1GFCA

Solution structure and ligand-binding site of the c-terminal sh3 domain of grb2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
GSTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
publication title Solution structure and ligand-binding site of the carboxy-terminal SH3 domain of GRB2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Adaptor protein containing sh2 and sh3
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1994-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gfcA00
4X1VA 2RPNA 2FEIA 4LNPA 2L2PA 2DL4A 4ESRA 1RLQC 1PHTA 1I0CA 2O88A 2JMAA 1JQQA 1WXBA 2DF6A 2CSIA 2F2WA 4CC7A 4OMLA 2DBMA 1X2KA 5IH2A 2DILA 1UHFA 1AEYA 2AKKA 1WDXA 1JU5C 1QKXA 2JTEA 1X2QA 2KT1A 2EVRA 1N5ZA 4AG2C 3LH5A 1E6GA 2RQTA 2XMFA 5FWCA 2AKLA 2D8HA 3I5SA 1OPKA 2KGTA 3VS3A 5FWBA 2BZ8A 2GBQA 1TUCA 2FO0A 4K11A 3VRZA 3M0PA 2O9VA 1K0XA 1U06A 3REBB 3UATA 4RTWA 2J6KA 1HD3A 2SEMA 1U5SA 1JEGA 2AK5A 2F2XA 4LE9A 1WFWA 3R6NA 1Y57A 1GCQC 4RTVA 1NM7A 2OAWA 2GTOA 3EG3A 4HCKA 1SRLA 4J9FA 2RQRA 2HEQA 3PVLA 1YN8A 1PWTA 2K6DA 1M27C 1UE9A 1CKAA 2FG0A 1GL5A 1PNJA 3FJ5A 5I11A 1FYNA 3O5ZA 1QCFA 2J6OA 2BZXA 3TVTA 2O31A 2X3XD 2CT3A 3I35A 2JM9A 4F16A 4RTXA 2D0NA 2CH4W 2KEAA 1QWEA 4AFSC 2MIOA 1RLPC 2YSQA 1NG2A 4OMMA 1ZX6A 1UUEA 4F17A 1ZUYA 1M3BA 2C0IA 1UECA 1SRMA 1W1FA 1AWJA 4GLMA 1HJDA 1UHCA 4OMPA 2VVKA 3IQLA 2ESWA 2G6FX 4Y92A 4JJBA 2C0TA 2L3PA 1SSHA 4RTUA 2K3BA 2QDLA 1PKSA 3NMZC 1M30A 2J06A 2A08A 4IIOA 2F2VA 1PRMC 2HBWA 1AZGB 1WIEA 1Z9ZA 4WCIA 4KRTA 3H0IA 2PNIA 1ZUUA 2LJ0A 1TUDA 4D8DA 2DL8A 4QT7A 2BTTA 4RTZA 3M0QA 5EC7A 2A28A 2FPDA 1WXUA 2K2MA 2EGAA 3EG0A 3M0TA 1UG1A 1X43A 1K4US 3TSZA 5HCKA 2KE9A 2OJ2A 2M0YA 2JS2A 3H0FA 2ABLA 1WLPB 4AFZC 1ZUKA 1K0SA 2DYBA 2W10A 2DNUA 1H8KA 2EYXA 4A63B 2CREA 4RTYA 1E6HA 2X3WD 1QLYA 1M8MA 1AD5A 4RTTA 1B3QA 4J9GA 1OV3A 1K1ZA 2K7AA 1SPKA 2P4RA 4D8KA 2RF0A 1M3AA 1T0JA 4J9CA 3A98A 1A0NB 4OMQA 2W0ZA 5IXBA 2DVJA 2JXBA 1AWWA 4J9DA 1BK2A 1GCQA 1ZSGA 1HSQA 1I1JA 2DBKA 2EBPA 2ED1A 3VRYA 1NYFA 2A37A 2GNCA 4R0KA 2KR3A 1OOTA 1GFCA 3I5RA 2RMOA 2CH4A 1BB9A 5ECAA 3ZL7C 3JV3A 3M0RA 2CSQA 1W70A 1TG0A 2DLPA 1G83A 3THKA 1CSKA 1OPLA 5L23A 3U23A 1QWFA 2LQNA 4HVWA 3TSWA 3NPFA 3NHNA 2VKNA 1S1NA 2YUPA 5IXFA 3SEMA 1VYUA 4LN2A 1UJ0A 2K9GA 2B86A 3EGUA 4JPBW 2AZVA 2GQIA 3EG2A 2EW3A 2KXDA 2EYZA 3VS5A 5IHIA 1ZBJA 2I0NA 1H3HA 3REAB 2DA9A 2M51A 2LQWA 1G2BA 2J05A 1NEGA 4DEXA 4GBQA 2EYWA 1J3TA 2FPFA 1W6XA 3VS1A 2HSPA 3H41A 2JT4A 2KYMA 3SHWA 1AOJA 3KFVA 3UF4A 2OI3A 2DX1A 1T3LA 4HVVA 2NWMA 4ZNXA 3C0CA 4FSSA 1ABQA 1UJYA 2J7IA 1E7OA 1EFNA 2C0OA 2CT4A 2LCSA 2LNHB 1NYGA 2KNBB 2ROTA 4RUGA 2YT6A 4DEYA 2DRMA 2IIMA 4JJDA 1I07A 2L3SA 2L3QA 1VYVA 4CC3A 1T3SA 3VS7A 1JO8A 3VS6A 1KSWA 2ED0A 2V1RA 2BZYA 1WI7A 1UTIA 2PTKA 1BBZA 2RQUA 4J9HA 2JM8A 2V1QA 1RI9A 1UGVA 4M4ZA 1AVZC 1X69A 2KRMA 1ARKA 2ROLA 3RBBB 1X27A 3EG1A 4AFUC 2YUOA 1GCPA 2JMCA 2PZ1A 2YUNA 4E6RA 3H0HA 1WX6A 4LUEA 1RUWA 1Z9QA 1GFDA 1H92A 2YDLA 2DE0X 4OMNA 2EGEA 2O9SA 2MCNA 1B07A 4J9BA 1MV3A 4IIMA 1YWOA 1WXTA 2RQWA 4OMOA 1BU1A 2JS0A 2LP5A 1AZEA 1XOVA 3EHQA 1KJWA 2A36A 1T0HA 2KRNA 1AWOA 4LUDA 4J9IA 2DL7A 1ZLMA 2RNAA 2DRKA 2O2OA 4HXJA 3UA6A 4CC2A 1MV0B 3UA7A 1K9AA 1FMKA 2FPEA 1WA7A 2EGCA 2K79A 2CDTA 2MOXA 2HDAA 1Y0MA 2DL3A 2EYYA 1WYXA 1KFZA 2KYBA 1NEBA 4Z88A 1GBRA 3M0SA 3VS4A 2SRCA 1GBQA 1MUZA 2AZSA 1QKWA 2H8HA 2RQVA 1NLOC 3PVQA 1JXMA 5FW9A 1K76A 4HVUA 1YP5A 2FRWA 4JJCA 2RN8A 2DM1A 1NLPC 2ECZA 2KRSA 3I9QA 3PE0A 3ULRB 3VS2A 2NUZA 1YNZA 2EKHA 1ABOA 2GTJA 2ENMA 4AFQC 1UDLA 1X6GA 2VWFA 4EIKA 1SHGA 3QWYA 2D1XA 2EQIA 1M3CA 2FRYA 2LJ3A 4AG1C 4Z8AA 1OEBA 1VA7A 2D8JA 4F14A 2E5KA 5IHKA 1X6BA 4ORZA 2HCKA 2DL5A 5IHNA 3GBQA 2KT8A 5GJWB 1YWPA 3M0UA 2JW4A 2GGRA 2KBTA 3RNJA 4J9EA 2KXCA 1YCSB 3CQTA 1VYTA 3NGPA 2LMJA 4Z89A 2LX7A 5GJVB 2DMOA 2YUQA 4JZ3A 1PRLC 1V1CA 5I22A 2LZ6B 1GRIA 1PKTA 1SHFA 2LJ1A 2KROA 1AWXA 3VS0A 3QWXX 1IO6A 2EPDA 1U3OA 2J6FA 3EHRA 1KIKA 1SEMA 2L0AA 1LCKA 1UFFA 2CUDA 1JXOA 1CKBA 2CUBA 4JZ4A 4CC4B 2DJQA
chains in the Genus database with same CATH superfamily
4X1VA 2FEIA 4J7FA 2DL4A 4ESRA 1I0CA 2JMAA 3Q1JA 1IHWA 1YJWA 5IH2A 1AEYA 1OULA 1WDXA 3OSSC 3QPHA 5A0DA 1JU5C 5HKCA 4FW1A 2JTEA 4IUPA 1N8RR 2YLBA 4LDUA 2KT1A 2GQVA 2PUOB 2DZ9A 4AG2C 3LH5A 3JRZA 2RQTA 2CZ7B 4OP0A 3UDCA 1NE8A 4M78A 3A8MB 5DLQE 2OTLQ 2VGNA 2E41A 3I56T 4IKFA 1PCXA 5FWBA 2QQRA 3OYDA 1KD1U 3QKJA 2VXEA 2DKGA 1BI3A 5KH6A 3M0PA 1NJIU 3CCMQ 4F7UF 1RAFB 1QP3A 3UATA 4RTWA 4NL2A 3VYGA 2AK5A 2F2XA 1WFWA 5I2MA 2X4YA 3LH0A 1NM7A 1M4ZA 3EH1A 3CCLQ 3HP9A 4LXCA 2HEQA 4JRQA 1PWTA 2DXCA 2K6DA 1WQ7A 3MEUA 3C4SA 2M0OA 1GL5A 2MK5A 2QI2A 1LNXA 4F04B 3MJXA 2NUPA 2M1HA 3JCMf 1WZOA 3HKSA 4GLKA 4OMFB 4O6JA 4QQGA 2D0NA 2KEAA 4AFSC 2EYQA 4E7JA 3CCRA 3F70A 2DYIA 1NG2A 4M78D 3JCMW 1VQKA 2FVUA 1UUEA 2KDSA 1QVFP 3ZFJA 3LYIA 3PMTA 2C0IA 1WHHA 3BDUA 4GLMA 2NUTB 3CPWP 3RERA 3C94A 3L1AA 2RB6A 5GAN4 2VXFA 3H8ZA 2QQAA 2C0TA 1TU0B 1OI1A 2K3BA 1K73U 2XKOC 1G3WA 3G6EA 1IGQA 1PRMC 3QO3A 1AZGB 3RKWA 3UPUA 2O4XB 3P8DA 1VQ7A 4M75A 3JB9H 2DTHA 1YITQ 1YJNA 2E5QA 3H0IA 2HNIA 1WHGA 3OY9A 3M5AA 2D0QB 2COZA 3EFOB 4QT7A 3O8VA 1FWZA 2H3EB 4WTOB 5EC7A 1VQ4A 1WXUA 4M77B 3S3NA 3X26B 1UGRB 3VKIA 3EG0A 5GAMd 4XTYA 1K4US 1K9MC 1VQ6T 1OX9A 4XU3A 5HCKA 1RAHB 1KHIA 2ABLA 2W10A 2DNUA 3BE3A 5LL6S 2JNGA 2CREA 1E6HA 1AD5A 3RKXA 2QQ9A 1B7TA 3HHTB 5LJ3j 4HA8A 1N8RU 3JCMP 3I56A 1TS9A 2WSEE 4J9CA 3LLRA 2YXYA 2CP7A 3A98A 3KBGA 4OMQA 5IXBA 4YTLA 3S6WA 1BYMA 1PM3A 4PKCC 4A4EA 4QKUA 1M90C 4FT4A 1HSQA 1I1JA 3LW5E 4M75D 1NYFA 1Q86R 2A37A 4NS5A 2QA4Q 3DLLA 2BE7D 4M7AB 4Y28E 3DB3A 1NPPA 3JB9G 1Q7YU 4IUQA 2RMOA 4MZTA 3JV3A 1D1AA 4C8QC 1G83A 1VIEA 1CSKA 3U23A 1IZ6A 3TSWA 3NPFA 5GAN7 2DETA 3CCMT 1S1NA 5IXFA 3CBMA 4DBQA 1VQPQ 4LN2A 2K9GA 2JVVA 3E9GA 2EW3A 5FU7C 2OTJT 2GFUA 2EYZA 1KQSS 1RABB 2EJGA 1PSEA 1H3HA 4XTZA 1S72Q 3REAB 2LQWA 1ZA2B 3QHSA 1G2BA 4E2FB 1J3TA 1PG5B 2EYWA 2HD0A 2FPFA 2QYZA 1VQOQ 3SHWA 1MGQA 2QTXA 1YBYA 4C92F 3OYMA 1D3BB 2NWMA 3CXCA 3FJPA 3QYHB 3OYNA 3TREA 2C0OA 1XTDA 5GAMe 1NYGA 4JLIA 3QZ9B 2RI2A 1WGSA 2DD4A 2IIMA 4JJDA 4J6XA 1MMDA 2L3SA 2FB7A 4CC3A 2O01E 4DBHA 1D0XA 1JO8A 4JS5A 3AT1B 3EGXB 1IXDA 2PTKA 1M2VB 3HPWA 1YJWQ 5KYWB 2C06A 2V1QA 5DM7R 4M4ZA 4MMLA 1M5Q1 2KRMA 1VQ6A 1ZHIA 4KGVB 3RBBB 1LPLA 4PNOA 3EG1A 4M78E 4HCBA 4XTXA 3NTKA 4CI0C 2YUOA 1GCPA 2YRCA 2HZYA 2COWA 2YUNA 5GAOn 1KQ2A 1MMAA 2P0KA 4XU1A 1RUWA 1VQ8T 5LJ5f 1GFDA 3OYIA 2EGEA 2VC8A 3QYGB 4C92A 4J9BA 2P84A 4PFPA 4BY6B 1UGPB 5AT1B 4J83A 1KJWA 2HQXA 1T0HA 2KRNA 1K8AR 1JBMA 4FYVB 2DL7A 1ZLMA 1RAEB 2DVEA 2LQKA 1O75A 4J6YA 2DRKA 2Y4YA 3OYGA 2FPEA 5KCHA 1N9SA 5KCOA 1WA7A 2EGCA 1Q86U 1JJ2P 3OW2P 2CDTA 2MOXA 3OS5A 1Y0MA 3OYCA 2QAZA 3QSUA 3CCMA 2M16A 3VS4A 1BIAA 3CCRQ 1MUZA 1VQKQ 1QKWA 2RO0A 3PVQA 1LJOA 5FW9A 1K76A 2OTJA 2DM1A 1NLPC 3I9QA 1IRXA 5LJ3h 1I8FA 3NTHA 3OB9A 5A0LA 2QGFB 1V29B 3G71Q 4C92D 4KUDK 4LDYA 1SHGA 3QBYA 1D0ZA 2KY9A 4J8OA 2KAFA 2FRYA 2LJ3A 4M7DG 3OYEA 1OEBA 3EG9B 3CCUT 2WSCE 3JB9J 4M75E 2E5KA 2HCKA 2XDPA 2PU9B 1VQ7Q 4XU2A 4PLIA 5KYYB 1YJNQ 4EMHA 3NFCA 5GJWB 3M0UA 4J9EA 2KSSA 4IUVA 1M1GA 1VYTA 3RUXA 2XICA 1VQ4Q 1QCOA 2LX7A 3MO8A 5GJVB 1VQOT 1WHMA 3M53A 3CMET 1V1CA 4FSXA 4C8QB 2LZ6B 3MPUB 4EMKC 3RR6A 2F69A 4ZN3A 1RL2A 3CBOA 2DXTA 1U3OA 2J6FA 3EHRA 3CPWA 4ELZC 1VIFA 3SB2A 2CUDA 1QCNA 2DJQA 5FU7B 3I56Q 2CP0A 4XU0A 2L2PA 1VQ8A 1VQNA 1RLQC 1PHTA 1JQQA 2DF6A 3L2QA 4CC7A 2F2WA 4OMLA 4QW2A 3OYKA 4NL3A 3EGDA 3PT9A 3M59A 5GAOm 1TOVA 2CS7A 3BW1A 3OBYA 4ZTJA 4AMCA 2K4YA 2EVRA 1N5ZA 2ZZDA 2XMFA 4ZN1A 2D8HA 2DFUA 2LQ8A 2VB6A 3OQ5A 1G3TA 1K8AU 1Y96A 5EG2A 1SSFA 2JUFA 2ZPFB 2DAQA 4OB1B 4C0ZA 4C92C 2DZCA 3CCVT 1MMGA 4LD9K 2WACA 4LE9A 1IREB 4RTVA 1IHVA 4F7UB 2GTOA 2RJEA 2E10A 3EG3A 4ELYC 4XK8E 4HT9A 3PVLA 1YN8A 4A4KA 4RCBA 1Q82R 3FJ5A 3EFRA 3ZBDA 5I11A 4DOWA 1QCFA 5FRNA 2BZXA 1KK7A 4KGXB 2X3XD 2CT3A 2HQEA 1TH7A 2ZPBB 3I35A 2MPXC 4RG2A 1LOJA 3CMAT 3JCMJ 1PD1A 4FT2A 4MZMA 3CCUA 3MP1A 4OMMA 2K5IA 1EIFA 2D9TA 3JCMX 2ZAEA 1M1KC 3G1JA 1AWJA 1HJDA 4XTWA 2ZPEB 1WJSA 4DOVA 5FLXE 3E2UA 4B6MA 4C5HA 1WHLA 2PQWA 4M78F 3LGLA 4MMKA 3G71T 4E7HA 3M55A 4QVCA 3ME9A 2G6FX 3L2RA 4Y92A 4C0DC 2V8JA 3CMEA 2R58A 2QDLA 1VQ6Q 4HKEA 2CP2A 2PVGB 9ATCB 2F2VA 2GCXA 4BE1A 2K2VA 5CQYA 1Z9ZA 1I81A 2CP5A 4WCIA 4JRIA 4KRTA 4BE0A 4M7DA 2QDYB 1TUDA 2DL8A 2BTTA 1Y71A 4C92E 3M0QA 2A28A 5CK9A 4N0AC 1VQ4T 2CZ1B 1KC8C 2KI7A 3QJ6A 1UG1A 1H3ZA 1W4SA 2M0YA 1BIBA 1X01A 4AFZC 4WF2A 2RJDA 2DYBA 1LVKA 3QJYA 1TWBA 5FU6C 1Q95G 1YI2T 4RTTA 4J9GA 2ZGWA 1ZBXA 2DD5A 4PJOB 2QQBA 1OV3A 1K1ZA 2P4RA 1SPKA 3V7CA 1M3AA 3CC7T 1Y7XA 1T0JA 3A8LB 2E4HA 2XDDA 3CPFA 4J9DA 1GCQA 1ZSGA 2DXUA 2DBKA 3VRYA 2ED1A 3CCVA 4M7DD 3EH2A 4C0GA 4KULA 3OBWA 2PVOB 1KQSP 1BI2A 2OTJQ 4RMOA 1U8RA 2CH4A 2MMPA 1BB9A 4PJOG 4EMKB 1W70A 1OZ3A 4M75F 2HKNA 3THKA 1OPLA 5GANg 1QWFA 3G4SA 3CMAA 1VYUA 3QXEB 1JRIA 1UJ0A 3EGUA 2B86A 1Q82U 3JCMV 2AZVA 1KD1C 4O5VA 1Y07A 1NJIC 2RHYA 5GAMf 2BKDN 2I0NA 2PVDB 4ANJA 4KGZB 2XG8D 1JJ2A 5D7UA 2HBPA 2M51A 3T9NA 3OW2A 2QK0A 2JJ9A 2B8AA 3URGA 1NEGA 4PFZA 2E65A 5LJ3g 4OGCA 3G71A 3SWNA 4P5NA 2M9UA 1W6XA 2HSPA 3H41A 1FXXA 2K3XA 4BACA 3KFVA 1ZSZC 1MMNA 2OI3A 2DX1A 1PC0A 2QGGA 3D7SB 3M54A 3RESA 4LD6A 1T3LA 4HVVA 1Q81R 4KBMB 4ZNXA 2Z0WA 3RMSA 1ABQA 1RAAB 4OB2B 3CXCS 3S3OA 2LCSA 3ASKA 2LNHB 2KNBB 4RCCA 1I07A 5FRMA 5GANj 3MEAA 3VS7A 2FZGB 1VQ8Q 1VQNQ 2BZYA 1YHQT 4BE2A 4A54A 1ARKA 4BI4A 2VV5A 1BI1A 4QVZA 1X27A 1VQLT 3LWHA 1YCYA 3PTAA 3PIPA 2GFAA 4DQ2A 2EFIA 5LJ3e 3H6ZA 2LVMA 1YI2A 2RD1A 3H0HA 3HRTA 1WX6A 5KYXA 2FL7A 3VJPA 3CC2T 2V8IA 3CC7A 1H92A 4OMNA 5KYUA 4M77G 4HCCA 1YWOA 4X9DA 4X9CA 4QQDA 4OMOA 4L59A 1XOVA 2BIVA 2A36A 2DXBA 3MHXA 3RMQA 1AWOA 4LUDA 3A1PA 1YIJA 5CVIA 4E7KA 3C12A 5GMKe 3GP8A 3CCSA 1FMVA 1D0YA 3JCMQ 2K79A 3GOXA 4M78C 3L2WA 5GMKj 2ZPIB 2DIGA 5GAOl 3CCET 1KHCA 2L8DA 2KYBA 3JCMg 3VV0A 1M2OA 4Z88A 1N8RC 3L2ZA 3GIBA 1I5OB 1GBQA 3CCUQ 2RQVA 4BDYA 3A8HB 4M7AG 4HVUA 1YP5A 2FRWA 4JJCA 2AIRB 3RIRA 3WXMB 2YWWA 3P8HA 2EKHA 1WPYA 3WVDB 4E7ZA 3HFOA 1UDLA 2VWFA 4E47A 5FU6B 1Q7YC 4C5GA 4PJOA 3QWYA 2D1XA 2EQIA 3JB9I 2RM4A 2ZCFB 2L89A 3CMEQ 1H641 5KE2A 2DJZA 3QDFA 2CKKA 1M1FA 2LT1A 2EQJA 2KVQG 3SD4A 2FZCB 2EWNA 3GBQA 3FLGA 2KT8A 1QVGP 1Q81U 4PJNA 5D6YA 3L2VA 1B34B 2Y90A 3OA6A 3CQTA 4Z02A 4JS4A 4DBRA 2LMJA 4Z89A 1PRLC 1G8XA 1YHQA 5I22A 1SHFA 1WJRA 2KROA 1QVFS 3VS0A 3QWXX 1VQLA 1TTHB 3VUBA 2CGHA 2M02A 1KIKA 3M58A 2LCLA 2KK4A 2MYSA 1C0MA 1SEMA 1UFFA 1FMWA 1JXOA 4M75C 4JZ4A 2X51A 4PJOD 3M9QA 5IAYA 2RPNA 1R77A 4LNPA 2O88A 1VQNT 3CC2A 2CSIA 3PIOA 2NUTA 3BFMA 2DEUA 4HT8A 3JB9F 2DILA 1ZA1B 4FCYA 1TXQA 4EPCA 3CCVQ 1X2QA 3OSVA 4L6V5 1DJ7B 2EJFA 1ZSZB 3META 5KE3A 2AKLA 3I5SA 2FYKA 5GANh 1OPKA 4IUTA 1W2BS 3QUIA 2GBQA 2E3HA 2O4XA 4KH0B 1TUCA 4K11A 3VRZA 3CCEA 1K0XA 2P4TA 3G4SQ 3CMAQ 2DERA 2DTIA 2SEMA 1BCMA 1C1AA 3EFOA 6AT1B 1JEGA 5IT9E 2LNVA 4LDXA 1Y57A 4M77A 2FZKB 4JRPA 1M1KR 4J9FA 2OAWA 3E1SA 2RJFA 2EAYA 1M27C 4NOYA 5IN1A 2FG0A 3OS0A 2CYZB 1FYNA 2J6OA 3TVTA 2O31A 4AT1B 3OYFA 5GAOr 2JM9A 1G5VA 4ZTFA 1WJQA 4RTXA 2XI9A 7AT1B 1Q86C 2E64A 2EKOA 4RG8A 1KQSA 4E7LA 1ZX6A 1V76A 2F5TX 4F17A 2XK0A 1X6OA 1M3BA 1UECA 1W1FA 2DEQA 3FB9A 4D6WA 4JRKA 2D6FA 1C6VX 3VU3C 5GMKh 4OMPA 2VVKA 3EAEA 2GF7A 3RKYA 3IQLA 4M7AA 2ESWA 4X34A 4E7IA 3E9FA 4M77D 1SSHA 5J3BA 4RTUA 4M78B 4A53A 1PKSA 5GMKi 5I21A 4PJMA 2J06A 2A08A 4N4GA 4IIOA 2E3IA 3S3MA 1WHJA 4ZGJB 4KH1B 1YI2Q 2PNIA 1ACMB 3JB9D 2DO3A 1TSFA 4D8DA 4RTZA 3A8OB 4OF1A 1QW1A 3CC7Q 2FPDA 3GLXA 1TUGB 2K2MA 1F1BB 1QP2A 4C8QG 1XQHA 2KE9A 3TEEA 2JN0A 3J7AF 3H0FA 2Y4XA 3CCQQ 1K0SA 1H8KA 2KQWA 2NUPB 2EYXA 3I55T 1YIJQ 2X3WD 1QLYA 1M8MA 4M7AD 1UEBA 2EQMA 3CCSQ 5HY6A 1D3BA 2NYSA 2K7AA 5CKDA 4RKUE 4A4HA 4D8KA 3CC4T 4BD3A 3OYHA 3JCMh 2LCCA 1A0NB 2WSFE 2DVJA 2XHCA 3X25B 3EGXA 2GNCA 5CKBA 1M2VA 5KYWA 3PFSA 1NBEB 3JSCA 4ME7A 2QXFA 2DLPA 4M7DF 2HL3A 5L23A 5C0MA 5LJ5j 2ATCB 3FEOA 3KXTA 1NZ9A 4M75B 4LDVA 3G4ST 4DBFA 3OMCA 3SEMA 4JPBW 1K8AC 1NPRA 4M77C 4F7UG 3VS5A 5IHIA 2RHUA 4OB0B 2KMTA 3VUZA 2DA9A 4FYYB 2EJ9A 1HYOA 3VS1A 5DLOA 2KYMA 2QG9B 2ZPGB 1YHQQ 2V26A 1K9MR 4Y91A 5HK0A 3JAME 1UJYA 1MHNA 1E7OA 2J7IA 2LT4A 1VQMT 1VQLQ 2CT4A 3DKMA 4HCZA 3M4YA 2YT6A 4DEYA 2DRMA 2L3QA 1VYVA 1T3SA 5D6XA 3X24B 3VS6A 2MWPA 1KSWA 3X20B 3CC2Q 4M7AC 1WI7A 1UTIA 4J9HA 3FC3A 1YJ9T 2JM8A 1UGQB 4OGEA 3CBPA 2X35A 4V2SA 1UGVA 5GANd 2MAMA 1M90R 1RAIB 3HTRA 3I55A 2JMCA 2JOYA 1QVGA 1U1SA 2PZ1A 3EG9A 4C5EA 4LUEA 1Z9QA 3CC4A 4FW2A 1EX4A 2YDLA 2DE0X 1IB8A 2JZ2A 5KYYA 2O9SA 2XD0A 3CCEQ 1B07A 4PJLA 1MV3A 5GAOq 4ZGEB 4M77E 3OYBA 2RQWA 3P8BB 5LJ3d 1M9SA 3CCQT 4A4FA 4J9IA 3V8LA 4R55A 1YIJT 2RNAA 2RH2A 2XDBA 2O2OA 4C8QA 4HXJA 2X9HA 4CC2A 1WHKA 3UA7A 3CCST 1FMKA 3SFMA 2VGMA 2XU8A 1Q7YR 1XNIA 2ZPHB 4UC4A 1KFZA 1NEBA 1SG5A 1XJWB 3M0SA 2SRCA 3H9NA 2H8HA 5GAOp 5J26A 1NLOC 1JXMA 2DPPB 2RN8A 2KRSA 5L8RE 3V7SA 4E7SA 3VS2A 4M7AE 1YNZA 1ABOA 2GTJA 5DY9A 2IG0A 3DB4A 3N5BB 4EIKA 1VQ9T 4KUIA 2E1HA 3R6OA 4AG1C 3MEVA 1GXIE 3DLMA 3TQ7P 4C8QD 4F14A 5IHKA 2HQHA 5D6WA 1X6BA 4R56A 1VQMA 2DL5A 4DA4A 4EMGA 5IHNA 1OU8A 3HSBA 1OX8A 5GANe 2MF2A 4BY6C 1Q82C 4C92B 3EFSA 1K9MU 3INZA 1YWPA 2GGRA 1QMCA 5LJ5h 3RNJA 3UWNA 4II1A 4F7UA 2QTVA 2PUKB 1AHJB 3NGPA 3CD6T 2DMOA 1YJ9A 4JZ3A 2YHTA 5CCAA 2COYA 1O9SA 3PGGA 2RHZA 1PKTA 3VYHB 1AWXA 2EQKA 2QEXT 2RJCA 1IO6A 3JCMd 3MP8A 5CKEA 4C92G 2MI6A 2L0AA 1LCKA 2CUBA 1K73C 3OYYA 4M7DC 1W2BP 4PL6A 1M90U 2R57A 3OS2A 1P92A 1WXBA 5A0GA 3OYLA 2DBMA 1X2KA 2R5AA 3A8GB 1UHFA 2AKKA 1QVPA 1VQ5T 4PJOF 1QKXA 3QDRB 3CCQA 4FYWB 2DIQA 1E6GA 3CCJQ 2L5QA 5FWCA 4C0DB 2JTFA 2K5LA 2KGTA 4JUVA 3VS3A 2BZ8A 2X4XA 5KYNA 3JCMc 4A4GA 5GAN3 2FO0A 5AYFA 3V7RA 2RK2A 2OX7A 2O9VA 1U06A 2EQUA 2L3RA 3REBB 2J6KA 1HD3A 2F1LA 1U5SA 1JB0E 2K3YA 2LRQA 3L42A 1HK9A 3R6NA 4C0FA 1KQ1A 4B9WA 1GCQC 2CZ0B 2V8KA 4HCKA 1SRLA 5CQXA 2OTLT 4L5GA 4Q5WA 1VUBA 2RQRA 4XTVA 1UE9A 2A0FB 1CKAA 2P0QA 5GAMg 1HXDA 1PNJA 3O5ZA 1RI0A 1UB4A 1EZZB 4F16A 1VQ9A 4J7IA 1R8OB 2CH4W 4J5YA 1QWEA 1QQJA 2MIOA 2YRVA 5CKFA 1RLPC 3GNFB 2YSQA 4IUUA 3GNGA 3CCLT 1ZUYA 4M7DE 5GMKl 1R0CB 1SRMA 2LX9A 1BCOA 3EGDB 2IPOB 1UHCA 2BUDA 5A2QE 2DK3A 2DTOA 3JCMe 5FROA 1OQKA 2E12A 4EMKA 3A5ZB 4JJBA 2HMAA 3TCJA 3OYAA 3CD6A 2L3PA 3SWNC 3M56A 3NMZC 3MKDA 3OS1A 1M30A 2VUBA 2A3LA 2HBWA 1WIEA 5CIUA 2QEXA 1Y96B 2A7YA 3I55Q 4M77F 5GAMj 1N9RA 3FDRA 4PLLA 2X4JA 1ZUUA 2LJ0A 3CPWS 2VYTA 1D1BA 1WNLA 3CC4Q 4BB7A 1OYXA 2EGAA 3M0TA 1X43A 1Q81C 3TSZA 3KUFA 2OJ2A 1VQ5A 2VASA 4MDWA 2JS2A 4XQ3A 2RHIA 1OU9A 1WLPB 1ZUKA 2HKQB 4C8QE 2G3RA 4A63B 1G3YA 1ZQ1A 3UT1A 4RTYA 1YITT 1D09B 1U1TA 2K57A 3QG1A 1B3QA 3HRUA 4PJJA 5GAN5 2RF0A 1PD0A 4BI3A 1M8VA 2HL5C 2E6NA 2R5MA 2K5FA 2W0ZA 4M7AF 2JXBA 2RA2A 1AWWA 1BK2A 3LX7A 5GAN8 3FIFA 2EBPA 4R0KA 2KR3A 1VOMA 2YRDA 1UGSB 3M57A 1I5LA 1OOTA 1GFCA 2E70A 4XAXB 1G3SA 3I5RA 4JJNK 3ZL7C 5ECAA 3CCJT 2OTLA 3M0RA 2CSQA 2JTMA 2OAUA 2CZ6B 1TG0A 2HAXA 3GF5A 1I4K1 2LQNA 3J80E 2RK1A 4N4IA 4HVWA 3NHNA 2VKNA 2YUPA 3V8KA 4M7DB 1BI0A 4BI8B 2QA4T 2MWOA 2GQIA 2H3JA 2HSEB 2X4WA 5LJ5d 3EG2A 4BDZA 1FX7A 2KXDA 1MNEA 1VQMQ 3PMIA 4KT0E 1N6AA 3CCLA 1ZBJA 4F7UE 1AT1B 5CR2A 3M4GA 2J05A 4QQ6A 4DEXA 4GBQA 4PFOA 5CAIA 1R0BG 2JT4A 1AOJA 1YJ9Q 5GAN6 1VQPT 3UF4A 1KC8R 3HFNA 3G6EQ 4PJOC 3LGFA 3C0CA 2NLUA 4FSSA 1RADB 1OZ2A 1EFNA 4IURA 3G7ZA 2ROTA 3MCAB 4RUGA 3LWIA 1S72T 1N27A 4MDXA 3MEWA 4FYXB 4N0AA 4JDSA 2ED0A 2V1RA 4QVDA 1BKBA 1BBZA 2RQUA 2YLCA 4JLGA 5M9OA 5LJ5g 4FM4B 1RI9A 3SDZA 1RACB 2CP6A 1AVZC 1X69A 4M78G 1QVFA 2LDMA 2ROLA 1WQWA 2IVWA 2FHDA 4AFUC 3C95A 4B9XA 2E6ZA 1YITA 8ATCB 4E6RA 1QVGS 4FL6A 1IGUA 4OVAA 4XTUA 3ER0A 1YJWT 3HL8A 2AHJB 3QZ5B 2MCNA 4OB3B 1RAGB 2BE9B 3BDLA 2AT1B 4IIMA 3E19A 3TU4K 2QASA 1WXTA 1B34A 1BU1A 2JS0A 2LP5A 1AZEA 3WVEB 2LC4A 3EHQA 3FRNA 1KD1R 3X28B 4MZPA 1NJIR 5GAMh 3SWNB 5CO7A 3UA6A 3AHUA 1W2BA 1MV0B 3CEYA 1K9AA 3CCJA 1D1CA 5GMKm 2P0PA 5LJ5e 3MP6A 1MNDA 4PJOE 2HDAA 4FIBA 3BY7A 4J6WA 4PK4A 2DL3A 2EYYA 1WYXA 4LDWA 5I2SA 1VQ9Q 4C5IA 4VUBA 5GAN2 1M1KU 3V8JA 1KG1A 2QQSA 3RDVA 1GBRA 5C6SA 2AZSA 2QA4A 1X75C 3GPLA 3CXCP 2LTOA 2ECZA 3PNWC 3PE0A 2CP3A 3ULRB 2NUZA 5GANf 2ENMA 4AFQC 1YFNA 4ATOA 1X6GA 2RI3A 5HK3A 1JJ2S 3QIIA 3OW2S 1ZSZA 4N4HA 1SKUB 2I2LA 4M75G 3CD6Q 1M3CA 4Z8AA 3CCRT 1VQPA 2RHXA 1VQKT 1VA7A 2D8JA 3L2UA 1SF9A 2RI5A 5KYXB 1PSFA 2F5KA 4ORZA 2QEXQ 5KYUB 3HRSA 1KC8U 5CKHA 4BUGA 3J81E 1S72A 1K73R 2JW4A 5LJ3f 4ZGDB 4GY5A 2KBTA 4C8QF 4FU6A 2KXCA 1YCSB 8AT1B 2EIFA 4TVRA 1VQOA 3JCMb 3NTIA 2YUQA 2XIDA 4CRIA 3G6ET 5J39A 1VQ5Q 3OYJA 1GRIA 2LJ1A 4EDUA 1VQ7T 2EPDA 1YJNT 3ZEHA 1CKBA 3OMGA 4CC4B
chains in the Genus database with same CATH topology
4X1VA 2RPNA 2FEIA 4LNPA 2L2PA 2DL4A 4ESRA 1RLQC 1PHTA 1I0CA 2O88A 2JMAA 1JQQA 1WXBA 2DF6A 2CSIA 2F2WA 4CC7A 4OMLA 2DBMA 1X2KA 5IH2A 2DILA 1UHFA 1AEYA 2AKKA 1WDXA 1JU5C 1QKXA 2JTEA 1X2QA 2KT1A 2EVRA 1N5ZA 4AG2C 3LH5A 1E6GA 2RQTA 2XMFA 5FWCA 2AKLA 2D8HA 3I5SA 1OPKA 2KGTA 3VS3A 5FWBA 2BZ8A 2GBQA 1TUCA 2FO0A 4K11A 3VRZA 3M0PA 2O9VA 1K0XA 1U06A 3REBB 3UATA 4RTWA 2J6KA 1HD3A 2SEMA 1U5SA 1JEGA 2AK5A 2F2XA 4LE9A 1WFWA 3R6NA 1Y57A 1GCQC 4RTVA 1NM7A 2OAWA 2GTOA 3EG3A 4HCKA 1SRLA 4J9FA 2RQRA 2HEQA 3PVLA 1YN8A 1PWTA 2K6DA 1M27C 1UE9A 1CKAA 2FG0A 1GL5A 1PNJA 3FJ5A 5I11A 1FYNA 3O5ZA 1QCFA 2J6OA 2BZXA 3TVTA 2O31A 2X3XD 2CT3A 3I35A 2JM9A 4F16A 4RTXA 2D0NA 2CH4W 2KEAA 1QWEA 4AFSC 2MIOA 1RLPC 2YSQA 1NG2A 4OMMA 1ZX6A 1UUEA 4F17A 1ZUYA 1M3BA 2C0IA 1UECA 1SRMA 1W1FA 1AWJA 4GLMA 1HJDA 1UHCA 4OMPA 2VVKA 3IQLA 2ESWA 2G6FX 4Y92A 4JJBA 2C0TA 2L3PA 1SSHA 4RTUA 2K3BA 2QDLA 1PKSA 3NMZC 1M30A 2J06A 2A08A 4IIOA 2F2VA 1PRMC 2HBWA 1AZGB 1WIEA 1Z9ZA 4WCIA 4KRTA 3H0IA 2PNIA 1ZUUA 2LJ0A 1TUDA 4D8DA 2DL8A 4QT7A 2BTTA 4RTZA 3M0QA 5EC7A 2A28A 2FPDA 1WXUA 2K2MA 2EGAA 3EG0A 3M0TA 1UG1A 1X43A 1K4US 3TSZA 5HCKA 2KE9A 2OJ2A 2M0YA 2JS2A 3H0FA 2ABLA 1WLPB 4AFZC 1ZUKA 1K0SA 2DYBA 2W10A 2DNUA 1H8KA 2EYXA 4A63B 2CREA 4RTYA 1E6HA 2X3WD 1QLYA 1M8MA 1AD5A 4RTTA 1B3QA 4J9GA 1OV3A 1K1ZA 2K7AA 1SPKA 2P4RA 4D8KA 2RF0A 1M3AA 1T0JA 4J9CA 3A98A 1A0NB 4OMQA 2W0ZA 5IXBA 2DVJA 2JXBA 1AWWA 4J9DA 1BK2A 1GCQA 1ZSGA 1HSQA 1I1JA 2DBKA 2EBPA 2ED1A 3VRYA 1NYFA 2A37A 2GNCA 4R0KA 2KR3A 1OOTA 1GFCA 3I5RA 2RMOA 2CH4A 1BB9A 5ECAA 3ZL7C 3JV3A 3M0RA 2CSQA 1W70A 1TG0A 2DLPA 1G83A 3THKA 1CSKA 1OPLA 5L23A 3U23A 1QWFA 2LQNA 4HVWA 3TSWA 3NPFA 3NHNA 2VKNA 1S1NA 2YUPA 5IXFA 3SEMA 1VYUA 4LN2A 1UJ0A 2K9GA 2B86A 3EGUA 4JPBW 2AZVA 2GQIA 3EG2A 2EW3A 2KXDA 2EYZA 3VS5A 5IHIA 1ZBJA 2I0NA 1H3HA 3REAB 2DA9A 2M51A 2LQWA 1G2BA 2J05A 1NEGA 4DEXA 4GBQA 2EYWA 1J3TA 2FPFA 1W6XA 3VS1A 2HSPA 3H41A 2JT4A 2KYMA 3SHWA 1AOJA 3KFVA 3UF4A 2OI3A 2DX1A 1T3LA 4HVVA 2NWMA 4ZNXA 3C0CA 4FSSA 1ABQA 1UJYA 2J7IA 1E7OA 1EFNA 2C0OA 2CT4A 2LCSA 2LNHB 1NYGA 2KNBB 2ROTA 4RUGA 2YT6A 4DEYA 2DRMA 2IIMA 4JJDA 1I07A 2L3SA 2L3QA 1VYVA 4CC3A 1T3SA 3VS7A 1JO8A 3VS6A 1KSWA 2ED0A 2V1RA 2BZYA 1WI7A 1UTIA 2PTKA 1BBZA 2RQUA 4J9HA 2JM8A 2V1QA 1RI9A 1UGVA 4M4ZA 1AVZC 1X69A 2KRMA 1ARKA 2ROLA 3RBBB 1X27A 3EG1A 4AFUC 2YUOA 1GCPA 2JMCA 2PZ1A 2YUNA 4E6RA 3H0HA 1WX6A 4LUEA 1RUWA 1Z9QA 1GFDA 1H92A 2YDLA 2DE0X 4OMNA 2EGEA 2O9SA 2MCNA 1B07A 4J9BA 1MV3A 4IIMA 1YWOA 1WXTA 2RQWA 4OMOA 1BU1A 2JS0A 2LP5A 1AZEA 1XOVA 3EHQA 1KJWA 2A36A 1T0HA 2KRNA 1AWOA 4LUDA 4J9IA 2DL7A 1ZLMA 2RNAA 2DRKA 2O2OA 4HXJA 3UA6A 4CC2A 1MV0B 3UA7A 1K9AA 1FMKA 2FPEA 1WA7A 2EGCA 2K79A 2CDTA 2MOXA 2HDAA 1Y0MA 2DL3A 2EYYA 1WYXA 1KFZA 2KYBA 1NEBA 4Z88A 1GBRA 3M0SA 3VS4A 2SRCA 1GBQA 1MUZA 2AZSA 1QKWA 2H8HA 2RQVA 1NLOC 3PVQA 1JXMA 5FW9A 1K76A 4HVUA 1YP5A 2FRWA 4JJCA 2RN8A 2DM1A 1NLPC 2ECZA 2KRSA 3I9QA 3PE0A 3ULRB 3VS2A 2NUZA 1YNZA 2EKHA 1ABOA 2GTJA 2ENMA 4AFQC 1UDLA 1X6GA 2VWFA 4EIKA 1SHGA 3QWYA 2D1XA 2EQIA 1M3CA 2FRYA 2LJ3A 4AG1C 4Z8AA 1OEBA 1VA7A 2D8JA 4F14A 2E5KA 5IHKA 1X6BA 4ORZA 2HCKA 2DL5A 5IHNA 3GBQA 2KT8A 5GJWB 1YWPA 3M0UA 2JW4A 2GGRA 2KBTA 3RNJA 4J9EA 2KXCA 1YCSB 3CQTA 1VYTA 3NGPA 2LMJA 4Z89A 2LX7A 5GJVB 2DMOA 2YUQA 4JZ3A 1PRLC 1V1CA 5I22A 2LZ6B 1GRIA 1PKTA 1SHFA 2LJ1A 2KROA 1AWXA 3VS0A 3QWXX 1IO6A 2EPDA 1U3OA 2J6FA 3EHRA 1KIKA 1SEMA 2L0AA 1LCKA 1UFFA 2CUDA 1JXOA 1CKBA 2CUBA 4JZ4A 4CC4B 2DJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X1V A;  2RPN A;  2FEI A;  4LNP A;  2L2P A;  2DL4 A;  4ESR A;  1RLQ C;  1PHT A;  1I0C A;  2O88 A;  2JMA A;  1JQQ A;  1WXB A;  2DF6 A;  2CSI A;  2F2W A;  4CC7 A;  4OML A;  2DBM A;  1X2K A;  5IH2 A;  2DIL A;  1UHF A;  1AEY A;  2AKK A;  1WDX A;  1JU5 C;  1QKX A;  2JTE A;  1X2Q A;  2KT1 A;  2EVR A;  1N5Z A;  4AG2 C;  3LH5 A;  1E6G A;  2RQT A;  2XMF A;  5FWC A;  2AKL A;  2D8H A;  3I5S A;  1OPK A;  2KGT A;  3VS3 A;  5FWB A;  2BZ8 A;  2GBQ A;  1TUC A;  2FO0 A;  4K11 A;  3VRZ A;  3M0P A;  2O9V A;  1K0X A;  1U06 A;  3REB B;  3UAT A;  4RTW A;  2J6K A;  1HD3 A;  2SEM A;  1U5S A;  1JEG A;  2AK5 A;  2F2X A;  4LE9 A;  1WFW A;  3R6N A;  1Y57 A;  1GCQ C;  4RTV A;  1NM7 A;  2OAW A;  2GTO A;  3EG3 A;  4HCK A;  1SRL A;  4J9F A;  2RQR A;  2HEQ A;  3PVL A;  1YN8 A;  1PWT A;  2K6D A;  1M27 C;  1UE9 A;  1CKA A;  2FG0 A;  1GL5 A;  1PNJ A;  3FJ5 A;  5I11 A;  1FYN A;  3O5Z A;  1QCF A;  2J6O A;  2BZX A;  3TVT A;  2O31 A;  2X3X D;  2CT3 A;  3I35 A;  2JM9 A;  4F16 A;  4RTX A;  2D0N A;  2CH4 W;  2KEA A;  1QWE A;  4AFS C;  2MIO A;  1RLP C;  2YSQ A;  1NG2 A;  4OMM A;  1ZX6 A;  1UUE A;  4F17 A;  1ZUY A;  1M3B A;  2C0I A;  1UEC A;  1SRM A;  1W1F A;  1AWJ A;  4GLM A;  1HJD A;  1UHC A;  4OMP A;  2VVK A;  3IQL A;  2ESW A;  2G6F X;  4Y92 A;  4JJB A;  2C0T A;  2L3P A;  1SSH A;  4RTU A;  2K3B A;  2QDL A;  1PKS A;  3NMZ C;  1M30 A;  2J06 A;  2A08 A;  4IIO A;  2F2V A;  1PRM C;  2HBW A;  1AZG B;  1WIE A;  1Z9Z A;  4WCI A;  4KRT A;  3H0I A;  2PNI A;  1ZUU A;  2LJ0 A;  1TUD A;  4D8D A;  2DL8 A;  4QT7 A;  2BTT A;  4RTZ A;  3M0Q A;  5EC7 A;  2A28 A;  2FPD A;  1WXU A;  2K2M A;  2EGA A;  3EG0 A;  3M0T A;  1UG1 A;  1X43 A;  1K4U S;  3TSZ A;  5HCK A;  2KE9 A;  2OJ2 A;  2M0Y A;  2JS2 A;  3H0F A;  2ABL A;  1WLP B;  4AFZ C;  1ZUK A;  1K0S A;  2DYB A;  2W10 A;  2DNU A;  1H8K A;  2EYX A;  4A63 B;  2CRE A;  4RTY A;  1E6H A;  2X3W D;  1QLY A;  1M8M A;  1AD5 A;  4RTT A;  1B3Q A;  4J9G A;  1OV3 A;  1K1Z A;  2K7A A;  1SPK A;  2P4R A;  4D8K A;  2RF0 A;  1M3A A;  1T0J A;  4J9C A;  3A98 A;  1A0N B;  4OMQ A;  2W0Z A;  5IXB A;  2DVJ A;  2JXB A;  1AWW A;  4J9D A;  1BK2 A;  1GCQ A;  1ZSG A;  1HSQ A;  1I1J A;  2DBK A;  2EBP A;  2ED1 A;  3VRY A;  1NYF A;  2A37 A;  2GNC A;  4R0K A;  2KR3 A;  1OOT A;  1GFC A;  3I5R A;  2RMO A;  2CH4 A;  1BB9 A;  5ECA A;  3ZL7 C;  3JV3 A;  3M0R A;  2CSQ A;  1W70 A;  1TG0 A;  2DLP A;  1G83 A;  3THK A;  1CSK A;  1OPL A;  5L23 A;  3U23 A;  1QWF A;  2LQN A;  4HVW A;  3TSW A;  3NPF A;  3NHN A;  2VKN A;  1S1N A;  2YUP A;  5IXF A;  3SEM A;  1VYU A;  4LN2 A;  1UJ0 A;  2K9G A;  2B86 A;  3EGU A;  4JPB W;  2AZV A;  2GQI A;  3EG2 A;  2EW3 A;  2KXD A;  2EYZ A;  3VS5 A;  5IHI A;  1ZBJ A;  2I0N A;  1H3H A;  3REA B;  2DA9 A;  2M51 A;  2LQW A;  1G2B A;  2J05 A;  1NEG A;  4DEX A;  4GBQ A;  2EYW A;  1J3T A;  2FPF A;  1W6X A;  3VS1 A;  2HSP A;  3H41 A;  2JT4 A;  2KYM A;  3SHW A;  1AOJ A;  3KFV A;  3UF4 A;  2OI3 A;  2DX1 A;  1T3L A;  4HVV A;  2NWM A;  4ZNX A;  3C0C A;  4FSS A;  1ABQ A;  1UJY A;  2J7I A;  1E7O A;  1EFN A;  2C0O A;  2CT4 A;  2LCS A;  2LNH B;  1NYG A;  2KNB B;  2ROT A;  4RUG A;  2YT6 A;  4DEY A;  2DRM A;  2IIM A;  4JJD A;  1I07 A;  2L3S A;  2L3Q A;  1VYV A;  4CC3 A;  1T3S A;  3VS7 A;  1JO8 A;  3VS6 A;  1KSW A;  2ED0 A;  2V1R A;  2BZY A;  1WI7 A;  1UTI A;  2PTK A;  1BBZ A;  2RQU A;  4J9H A;  2JM8 A;  2V1Q A;  1RI9 A;  1UGV A;  4M4Z A;  1AVZ C;  1X69 A;  2KRM A;  1ARK A;  2ROL A;  3RBB B;  1X27 A;  3EG1 A;  4AFU C;  2YUO A;  1GCP A;  2JMC A;  2PZ1 A;  2YUN A;  4E6R A;  3H0H A;  1WX6 A;  4LUE A;  1RUW A;  1Z9Q A;  1GFD A;  1H92 A;  2YDL A;  2DE0 X;  4OMN A;  2EGE A;  2O9S A;  2MCN A;  1B07 A;  4J9B A;  1MV3 A;  4IIM A;  1YWO A;  1WXT A;  2RQW A;  4OMO A;  1BU1 A;  2JS0 A;  2LP5 A;  1AZE A;  1XOV A;  3EHQ A;  1KJW A;  2A36 A;  1T0H A;  2KRN A;  1AWO A;  4LUD A;  4J9I A;  2DL7 A;  1ZLM A;  2RNA A;  2DRK A;  2O2O A;  4HXJ A;  3UA6 A;  4CC2 A;  1MV0 B;  3UA7 A;  1K9A A;  1FMK A;  2FPE A;  1WA7 A;  2EGC A;  2K79 A;  2CDT A;  2MOX A;  2HDA A;  1Y0M A;  2DL3 A;  2EYY A;  1WYX A;  1KFZ A;  2KYB A;  1NEB A;  4Z88 A;  1GBR A;  3M0S A;  3VS4 A;  2SRC A;  1GBQ A;  1MUZ A;  2AZS A;  1QKW A;  2H8H A;  2RQV A;  1NLO C;  3PVQ A;  1JXM A;  5FW9 A;  1K76 A;  4HVU A;  1YP5 A;  2FRW A;  4JJC A;  2RN8 A;  2DM1 A;  1NLP C;  2ECZ A;  2KRS A;  3I9Q A;  3PE0 A;  3ULR B;  3VS2 A;  2NUZ A;  1YNZ A;  2EKH A;  1ABO A;  2GTJ A;  2ENM A;  4AFQ C;  1UDL A;  1X6G A;  2VWF A;  4EIK A;  1SHG A;  3QWY A;  2D1X A;  2EQI A;  1M3C A;  2FRY A;  2LJ3 A;  4AG1 C;  4Z8A A;  1OEB A;  1VA7 A;  2D8J A;  4F14 A;  2E5K A;  5IHK A;  1X6B A;  4ORZ A;  2HCK A;  2DL5 A;  5IHN A;  3GBQ A;  2KT8 A;  5GJW B;  1YWP A;  3M0U A;  2JW4 A;  2GGR A;  2KBT A;  3RNJ A;  4J9E A;  2KXC A;  1YCS B;  3CQT A;  1VYT A;  3NGP A;  2LMJ A;  4Z89 A;  2LX7 A;  5GJV B;  2DMO A;  2YUQ A;  4JZ3 A;  1PRL C;  1V1C A;  5I22 A;  2LZ6 B;  1GRI A;  1PKT A;  1SHF A;  2LJ1 A;  2KRO A;  1AWX A;  3VS0 A;  3QWX X;  1IO6 A;  2EPD A;  1U3O A;  2J6F A;  3EHR A;  1KIK A;  1SEM A;  2L0A A;  1LCK A;  1UFF A;  2CUD A;  1JXO A;  1CKB A;  2CUB A;  4JZ4 A;  4CC4 B;  2DJQ A; 
#chains in the Genus database with same CATH topology
 4X1V A;  2FEI A;  4J7F A;  2DL4 A;  4ESR A;  1I0C A;  2JMA A;  3Q1J A;  1IHW A;  1YJW A;  5IH2 A;  1AEY A;  1OUL A;  1WDX A;  3OSS C;  3QPH A;  5A0D A;  1JU5 C;  5HKC A;  4FW1 A;  2JTE A;  4IUP A;  1N8R R;  2YLB A;  4LDU A;  2KT1 A;  2GQV A;  2PUO B;  2DZ9 A;  4AG2 C;  3LH5 A;  3JRZ A;  2RQT A;  2CZ7 B;  4OP0 A;  3UDC A;  1NE8 A;  4M78 A;  3A8M B;  5DLQ E;  2OTL Q;  2VGN A;  2E41 A;  3I56 T;  4IKF A;  1PCX A;  5FWB A;  2QQR A;  3OYD A;  1KD1 U;  3QKJ A;  2VXE A;  2DKG A;  1BI3 A;  5KH6 A;  3M0P A;  1NJI U;  3CCM Q;  4F7U F;  1RAF B;  1QP3 A;  3UAT A;  4RTW A;  4NL2 A;  3VYG A;  2AK5 A;  2F2X A;  1WFW A;  5I2M A;  2X4Y A;  3LH0 A;  1NM7 A;  1M4Z A;  3EH1 A;  3CCL Q;  3HP9 A;  4LXC A;  2HEQ A;  4JRQ A;  1PWT A;  2DXC A;  2K6D A;  1WQ7 A;  3MEU A;  3C4S A;  2M0O A;  1GL5 A;  2MK5 A;  2QI2 A;  1LNX A;  4F04 B;  3MJX A;  2NUP A;  2M1H A;  3JCM f;  1WZO A;  3HKS A;  4GLK A;  4OMF B;  4O6J A;  4QQG A;  2D0N A;  2KEA A;  4AFS C;  2EYQ A;  4E7J A;  3CCR A;  3F70 A;  2DYI A;  1NG2 A;  4M78 D;  3JCM W;  1VQK A;  2FVU A;  1UUE A;  2KDS A;  1QVF P;  3ZFJ A;  3LYI A;  3PMT A;  2C0I A;  1WHH A;  3BDU A;  4GLM A;  2NUT B;  3CPW P;  3RER A;  3C94 A;  3L1A A;  2RB6 A;  5GAN 4;  2VXF A;  3H8Z A;  2QQA A;  2C0T A;  1TU0 B;  1OI1 A;  2K3B A;  1K73 U;  2XKO C;  1G3W A;  3G6E A;  1IGQ A;  1PRM C;  3QO3 A;  1AZG B;  3RKW A;  3UPU A;  2O4X B;  3P8D A;  1VQ7 A;  4M75 A;  3JB9 H;  2DTH A;  1YIT Q;  1YJN A;  2E5Q A;  3H0I A;  2HNI A;  1WHG A;  3OY9 A;  3M5A A;  2D0Q B;  2COZ A;  3EFO B;  4QT7 A;  3O8V A;  1FWZ A;  2H3E B;  4WTO B;  5EC7 A;  1VQ4 A;  1WXU A;  4M77 B;  3S3N A;  3X26 B;  1UGR B;  3VKI A;  3EG0 A;  5GAM d;  4XTY A;  1K4U S;  1K9M C;  1VQ6 T;  1OX9 A;  4XU3 A;  5HCK A;  1RAH B;  1KHI A;  2ABL A;  2W10 A;  2DNU A;  3BE3 A;  5LL6 S;  2JNG A;  2CRE A;  1E6H A;  1AD5 A;  3RKX A;  2QQ9 A;  1B7T A;  3HHT B;  5LJ3 j;  4HA8 A;  1N8R U;  3JCM P;  3I56 A;  1TS9 A;  2WSE E;  4J9C A;  3LLR A;  2YXY A;  2CP7 A;  3A98 A;  3KBG A;  4OMQ A;  5IXB A;  4YTL A;  3S6W A;  1BYM A;  1PM3 A;  4PKC C;  4A4E A;  4QKU A;  1M90 C;  4FT4 A;  1HSQ A;  1I1J A;  3LW5 E;  4M75 D;  1NYF A;  1Q86 R;  2A37 A;  4NS5 A;  2QA4 Q;  3DLL A;  2BE7 D;  4M7A B;  4Y28 E;  3DB3 A;  1NPP A;  3JB9 G;  1Q7Y U;  4IUQ A;  2RMO A;  4MZT A;  3JV3 A;  1D1A A;  4C8Q C;  1G83 A;  1VIE A;  1CSK A;  3U23 A;  1IZ6 A;  3TSW A;  3NPF A;  5GAN 7;  2DET A;  3CCM T;  1S1N A;  5IXF A;  3CBM A;  4DBQ A;  1VQP Q;  4LN2 A;  2K9G A;  2JVV A;  3E9G A;  2EW3 A;  5FU7 C;  2OTJ T;  2GFU A;  2EYZ A;  1KQS S;  1RAB B;  2EJG A;  1PSE A;  1H3H A;  4XTZ A;  1S72 Q;  3REA B;  2LQW A;  1ZA2 B;  3QHS A;  1G2B A;  4E2F B;  1J3T A;  1PG5 B;  2EYW A;  2HD0 A;  2FPF A;  2QYZ A;  1VQO Q;  3SHW A;  1MGQ A;  2QTX A;  1YBY A;  4C92 F;  3OYM A;  1D3B B;  2NWM A;  3CXC A;  3FJP A;  3QYH B;  3OYN A;  3TRE A;  2C0O A;  1XTD A;  5GAM e;  1NYG A;  4JLI A;  3QZ9 B;  2RI2 A;  1WGS A;  2DD4 A;  2IIM A;  4JJD A;  4J6X A;  1MMD A;  2L3S A;  2FB7 A;  4CC3 A;  2O01 E;  4DBH A;  1D0X A;  1JO8 A;  4JS5 A;  3AT1 B;  3EGX B;  1IXD A;  2PTK A;  1M2V B;  3HPW A;  1YJW Q;  5KYW B;  2C06 A;  2V1Q A;  5DM7 R;  4M4Z A;  4MML A;  1M5Q 1;  2KRM A;  1VQ6 A;  1ZHI A;  4KGV B;  3RBB B;  1LPL A;  4PNO A;  3EG1 A;  4M78 E;  4HCB A;  4XTX A;  3NTK A;  4CI0 C;  2YUO A;  1GCP A;  2YRC A;  2HZY A;  2COW A;  2YUN A;  5GAO n;  1KQ2 A;  1MMA A;  2P0K A;  4XU1 A;  1RUW A;  1VQ8 T;  5LJ5 f;  1GFD A;  3OYI A;  2EGE A;  2VC8 A;  3QYG B;  4C92 A;  4J9B A;  2P84 A;  4PFP A;  4BY6 B;  1UGP B;  5AT1 B;  4J83 A;  1KJW A;  2HQX A;  1T0H A;  2KRN A;  1K8A R;  1JBM A;  4FYV B;  2DL7 A;  1ZLM A;  1RAE B;  2DVE A;  2LQK A;  1O75 A;  4J6Y A;  2DRK A;  2Y4Y A;  3OYG A;  2FPE A;  5KCH A;  1N9S A;  5KCO A;  1WA7 A;  2EGC A;  1Q86 U;  1JJ2 P;  3OW2 P;  2CDT A;  2MOX A;  3OS5 A;  1Y0M A;  3OYC A;  2QAZ A;  3QSU A;  3CCM A;  2M16 A;  3VS4 A;  1BIA A;  3CCR Q;  1MUZ A;  1VQK Q;  1QKW A;  2RO0 A;  3PVQ A;  1LJO A;  5FW9 A;  1K76 A;  2OTJ A;  2DM1 A;  1NLP C;  3I9Q A;  1IRX A;  5LJ3 h;  1I8F A;  3NTH A;  3OB9 A;  5A0L A;  2QGF B;  1V29 B;  3G71 Q;  4C92 D;  4KUD K;  4LDY A;  1SHG A;  3QBY A;  1D0Z A;  2KY9 A;  4J8O A;  2KAF A;  2FRY A;  2LJ3 A;  4M7D G;  3OYE A;  1OEB A;  3EG9 B;  3CCU T;  2WSC E;  3JB9 J;  4M75 E;  2E5K A;  2HCK A;  2XDP A;  2PU9 B;  1VQ7 Q;  4XU2 A;  4PLI A;  5KYY B;  1YJN Q;  4EMH A;  3NFC A;  5GJW B;  3M0U A;  4J9E A;  2KSS A;  4IUV A;  1M1G A;  1VYT A;  3RUX A;  2XIC A;  1VQ4 Q;  1QCO A;  2LX7 A;  3MO8 A;  5GJV B;  1VQO T;  1WHM A;  3M53 A;  3CME T;  1V1C A;  4FSX A;  4C8Q B;  2LZ6 B;  3MPU B;  4EMK C;  3RR6 A;  2F69 A;  4ZN3 A;  1RL2 A;  3CBO A;  2DXT A;  1U3O A;  2J6F A;  3EHR A;  3CPW A;  4ELZ C;  1VIF A;  3SB2 A;  2CUD A;  1QCN A;  2DJQ A;  5FU7 B;  3I56 Q;  2CP0 A;  4XU0 A;  2L2P A;  1VQ8 A;  1VQN A;  1RLQ C;  1PHT A;  1JQQ A;  2DF6 A;  3L2Q A;  4CC7 A;  2F2W A;  4OML A;  4QW2 A;  3OYK A;  4NL3 A;  3EGD A;  3PT9 A;  3M59 A;  5GAO m;  1TOV A;  2CS7 A;  3BW1 A;  3OBY A;  4ZTJ A;  4AMC A;  2K4Y A;  2EVR A;  1N5Z A;  2ZZD A;  2XMF A;  4ZN1 A;  2D8H A;  2DFU A;  2LQ8 A;  2VB6 A;  3OQ5 A;  1G3T A;  1K8A U;  1Y96 A;  5EG2 A;  1SSF A;  2JUF A;  2ZPF B;  2DAQ A;  4OB1 B;  4C0Z A;  4C92 C;  2DZC A;  3CCV T;  1MMG A;  4LD9 K;  2WAC A;  4LE9 A;  1IRE B;  4RTV A;  1IHV A;  4F7U B;  2GTO A;  2RJE A;  2E10 A;  3EG3 A;  4ELY C;  4XK8 E;  4HT9 A;  3PVL A;  1YN8 A;  4A4K A;  4RCB A;  1Q82 R;  3FJ5 A;  3EFR A;  3ZBD A;  5I11 A;  4DOW A;  1QCF A;  5FRN A;  2BZX A;  1KK7 A;  4KGX B;  2X3X D;  2CT3 A;  2HQE A;  1TH7 A;  2ZPB B;  3I35 A;  2MPX C;  4RG2 A;  1LOJ A;  3CMA T;  3JCM J;  1PD1 A;  4FT2 A;  4MZM A;  3CCU A;  3MP1 A;  4OMM A;  2K5I A;  1EIF A;  2D9T A;  3JCM X;  2ZAE A;  1M1K C;  3G1J A;  1AWJ A;  1HJD A;  4XTW A;  2ZPE B;  1WJS A;  4DOV A;  5FLX E;  3E2U A;  4B6M A;  4C5H A;  1WHL A;  2PQW A;  4M78 F;  3LGL A;  4MMK A;  3G71 T;  4E7H A;  3M55 A;  4QVC A;  3ME9 A;  2G6F X;  3L2R A;  4Y92 A;  4C0D C;  2V8J A;  3CME A;  2R58 A;  2QDL A;  1VQ6 Q;  4HKE A;  2CP2 A;  2PVG B;  9ATC B;  2F2V A;  2GCX A;  4BE1 A;  2K2V A;  5CQY A;  1Z9Z A;  1I81 A;  2CP5 A;  4WCI A;  4JRI A;  4KRT A;  4BE0 A;  4M7D A;  2QDY B;  1TUD A;  2DL8 A;  2BTT A;  1Y71 A;  4C92 E;  3M0Q A;  2A28 A;  5CK9 A;  4N0A C;  1VQ4 T;  2CZ1 B;  1KC8 C;  2KI7 A;  3QJ6 A;  1UG1 A;  1H3Z A;  1W4S A;  2M0Y A;  1BIB A;  1X01 A;  4AFZ C;  4WF2 A;  2RJD A;  2DYB A;  1LVK A;  3QJY A;  1TWB A;  5FU6 C;  1Q95 G;  1YI2 T;  4RTT A;  4J9G A;  2ZGW A;  1ZBX A;  2DD5 A;  4PJO B;  2QQB A;  1OV3 A;  1K1Z A;  2P4R A;  1SPK A;  3V7C A;  1M3A A;  3CC7 T;  1Y7X A;  1T0J A;  3A8L B;  2E4H A;  2XDD A;  3CPF A;  4J9D A;  1GCQ A;  1ZSG A;  2DXU A;  2DBK A;  3VRY A;  2ED1 A;  3CCV A;  4M7D D;  3EH2 A;  4C0G A;  4KUL A;  3OBW A;  2PVO B;  1KQS P;  1BI2 A;  2OTJ Q;  4RMO A;  1U8R A;  2CH4 A;  2MMP A;  1BB9 A;  4PJO G;  4EMK B;  1W70 A;  1OZ3 A;  4M75 F;  2HKN A;  3THK A;  1OPL A;  5GAN g;  1QWF A;  3G4S A;  3CMA A;  1VYU A;  3QXE B;  1JRI A;  1UJ0 A;  3EGU A;  2B86 A;  1Q82 U;  3JCM V;  2AZV A;  1KD1 C;  4O5V A;  1Y07 A;  1NJI C;  2RHY A;  5GAM f;  2BKD N;  2I0N A;  2PVD B;  4ANJ A;  4KGZ B;  2XG8 D;  1JJ2 A;  5D7U A;  2HBP A;  2M51 A;  3T9N A;  3OW2 A;  2QK0 A;  2JJ9 A;  2B8A A;  3URG A;  1NEG A;  4PFZ A;  2E65 A;  5LJ3 g;  4OGC A;  3G71 A;  3SWN A;  4P5N A;  2M9U A;  1W6X A;  2HSP A;  3H41 A;  1FXX A;  2K3X A;  4BAC A;  3KFV A;  1ZSZ C;  1MMN A;  2OI3 A;  2DX1 A;  1PC0 A;  2QGG A;  3D7S B;  3M54 A;  3RES A;  4LD6 A;  1T3L A;  4HVV A;  1Q81 R;  4KBM B;  4ZNX A;  2Z0W A;  3RMS A;  1ABQ A;  1RAA B;  4OB2 B;  3CXC S;  3S3O A;  2LCS A;  3ASK A;  2LNH B;  2KNB B;  4RCC A;  1I07 A;  5FRM A;  5GAN j;  3MEA A;  3VS7 A;  2FZG B;  1VQ8 Q;  1VQN Q;  2BZY A;  1YHQ T;  4BE2 A;  4A54 A;  1ARK A;  4BI4 A;  2VV5 A;  1BI1 A;  4QVZ A;  1X27 A;  1VQL T;  3LWH A;  1YCY A;  3PTA A;  3PIP A;  2GFA A;  4DQ2 A;  2EFI A;  5LJ3 e;  3H6Z A;  2LVM A;  1YI2 A;  2RD1 A;  3H0H A;  3HRT A;  1WX6 A;  5KYX A;  2FL7 A;  3VJP A;  3CC2 T;  2V8I A;  3CC7 A;  1H92 A;  4OMN A;  5KYU A;  4M77 G;  4HCC A;  1YWO A;  4X9D A;  4X9C A;  4QQD A;  4OMO A;  4L59 A;  1XOV A;  2BIV A;  2A36 A;  2DXB A;  3MHX A;  3RMQ A;  1AWO A;  4LUD A;  3A1P A;  1YIJ A;  5CVI A;  4E7K A;  3C12 A;  5GMK e;  3GP8 A;  3CCS A;  1FMV A;  1D0Y A;  3JCM Q;  2K79 A;  3GOX A;  4M78 C;  3L2W A;  5GMK j;  2ZPI B;  2DIG A;  5GAO l;  3CCE T;  1KHC A;  2L8D A;  2KYB A;  3JCM g;  3VV0 A;  1M2O A;  4Z88 A;  1N8R C;  3L2Z A;  3GIB A;  1I5O B;  1GBQ A;  3CCU Q;  2RQV A;  4BDY A;  3A8H B;  4M7A G;  4HVU A;  1YP5 A;  2FRW A;  4JJC A;  2AIR B;  3RIR A;  3WXM B;  2YWW A;  3P8H A;  2EKH A;  1WPY A;  3WVD B;  4E7Z A;  3HFO A;  1UDL A;  2VWF A;  4E47 A;  5FU6 B;  1Q7Y C;  4C5G A;  4PJO A;  3QWY A;  2D1X A;  2EQI A;  3JB9 I;  2RM4 A;  2ZCF B;  2L89 A;  3CME Q;  1H64 1;  5KE2 A;  2DJZ A;  3QDF A;  2CKK A;  1M1F A;  2LT1 A;  2EQJ A;  2KVQ G;  3SD4 A;  2FZC B;  2EWN A;  3GBQ A;  3FLG A;  2KT8 A;  1QVG P;  1Q81 U;  4PJN A;  5D6Y A;  3L2V A;  1B34 B;  2Y90 A;  3OA6 A;  3CQT A;  4Z02 A;  4JS4 A;  4DBR A;  2LMJ A;  4Z89 A;  1PRL C;  1G8X A;  1YHQ A;  5I22 A;  1SHF A;  1WJR A;  2KRO A;  1QVF S;  3VS0 A;  3QWX X;  1VQL A;  1TTH B;  3VUB A;  2CGH A;  2M02 A;  1KIK A;  3M58 A;  2LCL A;  2KK4 A;  2MYS A;  1C0M A;  1SEM A;  1UFF A;  1FMW A;  1JXO A;  4M75 C;  4JZ4 A;  2X51 A;  4PJO D;  3M9Q A;  5IAY A;  2RPN A;  1R77 A;  4LNP A;  2O88 A;  1VQN T;  3CC2 A;  2CSI A;  3PIO A;  2NUT A;  3BFM A;  2DEU A;  4HT8 A;  3JB9 F;  2DIL A;  1ZA1 B;  4FCY A;  1TXQ A;  4EPC A;  3CCV Q;  1X2Q A;  3OSV A;  4L6V 5;  1DJ7 B;  2EJF A;  1ZSZ B;  3MET A;  5KE3 A;  2AKL A;  3I5S A;  2FYK A;  5GAN h;  1OPK A;  4IUT A;  1W2B S;  3QUI A;  2GBQ A;  2E3H A;  2O4X A;  4KH0 B;  1TUC A;  4K11 A;  3VRZ A;  3CCE A;  1K0X A;  2P4T A;  3G4S Q;  3CMA Q;  2DER A;  2DTI A;  2SEM A;  1BCM A;  1C1A A;  3EFO A;  6AT1 B;  1JEG A;  5IT9 E;  2LNV A;  4LDX A;  1Y57 A;  4M77 A;  2FZK B;  4JRP A;  1M1K R;  4J9F A;  2OAW A;  3E1S A;  2RJF A;  2EAY A;  1M27 C;  4NOY A;  5IN1 A;  2FG0 A;  3OS0 A;  2CYZ B;  1FYN A;  2J6O A;  3TVT A;  2O31 A;  4AT1 B;  3OYF A;  5GAO r;  2JM9 A;  1G5V A;  4ZTF A;  1WJQ A;  4RTX A;  2XI9 A;  7AT1 B;  1Q86 C;  2E64 A;  2EKO A;  4RG8 A;  1KQS A;  4E7L A;  1ZX6 A;  1V76 A;  2F5T X;  4F17 A;  2XK0 A;  1X6O A;  1M3B A;  1UEC A;  1W1F A;  2DEQ A;  3FB9 A;  4D6W A;  4JRK A;  2D6F A;  1C6V X;  3VU3 C;  5GMK h;  4OMP A;  2VVK A;  3EAE A;  2GF7 A;  3RKY A;  3IQL A;  4M7A A;  2ESW A;  4X34 A;  4E7I A;  3E9F A;  4M77 D;  1SSH A;  5J3B A;  4RTU A;  4M78 B;  4A53 A;  1PKS A;  5GMK i;  5I21 A;  4PJM A;  2J06 A;  2A08 A;  4N4G A;  4IIO A;  2E3I A;  3S3M A;  1WHJ A;  4ZGJ B;  4KH1 B;  1YI2 Q;  2PNI A;  1ACM B;  3JB9 D;  2DO3 A;  1TSF A;  4D8D A;  4RTZ A;  3A8O B;  4OF1 A;  1QW1 A;  3CC7 Q;  2FPD A;  3GLX A;  1TUG B;  2K2M A;  1F1B B;  1QP2 A;  4C8Q G;  1XQH A;  2KE9 A;  3TEE A;  2JN0 A;  3J7A F;  3H0F A;  2Y4X A;  3CCQ Q;  1K0S A;  1H8K A;  2KQW A;  2NUP B;  2EYX A;  3I55 T;  1YIJ Q;  2X3W D;  1QLY A;  1M8M A;  4M7A D;  1UEB A;  2EQM A;  3CCS Q;  5HY6 A;  1D3B A;  2NYS A;  2K7A A;  5CKD A;  4RKU E;  4A4H A;  4D8K A;  3CC4 T;  4BD3 A;  3OYH A;  3JCM h;  2LCC A;  1A0N B;  2WSF E;  2DVJ A;  2XHC A;  3X25 B;  3EGX A;  2GNC A;  5CKB A;  1M2V A;  5KYW A;  3PFS A;  1NBE B;  3JSC A;  4ME7 A;  2QXF A;  2DLP A;  4M7D F;  2HL3 A;  5L23 A;  5C0M A;  5LJ5 j;  2ATC B;  3FEO A;  3KXT A;  1NZ9 A;  4M75 B;  4LDV A;  3G4S T;  4DBF A;  3OMC A;  3SEM A;  4JPB W;  1K8A C;  1NPR A;  4M77 C;  4F7U G;  3VS5 A;  5IHI A;  2RHU A;  4OB0 B;  2KMT A;  3VUZ A;  2DA9 A;  4FYY B;  2EJ9 A;  1HYO A;  3VS1 A;  5DLO A;  2KYM A;  2QG9 B;  2ZPG B;  1YHQ Q;  2V26 A;  1K9M R;  4Y91 A;  5HK0 A;  3JAM E;  1UJY A;  1MHN A;  1E7O A;  2J7I A;  2LT4 A;  1VQM T;  1VQL Q;  2CT4 A;  3DKM A;  4HCZ A;  3M4Y A;  2YT6 A;  4DEY A;  2DRM A;  2L3Q A;  1VYV A;  1T3S A;  5D6X A;  3X24 B;  3VS6 A;  2MWP A;  1KSW A;  3X20 B;  3CC2 Q;  4M7A C;  1WI7 A;  1UTI A;  4J9H A;  3FC3 A;  1YJ9 T;  2JM8 A;  1UGQ B;  4OGE A;  3CBP A;  2X35 A;  4V2S A;  1UGV A;  5GAN d;  2MAM A;  1M90 R;  1RAI B;  3HTR A;  3I55 A;  2JMC A;  2JOY A;  1QVG A;  1U1S A;  2PZ1 A;  3EG9 A;  4C5E A;  4LUE A;  1Z9Q A;  3CC4 A;  4FW2 A;  1EX4 A;  2YDL A;  2DE0 X;  1IB8 A;  2JZ2 A;  5KYY A;  2O9S A;  2XD0 A;  3CCE Q;  1B07 A;  4PJL A;  1MV3 A;  5GAO q;  4ZGE B;  4M77 E;  3OYB A;  2RQW A;  3P8B B;  5LJ3 d;  1M9S A;  3CCQ T;  4A4F A;  4J9I A;  3V8L A;  4R55 A;  1YIJ T;  2RNA A;  2RH2 A;  2XDB A;  2O2O A;  4C8Q A;  4HXJ A;  2X9H A;  4CC2 A;  1WHK A;  3UA7 A;  3CCS T;  1FMK A;  3SFM A;  2VGM A;  2XU8 A;  1Q7Y R;  1XNI A;  2ZPH B;  4UC4 A;  1KFZ A;  1NEB A;  1SG5 A;  1XJW B;  3M0S A;  2SRC A;  3H9N A;  2H8H A;  5GAO p;  5J26 A;  1NLO C;  1JXM A;  2DPP B;  2RN8 A;  2KRS A;  5L8R E;  3V7S A;  4E7S A;  3VS2 A;  4M7A E;  1YNZ A;  1ABO A;  2GTJ A;  5DY9 A;  2IG0 A;  3DB4 A;  3N5B B;  4EIK A;  1VQ9 T;  4KUI A;  2E1H A;  3R6O A;  4AG1 C;  3MEV A;  1GXI E;  3DLM A;  3TQ7 P;  4C8Q D;  4F14 A;  5IHK A;  2HQH A;  5D6W A;  1X6B A;  4R56 A;  1VQM A;  2DL5 A;  4DA4 A;  4EMG A;  5IHN A;  1OU8 A;  3HSB A;  1OX8 A;  5GAN e;  2MF2 A;  4BY6 C;  1Q82 C;  4C92 B;  3EFS A;  1K9M U;  3INZ A;  1YWP A;  2GGR A;  1QMC A;  5LJ5 h;  3RNJ A;  3UWN A;  4II1 A;  4F7U A;  2QTV A;  2PUK B;  1AHJ B;  3NGP A;  3CD6 T;  2DMO A;  1YJ9 A;  4JZ3 A;  2YHT A;  5CCA A;  2COY A;  1O9S A;  3PGG A;  2RHZ A;  1PKT A;  3VYH B;  1AWX A;  2EQK A;  2QEX T;  2RJC A;  1IO6 A;  3JCM d;  3MP8 A;  5CKE A;  4C92 G;  2MI6 A;  2L0A A;  1LCK A;  2CUB A;  1K73 C;  3OYY A;  4M7D C;  1W2B P;  4PL6 A;  1M90 U;  2R57 A;  3OS2 A;  1P92 A;  1WXB A;  5A0G A;  3OYL A;  2DBM A;  1X2K A;  2R5A A;  3A8G B;  1UHF A;  2AKK A;  1QVP A;  1VQ5 T;  4PJO F;  1QKX A;  3QDR B;  3CCQ A;  4FYW B;  2DIQ A;  1E6G A;  3CCJ Q;  2L5Q A;  5FWC A;  4C0D B;  2JTF A;  2K5L A;  2KGT A;  4JUV A;  3VS3 A;  2BZ8 A;  2X4X A;  5KYN A;  3JCM c;  4A4G A;  5GAN 3;  2FO0 A;  5AYF A;  3V7R A;  2RK2 A;  2OX7 A;  2O9V A;  1U06 A;  2EQU A;  2L3R A;  3REB B;  2J6K A;  1HD3 A;  2F1L A;  1U5S A;  1JB0 E;  2K3Y A;  2LRQ A;  3L42 A;  1HK9 A;  3R6N A;  4C0F A;  1KQ1 A;  4B9W A;  1GCQ C;  2CZ0 B;  2V8K A;  4HCK A;  1SRL A;  5CQX A;  2OTL T;  4L5G A;  4Q5W A;  1VUB A;  2RQR A;  4XTV A;  1UE9 A;  2A0F B;  1CKA A;  2P0Q A;  5GAM g;  1HXD A;  1PNJ A;  3O5Z A;  1RI0 A;  1UB4 A;  1EZZ B;  4F16 A;  1VQ9 A;  4J7I A;  1R8O B;  2CH4 W;  4J5Y A;  1QWE A;  1QQJ A;  2MIO A;  2YRV A;  5CKF A;  1RLP C;  3GNF B;  2YSQ A;  4IUU A;  3GNG A;  3CCL T;  1ZUY A;  4M7D E;  5GMK l;  1R0C B;  1SRM A;  2LX9 A;  1BCO A;  3EGD B;  2IPO B;  1UHC A;  2BUD A;  5A2Q E;  2DK3 A;  2DTO A;  3JCM e;  5FRO A;  1OQK A;  2E12 A;  4EMK A;  3A5Z B;  4JJB A;  2HMA A;  3TCJ A;  3OYA A;  3CD6 A;  2L3P A;  3SWN C;  3M56 A;  3NMZ C;  3MKD A;  3OS1 A;  1M30 A;  2VUB A;  2A3L A;  2HBW A;  1WIE A;  5CIU A;  2QEX A;  1Y96 B;  2A7Y A;  3I55 Q;  4M77 F;  5GAM j;  1N9R A;  3FDR A;  4PLL A;  2X4J A;  1ZUU A;  2LJ0 A;  3CPW S;  2VYT A;  1D1B A;  1WNL A;  3CC4 Q;  4BB7 A;  1OYX A;  2EGA A;  3M0T A;  1X43 A;  1Q81 C;  3TSZ A;  3KUF A;  2OJ2 A;  1VQ5 A;  2VAS A;  4MDW A;  2JS2 A;  4XQ3 A;  2RHI A;  1OU9 A;  1WLP B;  1ZUK A;  2HKQ B;  4C8Q E;  2G3R A;  4A63 B;  1G3Y A;  1ZQ1 A;  3UT1 A;  4RTY A;  1YIT T;  1D09 B;  1U1T A;  2K57 A;  3QG1 A;  1B3Q A;  3HRU A;  4PJJ A;  5GAN 5;  2RF0 A;  1PD0 A;  4BI3 A;  1M8V A;  2HL5 C;  2E6N A;  2R5M A;  2K5F A;  2W0Z A;  4M7A F;  2JXB A;  2RA2 A;  1AWW A;  1BK2 A;  3LX7 A;  5GAN 8;  3FIF A;  2EBP A;  4R0K A;  2KR3 A;  1VOM A;  2YRD A;  1UGS B;  3M57 A;  1I5L A;  1OOT A;  1GFC A;  2E70 A;  4XAX B;  1G3S A;  3I5R A;  4JJN K;  3ZL7 C;  5ECA A;  3CCJ T;  2OTL A;  3M0R A;  2CSQ A;  2JTM A;  2OAU A;  2CZ6 B;  1TG0 A;  2HAX A;  3GF5 A;  1I4K 1;  2LQN A;  3J80 E;  2RK1 A;  4N4I A;  4HVW A;  3NHN A;  2VKN A;  2YUP A;  3V8K A;  4M7D B;  1BI0 A;  4BI8 B;  2QA4 T;  2MWO A;  2GQI A;  2H3J A;  2HSE B;  2X4W A;  5LJ5 d;  3EG2 A;  4BDZ A;  1FX7 A;  2KXD A;  1MNE A;  1VQM Q;  3PMI A;  4KT0 E;  1N6A A;  3CCL A;  1ZBJ A;  4F7U E;  1AT1 B;  5CR2 A;  3M4G A;  2J05 A;  4QQ6 A;  4DEX A;  4GBQ A;  4PFO A;  5CAI A;  1R0B G;  2JT4 A;  1AOJ A;  1YJ9 Q;  5GAN 6;  1VQP T;  3UF4 A;  1KC8 R;  3HFN A;  3G6E Q;  4PJO C;  3LGF A;  3C0C A;  2NLU A;  4FSS A;  1RAD B;  1OZ2 A;  1EFN A;  4IUR A;  3G7Z A;  2ROT A;  3MCA B;  4RUG A;  3LWI A;  1S72 T;  1N27 A;  4MDX A;  3MEW A;  4FYX B;  4N0A A;  4JDS A;  2ED0 A;  2V1R A;  4QVD A;  1BKB A;  1BBZ A;  2RQU A;  2YLC A;  4JLG A;  5M9O A;  5LJ5 g;  4FM4 B;  1RI9 A;  3SDZ A;  1RAC B;  2CP6 A;  1AVZ C;  1X69 A;  4M78 G;  1QVF A;  2LDM A;  2ROL A;  1WQW A;  2IVW A;  2FHD A;  4AFU C;  3C95 A;  4B9X A;  2E6Z A;  1YIT A;  8ATC B;  4E6R A;  1QVG S;  4FL6 A;  1IGU A;  4OVA A;  4XTU A;  3ER0 A;  1YJW T;  3HL8 A;  2AHJ B;  3QZ5 B;  2MCN A;  4OB3 B;  1RAG B;  2BE9 B;  3BDL A;  2AT1 B;  4IIM A;  3E19 A;  3TU4 K;  2QAS A;  1WXT A;  1B34 A;  1BU1 A;  2JS0 A;  2LP5 A;  1AZE A;  3WVE B;  2LC4 A;  3EHQ A;  3FRN A;  1KD1 R;  3X28 B;  4MZP A;  1NJI R;  5GAM h;  3SWN B;  5CO7 A;  3UA6 A;  3AHU A;  1W2B A;  1MV0 B;  3CEY A;  1K9A A;  3CCJ A;  1D1C A;  5GMK m;  2P0P A;  5LJ5 e;  3MP6 A;  1MND A;  4PJO E;  2HDA A;  4FIB A;  3BY7 A;  4J6W A;  4PK4 A;  2DL3 A;  2EYY A;  1WYX A;  4LDW A;  5I2S A;  1VQ9 Q;  4C5I A;  4VUB A;  5GAN 2;  1M1K U;  3V8J A;  1KG1 A;  2QQS A;  3RDV A;  1GBR A;  5C6S A;  2AZS A;  2QA4 A;  1X75 C;  3GPL A;  3CXC P;  2LTO A;  2ECZ A;  3PNW C;  3PE0 A;  2CP3 A;  3ULR B;  2NUZ A;  5GAN f;  2ENM A;  4AFQ C;  1YFN A;  4ATO A;  1X6G A;  2RI3 A;  5HK3 A;  1JJ2 S;  3QII A;  3OW2 S;  1ZSZ A;  4N4H A;  1SKU B;  2I2L A;  4M75 G;  3CD6 Q;  1M3C A;  4Z8A A;  3CCR T;  1VQP A;  2RHX A;  1VQK T;  1VA7 A;  2D8J A;  3L2U A;  1SF9 A;  2RI5 A;  5KYX B;  1PSF A;  2F5K A;  4ORZ A;  2QEX Q;  5KYU B;  3HRS A;  1KC8 U;  5CKH A;  4BUG A;  3J81 E;  1S72 A;  1K73 R;  2JW4 A;  5LJ3 f;  4ZGD B;  4GY5 A;  2KBT A;  4C8Q F;  4FU6 A;  2KXC A;  1YCS B;  8AT1 B;  2EIF A;  4TVR A;  1VQO A;  3JCM b;  3NTI A;  2YUQ A;  2XID A;  4CRI A;  3G6E T;  5J39 A;  1VQ5 Q;  3OYJ A;  1GRI A;  2LJ1 A;  4EDU A;  1VQ7 T;  2EPD A;  1YJN T;  3ZEH A;  1CKB A;  3OMG A;  4CC4 B; 
#chains in the Genus database with same CATH homology
 4X1V A;  2RPN A;  2FEI A;  4LNP A;  2L2P A;  2DL4 A;  4ESR A;  1RLQ C;  1PHT A;  1I0C A;  2O88 A;  2JMA A;  1JQQ A;  1WXB A;  2DF6 A;  2CSI A;  2F2W A;  4CC7 A;  4OML A;  2DBM A;  1X2K A;  5IH2 A;  2DIL A;  1UHF A;  1AEY A;  2AKK A;  1WDX A;  1JU5 C;  1QKX A;  2JTE A;  1X2Q A;  2KT1 A;  2EVR A;  1N5Z A;  4AG2 C;  3LH5 A;  1E6G A;  2RQT A;  2XMF A;  5FWC A;  2AKL A;  2D8H A;  3I5S A;  1OPK A;  2KGT A;  3VS3 A;  5FWB A;  2BZ8 A;  2GBQ A;  1TUC A;  2FO0 A;  4K11 A;  3VRZ A;  3M0P A;  2O9V A;  1K0X A;  1U06 A;  3REB B;  3UAT A;  4RTW A;  2J6K A;  1HD3 A;  2SEM A;  1U5S A;  1JEG A;  2AK5 A;  2F2X A;  4LE9 A;  1WFW A;  3R6N A;  1Y57 A;  1GCQ C;  4RTV A;  1NM7 A;  2OAW A;  2GTO A;  3EG3 A;  4HCK A;  1SRL A;  4J9F A;  2RQR A;  2HEQ A;  3PVL A;  1YN8 A;  1PWT A;  2K6D A;  1M27 C;  1UE9 A;  1CKA A;  2FG0 A;  1GL5 A;  1PNJ A;  3FJ5 A;  5I11 A;  1FYN A;  3O5Z A;  1QCF A;  2J6O A;  2BZX A;  3TVT A;  2O31 A;  2X3X D;  2CT3 A;  3I35 A;  2JM9 A;  4F16 A;  4RTX A;  2D0N A;  2CH4 W;  2KEA A;  1QWE A;  4AFS C;  2MIO A;  1RLP C;  2YSQ A;  1NG2 A;  4OMM A;  1ZX6 A;  1UUE A;  4F17 A;  1ZUY A;  1M3B A;  2C0I A;  1UEC A;  1SRM A;  1W1F A;  1AWJ A;  4GLM A;  1HJD A;  1UHC A;  4OMP A;  2VVK A;  3IQL A;  2ESW A;  2G6F X;  4Y92 A;  4JJB A;  2C0T A;  2L3P A;  1SSH A;  4RTU A;  2K3B A;  2QDL A;  1PKS A;  3NMZ C;  1M30 A;  2J06 A;  2A08 A;  4IIO A;  2F2V A;  1PRM C;  2HBW A;  1AZG B;  1WIE A;  1Z9Z A;  4WCI A;  4KRT A;  3H0I A;  2PNI A;  1ZUU A;  2LJ0 A;  1TUD A;  4D8D A;  2DL8 A;  4QT7 A;  2BTT A;  4RTZ A;  3M0Q A;  5EC7 A;  2A28 A;  2FPD A;  1WXU A;  2K2M A;  2EGA A;  3EG0 A;  3M0T A;  1UG1 A;  1X43 A;  1K4U S;  3TSZ A;  5HCK A;  2KE9 A;  2OJ2 A;  2M0Y A;  2JS2 A;  3H0F A;  2ABL A;  1WLP B;  4AFZ C;  1ZUK A;  1K0S A;  2DYB A;  2W10 A;  2DNU A;  1H8K A;  2EYX A;  4A63 B;  2CRE A;  4RTY A;  1E6H A;  2X3W D;  1QLY A;  1M8M A;  1AD5 A;  4RTT A;  1B3Q A;  4J9G A;  1OV3 A;  1K1Z A;  2K7A A;  1SPK A;  2P4R A;  4D8K A;  2RF0 A;  1M3A A;  1T0J A;  4J9C A;  3A98 A;  1A0N B;  4OMQ A;  2W0Z A;  5IXB A;  2DVJ A;  2JXB A;  1AWW A;  4J9D A;  1BK2 A;  1GCQ A;  1ZSG A;  1HSQ A;  1I1J A;  2DBK A;  2EBP A;  2ED1 A;  3VRY A;  1NYF A;  2A37 A;  2GNC A;  4R0K A;  2KR3 A;  1OOT A;  1GFC A;  3I5R A;  2RMO A;  2CH4 A;  1BB9 A;  5ECA A;  3ZL7 C;  3JV3 A;  3M0R A;  2CSQ A;  1W70 A;  1TG0 A;  2DLP A;  1G83 A;  3THK A;  1CSK A;  1OPL A;  5L23 A;  3U23 A;  1QWF A;  2LQN A;  4HVW A;  3TSW A;  3NPF A;  3NHN A;  2VKN A;  1S1N A;  2YUP A;  5IXF A;  3SEM A;  1VYU A;  4LN2 A;  1UJ0 A;  2K9G A;  2B86 A;  3EGU A;  4JPB W;  2AZV A;  2GQI A;  3EG2 A;  2EW3 A;  2KXD A;  2EYZ A;  3VS5 A;  5IHI A;  1ZBJ A;  2I0N A;  1H3H A;  3REA B;  2DA9 A;  2M51 A;  2LQW A;  1G2B A;  2J05 A;  1NEG A;  4DEX A;  4GBQ A;  2EYW A;  1J3T A;  2FPF A;  1W6X A;  3VS1 A;  2HSP A;  3H41 A;  2JT4 A;  2KYM A;  3SHW A;  1AOJ A;  3KFV A;  3UF4 A;  2OI3 A;  2DX1 A;  1T3L A;  4HVV A;  2NWM A;  4ZNX A;  3C0C A;  4FSS A;  1ABQ A;  1UJY A;  2J7I A;  1E7O A;  1EFN A;  2C0O A;  2CT4 A;  2LCS A;  2LNH B;  1NYG A;  2KNB B;  2ROT A;  4RUG A;  2YT6 A;  4DEY A;  2DRM A;  2IIM A;  4JJD A;  1I07 A;  2L3S A;  2L3Q A;  1VYV A;  4CC3 A;  1T3S A;  3VS7 A;  1JO8 A;  3VS6 A;  1KSW A;  2ED0 A;  2V1R A;  2BZY A;  1WI7 A;  1UTI A;  2PTK A;  1BBZ A;  2RQU A;  4J9H A;  2JM8 A;  2V1Q A;  1RI9 A;  1UGV A;  4M4Z A;  1AVZ C;  1X69 A;  2KRM A;  1ARK A;  2ROL A;  3RBB B;  1X27 A;  3EG1 A;  4AFU C;  2YUO A;  1GCP A;  2JMC A;  2PZ1 A;  2YUN A;  4E6R A;  3H0H A;  1WX6 A;  4LUE A;  1RUW A;  1Z9Q A;  1GFD A;  1H92 A;  2YDL A;  2DE0 X;  4OMN A;  2EGE A;  2O9S A;  2MCN A;  1B07 A;  4J9B A;  1MV3 A;  4IIM A;  1YWO A;  1WXT A;  2RQW A;  4OMO A;  1BU1 A;  2JS0 A;  2LP5 A;  1AZE A;  1XOV A;  3EHQ A;  1KJW A;  2A36 A;  1T0H A;  2KRN A;  1AWO A;  4LUD A;  4J9I A;  2DL7 A;  1ZLM A;  2RNA A;  2DRK A;  2O2O A;  4HXJ A;  3UA6 A;  4CC2 A;  1MV0 B;  3UA7 A;  1K9A A;  1FMK A;  2FPE A;  1WA7 A;  2EGC A;  2K79 A;  2CDT A;  2MOX A;  2HDA A;  1Y0M A;  2DL3 A;  2EYY A;  1WYX A;  1KFZ A;  2KYB A;  1NEB A;  4Z88 A;  1GBR A;  3M0S A;  3VS4 A;  2SRC A;  1GBQ A;  1MUZ A;  2AZS A;  1QKW A;  2H8H A;  2RQV A;  1NLO C;  3PVQ A;  1JXM A;  5FW9 A;  1K76 A;  4HVU A;  1YP5 A;  2FRW A;  4JJC A;  2RN8 A;  2DM1 A;  1NLP C;  2ECZ A;  2KRS A;  3I9Q A;  3PE0 A;  3ULR B;  3VS2 A;  2NUZ A;  1YNZ A;  2EKH A;  1ABO A;  2GTJ A;  2ENM A;  4AFQ C;  1UDL A;  1X6G A;  2VWF A;  4EIK A;  1SHG A;  3QWY A;  2D1X A;  2EQI A;  1M3C A;  2FRY A;  2LJ3 A;  4AG1 C;  4Z8A A;  1OEB A;  1VA7 A;  2D8J A;  4F14 A;  2E5K A;  5IHK A;  1X6B A;  4ORZ A;  2HCK A;  2DL5 A;  5IHN A;  3GBQ A;  2KT8 A;  5GJW B;  1YWP A;  3M0U A;  2JW4 A;  2GGR A;  2KBT A;  3RNJ A;  4J9E A;  2KXC A;  1YCS B;  3CQT A;  1VYT A;  3NGP A;  2LMJ A;  4Z89 A;  2LX7 A;  5GJV B;  2DMO A;  2YUQ A;  4JZ3 A;  1PRL C;  1V1C A;  5I22 A;  2LZ6 B;  1GRI A;  1PKT A;  1SHF A;  2LJ1 A;  2KRO A;  1AWX A;  3VS0 A;  3QWX X;  1IO6 A;  2EPD A;  1U3O A;  2J6F A;  3EHR A;  1KIK A;  1SEM A;  2L0A A;  1LCK A;  1UFF A;  2CUD A;  1JXO A;  1CKB A;  2CUB A;  4JZ4 A;  4CC4 B;  2DJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...