1GFCA

Solution structure and ligand-binding site of the c-terminal sh3 domain of grb2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
GSTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and ligand-binding site of the carboxy-terminal SH3 domain of GRB2.
pubmed doi rcsb
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
source organism Homo sapiens
molecule tags Adaptor protein containing sh2 and sh3
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1994-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gfcA00
1E7OA 1JXOA 2DA9A 1WX6A 2G6FX 2O2OA 1G83A 2K6DA 3TSWA 1K76A 2EYXA 1QWFA 2E5KA 1RLPC 1FMKA 1PWTA 2KRNA 1LCKA 1ZX6A 1KJWA 5IXFA 2W10A 4HXJA 1YP5A 2K79A 2SEMA 1OPLA 2JTEA 2RF0A 4LNPA 1GFCA 1SSHA 2JMAA 1BBZA 4OMPA 2AZVA 4KRTA 2MIOA 4FSSA 4AG1C 1AZEA 1M3BA 1YWPA 2J6KA 2LP5A 2K3BA 5IHIA 4IIOA 2FG0A 1PHTA 2KR3A 1X2QA 2KNBB 1ZLMA 2BZ8A 1G2BA 2DE0X 2FRWA 1OPKA 2ED1A 1TUCA 1RI9A 2RMOA 2D8HA 3TVTA 5IH2A 2DILA 1CKAA 1WA7A 4K11A 2IIMA 4OMOA 2FEIA 2YUNA 1MUZA 2LZ6B 1AWWA 1GBQA 1PRLC 2EVRA 1IO6A 1WYXA 2ENMA 4Z89A 2ESWA 1W70A 2LMJA 3U23A 3PE0A 4JJCA 2EGCA 4QT7A 4F17A 2YUQA 3A98A 4AG2C 4CC3A 4ZNXA 3PVQA 1X2KA 4DEYA 2H8HA 2DBKA 1GL5A 1X69A 3REBB 2D0NA 1UECA 4JPBW 2CH4W 2W0ZA 2J6FA 3UA7A 2ROTA 2A37A 2EW3A 5GJVB 2YDLA 1WFWA 3LH5A 2GQIA 1JU5C 2DBMA 1MV0B 3CQTA 4RTZA 2JM8A 2KE9A 1U5SA 4AFUC 1EFNA 1ABQA 2FPDA 3C0CA 3PVLA 2C0IA 3I5RA 1UDLA 1AWJA 1VYVA 2M0YA 3VS1A 2RNAA 1T3LA 2YUOA 4HVWA 4DEXA 1WLPB 1B07A 2CDTA 1ARKA 1GFDA 1UJYA 2LJ3A 1GCQA 2DM1A 1ZUKA 1WDXA 1SEMA 3ULRB 1GCQC 4E6RA 3M0UA 2K9GA 1M8MA 2DL3A 2AZSA 4Z8AA 5I22A 3RBBB 4J9FA 3EG0A 2L0AA 2CSQA 4RTTA 2CT3A 2JS2A 3NGPA 1JXMA 3QWXX 1X43A 1ZBJA 2DF6A 2ABLA 1HD3A 1Z9QA 1UHFA 4F16A 2RQVA 1K4US 2AKLA 1GBRA 2HEQA 1BB9A 1TUDA 1B3QA 2LX7A 4J9IA 1NYGA 4AFZC 2DL4A 4JZ4A 1RUWA 2J7IA 2EPDA 2J6OA 2DX1A 4RTYA 2FPFA 2L3SA 1AEYA 1PNJA 2FO0A 2F2VA 1X6GA 1M3CA 2D1XA 4LE9A 2FPEA 1QWEA 1K9AA 2DL7A 3JV3A 2F2WA 2NUZA 1BU1A 2K2MA 2VVKA 2BZYA 4WCIA 3TSZA 4F14A 1AZGB 2RPNA 5IXBA 2LQNA 3SEMA 1K0SA 3EGUA 2KYBA 4JZ3A 1S1NA 1Z9ZA 3VRYA 2K7AA 2RQWA 2KRMA 1E6GA 2OI3A 4J9HA 1YN8A 4R0KA 1AOJA 1NEGA 2F2XA 4Z88A 1CKBA 4D8DA 1KIKA 1UTIA 4OMNA 2CH4A 1V1CA 2J05A 1ZSGA 2GGRA 4AFSC 4RTUA 2EYWA 1K1ZA 2KEAA 2ROLA 5HCKA 2C0OA 2JXBA 2L2PA 1KFZA 3EHRA 3M0TA 4RTVA 1FYNA 1SPKA 2DYBA 3I5SA 1SRMA 3H0IA 3M0QA 2DL5A 2BZXA 2AK5A 1XOVA 4M4ZA 2RQTA 4CC4B 1H8KA 1N5ZA 1T0JA 3I9QA 4J9GA 3VRZA 2HSPA 2YSQA 2DRMA 2GNCA 2B86A 2I0NA 1AWXA 2EYZA 1M30A 1ZUUA 1NM7A 2SRCA 3O5ZA 4ORZA 5EC7A 4EIKA 1NLOC 1WXTA 2PTKA 4RUGA 4GBQA 1ABOA 2KYMA 5FWCA 2EBPA 2EGEA 3VS2A 1NG2A 4HVVA 1GCPA 1UG1A 1SHGA 2CUDA 1SRLA 1QCFA 2X3WD 1J3TA 3M0RA 3KFVA 1Y0MA 2CSIA 4RTXA 3VS7A 4RTWA 2X3XD 1OOTA 2KT1A 2KXDA 3THKA 2LNHB 4AFQC 5ECAA 3VS5A 3EG3A 4OMQA 1X27A 2A36A 1OV3A 2L3QA 2QDLA 3H41A 3VS0A 2RQUA 2KBTA 4Y92A 4D8KA 2RQRA 2O9VA 3REAB 1I0CA 2KRSA 2PNIA 3IQLA 2DLPA 3UF4A 1UE9A 1YNZA 2AKKA 2VKNA 2OAWA 3I35A 4HCKA 2CT4A 2O9SA 4LN2A 2M51A 1AVZC 3EG2A 4JJBA 3UATA 2DJQA 3QWYA 4LUEA 1I07A 3H0HA 4A63B 5I11A 1JO8A 1HSQA 3FJ5A 5FW9A 2KROA 1WIEA 5IHNA 2LJ0A 3R6NA 2RN8A 1M3AA 2EGAA 1OEBA 1PKTA 1WI7A 1VYUA 2CUBA 2JM9A 1QLYA 4ESRA 2J06A 2OJ2A 4X1VA 2A28A 3UA6A 3RNJA 3SHWA 1K0XA 4JJDA 1X6BA 4HVUA 2L3PA 1QKXA 2GTJA 2JT4A 1UJ0A 2O88A 1MV3A 1E6HA 1H92A 2GBQA 2MOXA 1KSWA 1UUEA 4J9EA 2JS0A 4J9CA 4IIMA 5FWBA 3NHNA 4GLMA 1PRMC 1YWOA 1ZUYA 1T0HA 2YT6A 4J9BA 1JEGA 1W6XA 2KGTA 1PKSA 1NEBA 2YUPA 1M27C 1U06A 2GTOA 2JW4A 1NLPC 3GBQA 1CSKA 1TG0A 1JQQA 1H3HA 1T3SA 1VA7A 2P4RA 2DRKA 1RLQC 1BK2A 3M0PA 4J9DA 2A08A 2O31A 1UHCA 5L23A 1QKWA 2NWMA 3VS3A 2DL8A 2ED0A 1SHFA 4CC2A 1I1JA 2V1RA 2XMFA 2DVJA 2PZ1A 2EKHA 2HCKA 2KXCA 1HJDA 2HDAA 4CC7A 1GRIA 2V1QA 2CREA 2JMCA 1A0NB 1VYTA 1AD5A 2C0TA 3NPFA 2KT8A 4OMLA 1U3OA 1W1FA 2EYYA 3M0SA 1NYFA 1AWOA 3ZL7C 4OMMA 3EHQA 2DMOA 3NMZC 2HBWA 2BTTA 1WXBA 3H0FA 2VWFA 2D8JA 5IHKA 1Y57A 2EQIA 3VS4A 5GJWB 2LCSA 2FRYA 4LUDA 2LQWA 3EG1A 2MCNA 1UFFA 2LJ1A 1YCSB 3VS6A 1UGVA 1WXUA 2ECZA 2DNUA
chains in the Genus database with same CATH superfamily
3S3NA 2DD4A 3AHUA 2DA9A 2DFUA 3OSVA 2O2OA 3CD6A 1G3WA 1LJOA 4IUTA 1PWTA 4BY6B 1ZX6A 2W10A 4M77F 3J80E 4JS5A 1QVFP 3MKDA 3X26B 1Q7YR 4BD3A 3S3MA 2Y4YA 2RF0A 1GFCA 3G71Q 1SSHA 2JMAA 2YRCA 2K3YA 5I21A 3EGXB 4FSSA 2ZGWA 1D1AA 1MMDA 4PJOC 1AZEA 1YWPA 2J6KA 2FB7A 2LP5A 2K3BA 5IHIA 4IIOA 3CC4T 1R0CB 3GPLA 1K8AU 1PHTA 1X6OA 5CCAA 2BZ8A 3QHSA 1ZA1B 2FRWA 1DJ7B 4X9CA 1RI9A 2LC4A 3CC7T 2XDBA 1AHJB 2RMOA 3CCEA 5IH2A 1M1KR 2DILA 4BY6C 3QDFA 4R56A 2LT4A 1BCOA 1YJ9Q 4B6MA 1W70A 1RADB 2YUQA 4A4KA 1K8AC 7AT1B 4V2SA 4Q5WA 1I5LA 4ZNXA 5GMKm 2H8HA 3JB9F 3QPHA 5D7UA 2HBPA 3E19A 1QP3A 3OYNA 2MAMA 2J6FA 3OW2A 2JUFA 6AT1B 1YI2Q 4M7DF 3EFOB 9ATCB 3CCUQ 2A37A 1M9SA 2EW3A 2YDLA 4F7UB 3OS1A 2E64A 2NUTB 1JU5C 4M78F 1Q81U 4DBQA 4AFUC 2E5QA 4DOWA 1ABQA 2HQHA 1UDLA 1AWJA 3CD6Q 2CKKA 3VS1A 1WQ7A 4LD9K 4C5GA 1IRXA 3T9NA 1WLPB 1BI0A 4TVRA 3L2WA 4OB1B 2XIDA 5FRMA 4MZTA 1O75A 2RJCA 1RAEB 1GCQC 3M59A 2H3JA 1VQLA 1RI0A 4FYWB 2AZSA 2M16A 3CMEQ 1QVGA 3NTKA 4MZPA 1VQKA 2ZPGB 4J5YA 3EG0A 4N0AC 3WXMB 1K9MC 5CVIA 1M90U 3CCQA 2E70A 1NE8A 2YXYA 2CT3A 3WVDB 2D9TA 3M58A 3QWXX 4JRKA 2DF6A 3LYIA 1OZ2A 3A8LB 4F16A 1PC0A 5LJ5h 1M5Q1 1KC8U 1D09B 3V8LA 1KHCA 3CCEQ 4C8QA 2IPOB 4AFZC 2V8KA 2J7IA 4JS4A 2V26A 2XU8A 2RJDA 4QQDA 3QZ9B 3JSCA 1KQSA 1K8AR 5LJ5f 2XICA 4BDZA 2D1XA 2JZ2A 4QKUA 4M7AA 2X35A 1QVPA 4LDYA 2LVMA 3OYKA 4C92A 3H9NA 4FL6A 4F14A 3TSZA 5HKCA 3NTIA 1AZGB 2F1LA 4M7AE 2LQNA 3EGUA 1S1NA 2RQWA 4JJNK 2EQUA 3L2ZA 2H3EB 4BACA 4LDVA 2LX9A 2LCCA 1AOJA 1PD1A 2OAUA 4E7SA 4Z88A 2X51A 4D8DA 1KIKA 1UTIA 4N4HA 1V1CA 3OYJA 2FZCB 1OQKA 2GQVA 4AFSC 4DQ2A 4RTUA 2EYWA 1VQ6T 5LJ3e 2D0QB 2KEAA 3CPWA 2C0OA 2JXBA 1NJIC 3M0TA 4M75E 2CZ0B 4OB2B 1SRMA 1TXQA 3H0IA 4OF1A 4A4EA 4X9DA 4C0FA 2OTJA 1QCOA 2BZXA 2E10A 1XOVA 1IREB 4M4ZA 3L2RA 4HT8A 1H8KA 1N5ZA 3I9QA 4MMLA 3SB2A 3CPFA 1VQKQ 5LJ3h 2CGHA 2GNCA 2MK5A 5GANe 2I0NA 3CCQQ 1VQ8T 2OTLT 1NLOC 4OVAA 3C12A 2EBPA 2EGEA 5M9OA 3C4SA 1VIFA 1GCPA 2JVVA 5L8RE 2P4TA 3M0RA 1LNXA 1Y0MA 1M1FA 5GAOn 3E9GA 4RTWA 2XDDA 1OOTA 2KY9A 2KT1A 3THKA 1YITT 2VV5A 3VS5A 4A4GA 2QEXQ 1TUGB 2L3QA 2P84A 2QDLA 1M90R 4E2FB 1VQ9Q 2QK0A 4Y92A 4D8KA 1UGQB 2RQRA 1K73U 2E3IA 2KRSA 3IQLA 3X28B 4BDYA 2PQWA 1UE9A 2COZA 4BE2A 1YNZA 2AKKA 1VQ4A 4JJBA 3EG2A 5LJ5d 2E65A 2ZPBB 1KC8R 4A63B 3S6WA 5I11A 1SF9A 3OS2A 1G3SA 1G8XA 4UC4A 4FT2A 4C92F 1WIEA 5CKBA 3R6NA 3V7RA 2K57A 2HL3A 3OS0A 2CUBA 4II1A 5LL6S 1QLYA 4ESRA 2RA2A 2A28A 2GCXA 2QQSA 3UA6A 1NJIR 2ZAEA 3RNJA 2HKNA 1I4K1 3V7CA 1K0XA 4FYVB 2L3PA 4JRQA 1QKXA 1Y96A 5KYXA 2JT4A 1UJ0A 2O88A 2B8AA 2YLBA 2OTJQ 1XNIA 1C6VX 4IIMA 4NOYA 5GAN5 4ZGJB 4PFOA 1PRMC 1YWOA 3KBGA 2QQBA 1QP2A 4M75G 4BI4A 1JEGA 4YTLA 3OSSC 2YUPA 2GTOA 2MPXC 3GBQA 1TOVA 3OMGA 1OYXA 2HAXA 1WJQA 1Q86U 4QQGA 1TG0A 2EJFA 4XK8E 3GLXA 1JQQA 3L1AA 3LGFA 2DRKA 5LJ5j 1BK2A 1KK7A 3Q1JA 4J9DA 4X34A 2DL8A 2ED0A 3TEEA 2DYIA 1VOMA 4ZN3A 1SHFA 5LJ3d 1BIBA 3OYIA 4CC2A 1I1JA 1W2BS 2XMFA 2FL7A 3G4ST 2EKHA 1IGUA 2RD1A 2HDAA 1JB0E 2PU9B 2CREA 3HSBA 2QQAA 1A0NB 5KH6A 3OYHA 3EGDA 1NZ9A 1ZA2B 3M0SA 1NYFA 2DJZA 5IT9E 3ZL7C 2WSFE 5KCHA 3EHQA 1SG5A 1YHQT 3PMTA 2HBWA 2BTTA 1WXBA 3D7SB 2VWFA 2D8JA 2CYZB 1D0XA 2LCSA 4C8QB 2FRYA 2QQ9A 5GMKh 3CC7Q 1YCSB 5DY9A 4J6WA 2G6FX 4M7AB 1VQMT 1M4ZA 5LJ3g 4PJOG 1JJ2A 3R6OA 1TH7A 3QIIA 2WSCE 3PT9A 1VQLT 1LPLA 1QWFA 1RABB 1LCKA 1KG1A 1Y7XA 4PKCC 1YP5A 3OBWA 2CP5A 1OPLA 4EMKA 4M77A 4BE1A 2DXBA 2XD0A 4DA4A 3TU4K 4R55A 1XQHA 2VASA 1M3BA 5GANg 1M8VA 4M75B 2CZ1B 4C8QC 1I8FA 2PUKB 4KBMB 4M75D 2CP0A 1WHKA 4D6WA 4RCBA 3CCSA 4AT1B 2KNBB 1ZLMA 3MO8A 1PG5B 1OU9A 2DE0X 1I81A 1ZSZB 4M7AC 2ED1A 1TUCA 2D8HA 4PFZA 4ZGDB 3M56A 5C0MA 2MYSA 1MNEA 4KGZB 5GAMg 2FEIA 2QTVA 2RHZA 2LZ6B 1AWWA 4Y91A 1M1GA 1WYXA 2LQ8A 2LMJA 3U23A 1AT1B 4JJCA 3FB9A 5GAOl 4QT7A 3VYGA 5CR2A 2RK2A 4DEYA 3RDVA 3HRUA 5D6XA 1IB8A 2HQEA 4M75C 4BI8B 2D0NA 2OTLA 4N4IA 4E7JA 3BFMA 1G3TA 4E7ZA 4WF2A 3OW2P 5GJVB 1WFWA 3EFSA 3E2UA 4M7DA 1ZSZC 1VQ5T 4LDUA 4RTZA 1TWBA 2JM8A 3G6EA 4PJLA 1YITA 4L59A 2XDPA 4M78A 4LDXA 2ZCFB 3LWHA 4C0ZA 4C5IA 4C0GA 1ZQ1A 4M7DE 2OTJT 4OGCA 2M0YA 1T3LA 2YUOA 1JRIA 4HVWA 4M78E 3M53A 4F7UG 2X4WA 1B07A 1ARKA 1KD1C 2LJ3A 1BCMA 1HK9A 2ZPHB 4OMFB 2ZPFB 4KULA 4E6RA 3JCMX 3M0UA 1YBYA 1M8MA 2QTXA 2DL3A 1P92A 4XTUA 5CAIA 2LCLA 5D6WA 1B7TA 1TSFA 3RBBB 1UGRB 2L0AA 3MJXA 2WSEE 1IHVA 2JS2A 2A0FB 3M9QA 3CMAT 1ZBJA 3E1SA 4GY5A 2ABLA 3P8HA 1Y96B 1VQ6Q 1K4US 1QCNA 2ZPIB 3FDRA 2XHCA 1BB9A 3FC3A 1TUDA 1B3QA 4IKFA 4DBFA 2V8JA 4JZ4A 1VQ4T 4EDUA 2JN0A 1WPYA 2DX1A 4KT0E 3EG9A 1AEYA 1PNJA 2FO0A 1RL2A 2F2VA 5HK3A 1BIAA 4J7IA 5KYUA 2XG8D 1K9AA 2QQRA 1UGSB 3JV3A 3EH2A 3P8DA 2VVKA 2BZYA 4WCIA 3CCRT 2RPNA 1VQ8Q 3ZEHA 5IXBA 2OTLQ 2M0OA 3SEMA 1W2BP 1K0SA 3EH1A 1MMNA 1Z9ZA 4ELZC 5J39A 2EYQA 5GMKj 4QQ6A 2P0QA 2G3RA 3OYMA 2DZCA 1E6GA 5GAN7 3RUXA 2OI3A 2MF2A 1NEGA 1N8RU 3GNGA 1YITQ 2J05A 3G4SA 4VUBA 1N6AA 5HCKA 1KD1R 5GAOp 4RTVA 2VUBA 3CPWP 2DYBA 3UWNA 2RO0A 3H8ZA 1YHQA 2X9HA 3CCLT 3MHXA 3C95A 3SWNA 3OYEA 4FIBA 5DLQE 5GAN6 2HSPA 3MEUA 3JB9H 1B34B 1AWXA 1M30A 3VYHB 4WTOB 3MCAB 2SRCA 2MWOA 4EIKA 1OZ3A 2PTKA 4RUGA 5D6YA 2XK0A 2DPPB 4XU2A 2R5MA 4MDXA 3VJPA 1VQMA 5CKDA 3I56T 1UG1A 1SHGA 1Q81C 1PD0A 1YCYA 3L2UA 3KFVA 1VQOT 4RTXA 3VS7A 1VQ7T 2RI3A 2BE7D 1ACMB 2KXDA 4M77B 2O4XA 5HK0A 3CCVA 5KYWA 3OYGA 2RQUA 2KBTA 2COWA 4XTYA 1F1BB 2O9VA 2PNIA 4DBHA 1NPRA 3CEYA 8AT1B 2JTFA 1U8RA 3RESA 3HP9A 3JB9I 5A0LA 1AVZC 3UATA 1S72T 4BB7A 2F5KA 2GF7A 4AMCA 3M54A 5KYYB 3H0HA 1PSEA 1KQ1A 1IHWA 4NS5A 1WHJA 2KSSA 2MI6A 3DB3A 1G3YA 3OYDA 4C8QE 1M90C 3BW1A 1Y71A 2K5FA 3V7SA 1PKTA 4EMKC 1LVKA 4M77C 2JM9A 3G4SQ 2DERA 2OJ2A 2EQKA 3URGA 2VYTA 2P0KA 4C92E 1KC8C 2GTJA 2OX7A 1NBEB 2GBQA 3PTAA 3KXTA 3M5AA 4J9EA 1VQPT 3NHNA 4GLMA 4BUGA 1VQNA 1YHQQ 3J7AF 2RHYA 1ZUYA 4M7DB 3PIPA 3CCST 4XU1A 4M7DD 2QASA 3MEAA 3VUZA 5CIUA 3QJ6A 3QXEB 3BY7A 4M78B 1VQ5A 3FEOA 1U06A 3GIBA 2JW4A 1NLPC 2QGFB 4M78D 2PUOB 5FRNA 4BE0A 4NL2A 3QZ5B 2P4RA 2L89A 1M2OA 2KMTA 2C06A 3CBMA 1VQMQ 1Q81R 2D6FA 1VQLQ 1GXIE 1SKUB 2EAYA 1YJWA 1MNDA 4O6JA 2NWMA 2RHXA 2LDMA 2E6NA 3OQ5A 2I2LA 1WHHA 3HL8A 1MHNA 2DVJA 3UT1A 5KE3A 4OGEA 4HT9A 3CCJA 2RM4A 4M7DC 3L2QA 1WGSA 5LJ3f 2RHIA 5KYNA 2C0TA 3LH0A 2QA4T 2QDYB 4ELYC 1U3OA 2DXTA 3PMIA 3JCMV 4M78C 4HCCA 3JCMc 4OMMA 3G6ET 2RK1A 3A5ZB 3CMAA 1YIJT 5CK9A 5GANh 3L2VA 3OYAA 2RB6A 4PL6A 3H0FA 5GAMe 1Y57A 2EQIA 2YHTA 5GJWB 5CQXA 3OW2S 4ME7A 4MDWA 1UFFA 1UGVA 4JRPA 5GANf 2EJGA 3EG9B 3EAEA 1JXOA 1D1CA 1Q82U 1YFNA 2AIRB 4E7IA 5KYUB 2QG9B 2K6DA 3TSWA 1K76A 1RLPC 5GAMh 4C8QG 4HA8A 2KRNA 1KJWA 3DLMA 2K4YA 3ZFJA 1W4SA 2RH2A 2K79A 3GP8A 2SEMA 2JTEA 1QW1A 3CCRA 2MMPA 5GAMf 1K73C 4M7AG 2DTIA 5I2MA 4KGVB 4C92G 4IURA 5GMKl 5FU7B 1R77A 3J81E 1Y07A 1QVGS 1VQ5Q 2FG0A 2KR3A 1X2QA 4J6YA 4MMKA 4PJNA 3JCMQ 4E7HA 4EPCA 1G2BA 1JBMA 2VGNA 1OPKA 3FLGA 3TVTA 1QMCA 4EMGA 1CKAA 4JRIA 2IIMA 1Q95G 1GBQA 3SWNB 2EVRA 4KH1B 1IO6A 2EQJA 3CCLA 1FXXA 3RKWA 2EGCA 1M2VA 3DKMA 4F17A 5GAOr 3P8BB 4AG2C 1KQSS 1MGQA 1X2KA 2V8IA 2X4JA 4XTWA 3CC2A 2X4XA 2DBKA 5FU7C 1X69A 2PVGB 4LDWA 1C1AA 1UECA 2VXEA 3CMAQ 2VB6A 3I56A 4XAXB 2ATCB 4JLGA 1WHGA 1D0ZA 2DAQA 1N9RA 1MV0B 5CKFA 5DLOA 1VQOA 4OB0B 1VQ7A 2ZPEB 1Q86C 3I55T 5KYWB 1EFNA 1WZOA 3CXCA 1VQ4Q 2FPDA 1ZHIA 3PVLA 3OYYA 2C0IA 4E47A 1OULA 3RMQA 1VYVA 3SWNC 2RNAA 2EQMA 5GANd 4DEXA 3SFMA 2E6ZA 3L42A 3FIFA 1GFDA 1UJYA 2FZGB 3CPWS 1GCQA 5FROA 1S72A 2E4HA 4C8QD 1WDXA 1SEMA 1K73R 3CCRQ 3CBOA 3BDUA 4XQ3A 2K9GA 2DEQA 4N0AA 4Z8AA 5I22A 2LQKA 2CP2A 1Q82R 1C0MA 2CSQA 4M7AD 4C92B 5GAMd 4C92D 4RTTA 3A1PA 1D3BA 2P0PA 3NGPA 1TTHB 1JXMA 1X43A 2EKOA 3PFSA 4PJOF 1HD3A 3CCVT 4DBRA 1UHFA 5LJ3j 4C5EA 1GBRA 1RAFB 4B9XA 2HEQA 4XU0A 2Y4XA 2LX7A 4PNOA 3KUFA 3JCMe 1RUWA 1H3ZA 4M77E 4ZN1A 2EPDA 5GAN4 1VQPA 1Q7YU 2J6OA 4RTYA 2FPFA 3CCLQ 3HRSA 5GAN3 1WJSA 4KUDK 1EZZB 1PCXA 1QWEA 1OX9A 5GANj 3OB9A 1U1TA 4C92C 4BI3A 5A0GA 3JCMh 4JZ3A 2KRMA 2KVQG 2CS7A 3I56Q 4J9HA 1UGPB 3A8MB 1YN8A 4R0KA 1Q86R 2JNGA 3G71A 1VQOQ 5A0DA 2DEUA 1VQ7Q 2BKDN 2F69A 4N4GA 5GAMj 4ZTJA 2CH4A 1M1KU 3QDRB 2L8DA 2A3LA 1ZSGA 2GGRA 1K1ZA 1KFZA 2L2PA 1VQNT 3EHRA 3SDZA 3I5SA 3O8VA 3PNWC 3M57A 2QA4A 2NUPA 3M0QA 2R5AA 3M4GA 2AK5A 1S72Q 2DD5A 2FVUA 4CC4B 3JCMW 1YIJA 1T0JA 4J9GA 2HL5C 3VRZA 2MWPA 5CKHA 2BIVA 1KHIA 4B9WA 1YJWT 1ZUUA 1NM7A 3O5ZA 4ORZA 3QO3A 2BUDA 1WXTA 2A7YA 4ZTFA 4GBQA 2QAZA 2DTHA 2HMAA 2KYMA 5AT1B 2RI2A 1NG2A 4F7UF 5KCOA 4PLLA 1RAAB 1J3TA 3MEVA 3CCJT 2X3XD 2LNVA 1QVGP 3JAME 5ECAA 1YI2A 2DXCA 3WVEB 3QSUA 4OMQA 3CCUA 1QQJA 1D1BA 2A36A 1VQPQ 3H41A 3RIRA 3HTRA 5A2QE 5FLXE 3REAB 2PVDB 1I0CA 3UF4A 3CCSQ 1RAGB 4QVZA 4XTXA 1OI1A 2VKNA 2OAWA 3I35A 4HCKA 4LN2A 4FYXB 4QVCA 2M51A 5KYXB 4M77G 1MMAA 5CQYA 1OU8A 3CXCS 3QWYA 4J8OA 4LXCA 4LUEA 1JO8A 1HSQA 2YLCA 3RKYA 3OYBA 4FW1A 2DTOA 5IHNA 1KQSP 2LJ0A 2RN8A 1M3AA 1OEBA 3CMEA 1M2VB 4FM4B 2DETA 2J06A 3QJYA 4X1VA 4ATOA 1V29B 3JCMd 2DXUA 3GNFB 3SHWA 4J6XA 4HVUA 1JJ2S 3GF5A 2QA4Q 1E6HA 1H92A 2CP3A 2MOXA 4HKEA 1KSWA 2EFIA 2JS0A 4J9CA 4QW2A 5FWBA 3MEWA 3G6EQ 1TU0B 2RJFA 2XI9A 2RI5A 2KI7A 1YIJQ 2O01E 1OX8A 4O5VA 2YT6A 2RHUA 4J9BA 3EGDB 2KGTA 4LD6A 1PKSA 3OBYA 1M27C 2E41A 3I55A 3JB9G 1CSKA 2L5QA 1VA7A 2GFAA 3JCMP 1WQWA 2CP7A 4M7DG 3M0PA 2A08A 2O31A 1UHCA 5L23A 4RCCA 3VS3A 1N8RC 2ZZDA 4M78G 5KE2A 3JCMg 3EFRA 2V1RA 3OA6A 3CC2T 3LX7A 2PZ1A 1XTDA 2KXCA 2YRVA 4A54A 1GRIA 1R8OB 3QYHB 2JMCA 1VYTA 2LRQA 2K5LA 1AD5A 1PM3A 5DM7R 1K9MU 3NPFA 1D3BB 2KT8A 4OMLA 1W1FA 4GLKA 1AWOA 2DIQA 3OS5A 3NMZC 3CBPA 4EMKB 8ATCB 3G1JA 1O9SA 3X24B 4M77D 3VS4A 4PK4A 3OYCA 4FU6A 4LUDA 3OMCA 3EG1A 2MCNA 4HCZA 1WXUA 2ECZA 2DNUA 1E7OA 1BYMA 2R57A 3GOXA 5LJ5e 1WX6A 1G83A 1YJNT 2EYXA 2E5KA 2QI2A 1FMKA 1QVFA 5IXFA 4DOVA 3RKXA 4PJMA 4HXJA 1UB4A 3MP6A 4LNPA 4E7LA 4L6V5 3V8JA 3ASKA 1BBZA 1BI2A 2AZVA 4KRTA 4OMPA 5I2SA 2QYZA 2MIOA 3VU3C 4AG1C 4ANJA 1RACB 2QEXA 2M9UA 4KGXB 5GAN2 1XJWB 1VQ9A 3I55Q 5C6SA 3X25B 3AT1B 2LTOA 2NLUA 4FSXA 5GAN8 3TQ7P 4JLIA 1BI3A 2CZ7B 3JB9D 2K5IA 1N8RR 3PGGA 1SSFA 2NUPB 2FZKB 1VIEA 1NJIU 1W2BA 3HRTA 3A8GB 3RR6A 4J7FA 1BKBA 1IZ6A 1WA7A 2HZYA 4K11A 2EWNA 4OMOA 2LT1A 2YUNA 1MUZA 4E7KA 2R58A 1PRLC 2DK3A 3JB9J 2ENMA 4Z89A 2ESWA 1WJRA 3PE0A 3G7ZA 5CKEA 3A98A 4CC3A 3UPUA 2Z0WA 3BE3A 4EMHA 3PVQA 4M75A 3PIOA 3VUBA 1GL5A 4JDSA 2K2VA 3REBB 4C5HA 3OYLA 3G71T 4IUQA 4JPBW 2CH4W 3CCMA 2W0ZA 4L5GA 3UA7A 2ROTA 1ZSZA 3V8KA 3CCVQ 2JJ9A 3LH5A 4ZGEB 2GQIA 1KQ2A 2DBMA 3CQTA 1LOJA 2KE9A 1U5SA 3LLRA 2KK4A 3LW5E 1VUBA 4PFPA 3C0CA 2DKGA 1K9MR 3I5RA 3CXCP 4KUIA 3A8HB 5GAOm 3E9FA 1FMVA 2CDTA 3QUIA 1RAIB 4NL3A 2DM1A 2HNIA 4HCBA 3NTHA 1ZUKA 3ULRB 1YJ9T 2RJEA 2QGGA 3VKIA 4FW2A 2HSEB 4J9FA 2XKOC 2YWWA 3QBYA 5J26A 1H641 1JJ2P 2CP6A 3TCJA 1YI2T 5GMKi 3CCUT 1Z9QA 3TREA 4C8QF 2RQVA 2AKLA 2IVWA 5EG2A 3CC4A 1VQNQ 4PJOA 2FYKA 3MPUB 2JTMA 4J9IA 1NYGA 1FWZA 3QG1A 3ZBDA 2DL4A 4CI0C 1FX7A 1Q82C 4RG2A 2L3SA 4M7AF 3CD6T 4PJOE 1U1SA 3CC7A 3META 4KH0B 1X6GA 1M3CA 2AT1B 3SD4A 4LE9A 4A53A 2FPEA 1X01A 2DL7A 4XTVA 2F2WA 2NUZA 1BU1A 2K2MA 1YJWQ 4OB3B 5CO7A 2K3XA 1EX4A 2KYBA 3CCMQ 1MMGA 2K7AA 3VRYA 3CMET 4FCYA 2M1HA 2EIFA 1QVFS 3EGXA 4M75F 3HFOA 3JCMb 3OYFA 3CCJQ 5HY6A 2L3RA 1CKBA 1WNLA 3S3OA 1IGQA 4OMNA 2IG0A 5LJ5g 4Y28E 4IUUA 4OP0A 2HKQB 2DIGA 3F70A 2VXFA 3FRNA 2ROLA 1I5OB 4IUPA 1FYNA 1N27A 1SPKA 3CCET 1V76A 4RKUE 2DL5A 1EIFA 2O4XB 2DZ9A 4RG8A 2RQTA 3ME9A 2Y90A 3RERA 2YSQA 2DRMA 2B86A 2GFUA 2EYZA 2YRDA 3MP1A 3C94A 5EC7A 3QKJA 1ABOA 5GMKe 5FWCA 2KAFA 3VS2A 1HXDA 4HVVA 2CUDA 1YJNA 1SRLA 3H6ZA 1QCFA 2X3WD 3EFOA 3CC4Q 2CSIA 3JRZA 2WACA 4F7UA 3HPWA 5FU6B 2LNHB 2NUTA 4AFQC 1PSFA 3EG3A 2EJ9A 1X27A 4PLIA 1OV3A 4C0DB 3VS0A 2DO3A 4F7UE 2DVEA 4A4FA 2DLPA 1R0BG 3LWIA 4QVDA 2JOYA 1B34A 2CT4A 2O9SA 2M02A 2DJQA 3DB4A 4RMOA 5IAYA 1I07A 3DLLA 2E12A 3FJ5A 1VQKT 1BI1A 5FW9A 2KROA 3LGLA 3OY9A 3CCQT 1G5VA 3BDLA 4CRIA 2EGAA 1HYOA 1NPPA 1WI7A 1VYUA 5FU6C 3CC2Q 3NFCA 1D0YA 3VV0A 4C0DC 3HFNA 1UEBA 3M55A 3X20B 1IXDA 4JJDA 5IN1A 2KQWA 1X6BA 4J83A 1MV3A 2COYA 3HKSA 1UUEA 3INZA 3RMSA 2QEXT 1Q7YC 5KYYA 3JCMf 2AHJB 2BE9B 1VQ6A 3JCMJ 1VQ9T 2HQXA 1WHLA 5GAOq 3HHTB 2VGMA 1T0HA 1TS9A 4A4HA 1W6XA 3QYGB 1NEBA 3A8OB 1WHMA 4JUVA 4XU3A 3ER0A 1H3HA 1T3SA 2FHDA 2KDSA 2NYSA 1RLQC 4XTZA 4IUVA 1YJNQ 1FMWA 1QKWA 1VQ8A 1KD1U 2CZ6B 5AYFA 1M1KC 4MZMA 1YJ9A 2HCKA 1RAHB 1HJDA 4CC7A 4Z02A 1ZBXA 2V1QA 3CCMT 1N9SA 1X75C 3UDCA 4FT4A 3N5BB 2PVOB 2F5TX 2EYYA 4P5NA 2DMOA 2VC8A 4F04B 2E1HA 4FYYB 4PJOB 3MP8A 5IHKA 5J3BA 3M4YA 2QXFA 4PJOD 2E3HA 2HD0A 2LQWA 2LJ1A 2X4YA 3FJPA 3VS6A 4PJJA 2F2XA
chains in the Genus database with same CATH topology
1E7OA 1JXOA 2DA9A 1WX6A 2G6FX 2O2OA 1G83A 2K6DA 3TSWA 1K76A 2EYXA 1QWFA 2E5KA 1RLPC 1FMKA 1PWTA 2KRNA 1LCKA 1ZX6A 1KJWA 5IXFA 2W10A 4HXJA 1YP5A 2K79A 2SEMA 1OPLA 2JTEA 2RF0A 4LNPA 1GFCA 1SSHA 2JMAA 1BBZA 4OMPA 2AZVA 4KRTA 2MIOA 4FSSA 4AG1C 1AZEA 1M3BA 1YWPA 2J6KA 2LP5A 2K3BA 5IHIA 4IIOA 2FG0A 1PHTA 2KR3A 1X2QA 2KNBB 1ZLMA 2BZ8A 1G2BA 2DE0X 2FRWA 1OPKA 2ED1A 1TUCA 1RI9A 2RMOA 2D8HA 3TVTA 5IH2A 2DILA 1CKAA 1WA7A 4K11A 2IIMA 4OMOA 2FEIA 2YUNA 1MUZA 2LZ6B 1AWWA 1GBQA 1PRLC 2EVRA 1IO6A 1WYXA 2ENMA 4Z89A 2ESWA 1W70A 2LMJA 3U23A 3PE0A 4JJCA 2EGCA 4QT7A 4F17A 2YUQA 3A98A 4AG2C 4CC3A 4ZNXA 3PVQA 1X2KA 4DEYA 2H8HA 2DBKA 1GL5A 1X69A 3REBB 2D0NA 1UECA 4JPBW 2CH4W 2W0ZA 2J6FA 3UA7A 2ROTA 2A37A 2EW3A 5GJVB 2YDLA 1WFWA 3LH5A 2GQIA 1JU5C 2DBMA 1MV0B 3CQTA 4RTZA 2JM8A 2KE9A 1U5SA 4AFUC 1EFNA 1ABQA 2FPDA 3C0CA 3PVLA 2C0IA 3I5RA 1UDLA 1AWJA 1VYVA 2M0YA 3VS1A 2RNAA 1T3LA 2YUOA 4HVWA 4DEXA 1WLPB 1B07A 2CDTA 1ARKA 1GFDA 1UJYA 2LJ3A 1GCQA 2DM1A 1ZUKA 1WDXA 1SEMA 3ULRB 1GCQC 4E6RA 3M0UA 2K9GA 1M8MA 2DL3A 2AZSA 4Z8AA 5I22A 3RBBB 4J9FA 3EG0A 2L0AA 2CSQA 4RTTA 2CT3A 2JS2A 3NGPA 1JXMA 3QWXX 1X43A 1ZBJA 2DF6A 2ABLA 1HD3A 1Z9QA 1UHFA 4F16A 2RQVA 1K4US 2AKLA 1GBRA 2HEQA 1BB9A 1TUDA 1B3QA 2LX7A 4J9IA 1NYGA 4AFZC 2DL4A 4JZ4A 1RUWA 2J7IA 2EPDA 2J6OA 2DX1A 4RTYA 2FPFA 2L3SA 1AEYA 1PNJA 2FO0A 2F2VA 1X6GA 1M3CA 2D1XA 4LE9A 2FPEA 1QWEA 1K9AA 2DL7A 3JV3A 2F2WA 2NUZA 1BU1A 2K2MA 2VVKA 2BZYA 4WCIA 3TSZA 4F14A 1AZGB 2RPNA 5IXBA 2LQNA 3SEMA 1K0SA 3EGUA 2KYBA 4JZ3A 1S1NA 1Z9ZA 3VRYA 2K7AA 2RQWA 2KRMA 1E6GA 2OI3A 4J9HA 1YN8A 4R0KA 1AOJA 1NEGA 2F2XA 4Z88A 1CKBA 4D8DA 1KIKA 1UTIA 4OMNA 2CH4A 1V1CA 2J05A 1ZSGA 2GGRA 4AFSC 4RTUA 2EYWA 1K1ZA 2KEAA 2ROLA 5HCKA 2C0OA 2JXBA 2L2PA 1KFZA 3EHRA 3M0TA 4RTVA 1FYNA 1SPKA 2DYBA 3I5SA 1SRMA 3H0IA 3M0QA 2DL5A 2BZXA 2AK5A 1XOVA 4M4ZA 2RQTA 4CC4B 1H8KA 1N5ZA 1T0JA 3I9QA 4J9GA 3VRZA 2HSPA 2YSQA 2DRMA 2GNCA 2B86A 2I0NA 1AWXA 2EYZA 1M30A 1ZUUA 1NM7A 2SRCA 3O5ZA 4ORZA 5EC7A 4EIKA 1NLOC 1WXTA 2PTKA 4RUGA 4GBQA 1ABOA 2KYMA 5FWCA 2EBPA 2EGEA 3VS2A 1NG2A 4HVVA 1GCPA 1UG1A 1SHGA 2CUDA 1SRLA 1QCFA 2X3WD 1J3TA 3M0RA 3KFVA 1Y0MA 2CSIA 4RTXA 3VS7A 4RTWA 2X3XD 1OOTA 2KT1A 2KXDA 3THKA 2LNHB 4AFQC 5ECAA 3VS5A 3EG3A 4OMQA 1X27A 2A36A 1OV3A 2L3QA 2QDLA 3H41A 3VS0A 2RQUA 2KBTA 4Y92A 4D8KA 2RQRA 2O9VA 3REAB 1I0CA 2KRSA 2PNIA 3IQLA 2DLPA 3UF4A 1UE9A 1YNZA 2AKKA 2VKNA 2OAWA 3I35A 4HCKA 2CT4A 2O9SA 4LN2A 2M51A 1AVZC 3EG2A 4JJBA 3UATA 2DJQA 3QWYA 4LUEA 1I07A 3H0HA 4A63B 5I11A 1JO8A 1HSQA 3FJ5A 5FW9A 2KROA 1WIEA 5IHNA 2LJ0A 3R6NA 2RN8A 1M3AA 2EGAA 1OEBA 1PKTA 1WI7A 1VYUA 2CUBA 2JM9A 1QLYA 4ESRA 2J06A 2OJ2A 4X1VA 2A28A 3UA6A 3RNJA 3SHWA 1K0XA 4JJDA 1X6BA 4HVUA 2L3PA 1QKXA 2GTJA 2JT4A 1UJ0A 2O88A 1MV3A 1E6HA 1H92A 2GBQA 2MOXA 1KSWA 1UUEA 4J9EA 2JS0A 4J9CA 4IIMA 5FWBA 3NHNA 4GLMA 1PRMC 1YWOA 1ZUYA 1T0HA 2YT6A 4J9BA 1JEGA 1W6XA 2KGTA 1PKSA 1NEBA 2YUPA 1M27C 1U06A 2GTOA 2JW4A 1NLPC 3GBQA 1CSKA 1TG0A 1JQQA 1H3HA 1T3SA 1VA7A 2P4RA 2DRKA 1RLQC 1BK2A 3M0PA 4J9DA 2A08A 2O31A 1UHCA 5L23A 1QKWA 2NWMA 3VS3A 2DL8A 2ED0A 1SHFA 4CC2A 1I1JA 2V1RA 2XMFA 2DVJA 2PZ1A 2EKHA 2HCKA 2KXCA 1HJDA 2HDAA 4CC7A 1GRIA 2V1QA 2CREA 2JMCA 1A0NB 1VYTA 1AD5A 2C0TA 3NPFA 2KT8A 4OMLA 1U3OA 1W1FA 2EYYA 3M0SA 1NYFA 1AWOA 3ZL7C 4OMMA 3EHQA 2DMOA 3NMZC 2HBWA 2BTTA 1WXBA 3H0FA 2VWFA 2D8JA 5IHKA 1Y57A 2EQIA 3VS4A 5GJWB 2LCSA 2FRYA 4LUDA 2LQWA 3EG1A 2MCNA 1UFFA 2LJ1A 1YCSB 3VS6A 1UGVA 1WXUA 2ECZA 2DNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E7O A;  1JXO A;  2DA9 A;  1WX6 A;  2G6F X;  2O2O A;  1G83 A;  2K6D A;  3TSW A;  1K76 A;  2EYX A;  1QWF A;  2E5K A;  1RLP C;  1FMK A;  1PWT A;  2KRN A;  1LCK A;  1ZX6 A;  1KJW A;  5IXF A;  2W10 A;  4HXJ A;  1YP5 A;  2K79 A;  2SEM A;  1OPL A;  2JTE A;  2RF0 A;  4LNP A;  1GFC A;  1SSH A;  2JMA A;  1BBZ A;  4OMP A;  2AZV A;  4KRT A;  2MIO A;  4FSS A;  4AG1 C;  1AZE A;  1M3B A;  1YWP A;  2J6K A;  2LP5 A;  2K3B A;  5IHI A;  4IIO A;  2FG0 A;  1PHT A;  2KR3 A;  1X2Q A;  2KNB B;  1ZLM A;  2BZ8 A;  1G2B A;  2DE0 X;  2FRW A;  1OPK A;  2ED1 A;  1TUC A;  1RI9 A;  2RMO A;  2D8H A;  3TVT A;  5IH2 A;  2DIL A;  1CKA A;  1WA7 A;  4K11 A;  2IIM A;  4OMO A;  2FEI A;  2YUN A;  1MUZ A;  2LZ6 B;  1AWW A;  1GBQ A;  1PRL C;  2EVR A;  1IO6 A;  1WYX A;  2ENM A;  4Z89 A;  2ESW A;  1W70 A;  2LMJ A;  3U23 A;  3PE0 A;  4JJC A;  2EGC A;  4QT7 A;  4F17 A;  2YUQ A;  3A98 A;  4AG2 C;  4CC3 A;  4ZNX A;  3PVQ A;  1X2K A;  4DEY A;  2H8H A;  2DBK A;  1GL5 A;  1X69 A;  3REB B;  2D0N A;  1UEC A;  4JPB W;  2CH4 W;  2W0Z A;  2J6F A;  3UA7 A;  2ROT A;  2A37 A;  2EW3 A;  5GJV B;  2YDL A;  1WFW A;  3LH5 A;  2GQI A;  1JU5 C;  2DBM A;  1MV0 B;  3CQT A;  4RTZ A;  2JM8 A;  2KE9 A;  1U5S A;  4AFU C;  1EFN A;  1ABQ A;  2FPD A;  3C0C A;  3PVL A;  2C0I A;  3I5R A;  1UDL A;  1AWJ A;  1VYV A;  2M0Y A;  3VS1 A;  2RNA A;  1T3L A;  2YUO A;  4HVW A;  4DEX A;  1WLP B;  1B07 A;  2CDT A;  1ARK A;  1GFD A;  1UJY A;  2LJ3 A;  1GCQ A;  2DM1 A;  1ZUK A;  1WDX A;  1SEM A;  3ULR B;  1GCQ C;  4E6R A;  3M0U A;  2K9G A;  1M8M A;  2DL3 A;  2AZS A;  4Z8A A;  5I22 A;  3RBB B;  4J9F A;  3EG0 A;  2L0A A;  2CSQ A;  4RTT A;  2CT3 A;  2JS2 A;  3NGP A;  1JXM A;  3QWX X;  1X43 A;  1ZBJ A;  2DF6 A;  2ABL A;  1HD3 A;  1Z9Q A;  1UHF A;  4F16 A;  2RQV A;  1K4U S;  2AKL A;  1GBR A;  2HEQ A;  1BB9 A;  1TUD A;  1B3Q A;  2LX7 A;  4J9I A;  1NYG A;  4AFZ C;  2DL4 A;  4JZ4 A;  1RUW A;  2J7I A;  2EPD A;  2J6O A;  2DX1 A;  4RTY A;  2FPF A;  2L3S A;  1AEY A;  1PNJ A;  2FO0 A;  2F2V A;  1X6G A;  1M3C A;  2D1X A;  4LE9 A;  2FPE A;  1QWE A;  1K9A A;  2DL7 A;  3JV3 A;  2F2W A;  2NUZ A;  1BU1 A;  2K2M A;  2VVK A;  2BZY A;  4WCI A;  3TSZ A;  4F14 A;  1AZG B;  2RPN A;  5IXB A;  2LQN A;  3SEM A;  1K0S A;  3EGU A;  2KYB A;  4JZ3 A;  1S1N A;  1Z9Z A;  3VRY A;  2K7A A;  2RQW A;  2KRM A;  1E6G A;  2OI3 A;  4J9H A;  1YN8 A;  4R0K A;  1AOJ A;  1NEG A;  2F2X A;  4Z88 A;  1CKB A;  4D8D A;  1KIK A;  1UTI A;  4OMN A;  2CH4 A;  1V1C A;  2J05 A;  1ZSG A;  2GGR A;  4AFS C;  4RTU A;  2EYW A;  1K1Z A;  2KEA A;  2ROL A;  5HCK A;  2C0O A;  2JXB A;  2L2P A;  1KFZ A;  3EHR A;  3M0T A;  4RTV A;  1FYN A;  1SPK A;  2DYB A;  3I5S A;  1SRM A;  3H0I A;  3M0Q A;  2DL5 A;  2BZX A;  2AK5 A;  1XOV A;  4M4Z A;  2RQT A;  4CC4 B;  1H8K A;  1N5Z A;  1T0J A;  3I9Q A;  4J9G A;  3VRZ A;  2HSP A;  2YSQ A;  2DRM A;  2GNC A;  2B86 A;  2I0N A;  1AWX A;  2EYZ A;  1M30 A;  1ZUU A;  1NM7 A;  2SRC A;  3O5Z A;  4ORZ A;  5EC7 A;  4EIK A;  1NLO C;  1WXT A;  2PTK A;  4RUG A;  4GBQ A;  1ABO A;  2KYM A;  5FWC A;  2EBP A;  2EGE A;  3VS2 A;  1NG2 A;  4HVV A;  1GCP A;  1UG1 A;  1SHG A;  2CUD A;  1SRL A;  1QCF A;  2X3W D;  1J3T A;  3M0R A;  3KFV A;  1Y0M A;  2CSI A;  4RTX A;  3VS7 A;  4RTW A;  2X3X D;  1OOT A;  2KT1 A;  2KXD A;  3THK A;  2LNH B;  4AFQ C;  5ECA A;  3VS5 A;  3EG3 A;  4OMQ A;  1X27 A;  2A36 A;  1OV3 A;  2L3Q A;  2QDL A;  3H41 A;  3VS0 A;  2RQU A;  2KBT A;  4Y92 A;  4D8K A;  2RQR A;  2O9V A;  3REA B;  1I0C A;  2KRS A;  2PNI A;  3IQL A;  2DLP A;  3UF4 A;  1UE9 A;  1YNZ A;  2AKK A;  2VKN A;  2OAW A;  3I35 A;  4HCK A;  2CT4 A;  2O9S A;  4LN2 A;  2M51 A;  1AVZ C;  3EG2 A;  4JJB A;  3UAT A;  2DJQ A;  3QWY A;  4LUE A;  1I07 A;  3H0H A;  4A63 B;  5I11 A;  1JO8 A;  1HSQ A;  3FJ5 A;  5FW9 A;  2KRO A;  1WIE A;  5IHN A;  2LJ0 A;  3R6N A;  2RN8 A;  1M3A A;  2EGA A;  1OEB A;  1PKT A;  1WI7 A;  1VYU A;  2CUB A;  2JM9 A;  1QLY A;  4ESR A;  2J06 A;  2OJ2 A;  4X1V A;  2A28 A;  3UA6 A;  3RNJ A;  3SHW A;  1K0X A;  4JJD A;  1X6B A;  4HVU A;  2L3P A;  1QKX A;  2GTJ A;  2JT4 A;  1UJ0 A;  2O88 A;  1MV3 A;  1E6H A;  1H92 A;  2GBQ A;  2MOX A;  1KSW A;  1UUE A;  4J9E A;  2JS0 A;  4J9C A;  4IIM A;  5FWB A;  3NHN A;  4GLM A;  1PRM C;  1YWO A;  1ZUY A;  1T0H A;  2YT6 A;  4J9B A;  1JEG A;  1W6X A;  2KGT A;  1PKS A;  1NEB A;  2YUP A;  1M27 C;  1U06 A;  2GTO A;  2JW4 A;  1NLP C;  3GBQ A;  1CSK A;  1TG0 A;  1JQQ A;  1H3H A;  1T3S A;  1VA7 A;  2P4R A;  2DRK A;  1RLQ C;  1BK2 A;  3M0P A;  4J9D A;  2A08 A;  2O31 A;  1UHC A;  5L23 A;  1QKW A;  2NWM A;  3VS3 A;  2DL8 A;  2ED0 A;  1SHF A;  4CC2 A;  1I1J A;  2V1R A;  2XMF A;  2DVJ A;  2PZ1 A;  2EKH A;  2HCK A;  2KXC A;  1HJD A;  2HDA A;  4CC7 A;  1GRI A;  2V1Q A;  2CRE A;  2JMC A;  1A0N B;  1VYT A;  1AD5 A;  2C0T A;  3NPF A;  2KT8 A;  4OML A;  1U3O A;  1W1F A;  2EYY A;  3M0S A;  1NYF A;  1AWO A;  3ZL7 C;  4OMM A;  3EHQ A;  2DMO A;  3NMZ C;  2HBW A;  2BTT A;  1WXB A;  3H0F A;  2VWF A;  2D8J A;  5IHK A;  1Y57 A;  2EQI A;  3VS4 A;  5GJW B;  2LCS A;  2FRY A;  4LUD A;  2LQW A;  3EG1 A;  2MCN A;  1UFF A;  2LJ1 A;  1YCS B;  3VS6 A;  1UGV A;  1WXU A;  2ECZ A;  2DNU A; 
#chains in the Genus database with same CATH topology
 3S3N A;  2DD4 A;  3AHU A;  2DA9 A;  2DFU A;  3OSV A;  2O2O A;  3CD6 A;  1G3W A;  1LJO A;  4IUT A;  1PWT A;  4BY6 B;  1ZX6 A;  2W10 A;  4M77 F;  3J80 E;  4JS5 A;  1QVF P;  3MKD A;  3X26 B;  1Q7Y R;  4BD3 A;  3S3M A;  2Y4Y A;  2RF0 A;  1GFC A;  3G71 Q;  1SSH A;  2JMA A;  2YRC A;  2K3Y A;  5I21 A;  3EGX B;  4FSS A;  2ZGW A;  1D1A A;  1MMD A;  4PJO C;  1AZE A;  1YWP A;  2J6K A;  2FB7 A;  2LP5 A;  2K3B A;  5IHI A;  4IIO A;  3CC4 T;  1R0C B;  3GPL A;  1K8A U;  1PHT A;  1X6O A;  5CCA A;  2BZ8 A;  3QHS A;  1ZA1 B;  2FRW A;  1DJ7 B;  4X9C A;  1RI9 A;  2LC4 A;  3CC7 T;  2XDB A;  1AHJ B;  2RMO A;  3CCE A;  5IH2 A;  1M1K R;  2DIL A;  4BY6 C;  3QDF A;  4R56 A;  2LT4 A;  1BCO A;  1YJ9 Q;  4B6M A;  1W70 A;  1RAD B;  2YUQ A;  4A4K A;  1K8A C;  7AT1 B;  4V2S A;  4Q5W A;  1I5L A;  4ZNX A;  5GMK m;  2H8H A;  3JB9 F;  3QPH A;  5D7U A;  2HBP A;  3E19 A;  1QP3 A;  3OYN A;  2MAM A;  2J6F A;  3OW2 A;  2JUF A;  6AT1 B;  1YI2 Q;  4M7D F;  3EFO B;  9ATC B;  3CCU Q;  2A37 A;  1M9S A;  2EW3 A;  2YDL A;  4F7U B;  3OS1 A;  2E64 A;  2NUT B;  1JU5 C;  4M78 F;  1Q81 U;  4DBQ A;  4AFU C;  2E5Q A;  4DOW A;  1ABQ A;  2HQH A;  1UDL A;  1AWJ A;  3CD6 Q;  2CKK A;  3VS1 A;  1WQ7 A;  4LD9 K;  4C5G A;  1IRX A;  3T9N A;  1WLP B;  1BI0 A;  4TVR A;  3L2W A;  4OB1 B;  2XID A;  5FRM A;  4MZT A;  1O75 A;  2RJC A;  1RAE B;  1GCQ C;  3M59 A;  2H3J A;  1VQL A;  1RI0 A;  4FYW B;  2AZS A;  2M16 A;  3CME Q;  1QVG A;  3NTK A;  4MZP A;  1VQK A;  2ZPG B;  4J5Y A;  3EG0 A;  4N0A C;  3WXM B;  1K9M C;  5CVI A;  1M90 U;  3CCQ A;  2E70 A;  1NE8 A;  2YXY A;  2CT3 A;  3WVD B;  2D9T A;  3M58 A;  3QWX X;  4JRK A;  2DF6 A;  3LYI A;  1OZ2 A;  3A8L B;  4F16 A;  1PC0 A;  5LJ5 h;  1M5Q 1;  1KC8 U;  1D09 B;  3V8L A;  1KHC A;  3CCE Q;  4C8Q A;  2IPO B;  4AFZ C;  2V8K A;  2J7I A;  4JS4 A;  2V26 A;  2XU8 A;  2RJD A;  4QQD A;  3QZ9 B;  3JSC A;  1KQS A;  1K8A R;  5LJ5 f;  2XIC A;  4BDZ A;  2D1X A;  2JZ2 A;  4QKU A;  4M7A A;  2X35 A;  1QVP A;  4LDY A;  2LVM A;  3OYK A;  4C92 A;  3H9N A;  4FL6 A;  4F14 A;  3TSZ A;  5HKC A;  3NTI A;  1AZG B;  2F1L A;  4M7A E;  2LQN A;  3EGU A;  1S1N A;  2RQW A;  4JJN K;  2EQU A;  3L2Z A;  2H3E B;  4BAC A;  4LDV A;  2LX9 A;  2LCC A;  1AOJ A;  1PD1 A;  2OAU A;  4E7S A;  4Z88 A;  2X51 A;  4D8D A;  1KIK A;  1UTI A;  4N4H A;  1V1C A;  3OYJ A;  2FZC B;  1OQK A;  2GQV A;  4AFS C;  4DQ2 A;  4RTU A;  2EYW A;  1VQ6 T;  5LJ3 e;  2D0Q B;  2KEA A;  3CPW A;  2C0O A;  2JXB A;  1NJI C;  3M0T A;  4M75 E;  2CZ0 B;  4OB2 B;  1SRM A;  1TXQ A;  3H0I A;  4OF1 A;  4A4E A;  4X9D A;  4C0F A;  2OTJ A;  1QCO A;  2BZX A;  2E10 A;  1XOV A;  1IRE B;  4M4Z A;  3L2R A;  4HT8 A;  1H8K A;  1N5Z A;  3I9Q A;  4MML A;  3SB2 A;  3CPF A;  1VQK Q;  5LJ3 h;  2CGH A;  2GNC A;  2MK5 A;  5GAN e;  2I0N A;  3CCQ Q;  1VQ8 T;  2OTL T;  1NLO C;  4OVA A;  3C12 A;  2EBP A;  2EGE A;  5M9O A;  3C4S A;  1VIF A;  1GCP A;  2JVV A;  5L8R E;  2P4T A;  3M0R A;  1LNX A;  1Y0M A;  1M1F A;  5GAO n;  3E9G A;  4RTW A;  2XDD A;  1OOT A;  2KY9 A;  2KT1 A;  3THK A;  1YIT T;  2VV5 A;  3VS5 A;  4A4G A;  2QEX Q;  1TUG B;  2L3Q A;  2P84 A;  2QDL A;  1M90 R;  4E2F B;  1VQ9 Q;  2QK0 A;  4Y92 A;  4D8K A;  1UGQ B;  2RQR A;  1K73 U;  2E3I A;  2KRS A;  3IQL A;  3X28 B;  4BDY A;  2PQW A;  1UE9 A;  2COZ A;  4BE2 A;  1YNZ A;  2AKK A;  1VQ4 A;  4JJB A;  3EG2 A;  5LJ5 d;  2E65 A;  2ZPB B;  1KC8 R;  4A63 B;  3S6W A;  5I11 A;  1SF9 A;  3OS2 A;  1G3S A;  1G8X A;  4UC4 A;  4FT2 A;  4C92 F;  1WIE A;  5CKB A;  3R6N A;  3V7R A;  2K57 A;  2HL3 A;  3OS0 A;  2CUB A;  4II1 A;  5LL6 S;  1QLY A;  4ESR A;  2RA2 A;  2A28 A;  2GCX A;  2QQS A;  3UA6 A;  1NJI R;  2ZAE A;  3RNJ A;  2HKN A;  1I4K 1;  3V7C A;  1K0X A;  4FYV B;  2L3P A;  4JRQ A;  1QKX A;  1Y96 A;  5KYX A;  2JT4 A;  1UJ0 A;  2O88 A;  2B8A A;  2YLB A;  2OTJ Q;  1XNI A;  1C6V X;  4IIM A;  4NOY A;  5GAN 5;  4ZGJ B;  4PFO A;  1PRM C;  1YWO A;  3KBG A;  2QQB A;  1QP2 A;  4M75 G;  4BI4 A;  1JEG A;  4YTL A;  3OSS C;  2YUP A;  2GTO A;  2MPX C;  3GBQ A;  1TOV A;  3OMG A;  1OYX A;  2HAX A;  1WJQ A;  1Q86 U;  4QQG A;  1TG0 A;  2EJF A;  4XK8 E;  3GLX A;  1JQQ A;  3L1A A;  3LGF A;  2DRK A;  5LJ5 j;  1BK2 A;  1KK7 A;  3Q1J A;  4J9D A;  4X34 A;  2DL8 A;  2ED0 A;  3TEE A;  2DYI A;  1VOM A;  4ZN3 A;  1SHF A;  5LJ3 d;  1BIB A;  3OYI A;  4CC2 A;  1I1J A;  1W2B S;  2XMF A;  2FL7 A;  3G4S T;  2EKH A;  1IGU A;  2RD1 A;  2HDA A;  1JB0 E;  2PU9 B;  2CRE A;  3HSB A;  2QQA A;  1A0N B;  5KH6 A;  3OYH A;  3EGD A;  1NZ9 A;  1ZA2 B;  3M0S A;  1NYF A;  2DJZ A;  5IT9 E;  3ZL7 C;  2WSF E;  5KCH A;  3EHQ A;  1SG5 A;  1YHQ T;  3PMT A;  2HBW A;  2BTT A;  1WXB A;  3D7S B;  2VWF A;  2D8J A;  2CYZ B;  1D0X A;  2LCS A;  4C8Q B;  2FRY A;  2QQ9 A;  5GMK h;  3CC7 Q;  1YCS B;  5DY9 A;  4J6W A;  2G6F X;  4M7A B;  1VQM T;  1M4Z A;  5LJ3 g;  4PJO G;  1JJ2 A;  3R6O A;  1TH7 A;  3QII A;  2WSC E;  3PT9 A;  1VQL T;  1LPL A;  1QWF A;  1RAB B;  1LCK A;  1KG1 A;  1Y7X A;  4PKC C;  1YP5 A;  3OBW A;  2CP5 A;  1OPL A;  4EMK A;  4M77 A;  4BE1 A;  2DXB A;  2XD0 A;  4DA4 A;  3TU4 K;  4R55 A;  1XQH A;  2VAS A;  1M3B A;  5GAN g;  1M8V A;  4M75 B;  2CZ1 B;  4C8Q C;  1I8F A;  2PUK B;  4KBM B;  4M75 D;  2CP0 A;  1WHK A;  4D6W A;  4RCB A;  3CCS A;  4AT1 B;  2KNB B;  1ZLM A;  3MO8 A;  1PG5 B;  1OU9 A;  2DE0 X;  1I81 A;  1ZSZ B;  4M7A C;  2ED1 A;  1TUC A;  2D8H A;  4PFZ A;  4ZGD B;  3M56 A;  5C0M A;  2MYS A;  1MNE A;  4KGZ B;  5GAM g;  2FEI A;  2QTV A;  2RHZ A;  2LZ6 B;  1AWW A;  4Y91 A;  1M1G A;  1WYX A;  2LQ8 A;  2LMJ A;  3U23 A;  1AT1 B;  4JJC A;  3FB9 A;  5GAO l;  4QT7 A;  3VYG A;  5CR2 A;  2RK2 A;  4DEY A;  3RDV A;  3HRU A;  5D6X A;  1IB8 A;  2HQE A;  4M75 C;  4BI8 B;  2D0N A;  2OTL A;  4N4I A;  4E7J A;  3BFM A;  1G3T A;  4E7Z A;  4WF2 A;  3OW2 P;  5GJV B;  1WFW A;  3EFS A;  3E2U A;  4M7D A;  1ZSZ C;  1VQ5 T;  4LDU A;  4RTZ A;  1TWB A;  2JM8 A;  3G6E A;  4PJL A;  1YIT A;  4L59 A;  2XDP A;  4M78 A;  4LDX A;  2ZCF B;  3LWH A;  4C0Z A;  4C5I A;  4C0G A;  1ZQ1 A;  4M7D E;  2OTJ T;  4OGC A;  2M0Y A;  1T3L A;  2YUO A;  1JRI A;  4HVW A;  4M78 E;  3M53 A;  4F7U G;  2X4W A;  1B07 A;  1ARK A;  1KD1 C;  2LJ3 A;  1BCM A;  1HK9 A;  2ZPH B;  4OMF B;  2ZPF B;  4KUL A;  4E6R A;  3JCM X;  3M0U A;  1YBY A;  1M8M A;  2QTX A;  2DL3 A;  1P92 A;  4XTU A;  5CAI A;  2LCL A;  5D6W A;  1B7T A;  1TSF A;  3RBB B;  1UGR B;  2L0A A;  3MJX A;  2WSE E;  1IHV A;  2JS2 A;  2A0F B;  3M9Q A;  3CMA T;  1ZBJ A;  3E1S A;  4GY5 A;  2ABL A;  3P8H A;  1Y96 B;  1VQ6 Q;  1K4U S;  1QCN A;  2ZPI B;  3FDR A;  2XHC A;  1BB9 A;  3FC3 A;  1TUD A;  1B3Q A;  4IKF A;  4DBF A;  2V8J A;  4JZ4 A;  1VQ4 T;  4EDU A;  2JN0 A;  1WPY A;  2DX1 A;  4KT0 E;  3EG9 A;  1AEY A;  1PNJ A;  2FO0 A;  1RL2 A;  2F2V A;  5HK3 A;  1BIA A;  4J7I A;  5KYU A;  2XG8 D;  1K9A A;  2QQR A;  1UGS B;  3JV3 A;  3EH2 A;  3P8D A;  2VVK A;  2BZY A;  4WCI A;  3CCR T;  2RPN A;  1VQ8 Q;  3ZEH A;  5IXB A;  2OTL Q;  2M0O A;  3SEM A;  1W2B P;  1K0S A;  3EH1 A;  1MMN A;  1Z9Z A;  4ELZ C;  5J39 A;  2EYQ A;  5GMK j;  4QQ6 A;  2P0Q A;  2G3R A;  3OYM A;  2DZC A;  1E6G A;  5GAN 7;  3RUX A;  2OI3 A;  2MF2 A;  1NEG A;  1N8R U;  3GNG A;  1YIT Q;  2J05 A;  3G4S A;  4VUB A;  1N6A A;  5HCK A;  1KD1 R;  5GAO p;  4RTV A;  2VUB A;  3CPW P;  2DYB A;  3UWN A;  2RO0 A;  3H8Z A;  1YHQ A;  2X9H A;  3CCL T;  3MHX A;  3C95 A;  3SWN A;  3OYE A;  4FIB A;  5DLQ E;  5GAN 6;  2HSP A;  3MEU A;  3JB9 H;  1B34 B;  1AWX A;  1M30 A;  3VYH B;  4WTO B;  3MCA B;  2SRC A;  2MWO A;  4EIK A;  1OZ3 A;  2PTK A;  4RUG A;  5D6Y A;  2XK0 A;  2DPP B;  4XU2 A;  2R5M A;  4MDX A;  3VJP A;  1VQM A;  5CKD A;  3I56 T;  1UG1 A;  1SHG A;  1Q81 C;  1PD0 A;  1YCY A;  3L2U A;  3KFV A;  1VQO T;  4RTX A;  3VS7 A;  1VQ7 T;  2RI3 A;  2BE7 D;  1ACM B;  2KXD A;  4M77 B;  2O4X A;  5HK0 A;  3CCV A;  5KYW A;  3OYG A;  2RQU A;  2KBT A;  2COW A;  4XTY A;  1F1B B;  2O9V A;  2PNI A;  4DBH A;  1NPR A;  3CEY A;  8AT1 B;  2JTF A;  1U8R A;  3RES A;  3HP9 A;  3JB9 I;  5A0L A;  1AVZ C;  3UAT A;  1S72 T;  4BB7 A;  2F5K A;  2GF7 A;  4AMC A;  3M54 A;  5KYY B;  3H0H A;  1PSE A;  1KQ1 A;  1IHW A;  4NS5 A;  1WHJ A;  2KSS A;  2MI6 A;  3DB3 A;  1G3Y A;  3OYD A;  4C8Q E;  1M90 C;  3BW1 A;  1Y71 A;  2K5F A;  3V7S A;  1PKT A;  4EMK C;  1LVK A;  4M77 C;  2JM9 A;  3G4S Q;  2DER A;  2OJ2 A;  2EQK A;  3URG A;  2VYT A;  2P0K A;  4C92 E;  1KC8 C;  2GTJ A;  2OX7 A;  1NBE B;  2GBQ A;  3PTA A;  3KXT A;  3M5A A;  4J9E A;  1VQP T;  3NHN A;  4GLM A;  4BUG A;  1VQN A;  1YHQ Q;  3J7A F;  2RHY A;  1ZUY A;  4M7D B;  3PIP A;  3CCS T;  4XU1 A;  4M7D D;  2QAS A;  3MEA A;  3VUZ A;  5CIU A;  3QJ6 A;  3QXE B;  3BY7 A;  4M78 B;  1VQ5 A;  3FEO A;  1U06 A;  3GIB A;  2JW4 A;  1NLP C;  2QGF B;  4M78 D;  2PUO B;  5FRN A;  4BE0 A;  4NL2 A;  3QZ5 B;  2P4R A;  2L89 A;  1M2O A;  2KMT A;  2C06 A;  3CBM A;  1VQM Q;  1Q81 R;  2D6F A;  1VQL Q;  1GXI E;  1SKU B;  2EAY A;  1YJW A;  1MND A;  4O6J A;  2NWM A;  2RHX A;  2LDM A;  2E6N A;  3OQ5 A;  2I2L A;  1WHH A;  3HL8 A;  1MHN A;  2DVJ A;  3UT1 A;  5KE3 A;  4OGE A;  4HT9 A;  3CCJ A;  2RM4 A;  4M7D C;  3L2Q A;  1WGS A;  5LJ3 f;  2RHI A;  5KYN A;  2C0T A;  3LH0 A;  2QA4 T;  2QDY B;  4ELY C;  1U3O A;  2DXT A;  3PMI A;  3JCM V;  4M78 C;  4HCC A;  3JCM c;  4OMM A;  3G6E T;  2RK1 A;  3A5Z B;  3CMA A;  1YIJ T;  5CK9 A;  5GAN h;  3L2V A;  3OYA A;  2RB6 A;  4PL6 A;  3H0F A;  5GAM e;  1Y57 A;  2EQI A;  2YHT A;  5GJW B;  5CQX A;  3OW2 S;  4ME7 A;  4MDW A;  1UFF A;  1UGV A;  4JRP A;  5GAN f;  2EJG A;  3EG9 B;  3EAE A;  1JXO A;  1D1C A;  1Q82 U;  1YFN A;  2AIR B;  4E7I A;  5KYU B;  2QG9 B;  2K6D A;  3TSW A;  1K76 A;  1RLP C;  5GAM h;  4C8Q G;  4HA8 A;  2KRN A;  1KJW A;  3DLM A;  2K4Y A;  3ZFJ A;  1W4S A;  2RH2 A;  2K79 A;  3GP8 A;  2SEM A;  2JTE A;  1QW1 A;  3CCR A;  2MMP A;  5GAM f;  1K73 C;  4M7A G;  2DTI A;  5I2M A;  4KGV B;  4C92 G;  4IUR A;  5GMK l;  5FU7 B;  1R77 A;  3J81 E;  1Y07 A;  1QVG S;  1VQ5 Q;  2FG0 A;  2KR3 A;  1X2Q A;  4J6Y A;  4MMK A;  4PJN A;  3JCM Q;  4E7H A;  4EPC A;  1G2B A;  1JBM A;  2VGN A;  1OPK A;  3FLG A;  3TVT A;  1QMC A;  4EMG A;  1CKA A;  4JRI A;  2IIM A;  1Q95 G;  1GBQ A;  3SWN B;  2EVR A;  4KH1 B;  1IO6 A;  2EQJ A;  3CCL A;  1FXX A;  3RKW A;  2EGC A;  1M2V A;  3DKM A;  4F17 A;  5GAO r;  3P8B B;  4AG2 C;  1KQS S;  1MGQ A;  1X2K A;  2V8I A;  2X4J A;  4XTW A;  3CC2 A;  2X4X A;  2DBK A;  5FU7 C;  1X69 A;  2PVG B;  4LDW A;  1C1A A;  1UEC A;  2VXE A;  3CMA Q;  2VB6 A;  3I56 A;  4XAX B;  2ATC B;  4JLG A;  1WHG A;  1D0Z A;  2DAQ A;  1N9R A;  1MV0 B;  5CKF A;  5DLO A;  1VQO A;  4OB0 B;  1VQ7 A;  2ZPE B;  1Q86 C;  3I55 T;  5KYW B;  1EFN A;  1WZO A;  3CXC A;  1VQ4 Q;  2FPD A;  1ZHI A;  3PVL A;  3OYY A;  2C0I A;  4E47 A;  1OUL A;  3RMQ A;  1VYV A;  3SWN C;  2RNA A;  2EQM A;  5GAN d;  4DEX A;  3SFM A;  2E6Z A;  3L42 A;  3FIF A;  1GFD A;  1UJY A;  2FZG B;  3CPW S;  1GCQ A;  5FRO A;  1S72 A;  2E4H A;  4C8Q D;  1WDX A;  1SEM A;  1K73 R;  3CCR Q;  3CBO A;  3BDU A;  4XQ3 A;  2K9G A;  2DEQ A;  4N0A A;  4Z8A A;  5I22 A;  2LQK A;  2CP2 A;  1Q82 R;  1C0M A;  2CSQ A;  4M7A D;  4C92 B;  5GAM d;  4C92 D;  4RTT A;  3A1P A;  1D3B A;  2P0P A;  3NGP A;  1TTH B;  1JXM A;  1X43 A;  2EKO A;  3PFS A;  4PJO F;  1HD3 A;  3CCV T;  4DBR A;  1UHF A;  5LJ3 j;  4C5E A;  1GBR A;  1RAF B;  4B9X A;  2HEQ A;  4XU0 A;  2Y4X A;  2LX7 A;  4PNO A;  3KUF A;  3JCM e;  1RUW A;  1H3Z A;  4M77 E;  4ZN1 A;  2EPD A;  5GAN 4;  1VQP A;  1Q7Y U;  2J6O A;  4RTY A;  2FPF A;  3CCL Q;  3HRS A;  5GAN 3;  1WJS A;  4KUD K;  1EZZ B;  1PCX A;  1QWE A;  1OX9 A;  5GAN j;  3OB9 A;  1U1T A;  4C92 C;  4BI3 A;  5A0G A;  3JCM h;  4JZ3 A;  2KRM A;  2KVQ G;  2CS7 A;  3I56 Q;  4J9H A;  1UGP B;  3A8M B;  1YN8 A;  4R0K A;  1Q86 R;  2JNG A;  3G71 A;  1VQO Q;  5A0D A;  2DEU A;  1VQ7 Q;  2BKD N;  2F69 A;  4N4G A;  5GAM j;  4ZTJ A;  2CH4 A;  1M1K U;  3QDR B;  2L8D A;  2A3L A;  1ZSG A;  2GGR A;  1K1Z A;  1KFZ A;  2L2P A;  1VQN T;  3EHR A;  3SDZ A;  3I5S A;  3O8V A;  3PNW C;  3M57 A;  2QA4 A;  2NUP A;  3M0Q A;  2R5A A;  3M4G A;  2AK5 A;  1S72 Q;  2DD5 A;  2FVU A;  4CC4 B;  3JCM W;  1YIJ A;  1T0J A;  4J9G A;  2HL5 C;  3VRZ A;  2MWP A;  5CKH A;  2BIV A;  1KHI A;  4B9W A;  1YJW T;  1ZUU A;  1NM7 A;  3O5Z A;  4ORZ A;  3QO3 A;  2BUD A;  1WXT A;  2A7Y A;  4ZTF A;  4GBQ A;  2QAZ A;  2DTH A;  2HMA A;  2KYM A;  5AT1 B;  2RI2 A;  1NG2 A;  4F7U F;  5KCO A;  4PLL A;  1RAA B;  1J3T A;  3MEV A;  3CCJ T;  2X3X D;  2LNV A;  1QVG P;  3JAM E;  5ECA A;  1YI2 A;  2DXC A;  3WVE B;  3QSU A;  4OMQ A;  3CCU A;  1QQJ A;  1D1B A;  2A36 A;  1VQP Q;  3H41 A;  3RIR A;  3HTR A;  5A2Q E;  5FLX E;  3REA B;  2PVD B;  1I0C A;  3UF4 A;  3CCS Q;  1RAG B;  4QVZ A;  4XTX A;  1OI1 A;  2VKN A;  2OAW A;  3I35 A;  4HCK A;  4LN2 A;  4FYX B;  4QVC A;  2M51 A;  5KYX B;  4M77 G;  1MMA A;  5CQY A;  1OU8 A;  3CXC S;  3QWY A;  4J8O A;  4LXC A;  4LUE A;  1JO8 A;  1HSQ A;  2YLC A;  3RKY A;  3OYB A;  4FW1 A;  2DTO A;  5IHN A;  1KQS P;  2LJ0 A;  2RN8 A;  1M3A A;  1OEB A;  3CME A;  1M2V B;  4FM4 B;  2DET A;  2J06 A;  3QJY A;  4X1V A;  4ATO A;  1V29 B;  3JCM d;  2DXU A;  3GNF B;  3SHW A;  4J6X A;  4HVU A;  1JJ2 S;  3GF5 A;  2QA4 Q;  1E6H A;  1H92 A;  2CP3 A;  2MOX A;  4HKE A;  1KSW A;  2EFI A;  2JS0 A;  4J9C A;  4QW2 A;  5FWB A;  3MEW A;  3G6E Q;  1TU0 B;  2RJF A;  2XI9 A;  2RI5 A;  2KI7 A;  1YIJ Q;  2O01 E;  1OX8 A;  4O5V A;  2YT6 A;  2RHU A;  4J9B A;  3EGD B;  2KGT A;  4LD6 A;  1PKS A;  3OBY A;  1M27 C;  2E41 A;  3I55 A;  3JB9 G;  1CSK A;  2L5Q A;  1VA7 A;  2GFA A;  3JCM P;  1WQW A;  2CP7 A;  4M7D G;  3M0P A;  2A08 A;  2O31 A;  1UHC A;  5L23 A;  4RCC A;  3VS3 A;  1N8R C;  2ZZD A;  4M78 G;  5KE2 A;  3JCM g;  3EFR A;  2V1R A;  3OA6 A;  3CC2 T;  3LX7 A;  2PZ1 A;  1XTD A;  2KXC A;  2YRV A;  4A54 A;  1GRI A;  1R8O B;  3QYH B;  2JMC A;  1VYT A;  2LRQ A;  2K5L A;  1AD5 A;  1PM3 A;  5DM7 R;  1K9M U;  3NPF A;  1D3B B;  2KT8 A;  4OML A;  1W1F A;  4GLK A;  1AWO A;  2DIQ A;  3OS5 A;  3NMZ C;  3CBP A;  4EMK B;  8ATC B;  3G1J A;  1O9S A;  3X24 B;  4M77 D;  3VS4 A;  4PK4 A;  3OYC A;  4FU6 A;  4LUD A;  3OMC A;  3EG1 A;  2MCN A;  4HCZ A;  1WXU A;  2ECZ A;  2DNU A;  1E7O A;  1BYM A;  2R57 A;  3GOX A;  5LJ5 e;  1WX6 A;  1G83 A;  1YJN T;  2EYX A;  2E5K A;  2QI2 A;  1FMK A;  1QVF A;  5IXF A;  4DOV A;  3RKX A;  4PJM A;  4HXJ A;  1UB4 A;  3MP6 A;  4LNP A;  4E7L A;  4L6V 5;  3V8J A;  3ASK A;  1BBZ A;  1BI2 A;  2AZV A;  4KRT A;  4OMP A;  5I2S A;  2QYZ A;  2MIO A;  3VU3 C;  4AG1 C;  4ANJ A;  1RAC B;  2QEX A;  2M9U A;  4KGX B;  5GAN 2;  1XJW B;  1VQ9 A;  3I55 Q;  5C6S A;  3X25 B;  3AT1 B;  2LTO A;  2NLU A;  4FSX A;  5GAN 8;  3TQ7 P;  4JLI A;  1BI3 A;  2CZ7 B;  3JB9 D;  2K5I A;  1N8R R;  3PGG A;  1SSF A;  2NUP B;  2FZK B;  1VIE A;  1NJI U;  1W2B A;  3HRT A;  3A8G B;  3RR6 A;  4J7F A;  1BKB A;  1IZ6 A;  1WA7 A;  2HZY A;  4K11 A;  2EWN A;  4OMO A;  2LT1 A;  2YUN A;  1MUZ A;  4E7K A;  2R58 A;  1PRL C;  2DK3 A;  3JB9 J;  2ENM A;  4Z89 A;  2ESW A;  1WJR A;  3PE0 A;  3G7Z A;  5CKE A;  3A98 A;  4CC3 A;  3UPU A;  2Z0W A;  3BE3 A;  4EMH A;  3PVQ A;  4M75 A;  3PIO A;  3VUB A;  1GL5 A;  4JDS A;  2K2V A;  3REB B;  4C5H A;  3OYL A;  3G71 T;  4IUQ A;  4JPB W;  2CH4 W;  3CCM A;  2W0Z A;  4L5G A;  3UA7 A;  2ROT A;  1ZSZ A;  3V8K A;  3CCV Q;  2JJ9 A;  3LH5 A;  4ZGE B;  2GQI A;  1KQ2 A;  2DBM A;  3CQT A;  1LOJ A;  2KE9 A;  1U5S A;  3LLR A;  2KK4 A;  3LW5 E;  1VUB A;  4PFP A;  3C0C A;  2DKG A;  1K9M R;  3I5R A;  3CXC P;  4KUI A;  3A8H B;  5GAO m;  3E9F A;  1FMV A;  2CDT A;  3QUI A;  1RAI B;  4NL3 A;  2DM1 A;  2HNI A;  4HCB A;  3NTH A;  1ZUK A;  3ULR B;  1YJ9 T;  2RJE A;  2QGG A;  3VKI A;  4FW2 A;  2HSE B;  4J9F A;  2XKO C;  2YWW A;  3QBY A;  5J26 A;  1H64 1;  1JJ2 P;  2CP6 A;  3TCJ A;  1YI2 T;  5GMK i;  3CCU T;  1Z9Q A;  3TRE A;  4C8Q F;  2RQV A;  2AKL A;  2IVW A;  5EG2 A;  3CC4 A;  1VQN Q;  4PJO A;  2FYK A;  3MPU B;  2JTM A;  4J9I A;  1NYG A;  1FWZ A;  3QG1 A;  3ZBD A;  2DL4 A;  4CI0 C;  1FX7 A;  1Q82 C;  4RG2 A;  2L3S A;  4M7A F;  3CD6 T;  4PJO E;  1U1S A;  3CC7 A;  3MET A;  4KH0 B;  1X6G A;  1M3C A;  2AT1 B;  3SD4 A;  4LE9 A;  4A53 A;  2FPE A;  1X01 A;  2DL7 A;  4XTV A;  2F2W A;  2NUZ A;  1BU1 A;  2K2M A;  1YJW Q;  4OB3 B;  5CO7 A;  2K3X A;  1EX4 A;  2KYB A;  3CCM Q;  1MMG A;  2K7A A;  3VRY A;  3CME T;  4FCY A;  2M1H A;  2EIF A;  1QVF S;  3EGX A;  4M75 F;  3HFO A;  3JCM b;  3OYF A;  3CCJ Q;  5HY6 A;  2L3R A;  1CKB A;  1WNL A;  3S3O A;  1IGQ A;  4OMN A;  2IG0 A;  5LJ5 g;  4Y28 E;  4IUU A;  4OP0 A;  2HKQ B;  2DIG A;  3F70 A;  2VXF A;  3FRN A;  2ROL A;  1I5O B;  4IUP A;  1FYN A;  1N27 A;  1SPK A;  3CCE T;  1V76 A;  4RKU E;  2DL5 A;  1EIF A;  2O4X B;  2DZ9 A;  4RG8 A;  2RQT A;  3ME9 A;  2Y90 A;  3RER A;  2YSQ A;  2DRM A;  2B86 A;  2GFU A;  2EYZ A;  2YRD A;  3MP1 A;  3C94 A;  5EC7 A;  3QKJ A;  1ABO A;  5GMK e;  5FWC A;  2KAF A;  3VS2 A;  1HXD A;  4HVV A;  2CUD A;  1YJN A;  1SRL A;  3H6Z A;  1QCF A;  2X3W D;  3EFO A;  3CC4 Q;  2CSI A;  3JRZ A;  2WAC A;  4F7U A;  3HPW A;  5FU6 B;  2LNH B;  2NUT A;  4AFQ C;  1PSF A;  3EG3 A;  2EJ9 A;  1X27 A;  4PLI A;  1OV3 A;  4C0D B;  3VS0 A;  2DO3 A;  4F7U E;  2DVE A;  4A4F A;  2DLP A;  1R0B G;  3LWI A;  4QVD A;  2JOY A;  1B34 A;  2CT4 A;  2O9S A;  2M02 A;  2DJQ A;  3DB4 A;  4RMO A;  5IAY A;  1I07 A;  3DLL A;  2E12 A;  3FJ5 A;  1VQK T;  1BI1 A;  5FW9 A;  2KRO A;  3LGL A;  3OY9 A;  3CCQ T;  1G5V A;  3BDL A;  4CRI A;  2EGA A;  1HYO A;  1NPP A;  1WI7 A;  1VYU A;  5FU6 C;  3CC2 Q;  3NFC A;  1D0Y A;  3VV0 A;  4C0D C;  3HFN A;  1UEB A;  3M55 A;  3X20 B;  1IXD A;  4JJD A;  5IN1 A;  2KQW A;  1X6B A;  4J83 A;  1MV3 A;  2COY A;  3HKS A;  1UUE A;  3INZ A;  3RMS A;  2QEX T;  1Q7Y C;  5KYY A;  3JCM f;  2AHJ B;  2BE9 B;  1VQ6 A;  3JCM J;  1VQ9 T;  2HQX A;  1WHL A;  5GAO q;  3HHT B;  2VGM A;  1T0H A;  1TS9 A;  4A4H A;  1W6X A;  3QYG B;  1NEB A;  3A8O B;  1WHM A;  4JUV A;  4XU3 A;  3ER0 A;  1H3H A;  1T3S A;  2FHD A;  2KDS A;  2NYS A;  1RLQ C;  4XTZ A;  4IUV A;  1YJN Q;  1FMW A;  1QKW A;  1VQ8 A;  1KD1 U;  2CZ6 B;  5AYF A;  1M1K C;  4MZM A;  1YJ9 A;  2HCK A;  1RAH B;  1HJD A;  4CC7 A;  4Z02 A;  1ZBX A;  2V1Q A;  3CCM T;  1N9S A;  1X75 C;  3UDC A;  4FT4 A;  3N5B B;  2PVO B;  2F5T X;  2EYY A;  4P5N A;  2DMO A;  2VC8 A;  4F04 B;  2E1H A;  4FYY B;  4PJO B;  3MP8 A;  5IHK A;  5J3B A;  3M4Y A;  2QXF A;  4PJO D;  2E3H A;  2HD0 A;  2LQW A;  2LJ1 A;  2X4Y A;  3FJP A;  3VS6 A;  4PJJ A;  2F2X A; 
#chains in the Genus database with same CATH homology
 1E7O A;  1JXO A;  2DA9 A;  1WX6 A;  2G6F X;  2O2O A;  1G83 A;  2K6D A;  3TSW A;  1K76 A;  2EYX A;  1QWF A;  2E5K A;  1RLP C;  1FMK A;  1PWT A;  2KRN A;  1LCK A;  1ZX6 A;  1KJW A;  5IXF A;  2W10 A;  4HXJ A;  1YP5 A;  2K79 A;  2SEM A;  1OPL A;  2JTE A;  2RF0 A;  4LNP A;  1GFC A;  1SSH A;  2JMA A;  1BBZ A;  4OMP A;  2AZV A;  4KRT A;  2MIO A;  4FSS A;  4AG1 C;  1AZE A;  1M3B A;  1YWP A;  2J6K A;  2LP5 A;  2K3B A;  5IHI A;  4IIO A;  2FG0 A;  1PHT A;  2KR3 A;  1X2Q A;  2KNB B;  1ZLM A;  2BZ8 A;  1G2B A;  2DE0 X;  2FRW A;  1OPK A;  2ED1 A;  1TUC A;  1RI9 A;  2RMO A;  2D8H A;  3TVT A;  5IH2 A;  2DIL A;  1CKA A;  1WA7 A;  4K11 A;  2IIM A;  4OMO A;  2FEI A;  2YUN A;  1MUZ A;  2LZ6 B;  1AWW A;  1GBQ A;  1PRL C;  2EVR A;  1IO6 A;  1WYX A;  2ENM A;  4Z89 A;  2ESW A;  1W70 A;  2LMJ A;  3U23 A;  3PE0 A;  4JJC A;  2EGC A;  4QT7 A;  4F17 A;  2YUQ A;  3A98 A;  4AG2 C;  4CC3 A;  4ZNX A;  3PVQ A;  1X2K A;  4DEY A;  2H8H A;  2DBK A;  1GL5 A;  1X69 A;  3REB B;  2D0N A;  1UEC A;  4JPB W;  2CH4 W;  2W0Z A;  2J6F A;  3UA7 A;  2ROT A;  2A37 A;  2EW3 A;  5GJV B;  2YDL A;  1WFW A;  3LH5 A;  2GQI A;  1JU5 C;  2DBM A;  1MV0 B;  3CQT A;  4RTZ A;  2JM8 A;  2KE9 A;  1U5S A;  4AFU C;  1EFN A;  1ABQ A;  2FPD A;  3C0C A;  3PVL A;  2C0I A;  3I5R A;  1UDL A;  1AWJ A;  1VYV A;  2M0Y A;  3VS1 A;  2RNA A;  1T3L A;  2YUO A;  4HVW A;  4DEX A;  1WLP B;  1B07 A;  2CDT A;  1ARK A;  1GFD A;  1UJY A;  2LJ3 A;  1GCQ A;  2DM1 A;  1ZUK A;  1WDX A;  1SEM A;  3ULR B;  1GCQ C;  4E6R A;  3M0U A;  2K9G A;  1M8M A;  2DL3 A;  2AZS A;  4Z8A A;  5I22 A;  3RBB B;  4J9F A;  3EG0 A;  2L0A A;  2CSQ A;  4RTT A;  2CT3 A;  2JS2 A;  3NGP A;  1JXM A;  3QWX X;  1X43 A;  1ZBJ A;  2DF6 A;  2ABL A;  1HD3 A;  1Z9Q A;  1UHF A;  4F16 A;  2RQV A;  1K4U S;  2AKL A;  1GBR A;  2HEQ A;  1BB9 A;  1TUD A;  1B3Q A;  2LX7 A;  4J9I A;  1NYG A;  4AFZ C;  2DL4 A;  4JZ4 A;  1RUW A;  2J7I A;  2EPD A;  2J6O A;  2DX1 A;  4RTY A;  2FPF A;  2L3S A;  1AEY A;  1PNJ A;  2FO0 A;  2F2V A;  1X6G A;  1M3C A;  2D1X A;  4LE9 A;  2FPE A;  1QWE A;  1K9A A;  2DL7 A;  3JV3 A;  2F2W A;  2NUZ A;  1BU1 A;  2K2M A;  2VVK A;  2BZY A;  4WCI A;  3TSZ A;  4F14 A;  1AZG B;  2RPN A;  5IXB A;  2LQN A;  3SEM A;  1K0S A;  3EGU A;  2KYB A;  4JZ3 A;  1S1N A;  1Z9Z A;  3VRY A;  2K7A A;  2RQW A;  2KRM A;  1E6G A;  2OI3 A;  4J9H A;  1YN8 A;  4R0K A;  1AOJ A;  1NEG A;  2F2X A;  4Z88 A;  1CKB A;  4D8D A;  1KIK A;  1UTI A;  4OMN A;  2CH4 A;  1V1C A;  2J05 A;  1ZSG A;  2GGR A;  4AFS C;  4RTU A;  2EYW A;  1K1Z A;  2KEA A;  2ROL A;  5HCK A;  2C0O A;  2JXB A;  2L2P A;  1KFZ A;  3EHR A;  3M0T A;  4RTV A;  1FYN A;  1SPK A;  2DYB A;  3I5S A;  1SRM A;  3H0I A;  3M0Q A;  2DL5 A;  2BZX A;  2AK5 A;  1XOV A;  4M4Z A;  2RQT A;  4CC4 B;  1H8K A;  1N5Z A;  1T0J A;  3I9Q A;  4J9G A;  3VRZ A;  2HSP A;  2YSQ A;  2DRM A;  2GNC A;  2B86 A;  2I0N A;  1AWX A;  2EYZ A;  1M30 A;  1ZUU A;  1NM7 A;  2SRC A;  3O5Z A;  4ORZ A;  5EC7 A;  4EIK A;  1NLO C;  1WXT A;  2PTK A;  4RUG A;  4GBQ A;  1ABO A;  2KYM A;  5FWC A;  2EBP A;  2EGE A;  3VS2 A;  1NG2 A;  4HVV A;  1GCP A;  1UG1 A;  1SHG A;  2CUD A;  1SRL A;  1QCF A;  2X3W D;  1J3T A;  3M0R A;  3KFV A;  1Y0M A;  2CSI A;  4RTX A;  3VS7 A;  4RTW A;  2X3X D;  1OOT A;  2KT1 A;  2KXD A;  3THK A;  2LNH B;  4AFQ C;  5ECA A;  3VS5 A;  3EG3 A;  4OMQ A;  1X27 A;  2A36 A;  1OV3 A;  2L3Q A;  2QDL A;  3H41 A;  3VS0 A;  2RQU A;  2KBT A;  4Y92 A;  4D8K A;  2RQR A;  2O9V A;  3REA B;  1I0C A;  2KRS A;  2PNI A;  3IQL A;  2DLP A;  3UF4 A;  1UE9 A;  1YNZ A;  2AKK A;  2VKN A;  2OAW A;  3I35 A;  4HCK A;  2CT4 A;  2O9S A;  4LN2 A;  2M51 A;  1AVZ C;  3EG2 A;  4JJB A;  3UAT A;  2DJQ A;  3QWY A;  4LUE A;  1I07 A;  3H0H A;  4A63 B;  5I11 A;  1JO8 A;  1HSQ A;  3FJ5 A;  5FW9 A;  2KRO A;  1WIE A;  5IHN A;  2LJ0 A;  3R6N A;  2RN8 A;  1M3A A;  2EGA A;  1OEB A;  1PKT A;  1WI7 A;  1VYU A;  2CUB A;  2JM9 A;  1QLY A;  4ESR A;  2J06 A;  2OJ2 A;  4X1V A;  2A28 A;  3UA6 A;  3RNJ A;  3SHW A;  1K0X A;  4JJD A;  1X6B A;  4HVU A;  2L3P A;  1QKX A;  2GTJ A;  2JT4 A;  1UJ0 A;  2O88 A;  1MV3 A;  1E6H A;  1H92 A;  2GBQ A;  2MOX A;  1KSW A;  1UUE A;  4J9E A;  2JS0 A;  4J9C A;  4IIM A;  5FWB A;  3NHN A;  4GLM A;  1PRM C;  1YWO A;  1ZUY A;  1T0H A;  2YT6 A;  4J9B A;  1JEG A;  1W6X A;  2KGT A;  1PKS A;  1NEB A;  2YUP A;  1M27 C;  1U06 A;  2GTO A;  2JW4 A;  1NLP C;  3GBQ A;  1CSK A;  1TG0 A;  1JQQ A;  1H3H A;  1T3S A;  1VA7 A;  2P4R A;  2DRK A;  1RLQ C;  1BK2 A;  3M0P A;  4J9D A;  2A08 A;  2O31 A;  1UHC A;  5L23 A;  1QKW A;  2NWM A;  3VS3 A;  2DL8 A;  2ED0 A;  1SHF A;  4CC2 A;  1I1J A;  2V1R A;  2XMF A;  2DVJ A;  2PZ1 A;  2EKH A;  2HCK A;  2KXC A;  1HJD A;  2HDA A;  4CC7 A;  1GRI A;  2V1Q A;  2CRE A;  2JMC A;  1A0N B;  1VYT A;  1AD5 A;  2C0T A;  3NPF A;  2KT8 A;  4OML A;  1U3O A;  1W1F A;  2EYY A;  3M0S A;  1NYF A;  1AWO A;  3ZL7 C;  4OMM A;  3EHQ A;  2DMO A;  3NMZ C;  2HBW A;  2BTT A;  1WXB A;  3H0F A;  2VWF A;  2D8J A;  5IHK A;  1Y57 A;  2EQI A;  3VS4 A;  5GJW B;  2LCS A;  2FRY A;  4LUD A;  2LQW A;  3EG1 A;  2MCN A;  1UFF A;  2LJ1 A;  1YCS B;  3VS6 A;  1UGV A;  1WXU A;  2ECZ A;  2DNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...