A;  1IAE A;  4I03 A;  1OM8 A;  1R55 A;  3DNG A;  4GQL A;  1XFU A;  4H1Q A;  2YB9 A;  3L0V A;  4DV8 A;  1ROS A;  1XFX A;  2J0T A;  4DD8 A;  3WV3 A;  1HV5 A;  3HB2 P;  4AIG A;  3DPF A;  3I7G A;  1WNI A;  1OMJ A;  3EDZ A;  3USN A;  5D2B A;  5CXA A;  1JK3 A;  1A86 A;  1O0Q A;  3P1V A;  2OW1 A;  1JAP A;  4H3X A;  1KUH A;  1AF0 A;  1XUD A;  3Q2H A;  1CQR A;  1SAT A;  4ON1 A;  1YCM A;  3BA0 A;  2ERQ A;  4ILW D;  3F18 A;  1G05 A;  1R1H A;  2OVX A;  3MA2 A;  5BPA A;  3VTG A;  5D3C A;  5I4O A;  4EFS A;  2OZR A;  3LGP A;  4HX3 A;  1CK7 A;  1CXV A;  3WV1 A;  3ZXH A;  5CUH A;  4H84 A;  1K7Q A;  1GKC A;  2AIG P;  4GWM A;  1IAG A;  1IAA A;  1XFZ A;  2W12 A;  3B92 A;  1EUB A;  3AIG A;  4PKR A;  1Y93 A;  3HBV P;  4GR8 A;  3EDI A;  5D1S A;  2E2D A;  5D7W A;  3ZUK A;  2JIH A;  5CZM A;  1B8Y A;  2FV9 A;  3RTT A;  3VI1 A;  1EAK A;  4G9L A;  1BSW A;  4DF9 A;  1CAQ A;  5I3M A;  2OI0 A;  1MMP A;  1BQQ M;  1ZS0 A;  4A3W A;  1XFV A;  1UEA A;  4L6T A;  1C7K A;  1AKL A;  1Z3J A;  1XFW A;  1PWV A;  3LUM A;  3SHI A;  3EHX A;  1SU3 A;  2O36 A;  1AST A;  4IN9 A;  1IAB A;  3UVC A;  1I76 A;  2X3C A;  1CGE A;  1OM7 A;  1XFY A;  5B5O A;  2RJQ A;  1YOU A;  1OS9 A;  4JQG A;  3TVC A;  4AXQ A;  1GE5 A;  456C A;  1BZS A;  4I35 A;  1A85 A;  2CLT A;  2Z2D A;  4ZR5 A;  3LQB A;  1JAO A;  3LJZ A;  4QKZ A;  1QIB A;  5I0L A;  2K2G A;  3KHI A;  4IUW A;  2D1O A;  1ZXC A;  3B8Z A;  4JA1 A;  1ZVX A;  3HY9 A;  5LAB A;  1K7I A;  1UMS A;  2OVZ A;  2X3B A;  3LJG A;  3HDA P;  4AUO A;  3HBU P;  1Y8J A;  2ERP A;  4R3V A;  1KAP P;  4JPA A;  1RMZ A;  1CGF A;  1QJI A;  1QJJ A;  5I43 A;  4Q1L A;  3KMC A;  1MMB A;  2DW1 A;  2W15 A;  1FBL A;  4GR0 A;  2MLS A;  2PJT A;  4WKE A;  3B2Z A;  966C A;  1DMT A;  1KUI A;  4AYK A;  2OY2 A;  3LIK A;  2X7M A;  4L19 A;  1B3D A;  2W13 A;  3EDH A;  3I7I A;  4H49 A;  1CIZ A;  5L7F A;  4HMA A;  4J4M A;  1HTD A;  3LKA A;  3KEJ A;  3TSK A;  3G42 A;  1PWU A;  3F17 A;  1KBC A;  3LIR A;  5BOY A;  2RJP A;  2FV5 A;  4JP4 A;  1MNC A;  3GBO A;  2KRJ A;  1KUK A;  3U1R A;  2OXW A;  4JIJ A;  4H76 A;  3RTS A;  2SRT A;  4GWN A;  2Y6C A;  1G49 A;  3HDB A;  1D8F A;  1FM1 A;  1JIZ A;  1DTH A;  3LQ0 A;  5H8X A;  3Q2G A;  1PWW A;  2XS3 A;  1BM6 A;  2D1N A;  3TT4 A;  1BKC A;  5D1U A;  3OHL A;  3LMC A;  3CKI A;  4XBH A;  3WV2 A;  2OXZ A;  1GE7 A;  1YP1 A;  2L0R A;  2JNP A;  2MZI A;  4FXY P;  1GE6 A;  2A8H A;  1JIW P;  1Y0V A;  2K9C A;  3HYG A;  5I2Z A;  2HU6 A;  2V4B A;  1S4B P;  2YIG A;  2POJ A;  1MMQ A;  4IJO A;  2Y6D A;  3LEA A;  4A7B A;  2ERO A;  3DSL A;  1JAQ A;  1I73 A;  4GUY A;  1G12 A;  1PWQ A;  1HFC A;  3L0T A;  2CKI A; 
#chains in the Genus database with same CATH topology
 1ATL A;  3KWV C;  3F16 A;  3EHY A;  3DTE A;  3KRY A;  4GF1 A;  1H71 P;  4H2E A;  5L79 A;  2XS4 A;  1MMR A;  1HOV A;  4XM6 A;  3KEK A;  2O3E A;  1R1J A;  4XCT A;  1ZXV A;  2J83 A;  2OW9 A;  3KEC A;  3LJT A;  1ZTQ A;  1XUR A;  2DW0 A;  2W14 A;  3NX7 A;  1SLN A;  1O0T A;  3LIL A;  2OW2 A;  2AYK A;  1UTT A;  4FXQ A;  3V96 B;  3E8R A;  2E3X A;  1C8T A;  1BQO A;  1IAC A;  1JH1 A;  1D5J A;  830C A;  2X3A A;  4FU4 A;  4PKV A;  3LK8 A;  1R54 A;  4CTH A;  3AYK A;  2JT6 A;  2QPJ A;  3LE9 A;  3N2U A;  2MLR A;  4XM8 A;  1OO9 A;  1XUC A;  2MZH A;  1AYK A;  1BKC I;  1OZ9 A;  4XM7 A;  3N2V A;  1Q3A A;  1OM6 A;  3K7N A;  2WO8 A;  1ZP5 A;  4PKS A;  1D7X A;  2N8R A;  1CGL A;  2OW0 A;  3ELM A;  1OS2 A;  3OHO A;  4WK7 A;  1QIC A;  1GXD A;  1KUG A;  1SLM A;  4L7A A;  5B5P A;  3F1A A;  4WZV A;  3DWB A;  1QIA A;  1SMP A;  3F19 A;  1JKY A;  2OXU A;  1KUF A;  5D1T A;  2JT5 A;  2USN A;  4PKU A;  2JSD A;  3AYU A;  1L6J A;  3EWJ A;  1I1I P;  1K7G A;  1D8M A;  3KME A;  3ZVS A;  2MZE A;  5I12 A;  4H30 A;  1HFS A;  3DPE A;  4DPE A;  1RM8 A;  3K7L A;  1UMT A;  1G9K A;  1J7N A;  2TCL A;  2DW2 A;  1BKC E;  1BIW A;  3O64 A;  3P24 A;  1R1I A;  1GKD A;  1BUV M;  2I47 A;  4H82 A;  1JAN A;  4PKT A;  5JMY A;  4L63 A;  1USN A;  4PKW A;  2OY4 A;  2WO9 A;  3TS4 A;  1HY7 A;  4WKI A;  2DDY A;  1C3I A;  1UTZ A;  2DDF A;  1ND1 A;  5BOT A;  1BUD A;  1GO7 P;  4G0D A;  3DL1 A;  1QUA A;  2W0D A;  4PKQ A;  1SRP A;  2WOA A;  4WF6 A;  1JJ9 A;  1PWP A;  3O2X A;  1FLS A;  1YQY A;  3HY7 A;  3EDG A;  1GO8 P;  3G5C A;  3LUN A;  1IAD A;  4GR3 A;  3F15 A;  1EB6 A;  4FVL A;  1G4K A;  1IAE A;  4I03 A;  1OM8 A;  1R55 A;  3DNG A;  4GQL A;  1XFU A;  4H1Q A;  2YB9 A;  3L0V A;  4DV8 A;  1ROS A;  1XFX A;  2J0T A;  4DD8 A;  3WV3 A;  1HV5 A;  3HB2 P;  4AIG A;  3DPF A;  3I7G A;  1WNI A;  1OMJ A;  3EDZ A;  3USN A;  5D2B A;  5CXA A;  1JK3 A;  1A86 A;  1O0Q A;  3P1V A;  2OW1 A;  1JAP A;  4H3X A;  1KUH A;  1AF0 A;  1XUD A;  3Q2H A;  1CQR A;  3DTI A;  1SAT A;  4ON1 A;  1YCM A;  3BA0 A;  2ERQ A;  4ILW D;  3F18 A;  1G05 A;  1R1H A;  2OVX A;  3MA2 A;  5BPA A;  3VTG A;  5D3C A;  5I4O A;  4EFS A;  2OZR A;  3LGP A;  4HX3 A;  1CK7 A;  1CXV A;  3WV1 A;  3ZXH A;  5CUH A;  4H84 A;  1K7Q A;  1GKC A;  2AIG P;  4GWM A;  1IAG A;  1IAA A;  1XFZ A;  2W12 A;  3B92 A;  1EUB A;  1TVI A;  3AIG A;  4PKR A;  1Y93 A;  3HBV P;  4GR8 A;  3EDI A;  5D1S A;  2E2D A;  5D7W A;  3ZUK A;  2JIH A;  5CZM A;  1XM5 A;  1B8Y A;  2FV9 A;  3RTT A;  3VI1 A;  1EAK A;  4G9L A;  1BSW A;  4DF9 A;  1CAQ A;  5I3M A;  2OI0 A;  1MMP A;  1BQQ M;  1ZS0 A;  4A3W A;  1XFV A;  1UEA A;  4L6T A;  1C7K A;  1AKL A;  1Z3J A;  1XFW A;  1PWV A;  3LUM A;  3SHI A;  3EHX A;  1SU3 A;  2O36 A;  1AST A;  4IN9 A;  1IAB A;  3UVC A;  1I76 A;  2X3C A;  1CGE A;  1OM7 A;  1XFY A;  5B5O A;  2RJQ A;  1YOU A;  1OS9 A;  4JQG A;  3TVC A;  4AXQ A;  1GE5 A;  456C A;  1BZS A;  4I35 A;  1A85 A;  2CLT A;  2Z2D A;  4ZR5 A;  3LQB A;  1JAO A;  2YUF A;  3LJZ A;  4QKZ A;  1QIB A;  5I0L A;  2K2G A;  3KHI A;  4IUW A;  2D1O A;  1ZXC A;  3B8Z A;  4JA1 A;  1ZVX A;  3HY9 A;  5LAB A;  1K7I A;  1UMS A;  2OVZ A;  2X3B A;  3LJG A;  3HDA P;  4AUO A;  3HBU P;  1Y8J A;  2ERP A;  4R3V A;  1KAP P;  4JPA A;  1RMZ A;  1CGF A;  1QJI A;  1QJJ A;  5I43 A;  4Q1L A;  3KMC A;  1MMB A;  2DW1 A;  2W15 A;  1FBL A;  4GR0 A;  2MLS A;  2PJT A;  4WKE A;  3B2Z A;  966C A;  1DMT A;  1KUI A;  4AYK A;  2OY2 A;  3LIK A;  2X7M A;  4L19 A;  1B3D A;  2W13 A;  3EDH A;  3I7I A;  4H49 A;  1CIZ A;  5L7F A;  4HMA A;  4J4M A;  1HTD A;  3LKA A;  3KEJ A;  3TSK A;  3G42 A;  1PWU A;  3F17 A;  1KBC A;  3LIR A;  5BOY A;  2RJP A;  1XAX A;  2FV5 A;  4JP4 A;  1MNC A;  3GBO A;  2KRJ A;  1KUK A;  3U1R A;  2OXW A;  4JIJ A;  4H76 A;  3RTS A;  2SRT A;  4GWN A;  2Y6C A;  1G49 A;  3HDB A;  1D8F A;  1FM1 A;  1JIZ A;  1DTH A;  3LQ0 A;  5H8X A;  3Q2G A;  1PWW A;  2XS3 A;  1BM6 A;  2D1N A;  3TT4 A;  1BKC A;  5D1U A;  3OHL A;  3LMC A;  3CKI A;  4XBH A;  3WV2 A;  2OXZ A;  1GE7 A;  1YP1 A;  2L0R A;  2JNP A;  2MZI A;  4FXY P;  1GE6 A;  2A8H A;  1JIW P;  1Y0V A;  2K9C A;  3HYG A;  5I2Z A;  2HU6 A;  2V4B A;  1S4B P;  2YIG A;  3DTK A;  2POJ A;  1MMQ A;  4IJO A;  2Y6D A;  3LEA A;  4A7B A;  2ERO A;  3DSL A;  1JAQ A;  1I73 A;  4GUY A;  1G12 A;  1PWQ A;  1HFC A;  3L0T A;  2CKI A; 
#chains in the Genus database with same CATH homology
 1ATL A;  3KWV C;  3F16 A;  3EHY A;  3DTE A;  3KRY A;  4GF1 A;  1H71 P;  4H2E A;  5L79 A;  2XS4 A;  1MMR A;  1HOV A;  4XM6 A;  3KEK A;  2O3E A;  1R1J A;  4XCT A;  1ZXV A;  2J83 A;  2OW9 A;  3KEC A;  3LJT A;  1ZTQ A;  1XUR A;  2DW0 A;  2W14 A;  3NX7 A;  1SLN A;  1O0T A;  3LIL A;  2OW2 A;  2AYK A;  1UTT A;  4FXQ A;  3V96 B;  3E8R A;  2E3X A;  1C8T A;  1BQO A;  1IAC A;  1JH1 A;  1D5J A;  830C A;  2X3A A;  4FU4 A;  4PKV A;  3LK8 A;  1R54 A;  4CTH A;  3AYK A;  2JT6 A;  2QPJ A;  3LE9 A;  3N2U A;  2MLR A;  4XM8 A;  1OO9 A;  1XUC A;  2MZH A;  1AYK A;  1BKC I;  4XM7 A;  3N2V A;  1Q3A A;  1OM6 A;  3K7N A;  2WO8 A;  1ZP5 A;  4PKS A;  1D7X A;  2N8R A;  1CGL A;  2OW0 A;  3ELM A;  1OS2 A;  3OHO A;  4WK7 A;  1QIC A;  1GXD A;  1KUG A;  1SLM A;  4L7A A;  5B5P A;  3F1A A;  4WZV A;  3DWB A;  1QIA A;  1SMP A;  3F19 A;  1JKY A;  2OXU A;  1KUF A;  5D1T A;  2JT5 A;  2USN A;  4PKU A;  2JSD A;  3AYU A;  1L6J A;  3EWJ A;  1I1I P;  1K7G A;  1D8M A;  3KME A;  3ZVS A;  2MZE A;  5I12 A;  4H30 A;  1HFS A;  3DPE A;  4DPE A;  1RM8 A;  3K7L A;  1UMT A;  1G9K A;  1J7N A;  2TCL A;  2DW2 A;  1BKC E;  1BIW A;  3O64 A;  3P24 A;  1R1I A;  1GKD A;  1BUV M;  2I47 A;  4H82 A;  1JAN A;  4PKT A;  5JMY A;  4L63 A;  1USN A;  4PKW A;  2OY4 A;  2WO9 A;  3TS4 A;  1HY7 A;  4WKI A;  2DDY A;  1C3I A;  1UTZ A;  2DDF A;  1ND1 A;  5BOT A;  1BUD A;  1GO7 P;  4G0D A;  3DL1 A;  1QUA A;  2W0D A;  4PKQ A;  1SRP A;  2WOA A;  4WF6 A;  1JJ9 A;  1PWP A;  3O2X A;  1FLS A;  1YQY A;  3HY7 A;  3EDG A;  1GO8 P;  3G5C A;  3LUN A;  1IAD A;  4GR3 A;  3F15 A;  1EB6 A;  4FVL A;  1G4K A;  1IAE A;  4I03 A;  1OM8 A;  1R55 A;  3DNG A;  4GQL A;  1XFU A;  4H1Q A;  2YB9 A;  3L0V A;  4DV8 A;  1ROS A;  1XFX A;  2J0T A;  4DD8 A;  3WV3 A;  1HV5 A;  3HB2 P;  4AIG A;  3DPF A;  3I7G A;  1WNI A;  1OMJ A;  3EDZ A;  3USN A;  5D2B A;  5CXA A;  1JK3 A;  1A86 A;  1O0Q A;  3P1V A;  2OW1 A;  1JAP A;  4H3X A;  1KUH A;  1AF0 A;  1XUD A;  3Q2H A;  1CQR A;  3DTI A;  1SAT A;  4ON1 A;  1YCM A;  3BA0 A;  2ERQ A;  4ILW D;  3F18 A;  1G05 A;  1R1H A;  2OVX A;  3MA2 A;  5BPA A;  3VTG A;  5D3C A;  5I4O A;  4EFS A;  2OZR A;  3LGP A;  4HX3 A;  1CK7 A;  1CXV A;  3WV1 A;  3ZXH A;  5CUH A;  4H84 A;  1K7Q A;  1GKC A;  2AIG P;  4GWM A;  1IAG A;  1IAA A;  1XFZ A;  2W12 A;  3B92 A;  1EUB A;  3AIG A;  4PKR A;  1Y93 A;  3HBV P;  4GR8 A;  3EDI A;  5D1S A;  2E2D A;  5D7W A;  3ZUK A;  2JIH A;  5CZM A;  1B8Y A;  2FV9 A;  3RTT A;  3VI1 A;  1EAK A;  4G9L A;  1BSW A;  4DF9 A;  1CAQ A;  5I3M A;  2OI0 A;  1MMP A;  1BQQ M;  1ZS0 A;  4A3W A;  1XFV A;  1UEA A;  4L6T A;  1C7K A;  1AKL A;  1Z3J A;  1XFW A;  1PWV A;  3LUM A;  3SHI A;  3EHX A;  1SU3 A;  2O36 A;  1AST A;  4IN9 A;  1IAB A;  3UVC A;  1I76 A;  2X3C A;  1CGE A;  1OM7 A;  1XFY A;  5B5O A;  2RJQ A;  1YOU A;  1OS9 A;  4JQG A;  3TVC A;  4AXQ A;  1GE5 A;  456C A;  1BZS A;  4I35 A;  1A85 A;  2CLT A;  2Z2D A;  4ZR5 A;  3LQB A;  1JAO A;  2YUF A;  3LJZ A;  4QKZ A;  1QIB A;  5I0L A;  2K2G A;  3KHI A;  4IUW A;  2D1O A;  1ZXC A;  3B8Z A;  4JA1 A;  1ZVX A;  3HY9 A;  5LAB A;  1K7I A;  1UMS A;  2OVZ A;  2X3B A;  3LJG A;  3HDA P;  4AUO A;  3HBU P;  1Y8J A;  2ERP A;  4R3V A;  1KAP P;  4JPA A;  1RMZ A;  1CGF A;  1QJI A;  1QJJ A;  5I43 A;  4Q1L A;  3KMC A;  1MMB A;  2DW1 A;  2W15 A;  1FBL A;  4GR0 A;  2MLS A;  2PJT A;  4WKE A;  3B2Z A;  966C A;  1DMT A;  1KUI A;  4AYK A;  2OY2 A;  3LIK A;  2X7M A;  4L19 A;  1B3D A;  2W13 A;  3EDH A;  3I7I A;  4H49 A;  1CIZ A;  5L7F A;  4HMA A;  4J4M A;  1HTD A;  3LKA A;  3KEJ A;  3TSK A;  3G42 A;  1PWU A;  3F17 A;  1KBC A;  3LIR A;  5BOY A;  2RJP A;  2FV5 A;  4JP4 A;  1MNC A;  3GBO A;  2KRJ A;  1KUK A;  3U1R A;  2OXW A;  4JIJ A;  4H76 A;  3RTS A;  2SRT A;  4GWN A;  2Y6C A;  1G49 A;  3HDB A;  1D8F A;  1FM1 A;  1JIZ A;  1DTH A;  3LQ0 A;  5H8X A;  3Q2G A;  1PWW A;  2XS3 A;  1BM6 A;  2D1N A;  3TT4 A;  1BKC A;  5D1U A;  3OHL A;  3LMC A;  3CKI A;  4XBH A;  3WV2 A;  2OXZ A;  1GE7 A;  1YP1 A;  2L0R A;  2JNP A;  2MZI A;  4FXY P;  1GE6 A;  2A8H A;  1JIW P;  1Y0V A;  2K9C A;  3HYG A;  5I2Z A;  2HU6 A;  2V4B A;  1S4B P;  2YIG A;  3DTK A;  2POJ A;  1MMQ A;  4IJO A;  2Y6D A;  3LEA A;  4A7B A;  2ERO A;  3DSL A;  1JAQ A;  1I73 A;  4GUY A;  1G12 A;  1PWQ A;  1HFC A;  3L0T A;  2CKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...