1GFCA

Solution structure and ligand-binding site of the c-terminal sh3 domain of grb2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
b'GSTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
publication title Solution structure and ligand-binding site of the carboxy-terminal SH3 domain of GRB2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Adaptor protein containing sh2 and sh3
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1994-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gfcA00
3ULRB 4JPBW 1WA7A 3UATA 3QWXX 2IIMA 4ESRA 4OMOA 2X3XD 4LE9A 3FJ5A 2L2PA 3R6NA 2B86A 3GBQA 1KSWA 1HSQA 2HDAA 2DBKA 1UGVA 2DJQA 1VYVA 1M3CA 1PKSA 3EG0A 4J9CA 3VS4A 2D8HA 4DEYA 2RF0A 1GBRA 4AFZC 2ESWA 2KYBA 2EBPA 2DNUA 1ZUKA 1PRLC 2I0NA 1TUCA 2AKLA 4ZNXA 2VKNA 2V1QA 1GCPA 1MV0B 2EQIA 2ENMA 2J05A 2CUBA 4Y92A 2LNHB 2FG0A 1X2QA 4Z88A 1N5ZA 1Z9ZA 2K3BA 2FPDA 2LJ0A 2BZYA 1SSHA 1H3HA 2MCNA 1JO8A 1SEMA 1NEGA 4JZ3A 3M0RA 2KR3A 2J6FA 1V1CA 2AKKA 4OMQA 1RLPC 1UHFA 4J9GA 1M27C 2X3WD 2E5KA 1J3TA 2CUDA 1UJYA 2EPDA 1AZEA 2H8HA 2DRMA 1YP5A 2FRWA 3VS6A 2GTOA 1QWEA 1B3QA 2GQIA 3SHWA 5FW9A 1JEGA 2YSQA 2FO0A 1UDLA 2KT1A 1WLPB 4RUGA 2BZXA 2L3SA 2O9VA 2DL4A 2JM8A 2ROTA 1SHFA 3NMZC 4HVWA 3VS1A 1QKWA 3KFVA 2KE9A 2LCSA 1EFNA 1YNZA 2A37A 4EIKA 1K0XA 3PE0A 4A63B 2NWMA 1S1NA 3RBBB 4RTYA 5IHKA 2KROA 3I9QA 2JM9A 3M0UA 2CREA 1E6GA 2JS0A 4HVVA 1X43A 2DE0X 1UHCA 1NYFA 2D8JA 4LN2A 1SRMA 1X6GA 2ED1A 2ED0A 1JU5C 3VRYA 3CQTA 1PHTA 1I07A 4CC7A 3THKA 5GJWB 2PZ1A 1Y0MA 2DL5A 1WXBA 2DX1A 2M0YA 1FMKA 3IQLA 2EVRA 2VWFA 1AD5A 4JJDA 3EHRA 3REAB 3A98A 4FSSA 1K4US 1KJWA 4Z8AA 4OMLA 2RN8A 3I5SA 2SEMA 2JMAA 3NHNA 1KFZA 3EG3A 1I0CA 1GCQC 4KRTA 4F14A 5GJVB 2LJ1A 2L0AA 1NLOC 1UG1A 1UE9A 1NG2A 2PNIA 3H0FA 4J9FA 2C0IA 5IXBA 4J9BA 1I1JA 2KGTA 1H92A 2XMFA 1UUEA 1SHGA 4OMPA 2EGCA 1WXTA 1OPLA 1BK2A 1G83A 1GL5A 2V1RA 1SPKA 2DA9A 4K11A 5IXFA 2A28A 2F2VA 2AZSA 2YDLA 1AWXA 4RTXA 1ARKA 4LNPA 1B07A 1RLQC 2EYWA 2AK5A 2CT4A 5IHIA 2RMOA 2ABLA 1H8KA 2C0OA 4D8DA 1M30A 1UECA 4ORZA 1AEYA 1Z9QA 2JT4A 1ABOA 1T3SA 2KXCA 3VRZA 1AWJA 2PTKA 2DMOA 2MOXA 3PVLA 2J6KA 1SRLA 1ZSGA 2EYYA 4JJBA 2DYBA 2YT6A 2LP5A 1VYTA 2EKHA 2FPEA 2FEIA 2RQUA 3VS0A 4RTUA 2KRSA 2JXBA 3UF4A 3ZL7C 1K0SA 2DL8A 1K1ZA 2DLPA 2F2WA 1WYXA 2OI3A 2K79A 2YUPA 4OMMA 1NYGA 2RNAA 1AWOA 2DRKA 2DBMA 1JXOA 4GLMA 1T0JA 1RI9A 1UTIA 1XOVA 2G6FX 1CKBA 2O2OA 1GRIA 1X27A 2GNCA 3SEMA 1ZLMA 3NPFA 1WI7A 1U06A 2K2MA 1M3AA 4DEXA 1IO6A 2JW4A 2LQWA 2HSPA 5FWCA 2EW3A 4CC3A 1K9AA 1WFWA 4AG2C 1OV3A 3M0SA 2YUOA 3JV3A 2OJ2A 1W70A 5I22A 4RTTA 4RTVA 3U23A 1Y57A 1PRMC 2HEQA 2O31A 4R0KA 5IH2A 3UA6A 4WCIA 1E6HA 2LZ6B 2KT8A 2KYMA 2CDTA 1TUDA 2HBWA 4IIOA 1U5SA 2YUQA 1NLPC 2FPFA 2KNBB 1WIEA 2CH4W 4HXJA 2BTTA 2CSQA 1T3LA 4RTZA 2GGRA 1YCSB 1FYNA 2CT3A 5L23A 4HCKA 1WX6A 1AWWA 1AOJA 2W0ZA 4CC4B 1QLYA 4OMNA 1M8MA 2P4RA 3EGUA 2D0NA 3VS2A 3VS5A 3VS7A 2OAWA 2K7AA 1PNJA 2RPNA 3UA7A 1GFDA 1X6BA 4F16A 5HCKA 1WXUA 2LJ3A 2RQRA 2BZ8A 4AFUC 2W10A 1NEBA 4AFQC 4IIMA 4J9HA 4J9IA 2D1XA 4AG1C 3PVQA 3EHQA 2J06A 4JJCA 4J9EA 1JQQA 4J9DA 3TSWA 1M3BA 2L3QA 2KEAA 2RQWA 1ABQA 2K9GA 3RNJA 3EG1A 1ZUYA 1BB9A 1TG0A 2EYXA 5EC7A 3TSZA 4AFSC 2AZVA 4JZ4A 3H0HA 2VVKA 2A08A 2DF6A 1K76A 1A0NB 1MV3A 3TVTA 2LQNA 3I35A 3I5RA 3M0QA 1ZBJA 4CC2A 2RQVA 1WDXA 3LH5A 1YWPA 2HCKA 1PWTA 2DILA 1GBQA 2RQTA 4LUEA 1BBZA 2KBTA 1U3OA 1YWOA 2J7IA 1NM7A 1ZUUA 4HVUA 4F17A 3M0TA 1YN8A 2J6OA 1JXMA 1OEBA 1QCFA 2L3PA 1UFFA 2DL7A 2EGAA 1GFCA 2DL3A 2GTJA 2MIOA 3EG2A 2EGEA 1T0HA 2CSIA 2C0TA 4X1VA 1HD3A 2EYZA 3H41A 2A36A 5FWBA 1VA7A 2KRMA 3M0PA 2GBQA 2KXDA 2CH4A 2K6DA 3QWYA 4LUDA 4RTWA 1RUWA 2ROLA 2F2XA 2KRNA 1BU1A 1AZGB 4QT7A 1AVZC 3H0IA 1LCKA 1W6XA 1VYUA 2O9SA 2LX7A 3VS3A 2JMCA 1QWFA 1HJDA 4Z89A 1UJ0A 2QDLA 3NGPA 1QKXA 1ZX6A 5IHNA 1MUZA 1X2KA 4M4ZA 2JS2A 2O88A 2FRYA 1GCQA 2ECZA 1G2BA 4GBQA 1KIKA 2M51A 3O5ZA 4D8KA 1OOTA 4E6RA 1CKAA 1CSKA 1W1FA 1OPKA 2NUZA 1PKTA 2LMJA 3C0CA 2DVJA 1E7OA 1X69A 3REBB 5I11A 2YUNA 5ECAA 2DM1A 2SRCA 2JTEA
chains in the Genus database with same CATH superfamily
4IUPA 4JPBW 3CCUT 3GOXA 2NLUA 3QWXX 3FJ5A 4XU1A 4M77E 3R6NA 5GAMd 4DQ2A 1HXDA 5GAN8 1KSWA 4N4IA 1W4SA 3MEAA 2DJQA 1ZA1B 2ZZDA 3J81E 1XNIA 3JCMX 1WHKA 2XD0A 1D1BA 2V8KA 3CPWS 2MI6A 1GBRA 2KYBA 5GAMe 1M5Q1 2VV5A 2DNUA 1ZUKA 1YJNQ 4M7AD 2AKLA 4ZNXA 1GCPA 4E7LA 4N0AA 5J26A 3EAEA 2CGHA 2L8DA 5LJ3e 4Y92A 2EQKA 1D3BA 2VC8A 1K9MR 2FPDA 4NOYA 1RAEB 1VQ4T 3QZ5B 2MCNA 1KD1U 1SEMA 3G6EQ 4C0DB 4EMHA 3CC7Q 3M0RA 1K73R 2RHUA 4OMQA 3PIPA 4M7DB 4J5YA 1UHFA 4M77G 3UPUA 2X3WD 2E5KA 3PTAA 1WHMA 1QP3A 3QIIA 4CI0C 1YJ9T 1VQOT 1R8OB 2H8HA 3VS6A 3JCMc 1OZ3A 4PJNA 1NPPA 2YSQA 3CCJQ 1UDLA 3CC2Q 1KC8U 3V7SA 2BZXA 3E1SA 2P0KA 4M78E 5GAN5 1QW1A 3EGXB 3NMZC 4HVWA 4MDXA 1QKWA 5GMKi 4M77A 2Y4YA 3OYMA 3KFVA 4Z02A 2LCSA 1LPLA 4EIKA 1WQ7A 2AHJB 2ZPGB 2NWMA 1S1NA 5IHKA 1FMWA 3HHTB 3CCRQ 3M0UA 1BI0A 5CAIA 2XDPA 5LJ3j 1Y71A 3EFOB 2E65A 2D8JA 4C8QD 3G6EA 3EGDA 2ED1A 4JRKA 3M5AA 4E47A 3CC7A 1M1KR 3A1PA 5GJWB 5KYXA 3P8HA 2DL5A 5GAOq 1WXBA 3FDRA 4AT1B 1K8AR 2DIQA 1G5VA 3HRTA 4EMGA 4KT0E 1OZ2A 2EVRA 1G3TA 4OB2B 3EHRA 1M9SA 5LJ5f 4E7ZA 4FSSA 4M78G 3ZEHA 4HT9A 4OMLA 3JCMh 3RMQA 3CCJA 3CC2A 2K3XA 1VQ6Q 4KRTA 4BI3A 4F14A 1FX7A 3H0FA 4A4HA 3BY7A 5GMKl 4GLKA 3L2QA 5IXBA 3CCST 2KGTA 3QSUA 1UUEA 2XU8A 4OMPA 2EGCA 3N5BB 1WXTA 1YITQ 5KCOA 4XK8E 1BK2A 4JS4A 2DTOA 1GL5A 1QCOA 2YDLA 2BE7D 3CCRA 3UT1A 4RKUE 5CKFA 1RLQC 1WJRA 2RMOA 2ABLA 3JB9G 1M30A 1UECA 2RM4A 3JRZA 3CXCS 1Z9QA 2HZYA 1ABOA 2KXCA 1Y96B 2QTXA 1AWJA 2PQWA 2MOXA 3PVLA 2NUTB 4M75D 2EYYA 1QVFS 3OYGA 2LP5A 5D6YA 1PM3A 2FPEA 1K73C 2YRDA 2MYSA 1K0SA 3X28B 4JUVA 2X35A 4C5IA 4N0AC 5IT9E 2RNAA 1AWOA 2DRKA 3KBGA 3HSBA 3G1JA 3KUFA 1JXOA 2JTMA 2DO3A 3JB9H 1UTIA 2G6FX 1JJ2S 1M1GA 4PFZA 1X27A 1AT1B 2HD0A 1D1CA 3OS0A 3L1AA 3FJPA 1U06A 2PU9B 1M3AA 4DEXA 2QEXT 5CO7A 1YITA 4JLGA 2JW4A 2LQWA 1QVGP 4ZGEB 1WFWA 3S3MA 2YLBA 1RL2A 3M0SA 2YUOA 4R55A 4P5NA 4RTVA 3U23A 2DPPB 1PRMC 3LLRA 1IXDA 2E6NA 2OTLT 4PK4A 2CDTA 4XU3A 1TUDA 3CMAT 1U5SA 5DM7R 2FPFA 4X9CA 1WIEA 3CD6Q 3LGFA 3MCAB 3A5ZB 3BDUA 3OMCA 5I2SA 4N4GA 4FYXB 1FYNA 1MNDA 2JUFA 2CT3A 2HQXA 4QVDA 2P0PA 5L23A 4HCKA 4PJOE 1M1KC 1AWWA 3OYBA 1TUGB 4M77C 3OMGA 4XTWA 1M8MA 4E7IA 4BUGA 1IREB 1K8AC 2EJGA 2R5MA 2RPNA 3CMET 2HSEB 2OTJT 1X6BA 2VUBA 4FT4A 2LJ3A 4QQDA 4BB7A 3E9GA 2W10A 5KYUA 2KK4A 3PVQA 3EHQA 3GIBA 3QUIA 4J9EA 1PSEA 5IAYA 2E4HA 1M3BA 2KEAA 3F70A 3HTRA 2K9GA 2EYXA 3JSCA 5FRMA 2AZVA 2LDMA 3SD4A 4B9XA 4HCZA 1PD1A 4XQ3A 3TVTA 3JCMf 4C5HA 4PJOG 4DOWA 4PNOA 3ME9A 4CC2A 5GANh 3CD6A 2QQ9A 3LH5A 1W2BS 2HCKA 5GAN7 3G71Q 1LVKA 1PWTA 2Y4XA 2GCXA 2ZGWA 3OS5A 3JCMV 1U3OA 2FL7A 5LJ5d 1YWOA 1VQ9T 3M55A 1WJQA 2QDYB 4HVUA 3M0TA 1YN8A 5CCAA 2QASA 3GNFB 2DL7A 2BUDA 4II1A 4D6WA 2MIOA 3OYNA 2R58A 4RG8A 1Q86C 1KD1R 1UEBA 1QVPA 1NZ9A 1HD3A 3H41A 1S72T 4PJOA 4FYWB 4M7AF 5GMKh 4MMLA 1HK9A 3MP8A 2GBQA 1WZOA 2ZCFB 4LUDA 3META 5HK3A 2FB7A 4NL2A 2GFAA 1BU1A 2L89A 2QTVA 3OS1A 3H0IA 1VYUA 2LX7A 1D3BB 2CP7A 5DLOA 1HJDA 3VU3C 1YHQT 1ACMB 1PD0A 1MUZA 1BI3A 4M4ZA 3EFSA 4JDSA 1KC8R 1VQMQ 1NJIU 1EIFA 1G3YA 2ZPFB 3AT1B 1YJWQ 2CP6A 1KQ1A 3D7SB 2DETA 2COWA 2F1LA 1EZZB 3G71A 2DVJA 1VQPT 1E7OA 3NFCA 3Q1JA 3REBB 1SSFA 1TOVA 4J6XA 1IHWA 2BKDN 2FYKA 3ULRB 1IZ6A 5CQYA 3UATA 4OMOA 4M78D 2L2PA 1YIJT 3TU4K 5HKCA 4LDVA 4PJLA 1RAAB 3GLXA 3FIFA 3PNWC 5GMKm 1OX8A 5KE3A 4C92F 4M77B 2JJ9A 3CBPA 3M4YA 3EG0A 4J9CA 1VIEA 5KYYA 2D8HA 1QQJA 2RF0A 4DEYA 4BI4A 1QVFP 1ZBXA 2QGGA 1PRLC 1NE8A 4FSXA 2E10A 4C8QF 3OYHA 1TUCA 1Q86U 4BY6C 1M2OA 3OB9A 2EQIA 2CUBA 5CKBA 4F7UF 2LNHB 2EIFA 1B34A 2R57A 1N5ZA 4Z88A 1VQMA 3EGDB 2HKNA 1Z9ZA 1YJWA 4BE0A 1SSHA 3CCUQ 1NEGA 1JJ2P 2EWNA 2ZPIB 2J6FA 1V1CA 4QQGA 4J7FA 2XDDA 3EH1A 3TEEA 4FIBA 1VQ8T 2KY9A 2QQAA 3UDCA 4HCCA 2CUDA 2EPDA 5J39A 4BE2A 3QG1A 1AZEA 2LQ8A 3WXMB 2DRMA 1QWEA 1B3QA 3SHWA 2CP3A 5FW9A 3CC4Q 2FHDA 4ANJA 4KH0B 3V8LA 5GANg 3BFMA 1IRXA 3J80E 2L3SA 2O9VA 5GANf 1KD1C 5C6SA 1VQ7T 1SHFA 4M7DD 1VQ4Q 2DD5A 4ZGJB 4OB1B 1VUBA 5FLXE 2K57A 2X4YA 2V26A 3RBBB 3JCMd 3HP9A 1FMVA 1H3ZA 4J8OA 1ZSZB 2JM9A 4V2SA 3PMTA 2EYQA 2RHZA 4M75F 2JS0A 4LD6A 5AT1B 3G4ST 2YXYA 2DD4A 4LN2A 4Y91A 1X75C 1M4ZA 1YJ9Q 1KC8C 4PJOC 4DA4A 3BDLA 2LQKA 2PUOB 3CQTA 3RKXA 3OA6A 1BIAA 3CBOA 3THKA 5KYWB 2M9UA 3QKJA 3RERA 2DZCA 2WSFE 1FMKA 3REAB 1K4US 3SDZA 2RN8A 3CC4A 4MMKA 3EG3A 5FU7C 2QQBA 2ZPEB 3TQ7P 5DLQE 4KGVB 2LJ1A 3HKSA 2CP2A 1NLOC 1UE9A 1NG2A 2PNIA 2DXUA 4J9FA 2C0IA 3R6OA 2RO0A 2EQJA 1P92A 4J9BA 1I1JA 2X9HA 3RIRA 8ATCB 1H92A 1I8FA 2DFUA 4FYYB 1W2BP 4MZPA 4Q5WA 2K5IA 2KI7A 1VQ4A 2VYTA 1G83A 2V1RA 4XTYA 1D1AA 3RESA 2DEUA 1V29B 3MJXA 2QA4Q 3URGA 2EYWA 2CT4A 4WF2A 4ELZC 1ZHIA 4D8DA 2FVUA 1YJ9A 2JT4A 3VKIA 1Y07A 3LW5E 3CCQQ 2RD1A 2DMOA 2DAQA 4JRQA 2O4XA 2RJCA 1RABB 1D09B 2X4JA 4BY6B 2H3JA 2QG9B 2P84A 3VS0A 4KUIA 3BW1A 5D7UA 3ZL7C 1X6OA 5GAN4 3CCSQ 2DL8A 1K1ZA 2F2WA 2NUPA 2OI3A 1H641 4XAXB 1N9RA 3HL8A 4O6JA 4OMMA 3I56T 2DBMA 3QBYA 5KYUB 2E1HA 1MMAA 3MEWA 1XOVA 3L2RA 2DXTA 3C4SA 2GNCA 5AYFA 2XICA 3RDVA 2HAXA 3SEMA 1WI7A 5FRNA 1YJNA 4IUQA 5GAMj 5C0MA 1K9AA 4AG2C 3H6ZA 4A53A 3AHUA 5LL6S 1JRIA 2QA4A 1Y57A 2HEQA 4WCIA 2LZ6B 2KYMA 1KHCA 1WHJA 3E2UA 4XTVA 3QJYA 3ZBDA 4OMFB 2VXEA 4O5VA 3CCQA 2BTTA 2PVGB 1ZQ1A 4RTZA 2GGRA 2OX7A 1YI2T 3QPHA 5LJ5g 3RMSA 1RAFB 1EX4A 1I4K1 1FXXA 1AOJA 5GAN3 1QLYA 9ATCB 4OMNA 2P4RA 2D0NA 2DVEA 6AT1B 1IHVA 1NJIR 2MAMA 2HL3A 4PJOB 3CCEQ 2Y90A 2EQUA 5GANd 1GFDA 4ME7A 2E12A 2QI2A 1NPRA 2EAYA 1WXUA 2E41A 2RHXA 4AFQC 4J9HA 4J9IA 2D1XA 5GAOl 2OTLQ 4AG1C 4A4EA 3JCMJ 4JJCA 3L2VA 1KQSP 3OYFA 1SF9A 3A8OB 2E70A 3RNJA 5FU7B 3TSZA 3C12A 5EC7A 2VVKA 1ZSZA 3CC2T 2DF6A 1AHJB 2WACA 3I35A 5M9OA 3L2UA 1M2VA 5KE2A 1OQKA 2D6FA 4DBRA 3CMEQ 2OTJQ 2KAFA 5KYWA 1GBQA 3OYJA 3M56A 4KGXB 1Q86R 5GMKe 3CCRT 2DEQA 1ZUUA 5LJ3h 2X51A 2J6OA 1JXMA 2PUKB 1QCFA 2QQSA 1VQ6A 2EGAA 4C92B 3CCEA 2DL3A 2GTJA 2LTOA 2B8AA 4DBHA 3EG2A 4C0FA 2EGEA 4DOVA 4FCYA 1N8RU 2ZPHB 3CBMA 2F5TX 3VUBA 5CVIA 5KYYB 1VA7A 2KRMA 1Y7XA 2CZ6B 2K6DA 2XKOC 2ROLA 4B9WA 2DIGA 2F2XA 1AZGB 4QT7A 3UWNA 1UGQB 1AVZC 3A8HB 1O9SA 2O9SA 1B34B 3MP6A 1TU0B 4PLIA 1C0MA 5IHNA 2JS2A 1BIBA 4MZTA 1VQ9Q 4ELYC 2QQRA 1G2BA 4E6RA 1QMCA 4PL6A 2H3EB 1CSKA 3GF5A 4MDWA 1YITT 2FZKB 2E3HA 3LH0A 5KH6A 3CMEA 3CPWP 2NUZA 2OTJA 1VOMA 1X69A 1PCXA 5I11A 1S72Q 5ECAA 4OB3B 3CCLT 2HBPA 1WA7A 2YRVA 2IIMA 4ESRA 2JTFA 2X3XD 4LE9A 2I2LA 4L5GA 1KK7A 1D0XA 4M7DF 3GBQA 5GAN2 3P8DA 1JBMA 1HSQA 1OU8A 1NJIC 5HY6A 1OU9A 2DBKA 1UGVA 4OP0A 1G3SA 2XIDA 3M58A 4FL6A 1M3CA 3JCMP 1RAIB 4JRPA 2RK1A 4KH1B 2CZ1B 4AFZC 2ESWA 4FU6A 2DZ9A 2I0NA 3JCMg 3OYIA 2V1QA 3SWNA 1MV0B 3CCMQ 1VQPQ 2J05A 3EG9B 4QQ6A 2COZA 1X2QA 1VQ9A 3OS2A 2K3BA 1VQ5T 2BZYA 4JZ3A 1I81A 1YIJQ 4M77D 4C92E 1IB8A 2KR3A 3HRSA 2LC4A 2LCLA 5A0GA 1S72A 4E7KA 1M27C 3JB9J 1LNXA 2O01E 1Q82C 5CR2A 2DXCA 2FZCB 3MKDA 4C8QE 2JNGA 5GAOn 2F5KA 3L2WA 1KG1A 4M7AA 1VQKQ 5LJ5e 3HRUA 1ZSZC 4LD9K 1VQNQ 2FO0A 3QZ9B 3QDRB 4C5EA 3CD6T 2KT1A 1XTDA 1D0ZA 2BIVA 2M16A 4RUGA 3LWIA 3M53A 1MMDA 2DL4A 1U1SA 2JM8A 2ROTA 1F1BB 2ZPBB 3CCVT 3VYGA 4QVZA 2F69A 5LJ3g 1EFNA 1YNZA 2A37A 4PFPA 1K0XA 3DB3A 5LJ3f 1BYMA 3OYAA 3CCMA 4EPCA 2KROA 1VQPA 1NBEB 1IGUA 3I9QA 1TXQA 1VQ8Q 2CREA 1E6GA 4C92G 4HVVA 2RH2A 1X43A 3PMIA 1M1FA 2O4XB 1WGSA 2RI3A 1SRMA 4TVRA 3DB4A 1X01A 2ED0A 3I55T 3VRYA 1YIJA 2C06A 2MF2A 4C8QG 2A0FB 2NUPB 1XJWB 2KVQG 5FU6C 4E7HA 2VWFA 3A98A 4LDWA 1VQKA 3RKYA 1KJWA 4Z8AA 4C92A 3RR6A 2SEMA 1VQNA 3X24B 4M75E 2R5AA 2KMTA 3GPLA 3CXCP 1VQLT 1I0CA 5LJ5j 1KFZA 1RADB 4E7SA 5GJVB 2L0AA 3G71T 2X4XA 1TH7A 1Q82U 1WHHA 5GAOm 4C8QA 3G4SQ 5CK9A 1OPLA 4FW2A 4F7UA 2MPXC 2DA9A 5IXFA 2A28A 2AZSA 3L42A 2IG0A 4RTXA 3M4GA 1B07A 1VQ8A 4XU0A 3JB9D 4PJJA 3EFRA 1R0BG 2X4WA 4IUUA 4OGEA 1H8KA 4ORZA 3OW2S 1AEYA 1KQSA 1T3SA 2EJ9A 3VRZA 3CPFA 3PT9A 2DKGA 5CKHA 1YCYA 2J6KA 1SRLA 2DYBA 2YT6A 2Z0WA 1VYTA 2EKHA 4LXCA 2FEIA 4M75G 2KRSA 2DXBA 3ZFJA 2DLPA 2V8IA 1VQMT 2K2VA 4KGZB 1VIFA 3QDFA 3SWNC 4E7JA 1YJWT 2K79A 2VB6A 1NYGA 1RI0A 3P8BB 1SKUB 4IKFA 3SB2A 1T0JA 2NYSA 3GNGA 5A0DA 1CKBA 2O2OA 4QKUA 3NPFA 2K2MA 3OYKA 3FEOA 3G4SA 3RKWA 3MP1A 3LX7A 1IGQA 2XK0A 2HKQB 3ASKA 1Q7YC 2XG8D 2EW3A 2RJDA 2LVMA 4IUVA 4M75A 4CC3A 2K3YA 2YWWA 1OV3A 3JB9I 3M9QA 3JV3A 5I22A 4L6V5 2O31A 3EG9A 4X9DA 1G3WA 1M2VB 3CCUA 1N8RR 1U1TA 4HKEA 2JZ2A 4UC4A 2KT8A 4M7AC 1VQOQ 2HBWA 1QVGA 3H8ZA 3JCMe 2YUQA 4BDYA 1NLPC 4HT8A 4HXJA 1PG5B 1T3LA 3I56Q 1C1AA 2CS7A 1TWBA 3OYDA 3OY9A 4J6YA 2E3IA 4J6WA 3V8JA 4RCCA 1YBYA 1Q81U 2QK0A 3S6WA 1B7TA 3VS5A 2K7AA 3J7AF 3HFOA 3CPWA 3NTKA 4F16A 5HCKA 2RQRA 4JJNK 1D0YA 3OYEA 1NEBA 4XTUA 4IIMA 2HQHA 5FU6B 3M57A 1UGRB 2J06A 5LJ3d 4A54A 4R56A 3C95A 1JQQA 4C0GA 2L3QA 2RQWA 1KHIA 2XI9A 1ABQA 3EG1A 1ZUYA 1TG0A 4AFSC 4JZ4A 3CC4T 2A08A 2XDBA 1YI2Q 1RACB 2PVDB 1A0NB 1MV3A 3DLMA 4PJOD 4X34A 1VQOA 4C92C 1M90C 2WSCE 1N9SA 1RAGB 3I5RA 5D6XA 3M0QA 1ZBJA 1Q7YU 2RQVA 1WDXA 2BE9B 1KQ2A 3I56A 4EDUA 1YWPA 2VASA 3VJPA 2YLCA 3GP8A 4C8QC 1ZA2B 2E64A 4LUEA 1BBZA 2KBTA 3H9NA 1BI1A 2J7IA 3E9FA 5CKDA 1BCMA 4KBMB 1OEBA 1OYXA 1UFFA 3PIOA 1R77A 1T0HA 2CP0A 2LCCA 2C0TA 2EYZA 2K4YA 3L2ZA 5GAOp 4Y28E 5FWBA 1PSFA 2D9TA 3OSSC 2CZ0B 2KSSA 2KXDA 3A8MB 3QWYA 5A2QE 3SWNB 1MGQA 4OGCA 1LCKA 1XQHA 3VS3A 2JMCA 4Z89A 1UJ0A 2QDLA 3NGPA 1QKXA 1ZX6A 4M77F 1YI2A 2O88A 3PFSA 4C92D 1GCQA 2HL5C 1UGSB 2ECZA 4GBQA 3VYHB 1KIKA 2K5LA 2M51A 3O5ZA 4D8KA 2HQEA 2MK5A 3V8KA 1N8RC 4FW1A 1YJNT 1LOJA 1W1FA 2EFIA 1OPKA 3VV0A 3FB9A 2AIRB 2QAZA 1PKTA 4FM4B 2CZ7B 1U8RA 2M1HA 3CCSA 1MHNA 2VGMA 2QEXQ 2DM1A 2SRCA 4M7AB 2JTEA 4BI8B 2HMAA 2QA4T 4M75C 1M90U 1OX9A 3G6ET 4ATOA 2FZGB 3CC7T 3V7CA 5I21A 1G8XA 2B86A 2YHTA 4B6MA 3CCQT 2HDAA 1VYVA 4XU2A 3CMAQ 3OW2P 4JRIA 1QP2A 5KCHA 3HFNA 1PKSA 2DJZA 3QO3A 4EMKA 5GANe 3OBWA 3FLGA 3VS4A 3E19A 3QYGB 2EBPA 1V76A 3CCJT 2VKNA 4OB0B 1BI2A 3CXCA 2ENMA 4XTXA 5A0LA 3WVDB 2FG0A 1TSFA 4MZMA 1PC0A 1QVFA 4M78A 3CCLQ 2WSEE 4M7DE 2LJ0A 5I2MA 1Q82R 5GAN6 2K5FA 1H3HA 5GAMh 4J7IA 1JO8A 4M78F 5GAOr 2ATCB 3CEYA 2VXFA 3OQ5A 4IUTA 2JOYA 1BCOA 2AKKA 1C6VX 3M59A 2EKOA 1K9MC 1RLPC 4J9GA 2GF7A 2QEXA 4RG2A 1J3TA 3RUXA 1UJYA 1JJ2A 1TS9A 1WJSA 1YP5A 2FRWA 3FC3A 2GTOA 2GQIA 2MWOA 1BKBA 3V7RA 2RB6A 2QGFB 1JEGA 1DJ7B 4PKCC 2JVVA 4FYVB 4E2FB 2LT1A 4C8QB 1WLPB 3ER0A 2OTLA 3CMAA 1Q95G 4XTZA 3TREA 2RK2A 4F7UB 2AT1B 3KXTA 4BE1A 3VS1A 3JB9F 2XHCA 4J83A 1N6AA 1WHLA 3X20B 1VQ5Q 4WTOB 1WNLA 5GANj 4HCBA 2KE9A 4ZGDB 1VQ6T 4M7DG 3PE0A 4A63B 2GQVA 3CCET 4RTYA 2HNIA 2JN0A 1LJOA 2COYA 1JB0E 2DE0X 4A4KA 2DTHA 3CCLA 1UHCA 1NYFA 4M7AE 3PGGA 2OAUA 4AMCA 2QYZA 1X6GA 4LDUA 4BD3A 4RCBA 1JU5C 3LYIA 4L59A 5EG2A 1PHTA 4ZTFA 1I07A 4CC7A 2PZ1A 1Y0MA 2IPOB 5GMKj 2EQMA 2DX1A 2M0YA 3OYLA 4RMOA 4M7DA 3IQLA 2KQWA 5KYNA 1AD5A 4JJDA 1MMGA 2M0OA 3CCVQ 1YHQQ 3I5SA 2JMAA 3NHNA 3X26B 4JLIA 1GCQC 1K9MU 2DERA 4C5GA 3OBYA 4ZN1A 1UG1A 2D0QB 4QVCA 4M75B 2XMFA 1SHGA 1VQ5A 1K73U 3EGXA 1SPKA 3I55Q 4M7AG 4K11A 2F2VA 1Q81R 1AWXA 3DLLA 1ARKA 3MEUA 4LNPA 3C94A 2L3RA 2AK5A 1W2BA 5IHIA 2C0OA 3EH2A 2CKKA 7AT1B 4C0ZA 2LRQA 4BDZA 4PLLA 3EFOA 2E6ZA 2PTKA 4A4FA 2RJEA 1ZSGA 4JJBA 3OYYA 1VQLQ 4EMKC 3FRNA 2RQUA 4RTUA 2JXBA 3UF4A 4FT2A 1HYOA 4F7UE 4DBQA 3CCVA 3TCJA 3VUZA 1WYXA 1GXIE 1YHQA 2YUPA 2A7YA 2GFUA 1RAHB 2DK3A 4GLMA 1Q7YR 1RI9A 5GAMg 2P4TA 2LT4A 4M78C 2QXFA 1GRIA 5GAMf 2RA2A 1ZLMA 2RI5A 4NS5A 3MO8A 1M1KU 1IO6A 4OVAA 4PJOF 2P0QA 1UGPB 5FWCA 2HSPA 4ZTJA 3I55A 5FROA 2RJFA 1N27A 2OJ2A 2VGNA 1K8AU 1W70A 1UB4A 4RTTA 4R0KA 5IH2A 3UA6A 1E6HA 1OULA 4PJMA 4GY5A 4IIOA 3LGLA 4LDYA 2DTIA 2KNBB 3MEVA 2CH4W 1MMNA 2CSQA 4F7UG 4NL3A 4DBFA 1YCSB 5CKEA 1VQLA 2E5QA 3HPWA 1Y96A 1VQ7Q 4KUDK 2NUTA 3NTHA 1WX6A 3CCMT 3A8LB 2W0ZA 4CC4B 2LX9A 4ZN3A 3EGUA 3VS2A 4CRIA 3OYCA 3VS7A 5CQXA 2OAWA 1PNJA 2M02A 2A3LA 3M54A 3UA7A 1WQWA 4KULA 5DY9A 2DYIA 2BZ8A 2EJFA 4AFUC 3MPUB 4PFOA 2YRCA 2ZAEA 5IN1A 3QHSA 5CIUA 4J9DA 3TSWA 3G7ZA 4C0DC 1M90R 5HK0A 2LNVA 3QXEB 2KDSA 1SG5A 1VQKT 1M8VA 2CYZB 1BB9A 2PVOB 5D6WA 1VQNT 4M7DC 3H0HA 5L8RE 3QJ6A 3MHXA 1K76A 3OW2A 1Q81C 2LQNA 3A8GB 2IVWA 1OI1A 2MWPA 3JCMb 1FWZA 2RI2A 3OSVA 3WVEB 1O75A 3BE3A 2DILA 2RQTA 5KYXB 1VQ7A 5J3BA 1NM7A 1KQSS 2G3RA 4F17A 3JCMW 2RHYA 2MMPA 2L3PA 2V8JA 1GFCA 3JAME 1TTHB 4OF1A 2CSIA 4X1VA 4IURA 2A36A 3NTIA 4EMKB 3DKMA 4QW2A 3INZA 1WPYA 4VUBA 3M0PA 1I5OB 4BACA 2CH4A 4A4GA 4RTWA 1RUWA 3SFMA 3LWHA 3O8VA 1MNEA 1WHGA 2KRNA 4HA8A 4JS5A 1W6XA 1I5LA 1QCNA 1QWFA 3S3NA 4N4HA 5LJ5h 4M78B 4F04B 1X2KA 3JCMQ 1YFNA 2FRYA 1R0CB 2CP5A 1OOTA 2L5QA 1CKAA 3X25B 2RHIA 2LMJA 3C0CA 4LDXA 1QVGS 3QYHB 4YTLA 3T9NA 2YUNA 8AT1B 3S3OA
chains in the Genus database with same CATH topology
3ULRB 4JPBW 1WA7A 3UATA 3QWXX 2IIMA 4ESRA 4OMOA 2X3XD 4LE9A 3FJ5A 2L2PA 3R6NA 2B86A 3GBQA 1KSWA 1HSQA 2HDAA 2DBKA 1UGVA 2DJQA 1VYVA 1M3CA 1PKSA 3EG0A 4J9CA 3VS4A 2D8HA 4DEYA 2RF0A 1GBRA 4AFZC 2ESWA 2KYBA 2EBPA 2DNUA 1ZUKA 1PRLC 2I0NA 1TUCA 2AKLA 4ZNXA 2VKNA 2V1QA 1GCPA 1MV0B 2EQIA 2ENMA 2J05A 2CUBA 4Y92A 2LNHB 2FG0A 1X2QA 4Z88A 1N5ZA 1Z9ZA 2K3BA 2FPDA 2LJ0A 2BZYA 1SSHA 1H3HA 2MCNA 1JO8A 1SEMA 1NEGA 4JZ3A 3M0RA 2KR3A 2J6FA 1V1CA 2AKKA 4OMQA 1RLPC 1UHFA 4J9GA 1M27C 2X3WD 2E5KA 1J3TA 2CUDA 1UJYA 2EPDA 1AZEA 2H8HA 2DRMA 1YP5A 2FRWA 3VS6A 2GTOA 1QWEA 1B3QA 2GQIA 3SHWA 5FW9A 1JEGA 2YSQA 2FO0A 1UDLA 2KT1A 1WLPB 4RUGA 2BZXA 2L3SA 2O9VA 2DL4A 2JM8A 2ROTA 1SHFA 3NMZC 4HVWA 3VS1A 1QKWA 3KFVA 2KE9A 2LCSA 1EFNA 1YNZA 2A37A 4EIKA 1K0XA 3PE0A 4A63B 2NWMA 1S1NA 3RBBB 4RTYA 5IHKA 2KROA 3I9QA 2JM9A 3M0UA 2CREA 1E6GA 2JS0A 4HVVA 1X43A 2DE0X 1UHCA 1NYFA 2D8JA 4LN2A 1SRMA 1X6GA 2ED1A 2ED0A 1JU5C 3VRYA 3CQTA 1PHTA 1I07A 4CC7A 3THKA 5GJWB 2PZ1A 1Y0MA 2DL5A 1WXBA 2DX1A 2M0YA 1FMKA 3IQLA 2EVRA 2VWFA 1AD5A 4JJDA 3EHRA 3REAB 3A98A 4FSSA 1K4US 1KJWA 4Z8AA 4OMLA 2RN8A 3I5SA 2SEMA 2JMAA 3NHNA 1KFZA 3EG3A 1I0CA 1GCQC 4KRTA 4F14A 5GJVB 2LJ1A 2L0AA 1NLOC 1UG1A 1UE9A 1NG2A 2PNIA 3H0FA 4J9FA 2C0IA 5IXBA 4J9BA 1I1JA 2KGTA 1H92A 2XMFA 1UUEA 1SHGA 4OMPA 2EGCA 1WXTA 1OPLA 1BK2A 1G83A 1GL5A 2V1RA 1SPKA 2DA9A 4K11A 5IXFA 2A28A 2F2VA 2AZSA 2YDLA 1AWXA 4RTXA 1ARKA 4LNPA 1B07A 1RLQC 2EYWA 2AK5A 2CT4A 5IHIA 2RMOA 2ABLA 1H8KA 2C0OA 4D8DA 1M30A 1UECA 4ORZA 1AEYA 1Z9QA 2JT4A 1ABOA 1T3SA 2KXCA 3VRZA 1AWJA 2PTKA 2DMOA 2MOXA 3PVLA 2J6KA 1SRLA 1ZSGA 2EYYA 4JJBA 2DYBA 2YT6A 2LP5A 1VYTA 2EKHA 2FPEA 2FEIA 2RQUA 3VS0A 4RTUA 2KRSA 2JXBA 3UF4A 3ZL7C 1K0SA 2DL8A 1K1ZA 2DLPA 2F2WA 1WYXA 2OI3A 2K79A 2YUPA 4OMMA 1NYGA 2RNAA 1AWOA 2DRKA 2DBMA 1JXOA 4GLMA 1T0JA 1RI9A 1UTIA 1XOVA 2G6FX 1CKBA 2O2OA 1GRIA 1X27A 2GNCA 3SEMA 1ZLMA 3NPFA 1WI7A 1U06A 2K2MA 1M3AA 4DEXA 1IO6A 2JW4A 2LQWA 2HSPA 5FWCA 2EW3A 4CC3A 1K9AA 1WFWA 4AG2C 1OV3A 3M0SA 2YUOA 3JV3A 2OJ2A 1W70A 5I22A 4RTTA 4RTVA 3U23A 1Y57A 1PRMC 2HEQA 2O31A 4R0KA 5IH2A 3UA6A 4WCIA 1E6HA 2LZ6B 2KT8A 2KYMA 2CDTA 1TUDA 2HBWA 4IIOA 1U5SA 2YUQA 1NLPC 2FPFA 2KNBB 1WIEA 2CH4W 4HXJA 2BTTA 2CSQA 1T3LA 4RTZA 2GGRA 1YCSB 1FYNA 2CT3A 5L23A 4HCKA 1WX6A 1AWWA 1AOJA 2W0ZA 4CC4B 1QLYA 4OMNA 1M8MA 2P4RA 3EGUA 2D0NA 3VS2A 3VS5A 3VS7A 2OAWA 2K7AA 1PNJA 2RPNA 3UA7A 1GFDA 1X6BA 4F16A 5HCKA 1WXUA 2LJ3A 2RQRA 2BZ8A 4AFUC 2W10A 1NEBA 4AFQC 4IIMA 4J9HA 4J9IA 2D1XA 4AG1C 3PVQA 3EHQA 2J06A 4JJCA 4J9EA 1JQQA 4J9DA 3TSWA 1M3BA 2L3QA 2KEAA 2RQWA 1ABQA 2K9GA 3RNJA 3EG1A 1ZUYA 1BB9A 1TG0A 2EYXA 5EC7A 3TSZA 4AFSC 2AZVA 4JZ4A 3H0HA 2VVKA 2A08A 2DF6A 1K76A 1A0NB 1MV3A 3TVTA 2LQNA 3I35A 3I5RA 3M0QA 1ZBJA 4CC2A 2RQVA 1WDXA 3LH5A 1YWPA 2HCKA 1PWTA 2DILA 1GBQA 2RQTA 4LUEA 1BBZA 2KBTA 1U3OA 1YWOA 2J7IA 1NM7A 1ZUUA 4HVUA 4F17A 3M0TA 1YN8A 2J6OA 1JXMA 1OEBA 1QCFA 2L3PA 1UFFA 2DL7A 2EGAA 1GFCA 2DL3A 2GTJA 2MIOA 3EG2A 2EGEA 1T0HA 2CSIA 2C0TA 4X1VA 1HD3A 2EYZA 3H41A 2A36A 5FWBA 1VA7A 2KRMA 3M0PA 2GBQA 2KXDA 2CH4A 2K6DA 3QWYA 4LUDA 4RTWA 1RUWA 2ROLA 2F2XA 2KRNA 1BU1A 1AZGB 4QT7A 1AVZC 3H0IA 1LCKA 1W6XA 1VYUA 2O9SA 2LX7A 3VS3A 2JMCA 1QWFA 1HJDA 4Z89A 1UJ0A 2QDLA 3NGPA 1QKXA 1ZX6A 5IHNA 1MUZA 1X2KA 4M4ZA 2JS2A 2O88A 2FRYA 1GCQA 2ECZA 1G2BA 4GBQA 1KIKA 2M51A 3O5ZA 4D8KA 1OOTA 4E6RA 1CKAA 1CSKA 1W1FA 1OPKA 2NUZA 1PKTA 2LMJA 3C0CA 2DVJA 1E7OA 1X69A 3REBB 5I11A 2YUNA 5ECAA 2DM1A 2SRCA 2JTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULR B;  4JPB W;  1WA7 A;  3UAT A;  3QWX X;  2IIM A;  4ESR A;  4OMO A;  2X3X D;  4LE9 A;  3FJ5 A;  2L2P A;  3R6N A;  2B86 A;  3GBQ A;  1KSW A;  1HSQ A;  2HDA A;  2DBK A;  1UGV A;  2DJQ A;  1VYV A;  1M3C A;  1PKS A;  3EG0 A;  4J9C A;  3VS4 A;  2D8H A;  4DEY A;  2RF0 A;  1GBR A;  4AFZ C;  2ESW A;  2KYB A;  2EBP A;  2DNU A;  1ZUK A;  1PRL C;  2I0N A;  1TUC A;  2AKL A;  4ZNX A;  2VKN A;  2V1Q A;  1GCP A;  1MV0 B;  2EQI A;  2ENM A;  2J05 A;  2CUB A;  4Y92 A;  2LNH B;  2FG0 A;  1X2Q A;  4Z88 A;  1N5Z A;  1Z9Z A;  2K3B A;  2FPD A;  2LJ0 A;  2BZY A;  1SSH A;  1H3H A;  2MCN A;  1JO8 A;  1SEM A;  1NEG A;  4JZ3 A;  3M0R A;  2KR3 A;  2J6F A;  1V1C A;  2AKK A;  4OMQ A;  1RLP C;  1UHF A;  4J9G A;  1M27 C;  2X3W D;  2E5K A;  1J3T A;  2CUD A;  1UJY A;  2EPD A;  1AZE A;  2H8H A;  2DRM A;  1YP5 A;  2FRW A;  3VS6 A;  2GTO A;  1QWE A;  1B3Q A;  2GQI A;  3SHW A;  5FW9 A;  1JEG A;  2YSQ A;  2FO0 A;  1UDL A;  2KT1 A;  1WLP B;  4RUG A;  2BZX A;  2L3S A;  2O9V A;  2DL4 A;  2JM8 A;  2ROT A;  1SHF A;  3NMZ C;  4HVW A;  3VS1 A;  1QKW A;  3KFV A;  2KE9 A;  2LCS A;  1EFN A;  1YNZ A;  2A37 A;  4EIK A;  1K0X A;  3PE0 A;  4A63 B;  2NWM A;  1S1N A;  3RBB B;  4RTY A;  5IHK A;  2KRO A;  3I9Q A;  2JM9 A;  3M0U A;  2CRE A;  1E6G A;  2JS0 A;  4HVV A;  1X43 A;  2DE0 X;  1UHC A;  1NYF A;  2D8J A;  4LN2 A;  1SRM A;  1X6G A;  2ED1 A;  2ED0 A;  1JU5 C;  3VRY A;  3CQT A;  1PHT A;  1I07 A;  4CC7 A;  3THK A;  5GJW B;  2PZ1 A;  1Y0M A;  2DL5 A;  1WXB A;  2DX1 A;  2M0Y A;  1FMK A;  3IQL A;  2EVR A;  2VWF A;  1AD5 A;  4JJD A;  3EHR A;  3REA B;  3A98 A;  4FSS A;  1K4U S;  1KJW A;  4Z8A A;  4OML A;  2RN8 A;  3I5S A;  2SEM A;  2JMA A;  3NHN A;  1KFZ A;  3EG3 A;  1I0C A;  1GCQ C;  4KRT A;  4F14 A;  5GJV B;  2LJ1 A;  2L0A A;  1NLO C;  1UG1 A;  1UE9 A;  1NG2 A;  2PNI A;  3H0F A;  4J9F A;  2C0I A;  5IXB A;  4J9B A;  1I1J A;  2KGT A;  1H92 A;  2XMF A;  1UUE A;  1SHG A;  4OMP A;  2EGC A;  1WXT A;  1OPL A;  1BK2 A;  1G83 A;  1GL5 A;  2V1R A;  1SPK A;  2DA9 A;  4K11 A;  5IXF A;  2A28 A;  2F2V A;  2AZS A;  2YDL A;  1AWX A;  4RTX A;  1ARK A;  4LNP A;  1B07 A;  1RLQ C;  2EYW A;  2AK5 A;  2CT4 A;  5IHI A;  2RMO A;  2ABL A;  1H8K A;  2C0O A;  4D8D A;  1M30 A;  1UEC A;  4ORZ A;  1AEY A;  1Z9Q A;  2JT4 A;  1ABO A;  1T3S A;  2KXC A;  3VRZ A;  1AWJ A;  2PTK A;  2DMO A;  2MOX A;  3PVL A;  2J6K A;  1SRL A;  1ZSG A;  2EYY A;  4JJB A;  2DYB A;  2YT6 A;  2LP5 A;  1VYT A;  2EKH A;  2FPE A;  2FEI A;  2RQU A;  3VS0 A;  4RTU A;  2KRS A;  2JXB A;  3UF4 A;  3ZL7 C;  1K0S A;  2DL8 A;  1K1Z A;  2DLP A;  2F2W A;  1WYX A;  2OI3 A;  2K79 A;  2YUP A;  4OMM A;  1NYG A;  2RNA A;  1AWO A;  2DRK A;  2DBM A;  1JXO A;  4GLM A;  1T0J A;  1RI9 A;  1UTI A;  1XOV A;  2G6F X;  1CKB A;  2O2O A;  1GRI A;  1X27 A;  2GNC A;  3SEM A;  1ZLM A;  3NPF A;  1WI7 A;  1U06 A;  2K2M A;  1M3A A;  4DEX A;  1IO6 A;  2JW4 A;  2LQW A;  2HSP A;  5FWC A;  2EW3 A;  4CC3 A;  1K9A A;  1WFW A;  4AG2 C;  1OV3 A;  3M0S A;  2YUO A;  3JV3 A;  2OJ2 A;  1W70 A;  5I22 A;  4RTT A;  4RTV A;  3U23 A;  1Y57 A;  1PRM C;  2HEQ A;  2O31 A;  4R0K A;  5IH2 A;  3UA6 A;  4WCI A;  1E6H A;  2LZ6 B;  2KT8 A;  2KYM A;  2CDT A;  1TUD A;  2HBW A;  4IIO A;  1U5S A;  2YUQ A;  1NLP C;  2FPF A;  2KNB B;  1WIE A;  2CH4 W;  4HXJ A;  2BTT A;  2CSQ A;  1T3L A;  4RTZ A;  2GGR A;  1YCS B;  1FYN A;  2CT3 A;  5L23 A;  4HCK A;  1WX6 A;  1AWW A;  1AOJ A;  2W0Z A;  4CC4 B;  1QLY A;  4OMN A;  1M8M A;  2P4R A;  3EGU A;  2D0N A;  3VS2 A;  3VS5 A;  3VS7 A;  2OAW A;  2K7A A;  1PNJ A;  2RPN A;  3UA7 A;  1GFD A;  1X6B A;  4F16 A;  5HCK A;  1WXU A;  2LJ3 A;  2RQR A;  2BZ8 A;  4AFU C;  2W10 A;  1NEB A;  4AFQ C;  4IIM A;  4J9H A;  4J9I A;  2D1X A;  4AG1 C;  3PVQ A;  3EHQ A;  2J06 A;  4JJC A;  4J9E A;  1JQQ A;  4J9D A;  3TSW A;  1M3B A;  2L3Q A;  2KEA A;  2RQW A;  1ABQ A;  2K9G A;  3RNJ A;  3EG1 A;  1ZUY A;  1BB9 A;  1TG0 A;  2EYX A;  5EC7 A;  3TSZ A;  4AFS C;  2AZV A;  4JZ4 A;  3H0H A;  2VVK A;  2A08 A;  2DF6 A;  1K76 A;  1A0N B;  1MV3 A;  3TVT A;  2LQN A;  3I35 A;  3I5R A;  3M0Q A;  1ZBJ A;  4CC2 A;  2RQV A;  1WDX A;  3LH5 A;  1YWP A;  2HCK A;  1PWT A;  2DIL A;  1GBQ A;  2RQT A;  4LUE A;  1BBZ A;  2KBT A;  1U3O A;  1YWO A;  2J7I A;  1NM7 A;  1ZUU A;  4HVU A;  4F17 A;  3M0T A;  1YN8 A;  2J6O A;  1JXM A;  1OEB A;  1QCF A;  2L3P A;  1UFF A;  2DL7 A;  2EGA A;  1GFC A;  2DL3 A;  2GTJ A;  2MIO A;  3EG2 A;  2EGE A;  1T0H A;  2CSI A;  2C0T A;  4X1V A;  1HD3 A;  2EYZ A;  3H41 A;  2A36 A;  5FWB A;  1VA7 A;  2KRM A;  3M0P A;  2GBQ A;  2KXD A;  2CH4 A;  2K6D A;  3QWY A;  4LUD A;  4RTW A;  1RUW A;  2ROL A;  2F2X A;  2KRN A;  1BU1 A;  1AZG B;  4QT7 A;  1AVZ C;  3H0I A;  1LCK A;  1W6X A;  1VYU A;  2O9S A;  2LX7 A;  3VS3 A;  2JMC A;  1QWF A;  1HJD A;  4Z89 A;  1UJ0 A;  2QDL A;  3NGP A;  1QKX A;  1ZX6 A;  5IHN A;  1MUZ A;  1X2K A;  4M4Z A;  2JS2 A;  2O88 A;  2FRY A;  1GCQ A;  2ECZ A;  1G2B A;  4GBQ A;  1KIK A;  2M51 A;  3O5Z A;  4D8K A;  1OOT A;  4E6R A;  1CKA A;  1CSK A;  1W1F A;  1OPK A;  2NUZ A;  1PKT A;  2LMJ A;  3C0C A;  2DVJ A;  1E7O A;  1X69 A;  3REB B;  5I11 A;  2YUN A;  5ECA A;  2DM1 A;  2SRC A;  2JTE A; 
#chains in the Genus database with same CATH topology
 4IUP A;  4JPB W;  3CCU T;  3GOX A;  2NLU A;  3QWX X;  3FJ5 A;  4XU1 A;  4M77 E;  3R6N A;  5GAM d;  4DQ2 A;  1HXD A;  5GAN 8;  1KSW A;  4N4I A;  1W4S A;  3MEA A;  2DJQ A;  1ZA1 B;  2ZZD A;  3J81 E;  1XNI A;  3JCM X;  1WHK A;  2XD0 A;  1D1B A;  2V8K A;  3CPW S;  2MI6 A;  1GBR A;  2KYB A;  5GAM e;  1M5Q 1;  2VV5 A;  2DNU A;  1ZUK A;  1YJN Q;  4M7A D;  2AKL A;  4ZNX A;  1GCP A;  4E7L A;  4N0A A;  5J26 A;  3EAE A;  2CGH A;  2L8D A;  5LJ3 e;  4Y92 A;  2EQK A;  1D3B A;  2VC8 A;  1K9M R;  2FPD A;  4NOY A;  1RAE B;  1VQ4 T;  3QZ5 B;  2MCN A;  1KD1 U;  1SEM A;  3G6E Q;  4C0D B;  4EMH A;  3CC7 Q;  3M0R A;  1K73 R;  2RHU A;  4OMQ A;  3PIP A;  4M7D B;  4J5Y A;  1UHF A;  4M77 G;  3UPU A;  2X3W D;  2E5K A;  3PTA A;  1WHM A;  1QP3 A;  3QII A;  4CI0 C;  1YJ9 T;  1VQO T;  1R8O B;  2H8H A;  3VS6 A;  3JCM c;  1OZ3 A;  4PJN A;  1NPP A;  2YSQ A;  3CCJ Q;  1UDL A;  3CC2 Q;  1KC8 U;  3V7S A;  2BZX A;  3E1S A;  2P0K A;  4M78 E;  5GAN 5;  1QW1 A;  3EGX B;  3NMZ C;  4HVW A;  4MDX A;  1QKW A;  5GMK i;  4M77 A;  2Y4Y A;  3OYM A;  3KFV A;  4Z02 A;  2LCS A;  1LPL A;  4EIK A;  1WQ7 A;  2AHJ B;  2ZPG B;  2NWM A;  1S1N A;  5IHK A;  1FMW A;  3HHT B;  3CCR Q;  3M0U A;  1BI0 A;  5CAI A;  2XDP A;  5LJ3 j;  1Y71 A;  3EFO B;  2E65 A;  2D8J A;  4C8Q D;  3G6E A;  3EGD A;  2ED1 A;  4JRK A;  3M5A A;  4E47 A;  3CC7 A;  1M1K R;  3A1P A;  5GJW B;  5KYX A;  3P8H A;  2DL5 A;  5GAO q;  1WXB A;  3FDR A;  4AT1 B;  1K8A R;  2DIQ A;  1G5V A;  3HRT A;  4EMG A;  4KT0 E;  1OZ2 A;  2EVR A;  1G3T A;  4OB2 B;  3EHR A;  1M9S A;  5LJ5 f;  4E7Z A;  4FSS A;  4M78 G;  3ZEH A;  4HT9 A;  4OML A;  3JCM h;  3RMQ A;  3CCJ A;  3CC2 A;  2K3X A;  1VQ6 Q;  4KRT A;  4BI3 A;  4F14 A;  1FX7 A;  3H0F A;  4A4H A;  3BY7 A;  5GMK l;  4GLK A;  3L2Q A;  5IXB A;  3CCS T;  2KGT A;  3QSU A;  1UUE A;  2XU8 A;  4OMP A;  2EGC A;  3N5B B;  1WXT A;  1YIT Q;  5KCO A;  4XK8 E;  1BK2 A;  4JS4 A;  2DTO A;  1GL5 A;  1QCO A;  2YDL A;  2BE7 D;  3CCR A;  3UT1 A;  4RKU E;  5CKF A;  1RLQ C;  1WJR A;  2RMO A;  2ABL A;  3JB9 G;  1M30 A;  1UEC A;  2RM4 A;  3JRZ A;  3CXC S;  1Z9Q A;  2HZY A;  1ABO A;  2KXC A;  1Y96 B;  2QTX A;  1AWJ A;  2PQW A;  2MOX A;  3PVL A;  2NUT B;  4M75 D;  2EYY A;  1QVF S;  3OYG A;  2LP5 A;  5D6Y A;  1PM3 A;  2FPE A;  1K73 C;  2YRD A;  2MYS A;  1K0S A;  3X28 B;  4JUV A;  2X35 A;  4C5I A;  4N0A C;  5IT9 E;  2RNA A;  1AWO A;  2DRK A;  3KBG A;  3HSB A;  3G1J A;  3KUF A;  1JXO A;  2JTM A;  2DO3 A;  3JB9 H;  1UTI A;  2G6F X;  1JJ2 S;  1M1G A;  4PFZ A;  1X27 A;  1AT1 B;  2HD0 A;  1D1C A;  3OS0 A;  3L1A A;  3FJP A;  1U06 A;  2PU9 B;  1M3A A;  4DEX A;  2QEX T;  5CO7 A;  1YIT A;  4JLG A;  2JW4 A;  2LQW A;  1QVG P;  4ZGE B;  1WFW A;  3S3M A;  2YLB A;  1RL2 A;  3M0S A;  2YUO A;  4R55 A;  4P5N A;  4RTV A;  3U23 A;  2DPP B;  1PRM C;  3LLR A;  1IXD A;  2E6N A;  2OTL T;  4PK4 A;  2CDT A;  4XU3 A;  1TUD A;  3CMA T;  1U5S A;  5DM7 R;  2FPF A;  4X9C A;  1WIE A;  3CD6 Q;  3LGF A;  3MCA B;  3A5Z B;  3BDU A;  3OMC A;  5I2S A;  4N4G A;  4FYX B;  1FYN A;  1MND A;  2JUF A;  2CT3 A;  2HQX A;  4QVD A;  2P0P A;  5L23 A;  4HCK A;  4PJO E;  1M1K C;  1AWW A;  3OYB A;  1TUG B;  4M77 C;  3OMG A;  4XTW A;  1M8M A;  4E7I A;  4BUG A;  1IRE B;  1K8A C;  2EJG A;  2R5M A;  2RPN A;  3CME T;  2HSE B;  2OTJ T;  1X6B A;  2VUB A;  4FT4 A;  2LJ3 A;  4QQD A;  4BB7 A;  3E9G A;  2W10 A;  5KYU A;  2KK4 A;  3PVQ A;  3EHQ A;  3GIB A;  3QUI A;  4J9E A;  1PSE A;  5IAY A;  2E4H A;  1M3B A;  2KEA A;  3F70 A;  3HTR A;  2K9G A;  2EYX A;  3JSC A;  5FRM A;  2AZV A;  2LDM A;  3SD4 A;  4B9X A;  4HCZ A;  1PD1 A;  4XQ3 A;  3TVT A;  3JCM f;  4C5H A;  4PJO G;  4DOW A;  4PNO A;  3ME9 A;  4CC2 A;  5GAN h;  3CD6 A;  2QQ9 A;  3LH5 A;  1W2B S;  2HCK A;  5GAN 7;  3G71 Q;  1LVK A;  1PWT A;  2Y4X A;  2GCX A;  2ZGW A;  3OS5 A;  3JCM V;  1U3O A;  2FL7 A;  5LJ5 d;  1YWO A;  1VQ9 T;  3M55 A;  1WJQ A;  2QDY B;  4HVU A;  3M0T A;  1YN8 A;  5CCA A;  2QAS A;  3GNF B;  2DL7 A;  2BUD A;  4II1 A;  4D6W A;  2MIO A;  3OYN A;  2R58 A;  4RG8 A;  1Q86 C;  1KD1 R;  1UEB A;  1QVP A;  1NZ9 A;  1HD3 A;  3H41 A;  1S72 T;  4PJO A;  4FYW B;  4M7A F;  5GMK h;  4MML A;  1HK9 A;  3MP8 A;  2GBQ A;  1WZO A;  2ZCF B;  4LUD A;  3MET A;  5HK3 A;  2FB7 A;  4NL2 A;  2GFA A;  1BU1 A;  2L89 A;  2QTV A;  3OS1 A;  3H0I A;  1VYU A;  2LX7 A;  1D3B B;  2CP7 A;  5DLO A;  1HJD A;  3VU3 C;  1YHQ T;  1ACM B;  1PD0 A;  1MUZ A;  1BI3 A;  4M4Z A;  3EFS A;  4JDS A;  1KC8 R;  1VQM Q;  1NJI U;  1EIF A;  1G3Y A;  2ZPF B;  3AT1 B;  1YJW Q;  2CP6 A;  1KQ1 A;  3D7S B;  2DET A;  2COW A;  2F1L A;  1EZZ B;  3G71 A;  2DVJ A;  1VQP T;  1E7O A;  3NFC A;  3Q1J A;  3REB B;  1SSF A;  1TOV A;  4J6X A;  1IHW A;  2BKD N;  2FYK A;  3ULR B;  1IZ6 A;  5CQY A;  3UAT A;  4OMO A;  4M78 D;  2L2P A;  1YIJ T;  3TU4 K;  5HKC A;  4LDV A;  4PJL A;  1RAA B;  3GLX A;  3FIF A;  3PNW C;  5GMK m;  1OX8 A;  5KE3 A;  4C92 F;  4M77 B;  2JJ9 A;  3CBP A;  3M4Y A;  3EG0 A;  4J9C A;  1VIE A;  5KYY A;  2D8H A;  1QQJ A;  2RF0 A;  4DEY A;  4BI4 A;  1QVF P;  1ZBX A;  2QGG A;  1PRL C;  1NE8 A;  4FSX A;  2E10 A;  4C8Q F;  3OYH A;  1TUC A;  1Q86 U;  4BY6 C;  1M2O A;  3OB9 A;  2EQI A;  2CUB A;  5CKB A;  4F7U F;  2LNH B;  2EIF A;  1B34 A;  2R57 A;  1N5Z A;  4Z88 A;  1VQM A;  3EGD B;  2HKN A;  1Z9Z A;  1YJW A;  4BE0 A;  1SSH A;  3CCU Q;  1NEG A;  1JJ2 P;  2EWN A;  2ZPI B;  2J6F A;  1V1C A;  4QQG A;  4J7F A;  2XDD A;  3EH1 A;  3TEE A;  4FIB A;  1VQ8 T;  2KY9 A;  2QQA A;  3UDC A;  4HCC A;  2CUD A;  2EPD A;  5J39 A;  4BE2 A;  3QG1 A;  1AZE A;  2LQ8 A;  3WXM B;  2DRM A;  1QWE A;  1B3Q A;  3SHW A;  2CP3 A;  5FW9 A;  3CC4 Q;  2FHD A;  4ANJ A;  4KH0 B;  3V8L A;  5GAN g;  3BFM A;  1IRX A;  3J80 E;  2L3S A;  2O9V A;  5GAN f;  1KD1 C;  5C6S A;  1VQ7 T;  1SHF A;  4M7D D;  1VQ4 Q;  2DD5 A;  4ZGJ B;  4OB1 B;  1VUB A;  5FLX E;  2K57 A;  2X4Y A;  2V26 A;  3RBB B;  3JCM d;  3HP9 A;  1FMV A;  1H3Z A;  4J8O A;  1ZSZ B;  2JM9 A;  4V2S A;  3PMT A;  2EYQ A;  2RHZ A;  4M75 F;  2JS0 A;  4LD6 A;  5AT1 B;  3G4S T;  2YXY A;  2DD4 A;  4LN2 A;  4Y91 A;  1X75 C;  1M4Z A;  1YJ9 Q;  1KC8 C;  4PJO C;  4DA4 A;  3BDL A;  2LQK A;  2PUO B;  3CQT A;  3RKX A;  3OA6 A;  1BIA A;  3CBO A;  3THK A;  5KYW B;  2M9U A;  3QKJ A;  3RER A;  2DZC A;  2WSF E;  1FMK A;  3REA B;  1K4U S;  3SDZ A;  2RN8 A;  3CC4 A;  4MMK A;  3EG3 A;  5FU7 C;  2QQB A;  2ZPE B;  3TQ7 P;  5DLQ E;  4KGV B;  2LJ1 A;  3HKS A;  2CP2 A;  1NLO C;  1UE9 A;  1NG2 A;  2PNI A;  2DXU A;  4J9F A;  2C0I A;  3R6O A;  2RO0 A;  2EQJ A;  1P92 A;  4J9B A;  1I1J A;  2X9H A;  3RIR A;  8ATC B;  1H92 A;  1I8F A;  2DFU A;  4FYY B;  1W2B P;  4MZP A;  4Q5W A;  2K5I A;  2KI7 A;  1VQ4 A;  2VYT A;  1G83 A;  2V1R A;  4XTY A;  1D1A A;  3RES A;  2DEU A;  1V29 B;  3MJX A;  2QA4 Q;  3URG A;  2EYW A;  2CT4 A;  4WF2 A;  4ELZ C;  1ZHI A;  4D8D A;  2FVU A;  1YJ9 A;  2JT4 A;  3VKI A;  1Y07 A;  3LW5 E;  3CCQ Q;  2RD1 A;  2DMO A;  2DAQ A;  4JRQ A;  2O4X A;  2RJC A;  1RAB B;  1D09 B;  2X4J A;  4BY6 B;  2H3J A;  2QG9 B;  2P84 A;  3VS0 A;  4KUI A;  3BW1 A;  5D7U A;  3ZL7 C;  1X6O A;  5GAN 4;  3CCS Q;  2DL8 A;  1K1Z A;  2F2W A;  2NUP A;  2OI3 A;  1H64 1;  4XAX B;  1N9R A;  3HL8 A;  4O6J A;  4OMM A;  3I56 T;  2DBM A;  3QBY A;  5KYU B;  2E1H A;  1MMA A;  3MEW A;  1XOV A;  3L2R A;  2DXT A;  3C4S A;  2GNC A;  5AYF A;  2XIC A;  3RDV A;  2HAX A;  3SEM A;  1WI7 A;  5FRN A;  1YJN A;  4IUQ A;  5GAM j;  5C0M A;  1K9A A;  4AG2 C;  3H6Z A;  4A53 A;  3AHU A;  5LL6 S;  1JRI A;  2QA4 A;  1Y57 A;  2HEQ A;  4WCI A;  2LZ6 B;  2KYM A;  1KHC A;  1WHJ A;  3E2U A;  4XTV A;  3QJY A;  3ZBD A;  4OMF B;  2VXE A;  4O5V A;  3CCQ A;  2BTT A;  2PVG B;  1ZQ1 A;  4RTZ A;  2GGR A;  2OX7 A;  1YI2 T;  3QPH A;  5LJ5 g;  3RMS A;  1RAF B;  1EX4 A;  1I4K 1;  1FXX A;  1AOJ A;  5GAN 3;  1QLY A;  9ATC B;  4OMN A;  2P4R A;  2D0N A;  2DVE A;  6AT1 B;  1IHV A;  1NJI R;  2MAM A;  2HL3 A;  4PJO B;  3CCE Q;  2Y90 A;  2EQU A;  5GAN d;  1GFD A;  4ME7 A;  2E12 A;  2QI2 A;  1NPR A;  2EAY A;  1WXU A;  2E41 A;  2RHX A;  4AFQ C;  4J9H A;  4J9I A;  2D1X A;  5GAO l;  2OTL Q;  4AG1 C;  4A4E A;  3JCM J;  4JJC A;  3L2V A;  1KQS P;  3OYF A;  1SF9 A;  3A8O B;  2E70 A;  3RNJ A;  5FU7 B;  3TSZ A;  3C12 A;  5EC7 A;  2VVK A;  1ZSZ A;  3CC2 T;  2DF6 A;  1AHJ B;  2WAC A;  3I35 A;  5M9O A;  3L2U A;  1M2V A;  5KE2 A;  1OQK A;  2D6F A;  4DBR A;  3CME Q;  2OTJ Q;  2KAF A;  5KYW A;  1GBQ A;  3OYJ A;  3M56 A;  4KGX B;  1Q86 R;  5GMK e;  3CCR T;  2DEQ A;  1ZUU A;  5LJ3 h;  2X51 A;  2J6O A;  1JXM A;  2PUK B;  1QCF A;  2QQS A;  1VQ6 A;  2EGA A;  4C92 B;  3CCE A;  2DL3 A;  2GTJ A;  2LTO A;  2B8A A;  4DBH A;  3EG2 A;  4C0F A;  2EGE A;  4DOV A;  4FCY A;  1N8R U;  2ZPH B;  3CBM A;  2F5T X;  3VUB A;  5CVI A;  5KYY B;  1VA7 A;  2KRM A;  1Y7X A;  2CZ6 B;  2K6D A;  2XKO C;  2ROL A;  4B9W A;  2DIG A;  2F2X A;  1AZG B;  4QT7 A;  3UWN A;  1UGQ B;  1AVZ C;  3A8H B;  1O9S A;  2O9S A;  1B34 B;  3MP6 A;  1TU0 B;  4PLI A;  1C0M A;  5IHN A;  2JS2 A;  1BIB A;  4MZT A;  1VQ9 Q;  4ELY C;  2QQR A;  1G2B A;  4E6R A;  1QMC A;  4PL6 A;  2H3E B;  1CSK A;  3GF5 A;  4MDW A;  1YIT T;  2FZK B;  2E3H A;  3LH0 A;  5KH6 A;  3CME A;  3CPW P;  2NUZ A;  2OTJ A;  1VOM A;  1X69 A;  1PCX A;  5I11 A;  1S72 Q;  5ECA A;  4OB3 B;  3CCL T;  2HBP A;  1WA7 A;  2YRV A;  2IIM A;  4ESR A;  2JTF A;  2X3X D;  4LE9 A;  2I2L A;  4L5G A;  1KK7 A;  1D0X A;  4M7D F;  3GBQ A;  5GAN 2;  3P8D A;  1JBM A;  1HSQ A;  1OU8 A;  1NJI C;  5HY6 A;  1OU9 A;  2DBK A;  1UGV A;  4OP0 A;  1G3S A;  2XID A;  3M58 A;  4FL6 A;  1M3C A;  3JCM P;  1RAI B;  4JRP A;  2RK1 A;  4KH1 B;  2CZ1 B;  4AFZ C;  2ESW A;  4FU6 A;  2DZ9 A;  2I0N A;  3JCM g;  3OYI A;  2V1Q A;  3SWN A;  1MV0 B;  3CCM Q;  1VQP Q;  2J05 A;  3EG9 B;  4QQ6 A;  2COZ A;  1X2Q A;  1VQ9 A;  3OS2 A;  2K3B A;  1VQ5 T;  2BZY A;  4JZ3 A;  1I81 A;  1YIJ Q;  4M77 D;  4C92 E;  1IB8 A;  2KR3 A;  3HRS A;  2LC4 A;  2LCL A;  5A0G A;  1S72 A;  4E7K A;  1M27 C;  3JB9 J;  1LNX A;  2O01 E;  1Q82 C;  5CR2 A;  2DXC A;  2FZC B;  3MKD A;  4C8Q E;  2JNG A;  5GAO n;  2F5K A;  3L2W A;  1KG1 A;  4M7A A;  1VQK Q;  5LJ5 e;  3HRU A;  1ZSZ C;  4LD9 K;  1VQN Q;  2FO0 A;  3QZ9 B;  3QDR B;  4C5E A;  3CD6 T;  2KT1 A;  1XTD A;  1D0Z A;  2BIV A;  2M16 A;  4RUG A;  3LWI A;  3M53 A;  1MMD A;  2DL4 A;  1U1S A;  2JM8 A;  2ROT A;  1F1B B;  2ZPB B;  3CCV T;  3VYG A;  4QVZ A;  2F69 A;  5LJ3 g;  1EFN A;  1YNZ A;  2A37 A;  4PFP A;  1K0X A;  3DB3 A;  5LJ3 f;  1BYM A;  3OYA A;  3CCM A;  4EPC A;  2KRO A;  1VQP A;  1NBE B;  1IGU A;  3I9Q A;  1TXQ A;  1VQ8 Q;  2CRE A;  1E6G A;  4C92 G;  4HVV A;  2RH2 A;  1X43 A;  3PMI A;  1M1F A;  2O4X B;  1WGS A;  2RI3 A;  1SRM A;  4TVR A;  3DB4 A;  1X01 A;  2ED0 A;  3I55 T;  3VRY A;  1YIJ A;  2C06 A;  2MF2 A;  4C8Q G;  2A0F B;  2NUP B;  1XJW B;  2KVQ G;  5FU6 C;  4E7H A;  2VWF A;  3A98 A;  4LDW A;  1VQK A;  3RKY A;  1KJW A;  4Z8A A;  4C92 A;  3RR6 A;  2SEM A;  1VQN A;  3X24 B;  4M75 E;  2R5A A;  2KMT A;  3GPL A;  3CXC P;  1VQL T;  1I0C A;  5LJ5 j;  1KFZ A;  1RAD B;  4E7S A;  5GJV B;  2L0A A;  3G71 T;  2X4X A;  1TH7 A;  1Q82 U;  1WHH A;  5GAO m;  4C8Q A;  3G4S Q;  5CK9 A;  1OPL A;  4FW2 A;  4F7U A;  2MPX C;  2DA9 A;  5IXF A;  2A28 A;  2AZS A;  3L42 A;  2IG0 A;  4RTX A;  3M4G A;  1B07 A;  1VQ8 A;  4XU0 A;  3JB9 D;  4PJJ A;  3EFR A;  1R0B G;  2X4W A;  4IUU A;  4OGE A;  1H8K A;  4ORZ A;  3OW2 S;  1AEY A;  1KQS A;  1T3S A;  2EJ9 A;  3VRZ A;  3CPF A;  3PT9 A;  2DKG A;  5CKH A;  1YCY A;  2J6K A;  1SRL A;  2DYB A;  2YT6 A;  2Z0W A;  1VYT A;  2EKH A;  4LXC A;  2FEI A;  4M75 G;  2KRS A;  2DXB A;  3ZFJ A;  2DLP A;  2V8I A;  1VQM T;  2K2V A;  4KGZ B;  1VIF A;  3QDF A;  3SWN C;  4E7J A;  1YJW T;  2K79 A;  2VB6 A;  1NYG A;  1RI0 A;  3P8B B;  1SKU B;  4IKF A;  3SB2 A;  1T0J A;  2NYS A;  3GNG A;  5A0D A;  1CKB A;  2O2O A;  4QKU A;  3NPF A;  2K2M A;  3OYK A;  3FEO A;  3G4S A;  3RKW A;  3MP1 A;  3LX7 A;  1IGQ A;  2XK0 A;  2HKQ B;  3ASK A;  1Q7Y C;  2XG8 D;  2EW3 A;  2RJD A;  2LVM A;  4IUV A;  4M75 A;  4CC3 A;  2K3Y A;  2YWW A;  1OV3 A;  3JB9 I;  3M9Q A;  3JV3 A;  5I22 A;  4L6V 5;  2O31 A;  3EG9 A;  4X9D A;  1G3W A;  1M2V B;  3CCU A;  1N8R R;  1U1T A;  4HKE A;  2JZ2 A;  4UC4 A;  2KT8 A;  4M7A C;  1VQO Q;  2HBW A;  1QVG A;  3H8Z A;  3JCM e;  2YUQ A;  4BDY A;  1NLP C;  4HT8 A;  4HXJ A;  1PG5 B;  1T3L A;  3I56 Q;  1C1A A;  2CS7 A;  1TWB A;  3OYD A;  3OY9 A;  4J6Y A;  2E3I A;  4J6W A;  3V8J A;  4RCC A;  1YBY A;  1Q81 U;  2QK0 A;  3S6W A;  1B7T A;  3VS5 A;  2K7A A;  3J7A F;  3HFO A;  3CPW A;  3NTK A;  4F16 A;  5HCK A;  2RQR A;  4JJN K;  1D0Y A;  3OYE A;  1NEB A;  4XTU A;  4IIM A;  2HQH A;  5FU6 B;  3M57 A;  1UGR B;  2J06 A;  5LJ3 d;  4A54 A;  4R56 A;  3C95 A;  1JQQ A;  4C0G A;  2L3Q A;  2RQW A;  1KHI A;  2XI9 A;  1ABQ A;  3EG1 A;  1ZUY A;  1TG0 A;  4AFS C;  4JZ4 A;  3CC4 T;  2A08 A;  2XDB A;  1YI2 Q;  1RAC B;  2PVD B;  1A0N B;  1MV3 A;  3DLM A;  4PJO D;  4X34 A;  1VQO A;  4C92 C;  1M90 C;  2WSC E;  1N9S A;  1RAG B;  3I5R A;  5D6X A;  3M0Q A;  1ZBJ A;  1Q7Y U;  2RQV A;  1WDX A;  2BE9 B;  1KQ2 A;  3I56 A;  4EDU A;  1YWP A;  2VAS A;  3VJP A;  2YLC A;  3GP8 A;  4C8Q C;  1ZA2 B;  2E64 A;  4LUE A;  1BBZ A;  2KBT A;  3H9N A;  1BI1 A;  2J7I A;  3E9F A;  5CKD A;  1BCM A;  4KBM B;  1OEB A;  1OYX A;  1UFF A;  3PIO A;  1R77 A;  1T0H A;  2CP0 A;  2LCC A;  2C0T A;  2EYZ A;  2K4Y A;  3L2Z A;  5GAO p;  4Y28 E;  5FWB A;  1PSF A;  2D9T A;  3OSS C;  2CZ0 B;  2KSS A;  2KXD A;  3A8M B;  3QWY A;  5A2Q E;  3SWN B;  1MGQ A;  4OGC A;  1LCK A;  1XQH A;  3VS3 A;  2JMC A;  4Z89 A;  1UJ0 A;  2QDL A;  3NGP A;  1QKX A;  1ZX6 A;  4M77 F;  1YI2 A;  2O88 A;  3PFS A;  4C92 D;  1GCQ A;  2HL5 C;  1UGS B;  2ECZ A;  4GBQ A;  3VYH B;  1KIK A;  2K5L A;  2M51 A;  3O5Z A;  4D8K A;  2HQE A;  2MK5 A;  3V8K A;  1N8R C;  4FW1 A;  1YJN T;  1LOJ A;  1W1F A;  2EFI A;  1OPK A;  3VV0 A;  3FB9 A;  2AIR B;  2QAZ A;  1PKT A;  4FM4 B;  2CZ7 B;  1U8R A;  2M1H A;  3CCS A;  1MHN A;  2VGM A;  2QEX Q;  2DM1 A;  2SRC A;  4M7A B;  2JTE A;  4BI8 B;  2HMA A;  2QA4 T;  4M75 C;  1M90 U;  1OX9 A;  3G6E T;  4ATO A;  2FZG B;  3CC7 T;  3V7C A;  5I21 A;  1G8X A;  2B86 A;  2YHT A;  4B6M A;  3CCQ T;  2HDA A;  1VYV A;  4XU2 A;  3CMA Q;  3OW2 P;  4JRI A;  1QP2 A;  5KCH A;  3HFN A;  1PKS A;  2DJZ A;  3QO3 A;  4EMK A;  5GAN e;  3OBW A;  3FLG A;  3VS4 A;  3E19 A;  3QYG B;  2EBP A;  1V76 A;  3CCJ T;  2VKN A;  4OB0 B;  1BI2 A;  3CXC A;  2ENM A;  4XTX A;  5A0L A;  3WVD B;  2FG0 A;  1TSF A;  4MZM A;  1PC0 A;  1QVF A;  4M78 A;  3CCL Q;  2WSE E;  4M7D E;  2LJ0 A;  5I2M A;  1Q82 R;  5GAN 6;  2K5F A;  1H3H A;  5GAM h;  4J7I A;  1JO8 A;  4M78 F;  5GAO r;  2ATC B;  3CEY A;  2VXF A;  3OQ5 A;  4IUT A;  2JOY A;  1BCO A;  2AKK A;  1C6V X;  3M59 A;  2EKO A;  1K9M C;  1RLP C;  4J9G A;  2GF7 A;  2QEX A;  4RG2 A;  1J3T A;  3RUX A;  1UJY A;  1JJ2 A;  1TS9 A;  1WJS A;  1YP5 A;  2FRW A;  3FC3 A;  2GTO A;  2GQI A;  2MWO A;  1BKB A;  3V7R A;  2RB6 A;  2QGF B;  1JEG A;  1DJ7 B;  4PKC C;  2JVV A;  4FYV B;  4E2F B;  2LT1 A;  4C8Q B;  1WLP B;  3ER0 A;  2OTL A;  3CMA A;  1Q95 G;  4XTZ A;  3TRE A;  2RK2 A;  4F7U B;  2AT1 B;  3KXT A;  4BE1 A;  3VS1 A;  3JB9 F;  2XHC A;  4J83 A;  1N6A A;  1WHL A;  3X20 B;  1VQ5 Q;  4WTO B;  1WNL A;  5GAN j;  4HCB A;  2KE9 A;  4ZGD B;  1VQ6 T;  4M7D G;  3PE0 A;  4A63 B;  2GQV A;  3CCE T;  4RTY A;  2HNI A;  2JN0 A;  1LJO A;  2COY A;  1JB0 E;  2DE0 X;  4A4K A;  2DTH A;  3CCL A;  1UHC A;  1NYF A;  4M7A E;  3PGG A;  2OAU A;  4AMC A;  2QYZ A;  1X6G A;  4LDU A;  4BD3 A;  4RCB A;  1JU5 C;  3LYI A;  4L59 A;  5EG2 A;  1PHT A;  4ZTF A;  1I07 A;  4CC7 A;  2PZ1 A;  1Y0M A;  2IPO B;  5GMK j;  2EQM A;  2DX1 A;  2M0Y A;  3OYL A;  4RMO A;  4M7D A;  3IQL A;  2KQW A;  5KYN A;  1AD5 A;  4JJD A;  1MMG A;  2M0O A;  3CCV Q;  1YHQ Q;  3I5S A;  2JMA A;  3NHN A;  3X26 B;  4JLI A;  1GCQ C;  1K9M U;  2DER A;  4C5G A;  3OBY A;  4ZN1 A;  1UG1 A;  2D0Q B;  4QVC A;  4M75 B;  2XMF A;  1SHG A;  1VQ5 A;  1K73 U;  3EGX A;  1SPK A;  3I55 Q;  4M7A G;  4K11 A;  2F2V A;  1Q81 R;  1AWX A;  3DLL A;  1ARK A;  3MEU A;  4LNP A;  3C94 A;  2L3R A;  2AK5 A;  1W2B A;  5IHI A;  2C0O A;  3EH2 A;  2CKK A;  7AT1 B;  4C0Z A;  2LRQ A;  4BDZ A;  4PLL A;  3EFO A;  2E6Z A;  2PTK A;  4A4F A;  2RJE A;  1ZSG A;  4JJB A;  3OYY A;  1VQL Q;  4EMK C;  3FRN A;  2RQU A;  4RTU A;  2JXB A;  3UF4 A;  4FT2 A;  1HYO A;  4F7U E;  4DBQ A;  3CCV A;  3TCJ A;  3VUZ A;  1WYX A;  1GXI E;  1YHQ A;  2YUP A;  2A7Y A;  2GFU A;  1RAH B;  2DK3 A;  4GLM A;  1Q7Y R;  1RI9 A;  5GAM g;  2P4T A;  2LT4 A;  4M78 C;  2QXF A;  1GRI A;  5GAM f;  2RA2 A;  1ZLM A;  2RI5 A;  4NS5 A;  3MO8 A;  1M1K U;  1IO6 A;  4OVA A;  4PJO F;  2P0Q A;  1UGP B;  5FWC A;  2HSP A;  4ZTJ A;  3I55 A;  5FRO A;  2RJF A;  1N27 A;  2OJ2 A;  2VGN A;  1K8A U;  1W70 A;  1UB4 A;  4RTT A;  4R0K A;  5IH2 A;  3UA6 A;  1E6H A;  1OUL A;  4PJM A;  4GY5 A;  4IIO A;  3LGL A;  4LDY A;  2DTI A;  2KNB B;  3MEV A;  2CH4 W;  1MMN A;  2CSQ A;  4F7U G;  4NL3 A;  4DBF A;  1YCS B;  5CKE A;  1VQL A;  2E5Q A;  3HPW A;  1Y96 A;  1VQ7 Q;  4KUD K;  2NUT A;  3NTH A;  1WX6 A;  3CCM T;  3A8L B;  2W0Z A;  4CC4 B;  2LX9 A;  4ZN3 A;  3EGU A;  3VS2 A;  4CRI A;  3OYC A;  3VS7 A;  5CQX A;  2OAW A;  1PNJ A;  2M02 A;  2A3L A;  3M54 A;  3UA7 A;  1WQW A;  4KUL A;  5DY9 A;  2DYI A;  2BZ8 A;  2EJF A;  4AFU C;  3MPU B;  4PFO A;  2YRC A;  2ZAE A;  5IN1 A;  3QHS A;  5CIU A;  4J9D A;  3TSW A;  3G7Z A;  4C0D C;  1M90 R;  5HK0 A;  2LNV A;  3QXE B;  2KDS A;  1SG5 A;  1VQK T;  1M8V A;  2CYZ B;  1BB9 A;  2PVO B;  5D6W A;  1VQN T;  4M7D C;  3H0H A;  5L8R E;  3QJ6 A;  3MHX A;  1K76 A;  3OW2 A;  1Q81 C;  2LQN A;  3A8G B;  2IVW A;  1OI1 A;  2MWP A;  3JCM b;  1FWZ A;  2RI2 A;  3OSV A;  3WVE B;  1O75 A;  3BE3 A;  2DIL A;  2RQT A;  5KYX B;  1VQ7 A;  5J3B A;  1NM7 A;  1KQS S;  2G3R A;  4F17 A;  3JCM W;  2RHY A;  2MMP A;  2L3P A;  2V8J A;  1GFC A;  3JAM E;  1TTH B;  4OF1 A;  2CSI A;  4X1V A;  4IUR A;  2A36 A;  3NTI A;  4EMK B;  3DKM A;  4QW2 A;  3INZ A;  1WPY A;  4VUB A;  3M0P A;  1I5O B;  4BAC A;  2CH4 A;  4A4G A;  4RTW A;  1RUW A;  3SFM A;  3LWH A;  3O8V A;  1MNE A;  1WHG A;  2KRN A;  4HA8 A;  4JS5 A;  1W6X A;  1I5L A;  1QCN A;  1QWF A;  3S3N A;  4N4H A;  5LJ5 h;  4M78 B;  4F04 B;  1X2K A;  3JCM Q;  1YFN A;  2FRY A;  1R0C B;  2CP5 A;  1OOT A;  2L5Q A;  1CKA A;  3X25 B;  2RHI A;  2LMJ A;  3C0C A;  4LDX A;  1QVG S;  3QYH B;  4YTL A;  3T9N A;  2YUN A;  8AT1 B;  3S3O A; 
#chains in the Genus database with same CATH homology
 3ULR B;  4JPB W;  1WA7 A;  3UAT A;  3QWX X;  2IIM A;  4ESR A;  4OMO A;  2X3X D;  4LE9 A;  3FJ5 A;  2L2P A;  3R6N A;  2B86 A;  3GBQ A;  1KSW A;  1HSQ A;  2HDA A;  2DBK A;  1UGV A;  2DJQ A;  1VYV A;  1M3C A;  1PKS A;  3EG0 A;  4J9C A;  3VS4 A;  2D8H A;  4DEY A;  2RF0 A;  1GBR A;  4AFZ C;  2ESW A;  2KYB A;  2EBP A;  2DNU A;  1ZUK A;  1PRL C;  2I0N A;  1TUC A;  2AKL A;  4ZNX A;  2VKN A;  2V1Q A;  1GCP A;  1MV0 B;  2EQI A;  2ENM A;  2J05 A;  2CUB A;  4Y92 A;  2LNH B;  2FG0 A;  1X2Q A;  4Z88 A;  1N5Z A;  1Z9Z A;  2K3B A;  2FPD A;  2LJ0 A;  2BZY A;  1SSH A;  1H3H A;  2MCN A;  1JO8 A;  1SEM A;  1NEG A;  4JZ3 A;  3M0R A;  2KR3 A;  2J6F A;  1V1C A;  2AKK A;  4OMQ A;  1RLP C;  1UHF A;  4J9G A;  1M27 C;  2X3W D;  2E5K A;  1J3T A;  2CUD A;  1UJY A;  2EPD A;  1AZE A;  2H8H A;  2DRM A;  1YP5 A;  2FRW A;  3VS6 A;  2GTO A;  1QWE A;  1B3Q A;  2GQI A;  3SHW A;  5FW9 A;  1JEG A;  2YSQ A;  2FO0 A;  1UDL A;  2KT1 A;  1WLP B;  4RUG A;  2BZX A;  2L3S A;  2O9V A;  2DL4 A;  2JM8 A;  2ROT A;  1SHF A;  3NMZ C;  4HVW A;  3VS1 A;  1QKW A;  3KFV A;  2KE9 A;  2LCS A;  1EFN A;  1YNZ A;  2A37 A;  4EIK A;  1K0X A;  3PE0 A;  4A63 B;  2NWM A;  1S1N A;  3RBB B;  4RTY A;  5IHK A;  2KRO A;  3I9Q A;  2JM9 A;  3M0U A;  2CRE A;  1E6G A;  2JS0 A;  4HVV A;  1X43 A;  2DE0 X;  1UHC A;  1NYF A;  2D8J A;  4LN2 A;  1SRM A;  1X6G A;  2ED1 A;  2ED0 A;  1JU5 C;  3VRY A;  3CQT A;  1PHT A;  1I07 A;  4CC7 A;  3THK A;  5GJW B;  2PZ1 A;  1Y0M A;  2DL5 A;  1WXB A;  2DX1 A;  2M0Y A;  1FMK A;  3IQL A;  2EVR A;  2VWF A;  1AD5 A;  4JJD A;  3EHR A;  3REA B;  3A98 A;  4FSS A;  1K4U S;  1KJW A;  4Z8A A;  4OML A;  2RN8 A;  3I5S A;  2SEM A;  2JMA A;  3NHN A;  1KFZ A;  3EG3 A;  1I0C A;  1GCQ C;  4KRT A;  4F14 A;  5GJV B;  2LJ1 A;  2L0A A;  1NLO C;  1UG1 A;  1UE9 A;  1NG2 A;  2PNI A;  3H0F A;  4J9F A;  2C0I A;  5IXB A;  4J9B A;  1I1J A;  2KGT A;  1H92 A;  2XMF A;  1UUE A;  1SHG A;  4OMP A;  2EGC A;  1WXT A;  1OPL A;  1BK2 A;  1G83 A;  1GL5 A;  2V1R A;  1SPK A;  2DA9 A;  4K11 A;  5IXF A;  2A28 A;  2F2V A;  2AZS A;  2YDL A;  1AWX A;  4RTX A;  1ARK A;  4LNP A;  1B07 A;  1RLQ C;  2EYW A;  2AK5 A;  2CT4 A;  5IHI A;  2RMO A;  2ABL A;  1H8K A;  2C0O A;  4D8D A;  1M30 A;  1UEC A;  4ORZ A;  1AEY A;  1Z9Q A;  2JT4 A;  1ABO A;  1T3S A;  2KXC A;  3VRZ A;  1AWJ A;  2PTK A;  2DMO A;  2MOX A;  3PVL A;  2J6K A;  1SRL A;  1ZSG A;  2EYY A;  4JJB A;  2DYB A;  2YT6 A;  2LP5 A;  1VYT A;  2EKH A;  2FPE A;  2FEI A;  2RQU A;  3VS0 A;  4RTU A;  2KRS A;  2JXB A;  3UF4 A;  3ZL7 C;  1K0S A;  2DL8 A;  1K1Z A;  2DLP A;  2F2W A;  1WYX A;  2OI3 A;  2K79 A;  2YUP A;  4OMM A;  1NYG A;  2RNA A;  1AWO A;  2DRK A;  2DBM A;  1JXO A;  4GLM A;  1T0J A;  1RI9 A;  1UTI A;  1XOV A;  2G6F X;  1CKB A;  2O2O A;  1GRI A;  1X27 A;  2GNC A;  3SEM A;  1ZLM A;  3NPF A;  1WI7 A;  1U06 A;  2K2M A;  1M3A A;  4DEX A;  1IO6 A;  2JW4 A;  2LQW A;  2HSP A;  5FWC A;  2EW3 A;  4CC3 A;  1K9A A;  1WFW A;  4AG2 C;  1OV3 A;  3M0S A;  2YUO A;  3JV3 A;  2OJ2 A;  1W70 A;  5I22 A;  4RTT A;  4RTV A;  3U23 A;  1Y57 A;  1PRM C;  2HEQ A;  2O31 A;  4R0K A;  5IH2 A;  3UA6 A;  4WCI A;  1E6H A;  2LZ6 B;  2KT8 A;  2KYM A;  2CDT A;  1TUD A;  2HBW A;  4IIO A;  1U5S A;  2YUQ A;  1NLP C;  2FPF A;  2KNB B;  1WIE A;  2CH4 W;  4HXJ A;  2BTT A;  2CSQ A;  1T3L A;  4RTZ A;  2GGR A;  1YCS B;  1FYN A;  2CT3 A;  5L23 A;  4HCK A;  1WX6 A;  1AWW A;  1AOJ A;  2W0Z A;  4CC4 B;  1QLY A;  4OMN A;  1M8M A;  2P4R A;  3EGU A;  2D0N A;  3VS2 A;  3VS5 A;  3VS7 A;  2OAW A;  2K7A A;  1PNJ A;  2RPN A;  3UA7 A;  1GFD A;  1X6B A;  4F16 A;  5HCK A;  1WXU A;  2LJ3 A;  2RQR A;  2BZ8 A;  4AFU C;  2W10 A;  1NEB A;  4AFQ C;  4IIM A;  4J9H A;  4J9I A;  2D1X A;  4AG1 C;  3PVQ A;  3EHQ A;  2J06 A;  4JJC A;  4J9E A;  1JQQ A;  4J9D A;  3TSW A;  1M3B A;  2L3Q A;  2KEA A;  2RQW A;  1ABQ A;  2K9G A;  3RNJ A;  3EG1 A;  1ZUY A;  1BB9 A;  1TG0 A;  2EYX A;  5EC7 A;  3TSZ A;  4AFS C;  2AZV A;  4JZ4 A;  3H0H A;  2VVK A;  2A08 A;  2DF6 A;  1K76 A;  1A0N B;  1MV3 A;  3TVT A;  2LQN A;  3I35 A;  3I5R A;  3M0Q A;  1ZBJ A;  4CC2 A;  2RQV A;  1WDX A;  3LH5 A;  1YWP A;  2HCK A;  1PWT A;  2DIL A;  1GBQ A;  2RQT A;  4LUE A;  1BBZ A;  2KBT A;  1U3O A;  1YWO A;  2J7I A;  1NM7 A;  1ZUU A;  4HVU A;  4F17 A;  3M0T A;  1YN8 A;  2J6O A;  1JXM A;  1OEB A;  1QCF A;  2L3P A;  1UFF A;  2DL7 A;  2EGA A;  1GFC A;  2DL3 A;  2GTJ A;  2MIO A;  3EG2 A;  2EGE A;  1T0H A;  2CSI A;  2C0T A;  4X1V A;  1HD3 A;  2EYZ A;  3H41 A;  2A36 A;  5FWB A;  1VA7 A;  2KRM A;  3M0P A;  2GBQ A;  2KXD A;  2CH4 A;  2K6D A;  3QWY A;  4LUD A;  4RTW A;  1RUW A;  2ROL A;  2F2X A;  2KRN A;  1BU1 A;  1AZG B;  4QT7 A;  1AVZ C;  3H0I A;  1LCK A;  1W6X A;  1VYU A;  2O9S A;  2LX7 A;  3VS3 A;  2JMC A;  1QWF A;  1HJD A;  4Z89 A;  1UJ0 A;  2QDL A;  3NGP A;  1QKX A;  1ZX6 A;  5IHN A;  1MUZ A;  1X2K A;  4M4Z A;  2JS2 A;  2O88 A;  2FRY A;  1GCQ A;  2ECZ A;  1G2B A;  4GBQ A;  1KIK A;  2M51 A;  3O5Z A;  4D8K A;  1OOT A;  4E6R A;  1CKA A;  1CSK A;  1W1F A;  1OPK A;  2NUZ A;  1PKT A;  2LMJ A;  3C0C A;  2DVJ A;  1E7O A;  1X69 A;  3REB B;  5I11 A;  2YUN A;  5ECA A;  2DM1 A;  2SRC A;  2JTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...