1GFCA

Solution structure and ligand-binding site of the c-terminal sh3 domain of grb2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
GSTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
publication title Solution structure and ligand-binding site of the carboxy-terminal SH3 domain of GRB2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Adaptor protein containing sh2 and sh3
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1994-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gfcA00
1QWFA 1BBZA 2RPNA 4CC4B 2PTKA 1UDLA 2KYBA 1PHTA 1T0HA 2CREA 2X3XD 1SHGA 2CT3A 4HCKA 1UFFA 2KT1A 1J3TA 2ECZA 3EG0A 2I0NA 2NUZA 1KIKA 3ZL7C 2G6FX 2QDLA 4K11A 4ORZA 5IXBA 4DEYA 2HCKA 2AKKA 2O2OA 1NM7A 1M27C 1UECA 1MV3A 2J05A 2JW4A 5IHKA 2JS0A 3M0QA 1E7OA 2C0IA 1PKSA 4LN2A 1SRMA 3JV3A 1I07A 4JPBW 2FRWA 1HJDA 1K0XA 1M3AA 1EFNA 2DL4A 2FG0A 1I0CA 2O88A 4ZNXA 1V1CA 2DYBA 2DL3A 1AWWA 2DE0X 1MUZA 1SPKA 2GTJA 2RQVA 2SEMA 3EG1A 1GFCA 3PE0A 1UE9A 2OJ2A 2KNBB 2JM8A 3UA7A 2HDAA 1UHFA 2K3BA 2FPDA 1S1NA 2ESWA 3REBB 2JS2A 3O5ZA 1QLYA 2A36A 4JJCA 1E6GA 3PVLA 1JXOA 3NMZC 2DJQA 1YNZA 3NGPA 2B86A 2LJ1A 2HEQA 2ABLA 3RNJA 1PRLC 4QT7A 4OMOA 1PWTA 1CKBA 1NYFA 2KRSA 1T3SA 1NG2A 3TVTA 1FYNA 2IIMA 1Z9ZA 2CUBA 3UA6A 4HVVA 1U3OA 2YDLA 1E6HA 1B07A 1AVZC 2YUQA 2C0TA 1RLPC 2V1QA 1WXBA 4RTUA 4Z8AA 3ULRB 2K9GA 2EW3A 1GL5A 2EYWA 2AK5A 2DM1A 1X2QA 1A0NB 1JQQA 3EG2A 4FSSA 1Z9QA 4Y92A 4AG2C 2MIOA 1T3LA 1VYUA 1JEGA 1WXUA 1AZEA 1I1JA 3QWYA 4CC3A 2BZXA 3I35A 1OOTA 4OMMA 2EGEA 2LP5A 5GJWB 1UJYA 2D0NA 5FW9A 4AFZC 1CKAA 2KGTA 2EBPA 2P4RA 4RTWA 1SRLA 1H8KA 2EYXA 2JMAA 1K76A 4IIOA 2W10A 1X6BA 3KFVA 2ROLA 2O9SA 2O31A 1ARKA 1QCFA 3M0SA 1YWPA 1NYGA 2K7AA 2AZVA 2GTOA 2FPEA 1X2KA 1WFWA 1UUEA 1PKTA 3C0CA 4RTYA 1QKXA 5HCKA 2ENMA 2K2MA 4WCIA 1M30A 2DL7A 2LJ3A 2M51A 1RI9A 2CH4A 1BU1A 1BK2A 4J9DA 1UHCA 1GFDA 2CDTA 2CUDA 2KROA 2F2VA 3VS1A 1SHFA 3TSWA 1G2BA 1W70A 1ZBJA 2D8HA 4AFSC 3I5RA 4J9GA 2DF6A 1IO6A 1GBRA 1JXMA 4HXJA 5I11A 2YSQA 3I9QA 4J9HA 2DBMA 1NLPC 2DBKA 1M8MA 1UG1A 2ED1A 2LZ6B 2O9VA 2ROTA 1X43A 2FO0A 2DX1A 2L3QA 2M0YA 1UGVA 2HSPA 4CC7A 2DNUA 2ED0A 4OMNA 1XOVA 4DEXA 4F14A 1U5SA 1ZUKA 2GGRA 2L2PA 4LE9A 4M4ZA 1B3QA 1CSKA 1AWXA 2RQWA 5FWCA 4F17A 1OPKA 3EGUA 2EYZA 2JM9A 2W0ZA 2K6DA 3H0HA 5FWBA 3EG3A 1PNJA 1M3CA 1VA7A 4RTVA 3SHWA 1SSHA 2CH4W 2D1XA 1H3HA 4Z88A 2KXDA 1TUDA 4X1VA 2KEAA 3H0IA 2L3SA 3NPFA 3IQLA 2KT8A 1VYTA 5IHNA 1AOJA 2DLPA 2BTTA 3M0PA 1QWEA 3NHNA 4A63B 1G83A 3THKA 2KBTA 2V1RA 3VRYA 2DA9A 2RQRA 2LJ0A 4D8KA 3VS3A 1X27A 2SRCA 4EIKA 2J6OA 4AG1C 5I22A 4J9BA 1GCPA 1OV3A 2CSIA 2KRMA 4GLMA 2LQNA 4LNPA 4Z89A 1SEMA 4F16A 1HD3A 2GNCA 3H0FA 1K1ZA 3VS4A 2VVKA 1X69A 2LNHB 2JTEA 4RUGA 1JO8A 1FMKA 2VWFA 2F2XA 1ZLMA 3VS0A 3REAB 1ZSGA 4KRTA 2H8HA 1ZX6A 2A37A 2EGCA 1ABQA 1UTIA 1WLPB 1YCSB 3PVQA 4JZ4A 4OMLA 3A98A 3U23A 3RBBB 1GRIA 1GCQC 2RF0A 5GJVB 1NLOC 2L0AA 4JJDA 4AFUC 2EVRA 1ZUUA 2CSQA 1MV0B 4LUEA 2KXCA 2RMOA 2OI3A 3R6NA 3VS5A 2DVJA 1RLQC 3QWXX 2EKHA 2A08A 2J7IA 2LX7A 3M0RA 3I5SA 1N5ZA 2RN8A 2KR3A 1WYXA 2KE9A 2JXBA 2LMJA 1AZGB 2K79A 2D8JA 3FJ5A 1Y57A 4IIMA 1ABOA 5IXFA 2EGAA 2KYMA 1H92A 1KJWA 1WX6A 2L3PA 3UATA 2A28A 5IHIA 1JU5C 4LUDA 1NEBA 4D8DA 5EC7A 2XMFA 4OMPA 1BB9A 3M0TA 2LCSA 1Y0MA 2YT6A 1YP5A 3LH5A 4RTTA 2FRYA 4J9FA 1LCKA 2GQIA 1WA7A 4RTZA 1TUCA 4J9EA 1K4US 2RNAA 2JT4A 2PNIA 2RQTA 3VS6A 2DL5A 2FEIA 4J9IA 3H41A 2YUPA 1T0JA 2MCNA 3TSZA 5IH2A 4ESRA 4OMQA 2RQUA 3VRZA 2FPFA 2J6KA 3M0UA 1KFZA 1AD5A 2BZYA 1WXTA 2KRNA 3EHRA 1HSQA 5ECAA 2NWMA 4AFQC 2C0OA 4R0KA 2X3WD 1PRMC 2J6FA 4RTXA 1OPLA 1UJ0A 1AWJA 1W6XA 1KSWA 2VKNA 1YWOA 4HVUA 1QKWA 1WDXA 5L23A 1ZUYA 2J06A 2OAWA 2DL8A 2JMCA 2EQIA 4JZ3A 2HBWA 1RUWA 4J9CA 1W1FA 2DILA 2LQWA 3VS7A 3CQTA 1VYVA 2GBQA 4CC2A 1WI7A 1YN8A 2DRKA 1TG0A 1NEGA 4HVWA 2EPDA 3GBQA 2E5KA 2F2WA 1AWOA 2MOXA 2YUNA 2DRMA 1GBQA 2DMOA 2AKLA 2BZ8A 2CT4A 3SEMA 4E6RA 2EYYA 1WIEA 2YUOA 2PZ1A 1U06A 4GBQA 1K0SA 3EHQA 1OEBA 1M3BA 1AEYA 3UF4A 3VS2A 1K9AA 1GCQA 4JJBA 1X6GA 2AZSA
chains in the Genus database with same CATH superfamily
1QWFA 1VQ7T 2X4XA 1BBZA 2PTKA 1VQNQ 3GPLA 1T0HA 2CREA 2DZCA 1SHGA 1Q7YU 4P5NA 4JRQA 1J3TA 2ECZA 4FT4A 3EG0A 3JB9D 3CC2A 4K11A 3DKMA 2HCKA 4CI0C 2O2OA 1NM7A 1UECA 2YRVA 4ATOA 4XU3A 1WHHA 2JS0A 1E7OA 2C0IA 4FW2A 4Y28E 3JV3A 1SG5A 3VUBA 2JTMA 1I07A 3HFNA 4XU1A 1G3SA 3NTKA 1QVGA 1JBMA 1I0CA 4M7DD 4QQ6A 1V1CA 2DYBA 4C8QB 2RQVA 3G71Q 1JJ2S 3TCJA 3HTRA 2LCCA 5KYXA 3I56Q 1S1NA 2ESWA 4XU2A 2OX7A 1VQ9T 3EAEA 2JS2A 2L8DA 4JDSA 4LXCA 3CCJA 1M90R 1QCNA 2B86A 4IUPA 2XICA 2HEQA 4FCYA 1M1GA 1JJ2A 1CKBA 1AHJB 4BACA 1NYFA 1MGQA 5D6YA 1IXDA 2RHZA 3DLLA 1FYNA 4D6WA 3HKSA 4HCCA 5GAN6 1U3OA 2K2VA 1KQSP 3KXTA 3L2VA 1B07A 4C8QD 1AVZC 3CC7T 2WACA 3CCVA 2MF2A 2EYWA 2AK5A 1X2QA 3LW5E 4ZGEB 1FMWA 3I55Q 2LRQA 4AG2C 4QQGA 2MIOA 4M75C 1T3LA 1VYUA 4EPCA 3UPUA 1BI3A 3OYFA 2RHUA 2GF7A 1I1JA 3QWYA 2QA4A 3I35A 3CXCP 3VYHB 5GMKi 5LJ3f 2VC8A 2LQKA 5FW9A 1UGPB 2KGTA 2EBPA 3HFOA 5J26A 3RUXA 3M58A 4XTUA 2P4TA 2RJFA 1K76A 1X6BA 5FRMA 2O9SA 1ARKA 4MDWA 1NYGA 4O6JA 1BI0A 4A4HA 3ASKA 4JLGA 3KBGA 1VQMQ 3QKJA 3URGA 1WHMA 5KH6A 1WFWA 3X24B 4OB0B 3C0CA 4RTYA 2VGNA 2K2MA 4WCIA 1VQLQ 3JCMd 1M30A 2RHIA 2M51A 2CH4A 2DIGA 5KYYB 2F5TX 5LJ3g 4F7UA 2BUDA 3GIBA 4GY5A 1BK2A 3JCMh 4J9DA 1UHCA 2COZA 1GFDA 1X01A 2CUDA 3RERA 2F2VA 1VQ8Q 3PMTA 4M7DC 1VOMA 4M7DA 4O5VA 4PJOE 4AFSC 1MHNA 5C0MA 3S3NA 1GBRA 4MZMA 1N9SA 1UGSB 4M75G 4HA8A 2LNVA 5I11A 1VQKA 3VYGA 2HZYA 4DBQA 5LJ3e 2DBKA 1LVKA 1UG1A 2ED1A 2M1HA 1AT1B 1UGVA 2WSFE 2ED0A 2D0QB 1XOVA 4F14A 4FYYB 1KC8C 1ZUKA 2L2PA 5KYWB 4PKCC 4LE9A 3V8KA 1PD0A 1YHQA 5FWCA 4F17A 2VXFA 3A8HB 3EGUA 3I56T 4ELYC 5CVIA 3R6OA 2O01E 3HRTA 4PK4A 2DZ9A 5GAMd 4C8QA 4C0FA 1QVGP 4RKUE 5GAMh 1KC8U 2QQBA 4F7UG 2KVQG 2D6FA 2DJZA 1RACB 3OB9A 2R58A 4VUBA 3CCVT 2E10A 2DLPA 3M0PA 3OYKA 1QWEA 2JOYA 4M7DG 3OA6A 5GMKm 1YITT 2V1RA 5A0LA 1QW1A 1Q86U 1BYMA 2B8AA 1Q82C 3MPUB 4EIKA 2J6OA 4AG1C 4C0DB 3H8ZA 5I22A 3OYLA 2KRMA 3CEYA 4GLMA 2E4HA 4M78F 2C06A 5CKEA 1VQ6Q 4F16A 3G4SA 1NJIR 5CAIA 1HD3A 3KUFA 2K5FA 2QQRA 3VS4A 1K1ZA 2ZPGB 1X69A 2KK4A 2JTEA 2LNHB 2EFIA 1JO8A 2X51A 2O4XB 1MNDA 2WSCE 2LTOA 1Q82U 1TUGB 2LVMA 1WNLA 2E6ZA 2GQVA 3PIOA 1WGSA 1UTIA 3CC4Q 1WLPB 1YCSB 3LGLA 3OSSC 3CCSA 2VASA 1NE8A 3A98A 5FRNA 4JRPA 1QMCA 2A7YA 1VQPQ 1YJNT 1GCQC 1WJSA 2RF0A 2E12A 2EVRA 1ZUUA 3BW1A 2KXCA 3JCMf 5J3BA 1N8RR 5CQXA 3A1PA 2IG0A 3M54A 2DVJA 3CCMA 1YJWQ 2MPXC 3QWXX 2EKHA 5KE3A 4KH0B 2J7IA 2EIFA 3S6WA 1G3WA 2ATCB 4M78B 1YIJQ 2QDYB 4N4GA 1VQOQ 2JXBA 2LMJA 1AZGB 2JJ9A 2D8JA 3FEOA 1XJWB 1KJWA 2BIVA 2L3PA 3BE3A 3UATA 4MDXA 5LJ5d 1NEBA 3CCUQ 3OS2A 4OMPA 2OTLQ 4HT8A 3L1AA 3Q1JA 5LJ5h 1Y0MA 3M5AA 5GANd 1YP5A 4FM4B 4RTTA 4KT0E 2H3JA 3CCQA 5KYNA 3OY9A 2GQIA 5HY6A 1NJIC 2L89A 5CO7A 3OBWA 4M78D 2HKQB 3H41A 4PJLA 4BD3A 2KSSA 5HKCA 3MJXA 4M77D 4HCBA 1S72A 4OMQA 2RQUA 5GAOp 4R56A 2Y4YA 1VQ5T 3M0UA 4QVCA 2QASA 1EIFA 2OTJQ 2BZYA 1WXTA 2FZGB 1HSQA 2LT4A 4LDWA 4R0KA 3EGDB 1K9MR 3CD6A 1BI2A 4E7KA 1UJ0A 1W6XA 3G1JA 1IB8A 3QZ5B 4HVUA 3EH1A 4OP0A 2KMTA 4LDVA 2OAWA 4JZ3A 1Y07A 3D7SB 2MYSA 2DTIA 1N8RC 2RD1A 4HCZA 3NTHA 1WI7A 1KHCA 2RM4A 1N27A 2DEQA 4X9DA 2LX9A 3DB3A 3GBQA 1O75A 1ZA2B 1AWOA 2DRMA 5I2SA 4JRIA 3VKIA 4E7ZA 2BZ8A 3CCEQ 2EYYA 1VQ7Q 1WIEA 4YTLA 3CC4T 4JS5A 1MMNA 3N5BB 3VS2A 2XG8D 3CBPA 3OYYA 1X6GA 4PLLA 2RPNA 2HD0A 5C6SA 3JCMc 1UDLA 3EH2A 2QTVA 1QVFS 2KYBA 1PHTA 2X3XD 4OVAA 5GAN4 4M75F 2K5IA 3CCMT 3GF5A 1X6OA 5KCOA 4DEYA 5KYXB 2P84A 5GMKl 5AYFA 3CMAT 4C5GA 2JW4A 3ZEHA 2NLUA 5L8RE 4IUVA 1QVFA 3FC3A 2FRWA 1WHGA 1HJDA 2DXBA 2HQEA 2DL4A 3V8JA 1R0CB 3OYNA 1VQOT 3CPWA 3OW2A 4QQDA 4ZTJA 1VQ9Q 3C95A 4LDXA 3PE0A 4PJNA 4XAXB 1PM3A 4L59A 1K9MC 3G6EQ 4M78A 4FYWB 3REBB 2OTLT 2XDPA 4F7UE 3OYAA 4F7UF 1B34B 3QPHA 4M77C 3O5ZA 4M77A 2EKOA 2EJGA 4ZGDB 2DJQA 2YXYA 3NGPA 3MEAA 1NZ9A 2LJ1A 3L2WA 2ABLA 3CMEA 4M7DF 5GANf 4OMOA 4FYVB 2NUTA 4RCBA 4KUDK 4UC4A 1GXIE 3QHSA 1T3SA 3A8LB 3L2RA 3CC7Q 4M75B 1KK7A 3J7AF 2R57A 1Z9ZA 4CRIA 3UA6A 4NS5A 2NUPA 3CBOA 2YUQA 4MMKA 5GMKj 1RLPC 4ZN1A 5GAN2 2V1QA 3CD6T 3JB9J 3JRZA 4Z8AA 2K9GA 2EW3A 2VGMA 2DM1A 4BI8B 5LJ3d 4LDUA 1JQQA 5GANg 3RMQA 1YJ9A 3PGGA 4KH1B 2LT1A 5LJ3h 3A8MB 5HK3A 3CCLA 1LOJA 2XK0A 4C8QE 4CC3A 3S3OA 3G7ZA 2BZXA 1OOTA 3V7SA 1D1AA 4DA4A 2EGEA 2LP5A 1K73C 4M75D 3EGDA 2CP2A 4F7UB 1CKAA 3L2ZA 4M77G 1H8KA 2ROLA 4B9WA 1ZSZC 3M0SA 4M7DB 1ZSZA 4JUVA 3MEVA 2K3XA 1D1CA 1X2KA 2L5QA 4ME7A 4N4IA 1UUEA 5GAN7 4FW1A 2M02A 2FYKA 5HCKA 2MI6A 3CC2Q 2CP7A 2LJ3A 1K8AR 2K5LA 3QO3A 2CZ7B 2QEXA 1Q81C 3L2QA 1RADB 3F70A 4J9GA 2DF6A 1IO6A 4EMKC 4EMKA 3MCAB 3QUIA 2YSQA 2QXFA 1NLPC 1OU9A 1M8MA 2O9VA 3OYIA 4E7LA 2FO0A 4XTYA 1IGQA 2EQKA 1BKBA 2L3QA 1VQ4T 2HSPA 2DNUA 3EFSA 1Q81U 3CCJQ 2GGRA 1XQHA 4M4ZA 1AWXA 1G3YA 1OPKA 2CP5A 2EYZA 3G6ET 3SDZA 2E1HA 3CBMA 3AHUA 1PNJA 2Y90A 1D3BB 1M3CA 3O8VA 1VA7A 3SHWA 1PSEA 1SSHA 1TH7A 1PG5B 3G71A 5DLOA 1IHVA 3RR6A 3CPWP 1W2BP 3JCMV 1D0XA 3CCVQ 3OW2P 4X1VA 2M9UA 1I5OB 2L3SA 3NPFA 3IQLA 1B34A 1YITQ 2VUBA 1I81A 3QZ9B 1VYTA 5FU6C 1Y96A 1AOJA 4C5HA 4A63B 1G83A 2BKDN 3EFRA 2DETA 2KBTA 2V8KA 4A54A 4D8KA 1YJ9T 1X27A 5CCAA 1YI2A 4M75A 1FMVA 4L5GA 1G5VA 1VUBA 4J9BA 1GCPA 3CCLT 1K8AC 1IGUA 2YHTA 4Z89A 3FDRA 3OYEA 3TREA 4WTOB 2MMPA 2GNCA 3H0FA 4NL2A 2D9TA 1YFNA 2QAZA 1FMKA 3OQ5A 2VWFA 2F2XA 3OMCA 3REAB 1ZSGA 3BDLA 3I55A 1Q86R 4A4GA 2DYIA 1U1SA 2DTOA 4M7AG 3PVQA 4JZ4A 4N0AC 1YJNQ 4N0AA 4N4HA 3U23A 1TSFA 2DTHA 3EGXA 8ATCB 1WQ7A 2BE7D 2K4YA 4ZGJB 3BY7A 1TOVA 3H6ZA 3CC2T 2CGHA 3GLXA 4AFUC 1M90C 2HSEB 2QEXT 2CSQA 2R5MA 4PFPA 1RAEB 4LUEA 1VQMA 2M0OA 5GAOm 2QQAA 2ZPEB 3R6NA 3JCMW 4E7IA 3X20B 4DBRA 4PLIA 1VQLA 2LX7A 3M0RA 3I5SA 1N5ZA 2KR3A 2E5QA 2HKNA 1YHQQ 1M90U 1ABOA 5IXFA 2KYMA 1H92A 2MWOA 4V2SA 1IZ6A 5D7UA 4LUDA 1KHIA 2QYZA 1OI1A 4D8DA 3CCJT 1M9SA 3QBYA 1HXDA 2GFUA 1WA7A 3PTAA 4J9EA 5CQYA 2RNAA 2JT4A 3M53A 3ZFJA 4Y91A 4E7HA 1B7TA 5GAMj 1VQ5Q 1JRIA 3TSZA 5IH2A 1QP2A 1MNEA 1XNIA 2XI9A 4JRKA 2FPFA 1D3BA 5GAOq 3A8OB 1KFZA 1AD5A 5FU7C 2KRNA 3EHRA 3SFMA 4A4EA 5ECAA 2NWMA 3G4SQ 4AFQC 3X26B 1JJ2P 1YI2T 1BIAA 1U1TA 2X3WD 4RTXA 4M78E 2QA4T 1KSWA 4M77E 4M77F 3V8LA 1W1FA 3CCSQ 2DILA 1VYVA 4CC2A 1Y7XA 1YN8A 1TG0A 2P0QA 2E5KA 2F2WA 2RO0A 2OAUA 5GAOn 2XDBA 3SB2A 4L6V5 1GBQA 2DMOA 2AKLA 3SEMA 2CT4A 1C6VX 2G3RA 3EHQA 1OEBA 1K9AA 1GCQA 2YRCA 2AZSA 1M2VA 3CCMQ 2I2LA 3NFCA 3FIFA 1KD1R 1WHKA 2K57A 1I5LA 3OYBA 1M8VA 2V26A 3CMAQ 6AT1B 1R77A 1WJQA 2I0NA 1ACMB 2WSEE 3ZL7C 2DVEA 5IXBA 2AKKA 2X35A 1VQKT 1MV3A 1D1BA 4M77B 1VQPA 3JCMX 1TS9A 4LN2A 4JPBW 5CKBA 3EG9B 3CCRA 2FG0A 3DLMA 2NUTB 4JJNK 2O88A 1YHQT 3QIIA 5AT1B 1UEBA 3CCQQ 2DL3A 3OYHA 4BDZA 3MEWA 2DE0X 1MUZA 1SPKA 4F04B 3EG1A 5CKHA 2F1LA 2OJ2A 2NUPB 1ZBXA 5LJ5j 2K3BA 1YIJA 2IPOB 4BB7A 1X75C 5GANh 1RAIB 1OYXA 4JJCA 5D6XA 2YLCA 1MMGA 3PVLA 3A5ZB 1JXOA 1M1KR 5GANj 4J7FA 1UGRB 2ZPBB 3SD4A 1UGQB 3RNJA 1PRLC 1PWTA 1R0BG 3QYHB 2CP6A 2MK5A 2KRSA 3CCUA 3UT1A 4RCCA 1UB4A 3OBYA 4EMHA 1SF9A 3TVTA 1TTHB 3RKYA 2IIMA 5CIUA 2DIQA 3CD6Q 1RAFB 2CUBA 4MZTA 2AHJB 2VYTA 4HVVA 1E6HA 3AT1B 1D09B 1NJIU 3J81E 3MEUA 4RTUA 5D6WA 5GAOl 1N6AA 1LJOA 2GFAA 3G4ST 2PVGB 1A0NB 1ZSZB 2P0PA 3SWNC 3SWNA 4FSSA 3QYGB 1Z9QA 4Y92A 2FL7A 1JEGA 1WXUA 1AZEA 2DEUA 4M7AF 5CKDA 2OTJA 2H3EB 3QDRB 3OYGA 5GJWB 2PVOB 1UJYA 3QXEB 3CCST 2P0KA 1PCXA 2LC4A 9ATCB 4PJOC 2JMAA 2EYXA 4IIOA 2W10A 3KFVA 5GAOr 1OZ3A 2O31A 1QCFA 4J7IA 1YWPA 4MZPA 3WVDB 1OZ2A 2YRDA 1P92A 2AZVA 3FRNA 1N8RU 3NTIA 1PKTA 1QKXA 3JB9H 4KGZB 1Y71A 4EMKB 2ENMA 4M75E 2DL7A 2CZ6B 1WPYA 2QQ9A 1RI9A 2M16A 1ZQ1A 2HMAA 1VIFA 1VIEA 3PFSA 3TEEA 3CCEA 4IKFA 2KROA 2AT1B 2CKKA 1M1KC 3JB9I 2DFUA 3ZBDA 2E6NA 3TSWA 2QGFB 1W70A 2GCXA 2D8HA 2DO3A 2XKOC 1FXXA 3I5RA 2MWPA 4LDYA 3HSBA 3H9NA 2PVDB 1VQ4Q 2HAXA 3V7CA 4HXJA 1KQSS 1Q7YR 3I9QA 4J9HA 2ROTA 2LZ6B 1OX9A 2DPPB 2E3HA 5IT9E 1KQ1A 3CCQT 4DEXA 4C5EA 1RAHB 3CMEQ 2R5AA 2DKGA 4PJOG 5FU6B 2RQWA 3LLRA 3OS0A 1Y96B 1OULA 2JM9A 2K6DA 4M7DE 3H0HA 5FWBA 4AMCA 3EG9A 4FT2A 3M4GA 4FIBA 4RTVA 2D1XA 1S72T 3CXCS 3E9GA 1K9MU 2KXDA 5IN1A 1TUDA 4M7AD 2KEAA 4DBFA 3H0IA 5GAN3 1R8OB 3J80E 2KT8A 4C0GA 4EMGA 1WJRA 5IHNA 1V76A 1YJ9Q 2DXTA 3HRSA 4A4FA 2E64A 1TXQA 3CCLQ 2KQWA 3UWNA 2RQRA 2MAMA 2SRCA 2CS7A 1OV3A 2CSIA 5LJ3j 2LQNA 3EGXB 3L42A 2ZAEA 1PD1A 1KG1A 8AT1B 4E7JA 3GNFB 2EJFA 1M1FA 1BIBA 3OYDA 3VS0A 2DD4A 1ZX6A 3E9FA 4IUQA 3ER0A 3JCMb 2DXCA 1EZZB 1K73U 4QKUA 3META 2EQMA 3M4YA 2QEXQ 3LX7A 2RK2A 1C1AA 4PFOA 3LWIA 3MO8A 2EWNA 1NLOC 3BDUA 2FHDA 3T9NA 1MMAA 1MV0B 1F1BB 2E70A 3P8DA 2RMOA 4XU0A 4KGVB 3VS5A 1RLQC 3C4SA 1QVGS 2QGGA 3X28B 1VQNA 4E47A 2IVWA 4X34A 3RKWA 2XD0A 4FL6A 2F69A 2RN8A 4ZTFA 1LPLA 2KE9A 2QTXA 3VUZA 4GLKA 5CR2A 3TQ7P 2K79A 3FJ5A 3EFOA 4OGCA 1I4K1 1OQKA 4BE0A 1WX6A 3INZA 4BY6C 5IHIA 3QDFA 4RG8A 5EC7A 2XMFA 4C92D 4XTWA 2ZZDA 3M0TA 2LCSA 1RAGB 3CMET 4M7AC 2FRYA 4J9FA 1QVFP 4M7AA 5FU7B 1TUCA 1K4US 2PU9B 2ZCFB 1QQJA 4QW2A 2HBPA 2HQHA 2RQTA 3VS6A 3I56A 4J9IA 2FZKB 1M5Q1 4PJJA 4ESRA 1TWBA 1ZHIA 2XIDA 1NPRA 4IURA 2KY9A 1YI2Q 1D0YA 3RESA 1QVPA 2QA4Q 4BDYA 5IAYA 3RMSA 3PNWC 3OYJA 2X9HA 2V8IA 3WXMB 5J39A 1PRMC 3LGFA 4OMFB 1KC8R 4A4KA 4KGXB 1YITA 4BI3A 1YCYA 1JB0E 3E1SA 5L23A 1ZUYA 2J06A 2ZGWA 2DL8A 2JMCA 1H641 4MMLA 4BI4A 2HBWA 1RUWA 4J83A 2HQXA 5A0DA 1M2VB 4J9CA 2K3YA 3OS1A 3S3MA 2LQWA 3CQTA 2LCLA 5M9OA 4HVWA 1K8AU 1QCOA 3JAME 5GAN5 1BCMA 1TU0B 4II1A 2YUOA 1FX7A 4FYXB 1U06A 4LD9K 2Z0WA 3JCMP 5EG2A 1M3BA 3P8BB 2RJCA 4JJBA 1SKUB 2FB7A 2LDMA 1PC0A 2CZ1B 4IUUA 2RI2A 1WHLA 4CC4B 1Q82R 4OB3B 2JNGA 4BUGA 3OYMA 4HCKA 2CT3A 1VQKQ 1UFFA 2KT1A 1YJNA 3BFMA 3HPWA 2NUZA 1KIKA 2RH2A 2G6FX 2PQWA 2QDLA 4ORZA 1VQNT 3ME9A 5GMKe 5GAN8 1M27C 2RHXA 2J05A 5DLQE 1SSFA 5IHKA 4XTVA 3M0QA 1PKSA 2XU8A 1RI0A 1ZA1B 4C92C 5A0GA 1SRMA 4PJOF 4C92A 4EDUA 1VQ8A 7AT1B 1RAAB 4XK8E 3MKDA 4HT9A 5I21A 1K0XA 1M3AA 1EFNA 2JUFA 4ZNXA 2RHYA 4PFZA 4KULA 3RIRA 1AWWA 2GTJA 2SEMA 5A2QE 1GFCA 1UE9A 2KNBB 2JM8A 3UA7A 2HDAA 1UHFA 2FPDA 3JSCA 4B9XA 4E7SA 1QLYA 2A36A 4C5IA 3G71T 2YLBA 1E6GA 2L3RA 2ZPHB 3NMZC 4OGEA 1YNZA 3PMIA 4QT7A 4BE1A 1HYOA 1HK9A 3SWNB 4C8QC 3JB9G 2EJ9A 1Q86C 1NG2A 4FU6A 5CK9A 2JTFA 2YDLA 1NPPA 2C0TA 2FZCB 1WXBA 3QG1A 1WZOA 3ULRB 1GL5A 4PJOB 1QP3A 1VQ5A 1C0MA 4C92G 1O9SA 1LNXA 3EG2A 4DOWA 1WHJA 2RI3A 2XHCA 5I2MA 2HNIA 4XTZA 2CYZB 2Y4XA 2DXUA 3I55T 4OMMA 5DY9A 2LQ8A 3FB9A 1OX8A 2D0NA 4AFZC 3L2UA 2X4JA 4RMOA 2P4RA 4RTWA 1VQ6A 1SRLA 2KI7A 2KDSA 1IRXA 2RI5A 4WF2A 2EQJA 2K7AA 4JLIA 2GTOA 2ZPIB 1XTDA 2FPEA 1BCOA 3OYCA 1WQWA 4PJOD 2E41A 4DQ2A 4B6MA 2DD5A 3QJYA 4C8QG 4ELZC 5CKFA 1VQMT 4OB2B 3CC4A 2DERA 4PJMA 2VB6A 3LH0A 2A3LA 1BU1A 4J6YA 2AIRB 1VQLT 2CDTA 1MMDA 4DBHA 2EYQA 4XTXA 3VS1A 1SHFA 4JS4A 3CCRQ 1G2BA 1ZBJA 2COYA 2V8JA 1RABB 4ZN3A 1VQ8T 4PL6A 1JXMA 3TU4K 3M55A 3CMAA 1YJWA 2DBMA 1EX4A 5KYYA 2E3IA 1X43A 3VU3C 1N9RA 2DX1A 2M0YA 4CC7A 2XDDA 4X9CA 4QVDA 4OMNA 1U5SA 2RA2A 1VQOA 3MP1A 4Q5WA 3MHXA 1B3QA 2RK1A 1CSKA 2QK0A 1S72Q 3JCMJ 3JCMg 1Q95G 4AT1B 2W0ZA 3HP9A 3EG3A 3RKXA 3LWHA 1DJ7B 2CH4W 2COWA 2OTLA 1V29B 2RJDA 4Z88A 1G8XA 2DK3A 1G3TA 2CP3A 2DAQA 2EAYA 4HKEA 2RJEA 5KYWA 5GAMf 3WVEB 3JCMe 2BTTA 3NHNA 3QJ6A 3THKA 2KAFA 2HL5C 3VRYA 3PT9A 2DA9A 3GNGA 5KYUB 2LJ0A 3VS3A 3OS5A 2CZ0B 1KD1C 1I8FA 4M7AE 1IREB 2F5KA 1KQ2A 4LNPA 1SEMA 4PNOA 4QVZA 1U8RA 2ZPFB 4OB1B 2HL3A 2VVKA 4RUGA 5GAMg 4PJOA 2X4YA 1VQ6T 1M2OA 1ZLMA 3UDCA 2BE9B 4KRTA 2H8HA 2A37A 2EGCA 1ABQA 1KD1U 5LL6S 4J5YA 4C0DC 4OMLA 4Z02A 4A53A 2CP0A 2FVUA 3P8HA 3C12A 3FJPA 3RBBB 2QQSA 1GRIA 3A8GB 3VJPA 5GAMe 5GJVB 1VQ7A 3EFOB 2O4XA 2L0AA 4JJDA 1M4ZA 4BY6B 1VQPT 4LD6A 2OI3A 3RDVA 2PUOB 4NL3A 3CPWS 3CCRT 1W2BS 2A08A 3OW2S 4M7AB 1K73R 5DM7R 1WYXA 1YJWT 1IHWA 3X25B 5KCHA 2VV5A 1M1KU 3MP6A 1Y57A 2NYSA 4IIMA 3CPFA 2EGAA 1YIJT 2A28A 3VV0A 4RG2A 1JU5C 4KBMB 4E2FB 1W2BA 3HL8A 1NBEB 1BB9A 1KQSA 2PUKB 3JB9F 1VQ4A 2YT6A 3V7RA 4C0ZA 3M56A 3LH5A 3M57A 1OU8A 1LCKA 4M78C 4RTZA 1VQ9A 1RL2A 3C94A 3CCUT 4BE2A 2PNIA 5LJ5f 3HRUA 4XQ3A 5FLXE 2DL5A 2FEIA 2QI2A 3G6EA 1Q81R 2JVVA 4J6WA 2YUPA 1T0JA 1FWZA 2MCNA 4C92E 4C92F 4J8OA 3M9QA 3VRZA 4DOVA 3OSVA 3M59A 3CXCA 3QSUA 2J6KA 3LYIA 4OF1A 3E19A 2VXEA 4ANJA 3JCMQ 3GP8A 5GMKh 3HHTB 2A0FB 2JZ2A 3CC7A 2JN0A 2C0OA 2J6FA 5LJ5g 1OPLA 1AWJA 5HK0A 3GOXA 2QG9B 2OTJT 2VKNA 1YWOA 3DB4A 4NOYA 2EQUA 1QKWA 1WDXA 4IUTA 2EQIA 3PIPA 4R55A 4TVRA 1H3ZA 2RB6A 3VS7A 2GBQA 5KYUA 4C8QF 5KE2A 2DRKA 1YBYA 2E65A 1NEGA 3E2UA 5FROA 2EPDA 1Q7YC 5LJ5e 2MOXA 2YUNA 4J6XA 4M78G 4KUIA 3MP8A 4E6RA 4FSXA 3FLGA 1D0ZA 2X4WA 2PZ1A 1BI1A 4GBQA 1K0SA 5GANe 2YWWA 1AEYA 3UF4A 3OMGA 1W4SA 1PSFA 4C92B 3CCET 1H3HA
chains in the Genus database with same CATH topology
1QWFA 1BBZA 2RPNA 4CC4B 2PTKA 1UDLA 2KYBA 1PHTA 1T0HA 2CREA 2X3XD 1SHGA 2CT3A 4HCKA 1UFFA 2KT1A 1J3TA 2ECZA 3EG0A 2I0NA 2NUZA 1KIKA 3ZL7C 2G6FX 2QDLA 4K11A 4ORZA 5IXBA 4DEYA 2HCKA 2AKKA 2O2OA 1NM7A 1M27C 1UECA 1MV3A 2J05A 2JW4A 5IHKA 2JS0A 3M0QA 1E7OA 2C0IA 1PKSA 4LN2A 1SRMA 3JV3A 1I07A 4JPBW 2FRWA 1HJDA 1K0XA 1M3AA 1EFNA 2DL4A 2FG0A 1I0CA 2O88A 4ZNXA 1V1CA 2DYBA 2DL3A 1AWWA 2DE0X 1MUZA 1SPKA 2GTJA 2RQVA 2SEMA 3EG1A 1GFCA 3PE0A 1UE9A 2OJ2A 2KNBB 2JM8A 3UA7A 2HDAA 1UHFA 2K3BA 2FPDA 1S1NA 2ESWA 3REBB 2JS2A 3O5ZA 1QLYA 2A36A 4JJCA 1E6GA 3PVLA 1JXOA 3NMZC 2DJQA 1YNZA 3NGPA 2B86A 2LJ1A 2HEQA 2ABLA 3RNJA 1PRLC 4QT7A 4OMOA 1PWTA 1CKBA 1NYFA 2KRSA 1T3SA 1NG2A 3TVTA 1FYNA 2IIMA 1Z9ZA 2CUBA 3UA6A 4HVVA 1U3OA 2YDLA 1E6HA 1B07A 1AVZC 2YUQA 2C0TA 1RLPC 2V1QA 1WXBA 4RTUA 4Z8AA 3ULRB 2K9GA 2EW3A 1GL5A 2EYWA 2AK5A 2DM1A 1X2QA 1A0NB 1JQQA 3EG2A 4FSSA 1Z9QA 4Y92A 4AG2C 2MIOA 1T3LA 1VYUA 1JEGA 1WXUA 1AZEA 1I1JA 3QWYA 4CC3A 2BZXA 3I35A 1OOTA 4OMMA 2EGEA 2LP5A 5GJWB 1UJYA 2D0NA 5FW9A 4AFZC 1CKAA 2KGTA 2EBPA 2P4RA 4RTWA 1SRLA 1H8KA 2EYXA 2JMAA 1K76A 4IIOA 2W10A 1X6BA 3KFVA 2ROLA 2O9SA 2O31A 1ARKA 1QCFA 3M0SA 1YWPA 1NYGA 2K7AA 2AZVA 2GTOA 2FPEA 1X2KA 1WFWA 1UUEA 1PKTA 3C0CA 4RTYA 1QKXA 5HCKA 2ENMA 2K2MA 4WCIA 1M30A 2DL7A 2LJ3A 2M51A 1RI9A 2CH4A 1BU1A 1BK2A 4J9DA 1UHCA 1GFDA 2CDTA 2CUDA 2KROA 2F2VA 3VS1A 1SHFA 3TSWA 1G2BA 1W70A 1ZBJA 2D8HA 4AFSC 3I5RA 4J9GA 2DF6A 1IO6A 1GBRA 1JXMA 4HXJA 5I11A 2YSQA 3I9QA 4J9HA 2DBMA 1NLPC 2DBKA 1M8MA 1UG1A 2ED1A 2LZ6B 2O9VA 2ROTA 1X43A 2FO0A 2DX1A 2L3QA 2M0YA 1UGVA 2HSPA 4CC7A 2DNUA 2ED0A 4OMNA 1XOVA 4DEXA 4F14A 1U5SA 1ZUKA 2GGRA 2L2PA 4LE9A 4M4ZA 1B3QA 1CSKA 1AWXA 2RQWA 5FWCA 4F17A 1OPKA 3EGUA 2EYZA 2JM9A 2W0ZA 2K6DA 3H0HA 5FWBA 3EG3A 1PNJA 1M3CA 1VA7A 4RTVA 3SHWA 1SSHA 2CH4W 2D1XA 1H3HA 4Z88A 2KXDA 1TUDA 4X1VA 2KEAA 3H0IA 2L3SA 3NPFA 3IQLA 2KT8A 1VYTA 5IHNA 1AOJA 2DLPA 2BTTA 3M0PA 1QWEA 3NHNA 4A63B 1G83A 3THKA 2KBTA 2V1RA 3VRYA 2DA9A 2RQRA 2LJ0A 4D8KA 3VS3A 1X27A 2SRCA 4EIKA 2J6OA 4AG1C 5I22A 4J9BA 1GCPA 1OV3A 2CSIA 2KRMA 4GLMA 2LQNA 4LNPA 4Z89A 1SEMA 4F16A 1HD3A 2GNCA 3H0FA 1K1ZA 3VS4A 2VVKA 1X69A 2LNHB 2JTEA 4RUGA 1JO8A 1FMKA 2VWFA 2F2XA 1ZLMA 3VS0A 3REAB 1ZSGA 4KRTA 2H8HA 1ZX6A 2A37A 2EGCA 1ABQA 1UTIA 1WLPB 1YCSB 3PVQA 4JZ4A 4OMLA 3A98A 3U23A 3RBBB 1GRIA 1GCQC 2RF0A 5GJVB 1NLOC 2L0AA 4JJDA 4AFUC 2EVRA 1ZUUA 2CSQA 1MV0B 4LUEA 2KXCA 2RMOA 2OI3A 3R6NA 3VS5A 2DVJA 1RLQC 3QWXX 2EKHA 2A08A 2J7IA 2LX7A 3M0RA 3I5SA 1N5ZA 2RN8A 2KR3A 1WYXA 2KE9A 2JXBA 2LMJA 1AZGB 2K79A 2D8JA 3FJ5A 1Y57A 4IIMA 1ABOA 5IXFA 2EGAA 2KYMA 1H92A 1KJWA 1WX6A 2L3PA 3UATA 2A28A 5IHIA 1JU5C 4LUDA 1NEBA 4D8DA 5EC7A 2XMFA 4OMPA 1BB9A 3M0TA 2LCSA 1Y0MA 2YT6A 1YP5A 3LH5A 4RTTA 2FRYA 4J9FA 1LCKA 2GQIA 1WA7A 4RTZA 1TUCA 4J9EA 1K4US 2RNAA 2JT4A 2PNIA 2RQTA 3VS6A 2DL5A 2FEIA 4J9IA 3H41A 2YUPA 1T0JA 2MCNA 3TSZA 5IH2A 4ESRA 4OMQA 2RQUA 3VRZA 2FPFA 2J6KA 3M0UA 1KFZA 1AD5A 2BZYA 1WXTA 2KRNA 3EHRA 1HSQA 5ECAA 2NWMA 4AFQC 2C0OA 4R0KA 2X3WD 1PRMC 2J6FA 4RTXA 1OPLA 1UJ0A 1AWJA 1W6XA 1KSWA 2VKNA 1YWOA 4HVUA 1QKWA 1WDXA 5L23A 1ZUYA 2J06A 2OAWA 2DL8A 2JMCA 2EQIA 4JZ3A 2HBWA 1RUWA 4J9CA 1W1FA 2DILA 2LQWA 3VS7A 3CQTA 1VYVA 2GBQA 4CC2A 1WI7A 1YN8A 2DRKA 1TG0A 1NEGA 4HVWA 2EPDA 3GBQA 2E5KA 2F2WA 1AWOA 2MOXA 2YUNA 2DRMA 1GBQA 2DMOA 2AKLA 2BZ8A 2CT4A 3SEMA 4E6RA 2EYYA 1WIEA 2YUOA 2PZ1A 1U06A 4GBQA 1K0SA 3EHQA 1OEBA 1M3BA 1AEYA 3UF4A 3VS2A 1K9AA 1GCQA 4JJBA 1X6GA 2AZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QWF A;  1BBZ A;  2RPN A;  4CC4 B;  2PTK A;  1UDL A;  2KYB A;  1PHT A;  1T0H A;  2CRE A;  2X3X D;  1SHG A;  2CT3 A;  4HCK A;  1UFF A;  2KT1 A;  1J3T A;  2ECZ A;  3EG0 A;  2I0N A;  2NUZ A;  1KIK A;  3ZL7 C;  2G6F X;  2QDL A;  4K11 A;  4ORZ A;  5IXB A;  4DEY A;  2HCK A;  2AKK A;  2O2O A;  1NM7 A;  1M27 C;  1UEC A;  1MV3 A;  2J05 A;  2JW4 A;  5IHK A;  2JS0 A;  3M0Q A;  1E7O A;  2C0I A;  1PKS A;  4LN2 A;  1SRM A;  3JV3 A;  1I07 A;  4JPB W;  2FRW A;  1HJD A;  1K0X A;  1M3A A;  1EFN A;  2DL4 A;  2FG0 A;  1I0C A;  2O88 A;  4ZNX A;  1V1C A;  2DYB A;  2DL3 A;  1AWW A;  2DE0 X;  1MUZ A;  1SPK A;  2GTJ A;  2RQV A;  2SEM A;  3EG1 A;  1GFC A;  3PE0 A;  1UE9 A;  2OJ2 A;  2KNB B;  2JM8 A;  3UA7 A;  2HDA A;  1UHF A;  2K3B A;  2FPD A;  1S1N A;  2ESW A;  3REB B;  2JS2 A;  3O5Z A;  1QLY A;  2A36 A;  4JJC A;  1E6G A;  3PVL A;  1JXO A;  3NMZ C;  2DJQ A;  1YNZ A;  3NGP A;  2B86 A;  2LJ1 A;  2HEQ A;  2ABL A;  3RNJ A;  1PRL C;  4QT7 A;  4OMO A;  1PWT A;  1CKB A;  1NYF A;  2KRS A;  1T3S A;  1NG2 A;  3TVT A;  1FYN A;  2IIM A;  1Z9Z A;  2CUB A;  3UA6 A;  4HVV A;  1U3O A;  2YDL A;  1E6H A;  1B07 A;  1AVZ C;  2YUQ A;  2C0T A;  1RLP C;  2V1Q A;  1WXB A;  4RTU A;  4Z8A A;  3ULR B;  2K9G A;  2EW3 A;  1GL5 A;  2EYW A;  2AK5 A;  2DM1 A;  1X2Q A;  1A0N B;  1JQQ A;  3EG2 A;  4FSS A;  1Z9Q A;  4Y92 A;  4AG2 C;  2MIO A;  1T3L A;  1VYU A;  1JEG A;  1WXU A;  1AZE A;  1I1J A;  3QWY A;  4CC3 A;  2BZX A;  3I35 A;  1OOT A;  4OMM A;  2EGE A;  2LP5 A;  5GJW B;  1UJY A;  2D0N A;  5FW9 A;  4AFZ C;  1CKA A;  2KGT A;  2EBP A;  2P4R A;  4RTW A;  1SRL A;  1H8K A;  2EYX A;  2JMA A;  1K76 A;  4IIO A;  2W10 A;  1X6B A;  3KFV A;  2ROL A;  2O9S A;  2O31 A;  1ARK A;  1QCF A;  3M0S A;  1YWP A;  1NYG A;  2K7A A;  2AZV A;  2GTO A;  2FPE A;  1X2K A;  1WFW A;  1UUE A;  1PKT A;  3C0C A;  4RTY A;  1QKX A;  5HCK A;  2ENM A;  2K2M A;  4WCI A;  1M30 A;  2DL7 A;  2LJ3 A;  2M51 A;  1RI9 A;  2CH4 A;  1BU1 A;  1BK2 A;  4J9D A;  1UHC A;  1GFD A;  2CDT A;  2CUD A;  2KRO A;  2F2V A;  3VS1 A;  1SHF A;  3TSW A;  1G2B A;  1W70 A;  1ZBJ A;  2D8H A;  4AFS C;  3I5R A;  4J9G A;  2DF6 A;  1IO6 A;  1GBR A;  1JXM A;  4HXJ A;  5I11 A;  2YSQ A;  3I9Q A;  4J9H A;  2DBM A;  1NLP C;  2DBK A;  1M8M A;  1UG1 A;  2ED1 A;  2LZ6 B;  2O9V A;  2ROT A;  1X43 A;  2FO0 A;  2DX1 A;  2L3Q A;  2M0Y A;  1UGV A;  2HSP A;  4CC7 A;  2DNU A;  2ED0 A;  4OMN A;  1XOV A;  4DEX A;  4F14 A;  1U5S A;  1ZUK A;  2GGR A;  2L2P A;  4LE9 A;  4M4Z A;  1B3Q A;  1CSK A;  1AWX A;  2RQW A;  5FWC A;  4F17 A;  1OPK A;  3EGU A;  2EYZ A;  2JM9 A;  2W0Z A;  2K6D A;  3H0H A;  5FWB A;  3EG3 A;  1PNJ A;  1M3C A;  1VA7 A;  4RTV A;  3SHW A;  1SSH A;  2CH4 W;  2D1X A;  1H3H A;  4Z88 A;  2KXD A;  1TUD A;  4X1V A;  2KEA A;  3H0I A;  2L3S A;  3NPF A;  3IQL A;  2KT8 A;  1VYT A;  5IHN A;  1AOJ A;  2DLP A;  2BTT A;  3M0P A;  1QWE A;  3NHN A;  4A63 B;  1G83 A;  3THK A;  2KBT A;  2V1R A;  3VRY A;  2DA9 A;  2RQR A;  2LJ0 A;  4D8K A;  3VS3 A;  1X27 A;  2SRC A;  4EIK A;  2J6O A;  4AG1 C;  5I22 A;  4J9B A;  1GCP A;  1OV3 A;  2CSI A;  2KRM A;  4GLM A;  2LQN A;  4LNP A;  4Z89 A;  1SEM A;  4F16 A;  1HD3 A;  2GNC A;  3H0F A;  1K1Z A;  3VS4 A;  2VVK A;  1X69 A;  2LNH B;  2JTE A;  4RUG A;  1JO8 A;  1FMK A;  2VWF A;  2F2X A;  1ZLM A;  3VS0 A;  3REA B;  1ZSG A;  4KRT A;  2H8H A;  1ZX6 A;  2A37 A;  2EGC A;  1ABQ A;  1UTI A;  1WLP B;  1YCS B;  3PVQ A;  4JZ4 A;  4OML A;  3A98 A;  3U23 A;  3RBB B;  1GRI A;  1GCQ C;  2RF0 A;  5GJV B;  1NLO C;  2L0A A;  4JJD A;  4AFU C;  2EVR A;  1ZUU A;  2CSQ A;  1MV0 B;  4LUE A;  2KXC A;  2RMO A;  2OI3 A;  3R6N A;  3VS5 A;  2DVJ A;  1RLQ C;  3QWX X;  2EKH A;  2A08 A;  2J7I A;  2LX7 A;  3M0R A;  3I5S A;  1N5Z A;  2RN8 A;  2KR3 A;  1WYX A;  2KE9 A;  2JXB A;  2LMJ A;  1AZG B;  2K79 A;  2D8J A;  3FJ5 A;  1Y57 A;  4IIM A;  1ABO A;  5IXF A;  2EGA A;  2KYM A;  1H92 A;  1KJW A;  1WX6 A;  2L3P A;  3UAT A;  2A28 A;  5IHI A;  1JU5 C;  4LUD A;  1NEB A;  4D8D A;  5EC7 A;  2XMF A;  4OMP A;  1BB9 A;  3M0T A;  2LCS A;  1Y0M A;  2YT6 A;  1YP5 A;  3LH5 A;  4RTT A;  2FRY A;  4J9F A;  1LCK A;  2GQI A;  1WA7 A;  4RTZ A;  1TUC A;  4J9E A;  1K4U S;  2RNA A;  2JT4 A;  2PNI A;  2RQT A;  3VS6 A;  2DL5 A;  2FEI A;  4J9I A;  3H41 A;  2YUP A;  1T0J A;  2MCN A;  3TSZ A;  5IH2 A;  4ESR A;  4OMQ A;  2RQU A;  3VRZ A;  2FPF A;  2J6K A;  3M0U A;  1KFZ A;  1AD5 A;  2BZY A;  1WXT A;  2KRN A;  3EHR A;  1HSQ A;  5ECA A;  2NWM A;  4AFQ C;  2C0O A;  4R0K A;  2X3W D;  1PRM C;  2J6F A;  4RTX A;  1OPL A;  1UJ0 A;  1AWJ A;  1W6X A;  1KSW A;  2VKN A;  1YWO A;  4HVU A;  1QKW A;  1WDX A;  5L23 A;  1ZUY A;  2J06 A;  2OAW A;  2DL8 A;  2JMC A;  2EQI A;  4JZ3 A;  2HBW A;  1RUW A;  4J9C A;  1W1F A;  2DIL A;  2LQW A;  3VS7 A;  3CQT A;  1VYV A;  2GBQ A;  4CC2 A;  1WI7 A;  1YN8 A;  2DRK A;  1TG0 A;  1NEG A;  4HVW A;  2EPD A;  3GBQ A;  2E5K A;  2F2W A;  1AWO A;  2MOX A;  2YUN A;  2DRM A;  1GBQ A;  2DMO A;  2AKL A;  2BZ8 A;  2CT4 A;  3SEM A;  4E6R A;  2EYY A;  1WIE A;  2YUO A;  2PZ1 A;  1U06 A;  4GBQ A;  1K0S A;  3EHQ A;  1OEB A;  1M3B A;  1AEY A;  3UF4 A;  3VS2 A;  1K9A A;  1GCQ A;  4JJB A;  1X6G A;  2AZS A; 
#chains in the Genus database with same CATH topology
 1QWF A;  1VQ7 T;  2X4X A;  1BBZ A;  2PTK A;  1VQN Q;  3GPL A;  1T0H A;  2CRE A;  2DZC A;  1SHG A;  1Q7Y U;  4P5N A;  4JRQ A;  1J3T A;  2ECZ A;  4FT4 A;  3EG0 A;  3JB9 D;  3CC2 A;  4K11 A;  3DKM A;  2HCK A;  4CI0 C;  2O2O A;  1NM7 A;  1UEC A;  2YRV A;  4ATO A;  4XU3 A;  1WHH A;  2JS0 A;  1E7O A;  2C0I A;  4FW2 A;  4Y28 E;  3JV3 A;  1SG5 A;  3VUB A;  2JTM A;  1I07 A;  3HFN A;  4XU1 A;  1G3S A;  3NTK A;  1QVG A;  1JBM A;  1I0C A;  4M7D D;  4QQ6 A;  1V1C A;  2DYB A;  4C8Q B;  2RQV A;  3G71 Q;  1JJ2 S;  3TCJ A;  3HTR A;  2LCC A;  5KYX A;  3I56 Q;  1S1N A;  2ESW A;  4XU2 A;  2OX7 A;  1VQ9 T;  3EAE A;  2JS2 A;  2L8D A;  4JDS A;  4LXC A;  3CCJ A;  1M90 R;  1QCN A;  2B86 A;  4IUP A;  2XIC A;  2HEQ A;  4FCY A;  1M1G A;  1JJ2 A;  1CKB A;  1AHJ B;  4BAC A;  1NYF A;  1MGQ A;  5D6Y A;  1IXD A;  2RHZ A;  3DLL A;  1FYN A;  4D6W A;  3HKS A;  4HCC A;  5GAN 6;  1U3O A;  2K2V A;  1KQS P;  3KXT A;  3L2V A;  1B07 A;  4C8Q D;  1AVZ C;  3CC7 T;  2WAC A;  3CCV A;  2MF2 A;  2EYW A;  2AK5 A;  1X2Q A;  3LW5 E;  4ZGE B;  1FMW A;  3I55 Q;  2LRQ A;  4AG2 C;  4QQG A;  2MIO A;  4M75 C;  1T3L A;  1VYU A;  4EPC A;  3UPU A;  1BI3 A;  3OYF A;  2RHU A;  2GF7 A;  1I1J A;  3QWY A;  2QA4 A;  3I35 A;  3CXC P;  3VYH B;  5GMK i;  5LJ3 f;  2VC8 A;  2LQK A;  5FW9 A;  1UGP B;  2KGT A;  2EBP A;  3HFO A;  5J26 A;  3RUX A;  3M58 A;  4XTU A;  2P4T A;  2RJF A;  1K76 A;  1X6B A;  5FRM A;  2O9S A;  1ARK A;  4MDW A;  1NYG A;  4O6J A;  1BI0 A;  4A4H A;  3ASK A;  4JLG A;  3KBG A;  1VQM Q;  3QKJ A;  3URG A;  1WHM A;  5KH6 A;  1WFW A;  3X24 B;  4OB0 B;  3C0C A;  4RTY A;  2VGN A;  2K2M A;  4WCI A;  1VQL Q;  3JCM d;  1M30 A;  2RHI A;  2M51 A;  2CH4 A;  2DIG A;  5KYY B;  2F5T X;  5LJ3 g;  4F7U A;  2BUD A;  3GIB A;  4GY5 A;  1BK2 A;  3JCM h;  4J9D A;  1UHC A;  2COZ A;  1GFD A;  1X01 A;  2CUD A;  3RER A;  2F2V A;  1VQ8 Q;  3PMT A;  4M7D C;  1VOM A;  4M7D A;  4O5V A;  4PJO E;  4AFS C;  1MHN A;  5C0M A;  3S3N A;  1GBR A;  4MZM A;  1N9S A;  1UGS B;  4M75 G;  4HA8 A;  2LNV A;  5I11 A;  1VQK A;  3VYG A;  2HZY A;  4DBQ A;  5LJ3 e;  2DBK A;  1LVK A;  1UG1 A;  2ED1 A;  2M1H A;  1AT1 B;  1UGV A;  2WSF E;  2ED0 A;  2D0Q B;  1XOV A;  4F14 A;  4FYY B;  1KC8 C;  1ZUK A;  2L2P A;  5KYW B;  4PKC C;  4LE9 A;  3V8K A;  1PD0 A;  1YHQ A;  5FWC A;  4F17 A;  2VXF A;  3A8H B;  3EGU A;  3I56 T;  4ELY C;  5CVI A;  3R6O A;  2O01 E;  3HRT A;  4PK4 A;  2DZ9 A;  5GAM d;  4C8Q A;  4C0F A;  1QVG P;  4RKU E;  5GAM h;  1KC8 U;  2QQB A;  4F7U G;  2KVQ G;  2D6F A;  2DJZ A;  1RAC B;  3OB9 A;  2R58 A;  4VUB A;  3CCV T;  2E10 A;  2DLP A;  3M0P A;  3OYK A;  1QWE A;  2JOY A;  4M7D G;  3OA6 A;  5GMK m;  1YIT T;  2V1R A;  5A0L A;  1QW1 A;  1Q86 U;  1BYM A;  2B8A A;  1Q82 C;  3MPU B;  4EIK A;  2J6O A;  4AG1 C;  4C0D B;  3H8Z A;  5I22 A;  3OYL A;  2KRM A;  3CEY A;  4GLM A;  2E4H A;  4M78 F;  2C06 A;  5CKE A;  1VQ6 Q;  4F16 A;  3G4S A;  1NJI R;  5CAI A;  1HD3 A;  3KUF A;  2K5F A;  2QQR A;  3VS4 A;  1K1Z A;  2ZPG B;  1X69 A;  2KK4 A;  2JTE A;  2LNH B;  2EFI A;  1JO8 A;  2X51 A;  2O4X B;  1MND A;  2WSC E;  2LTO A;  1Q82 U;  1TUG B;  2LVM A;  1WNL A;  2E6Z A;  2GQV A;  3PIO A;  1WGS A;  1UTI A;  3CC4 Q;  1WLP B;  1YCS B;  3LGL A;  3OSS C;  3CCS A;  2VAS A;  1NE8 A;  3A98 A;  5FRN A;  4JRP A;  1QMC A;  2A7Y A;  1VQP Q;  1YJN T;  1GCQ C;  1WJS A;  2RF0 A;  2E12 A;  2EVR A;  1ZUU A;  3BW1 A;  2KXC A;  3JCM f;  5J3B A;  1N8R R;  5CQX A;  3A1P A;  2IG0 A;  3M54 A;  2DVJ A;  3CCM A;  1YJW Q;  2MPX C;  3QWX X;  2EKH A;  5KE3 A;  4KH0 B;  2J7I A;  2EIF A;  3S6W A;  1G3W A;  2ATC B;  4M78 B;  1YIJ Q;  2QDY B;  4N4G A;  1VQO Q;  2JXB A;  2LMJ A;  1AZG B;  2JJ9 A;  2D8J A;  3FEO A;  1XJW B;  1KJW A;  2BIV A;  2L3P A;  3BE3 A;  3UAT A;  4MDX A;  5LJ5 d;  1NEB A;  3CCU Q;  3OS2 A;  4OMP A;  2OTL Q;  4HT8 A;  3L1A A;  3Q1J A;  5LJ5 h;  1Y0M A;  3M5A A;  5GAN d;  1YP5 A;  4FM4 B;  4RTT A;  4KT0 E;  2H3J A;  3CCQ A;  5KYN A;  3OY9 A;  2GQI A;  5HY6 A;  1NJI C;  2L89 A;  5CO7 A;  3OBW A;  4M78 D;  2HKQ B;  3H41 A;  4PJL A;  4BD3 A;  2KSS A;  5HKC A;  3MJX A;  4M77 D;  4HCB A;  1S72 A;  4OMQ A;  2RQU A;  5GAO p;  4R56 A;  2Y4Y A;  1VQ5 T;  3M0U A;  4QVC A;  2QAS A;  1EIF A;  2OTJ Q;  2BZY A;  1WXT A;  2FZG B;  1HSQ A;  2LT4 A;  4LDW A;  4R0K A;  3EGD B;  1K9M R;  3CD6 A;  1BI2 A;  4E7K A;  1UJ0 A;  1W6X A;  3G1J A;  1IB8 A;  3QZ5 B;  4HVU A;  3EH1 A;  4OP0 A;  2KMT A;  4LDV A;  2OAW A;  4JZ3 A;  1Y07 A;  3D7S B;  2MYS A;  2DTI A;  1N8R C;  2RD1 A;  4HCZ A;  3NTH A;  1WI7 A;  1KHC A;  2RM4 A;  1N27 A;  2DEQ A;  4X9D A;  2LX9 A;  3DB3 A;  3GBQ A;  1O75 A;  1ZA2 B;  1AWO A;  2DRM A;  5I2S A;  4JRI A;  3VKI A;  4E7Z A;  2BZ8 A;  3CCE Q;  2EYY A;  1VQ7 Q;  1WIE A;  4YTL A;  3CC4 T;  4JS5 A;  1MMN A;  3N5B B;  3VS2 A;  2XG8 D;  3CBP A;  3OYY A;  1X6G A;  4PLL A;  2RPN A;  2HD0 A;  5C6S A;  3JCM c;  1UDL A;  3EH2 A;  2QTV A;  1QVF S;  2KYB A;  1PHT A;  2X3X D;  4OVA A;  5GAN 4;  4M75 F;  2K5I A;  3CCM T;  3GF5 A;  1X6O A;  5KCO A;  4DEY A;  5KYX B;  2P84 A;  5GMK l;  5AYF A;  3CMA T;  4C5G A;  2JW4 A;  3ZEH A;  2NLU A;  5L8R E;  4IUV A;  1QVF A;  3FC3 A;  2FRW A;  1WHG A;  1HJD A;  2DXB A;  2HQE A;  2DL4 A;  3V8J A;  1R0C B;  3OYN A;  1VQO T;  3CPW A;  3OW2 A;  4QQD A;  4ZTJ A;  1VQ9 Q;  3C95 A;  4LDX A;  3PE0 A;  4PJN A;  4XAX B;  1PM3 A;  4L59 A;  1K9M C;  3G6E Q;  4M78 A;  4FYW B;  3REB B;  2OTL T;  2XDP A;  4F7U E;  3OYA A;  4F7U F;  1B34 B;  3QPH A;  4M77 C;  3O5Z A;  4M77 A;  2EKO A;  2EJG A;  4ZGD B;  2DJQ A;  2YXY A;  3NGP A;  3MEA A;  1NZ9 A;  2LJ1 A;  3L2W A;  2ABL A;  3CME A;  4M7D F;  5GAN f;  4OMO A;  4FYV B;  2NUT A;  4RCB A;  4KUD K;  4UC4 A;  1GXI E;  3QHS A;  1T3S A;  3A8L B;  3L2R A;  3CC7 Q;  4M75 B;  1KK7 A;  3J7A F;  2R57 A;  1Z9Z A;  4CRI A;  3UA6 A;  4NS5 A;  2NUP A;  3CBO A;  2YUQ A;  4MMK A;  5GMK j;  1RLP C;  4ZN1 A;  5GAN 2;  2V1Q A;  3CD6 T;  3JB9 J;  3JRZ A;  4Z8A A;  2K9G A;  2EW3 A;  2VGM A;  2DM1 A;  4BI8 B;  5LJ3 d;  4LDU A;  1JQQ A;  5GAN g;  3RMQ A;  1YJ9 A;  3PGG A;  4KH1 B;  2LT1 A;  5LJ3 h;  3A8M B;  5HK3 A;  3CCL A;  1LOJ A;  2XK0 A;  4C8Q E;  4CC3 A;  3S3O A;  3G7Z A;  2BZX A;  1OOT A;  3V7S A;  1D1A A;  4DA4 A;  2EGE A;  2LP5 A;  1K73 C;  4M75 D;  3EGD A;  2CP2 A;  4F7U B;  1CKA A;  3L2Z A;  4M77 G;  1H8K A;  2ROL A;  4B9W A;  1ZSZ C;  3M0S A;  4M7D B;  1ZSZ A;  4JUV A;  3MEV A;  2K3X A;  1D1C A;  1X2K A;  2L5Q A;  4ME7 A;  4N4I A;  1UUE A;  5GAN 7;  4FW1 A;  2M02 A;  2FYK A;  5HCK A;  2MI6 A;  3CC2 Q;  2CP7 A;  2LJ3 A;  1K8A R;  2K5L A;  3QO3 A;  2CZ7 B;  2QEX A;  1Q81 C;  3L2Q A;  1RAD B;  3F70 A;  4J9G A;  2DF6 A;  1IO6 A;  4EMK C;  4EMK A;  3MCA B;  3QUI A;  2YSQ A;  2QXF A;  1NLP C;  1OU9 A;  1M8M A;  2O9V A;  3OYI A;  4E7L A;  2FO0 A;  4XTY A;  1IGQ A;  2EQK A;  1BKB A;  2L3Q A;  1VQ4 T;  2HSP A;  2DNU A;  3EFS A;  1Q81 U;  3CCJ Q;  2GGR A;  1XQH A;  4M4Z A;  1AWX A;  1G3Y A;  1OPK A;  2CP5 A;  2EYZ A;  3G6E T;  3SDZ A;  2E1H A;  3CBM A;  3AHU A;  1PNJ A;  2Y90 A;  1D3B B;  1M3C A;  3O8V A;  1VA7 A;  3SHW A;  1PSE A;  1SSH A;  1TH7 A;  1PG5 B;  3G71 A;  5DLO A;  1IHV A;  3RR6 A;  3CPW P;  1W2B P;  3JCM V;  1D0X A;  3CCV Q;  3OW2 P;  4X1V A;  2M9U A;  1I5O B;  2L3S A;  3NPF A;  3IQL A;  1B34 A;  1YIT Q;  2VUB A;  1I81 A;  3QZ9 B;  1VYT A;  5FU6 C;  1Y96 A;  1AOJ A;  4C5H A;  4A63 B;  1G83 A;  2BKD N;  3EFR A;  2DET A;  2KBT A;  2V8K A;  4A54 A;  4D8K A;  1YJ9 T;  1X27 A;  5CCA A;  1YI2 A;  4M75 A;  1FMV A;  4L5G A;  1G5V A;  1VUB A;  4J9B A;  1GCP A;  3CCL T;  1K8A C;  1IGU A;  2YHT A;  4Z89 A;  3FDR A;  3OYE A;  3TRE A;  4WTO B;  2MMP A;  2GNC A;  3H0F A;  4NL2 A;  2D9T A;  1YFN A;  2QAZ A;  1FMK A;  3OQ5 A;  2VWF A;  2F2X A;  3OMC A;  3REA B;  1ZSG A;  3BDL A;  3I55 A;  1Q86 R;  4A4G A;  2DYI A;  1U1S A;  2DTO A;  4M7A G;  3PVQ A;  4JZ4 A;  4N0A C;  1YJN Q;  4N0A A;  4N4H A;  3U23 A;  1TSF A;  2DTH A;  3EGX A;  8ATC B;  1WQ7 A;  2BE7 D;  2K4Y A;  4ZGJ B;  3BY7 A;  1TOV A;  3H6Z A;  3CC2 T;  2CGH A;  3GLX A;  4AFU C;  1M90 C;  2HSE B;  2QEX T;  2CSQ A;  2R5M A;  4PFP A;  1RAE B;  4LUE A;  1VQM A;  2M0O A;  5GAO m;  2QQA A;  2ZPE B;  3R6N A;  3JCM W;  4E7I A;  3X20 B;  4DBR A;  4PLI A;  1VQL A;  2LX7 A;  3M0R A;  3I5S A;  1N5Z A;  2KR3 A;  2E5Q A;  2HKN A;  1YHQ Q;  1M90 U;  1ABO A;  5IXF A;  2KYM A;  1H92 A;  2MWO A;  4V2S A;  1IZ6 A;  5D7U A;  4LUD A;  1KHI A;  2QYZ A;  1OI1 A;  4D8D A;  3CCJ T;  1M9S A;  3QBY A;  1HXD A;  2GFU A;  1WA7 A;  3PTA A;  4J9E A;  5CQY A;  2RNA A;  2JT4 A;  3M53 A;  3ZFJ A;  4Y91 A;  4E7H A;  1B7T A;  5GAM j;  1VQ5 Q;  1JRI A;  3TSZ A;  5IH2 A;  1QP2 A;  1MNE A;  1XNI A;  2XI9 A;  4JRK A;  2FPF A;  1D3B A;  5GAO q;  3A8O B;  1KFZ A;  1AD5 A;  5FU7 C;  2KRN A;  3EHR A;  3SFM A;  4A4E A;  5ECA A;  2NWM A;  3G4S Q;  4AFQ C;  3X26 B;  1JJ2 P;  1YI2 T;  1BIA A;  1U1T A;  2X3W D;  4RTX A;  4M78 E;  2QA4 T;  1KSW A;  4M77 E;  4M77 F;  3V8L A;  1W1F A;  3CCS Q;  2DIL A;  1VYV A;  4CC2 A;  1Y7X A;  1YN8 A;  1TG0 A;  2P0Q A;  2E5K A;  2F2W A;  2RO0 A;  2OAU A;  5GAO n;  2XDB A;  3SB2 A;  4L6V 5;  1GBQ A;  2DMO A;  2AKL A;  3SEM A;  2CT4 A;  1C6V X;  2G3R A;  3EHQ A;  1OEB A;  1K9A A;  1GCQ A;  2YRC A;  2AZS A;  1M2V A;  3CCM Q;  2I2L A;  3NFC A;  3FIF A;  1KD1 R;  1WHK A;  2K57 A;  1I5L A;  3OYB A;  1M8V A;  2V26 A;  3CMA Q;  6AT1 B;  1R77 A;  1WJQ A;  2I0N A;  1ACM B;  2WSE E;  3ZL7 C;  2DVE A;  5IXB A;  2AKK A;  2X35 A;  1VQK T;  1MV3 A;  1D1B A;  4M77 B;  1VQP A;  3JCM X;  1TS9 A;  4LN2 A;  4JPB W;  5CKB A;  3EG9 B;  3CCR A;  2FG0 A;  3DLM A;  2NUT B;  4JJN K;  2O88 A;  1YHQ T;  3QII A;  5AT1 B;  1UEB A;  3CCQ Q;  2DL3 A;  3OYH A;  4BDZ A;  3MEW A;  2DE0 X;  1MUZ A;  1SPK A;  4F04 B;  3EG1 A;  5CKH A;  2F1L A;  2OJ2 A;  2NUP B;  1ZBX A;  5LJ5 j;  2K3B A;  1YIJ A;  2IPO B;  4BB7 A;  1X75 C;  5GAN h;  1RAI B;  1OYX A;  4JJC A;  5D6X A;  2YLC A;  1MMG A;  3PVL A;  3A5Z B;  1JXO A;  1M1K R;  5GAN j;  4J7F A;  1UGR B;  2ZPB B;  3SD4 A;  1UGQ B;  3RNJ A;  1PRL C;  1PWT A;  1R0B G;  3QYH B;  2CP6 A;  2MK5 A;  2KRS A;  3CCU A;  3UT1 A;  4RCC A;  1UB4 A;  3OBY A;  4EMH A;  1SF9 A;  3TVT A;  1TTH B;  3RKY A;  2IIM A;  5CIU A;  2DIQ A;  3CD6 Q;  1RAF B;  2CUB A;  4MZT A;  2AHJ B;  2VYT A;  4HVV A;  1E6H A;  3AT1 B;  1D09 B;  1NJI U;  3J81 E;  3MEU A;  4RTU A;  5D6W A;  5GAO l;  1N6A A;  1LJO A;  2GFA A;  3G4S T;  2PVG B;  1A0N B;  1ZSZ B;  2P0P A;  3SWN C;  3SWN A;  4FSS A;  3QYG B;  1Z9Q A;  4Y92 A;  2FL7 A;  1JEG A;  1WXU A;  1AZE A;  2DEU A;  4M7A F;  5CKD A;  2OTJ A;  2H3E B;  3QDR B;  3OYG A;  5GJW B;  2PVO B;  1UJY A;  3QXE B;  3CCS T;  2P0K A;  1PCX A;  2LC4 A;  9ATC B;  4PJO C;  2JMA A;  2EYX A;  4IIO A;  2W10 A;  3KFV A;  5GAO r;  1OZ3 A;  2O31 A;  1QCF A;  4J7I A;  1YWP A;  4MZP A;  3WVD B;  1OZ2 A;  2YRD A;  1P92 A;  2AZV A;  3FRN A;  1N8R U;  3NTI A;  1PKT A;  1QKX A;  3JB9 H;  4KGZ B;  1Y71 A;  4EMK B;  2ENM A;  4M75 E;  2DL7 A;  2CZ6 B;  1WPY A;  2QQ9 A;  1RI9 A;  2M16 A;  1ZQ1 A;  2HMA A;  1VIF A;  1VIE A;  3PFS A;  3TEE A;  3CCE A;  4IKF A;  2KRO A;  2AT1 B;  2CKK A;  1M1K C;  3JB9 I;  2DFU A;  3ZBD A;  2E6N A;  3TSW A;  2QGF B;  1W70 A;  2GCX A;  2D8H A;  2DO3 A;  2XKO C;  1FXX A;  3I5R A;  2MWP A;  4LDY A;  3HSB A;  3H9N A;  2PVD B;  1VQ4 Q;  2HAX A;  3V7C A;  4HXJ A;  1KQS S;  1Q7Y R;  3I9Q A;  4J9H A;  2ROT A;  2LZ6 B;  1OX9 A;  2DPP B;  2E3H A;  5IT9 E;  1KQ1 A;  3CCQ T;  4DEX A;  4C5E A;  1RAH B;  3CME Q;  2R5A A;  2DKG A;  4PJO G;  5FU6 B;  2RQW A;  3LLR A;  3OS0 A;  1Y96 B;  1OUL A;  2JM9 A;  2K6D A;  4M7D E;  3H0H A;  5FWB A;  4AMC A;  3EG9 A;  4FT2 A;  3M4G A;  4FIB A;  4RTV A;  2D1X A;  1S72 T;  3CXC S;  3E9G A;  1K9M U;  2KXD A;  5IN1 A;  1TUD A;  4M7A D;  2KEA A;  4DBF A;  3H0I A;  5GAN 3;  1R8O B;  3J80 E;  2KT8 A;  4C0G A;  4EMG A;  1WJR A;  5IHN A;  1V76 A;  1YJ9 Q;  2DXT A;  3HRS A;  4A4F A;  2E64 A;  1TXQ A;  3CCL Q;  2KQW A;  3UWN A;  2RQR A;  2MAM A;  2SRC A;  2CS7 A;  1OV3 A;  2CSI A;  5LJ3 j;  2LQN A;  3EGX B;  3L42 A;  2ZAE A;  1PD1 A;  1KG1 A;  8AT1 B;  4E7J A;  3GNF B;  2EJF A;  1M1F A;  1BIB A;  3OYD A;  3VS0 A;  2DD4 A;  1ZX6 A;  3E9F A;  4IUQ A;  3ER0 A;  3JCM b;  2DXC A;  1EZZ B;  1K73 U;  4QKU A;  3MET A;  2EQM A;  3M4Y A;  2QEX Q;  3LX7 A;  2RK2 A;  1C1A A;  4PFO A;  3LWI A;  3MO8 A;  2EWN A;  1NLO C;  3BDU A;  2FHD A;  3T9N A;  1MMA A;  1MV0 B;  1F1B B;  2E70 A;  3P8D A;  2RMO A;  4XU0 A;  4KGV B;  3VS5 A;  1RLQ C;  3C4S A;  1QVG S;  2QGG A;  3X28 B;  1VQN A;  4E47 A;  2IVW A;  4X34 A;  3RKW A;  2XD0 A;  4FL6 A;  2F69 A;  2RN8 A;  4ZTF A;  1LPL A;  2KE9 A;  2QTX A;  3VUZ A;  4GLK A;  5CR2 A;  3TQ7 P;  2K79 A;  3FJ5 A;  3EFO A;  4OGC A;  1I4K 1;  1OQK A;  4BE0 A;  1WX6 A;  3INZ A;  4BY6 C;  5IHI A;  3QDF A;  4RG8 A;  5EC7 A;  2XMF A;  4C92 D;  4XTW A;  2ZZD A;  3M0T A;  2LCS A;  1RAG B;  3CME T;  4M7A C;  2FRY A;  4J9F A;  1QVF P;  4M7A A;  5FU7 B;  1TUC A;  1K4U S;  2PU9 B;  2ZCF B;  1QQJ A;  4QW2 A;  2HBP A;  2HQH A;  2RQT A;  3VS6 A;  3I56 A;  4J9I A;  2FZK B;  1M5Q 1;  4PJJ A;  4ESR A;  1TWB A;  1ZHI A;  2XID A;  1NPR A;  4IUR A;  2KY9 A;  1YI2 Q;  1D0Y A;  3RES A;  1QVP A;  2QA4 Q;  4BDY A;  5IAY A;  3RMS A;  3PNW C;  3OYJ A;  2X9H A;  2V8I A;  3WXM B;  5J39 A;  1PRM C;  3LGF A;  4OMF B;  1KC8 R;  4A4K A;  4KGX B;  1YIT A;  4BI3 A;  1YCY A;  1JB0 E;  3E1S A;  5L23 A;  1ZUY A;  2J06 A;  2ZGW A;  2DL8 A;  2JMC A;  1H64 1;  4MML A;  4BI4 A;  2HBW A;  1RUW A;  4J83 A;  2HQX A;  5A0D A;  1M2V B;  4J9C A;  2K3Y A;  3OS1 A;  3S3M A;  2LQW A;  3CQT A;  2LCL A;  5M9O A;  4HVW A;  1K8A U;  1QCO A;  3JAM E;  5GAN 5;  1BCM A;  1TU0 B;  4II1 A;  2YUO A;  1FX7 A;  4FYX B;  1U06 A;  4LD9 K;  2Z0W A;  3JCM P;  5EG2 A;  1M3B A;  3P8B B;  2RJC A;  4JJB A;  1SKU B;  2FB7 A;  2LDM A;  1PC0 A;  2CZ1 B;  4IUU A;  2RI2 A;  1WHL A;  4CC4 B;  1Q82 R;  4OB3 B;  2JNG A;  4BUG A;  3OYM A;  4HCK A;  2CT3 A;  1VQK Q;  1UFF A;  2KT1 A;  1YJN A;  3BFM A;  3HPW A;  2NUZ A;  1KIK A;  2RH2 A;  2G6F X;  2PQW A;  2QDL A;  4ORZ A;  1VQN T;  3ME9 A;  5GMK e;  5GAN 8;  1M27 C;  2RHX A;  2J05 A;  5DLQ E;  1SSF A;  5IHK A;  4XTV A;  3M0Q A;  1PKS A;  2XU8 A;  1RI0 A;  1ZA1 B;  4C92 C;  5A0G A;  1SRM A;  4PJO F;  4C92 A;  4EDU A;  1VQ8 A;  7AT1 B;  1RAA B;  4XK8 E;  3MKD A;  4HT9 A;  5I21 A;  1K0X A;  1M3A A;  1EFN A;  2JUF A;  4ZNX A;  2RHY A;  4PFZ A;  4KUL A;  3RIR A;  1AWW A;  2GTJ A;  2SEM A;  5A2Q E;  1GFC A;  1UE9 A;  2KNB B;  2JM8 A;  3UA7 A;  2HDA A;  1UHF A;  2FPD A;  3JSC A;  4B9X A;  4E7S A;  1QLY A;  2A36 A;  4C5I A;  3G71 T;  2YLB A;  1E6G A;  2L3R A;  2ZPH B;  3NMZ C;  4OGE A;  1YNZ A;  3PMI A;  4QT7 A;  4BE1 A;  1HYO A;  1HK9 A;  3SWN B;  4C8Q C;  3JB9 G;  2EJ9 A;  1Q86 C;  1NG2 A;  4FU6 A;  5CK9 A;  2JTF A;  2YDL A;  1NPP A;  2C0T A;  2FZC B;  1WXB A;  3QG1 A;  1WZO A;  3ULR B;  1GL5 A;  4PJO B;  1QP3 A;  1VQ5 A;  1C0M A;  4C92 G;  1O9S A;  1LNX A;  3EG2 A;  4DOW A;  1WHJ A;  2RI3 A;  2XHC A;  5I2M A;  2HNI A;  4XTZ A;  2CYZ B;  2Y4X A;  2DXU A;  3I55 T;  4OMM A;  5DY9 A;  2LQ8 A;  3FB9 A;  1OX8 A;  2D0N A;  4AFZ C;  3L2U A;  2X4J A;  4RMO A;  2P4R A;  4RTW A;  1VQ6 A;  1SRL A;  2KI7 A;  2KDS A;  1IRX A;  2RI5 A;  4WF2 A;  2EQJ A;  2K7A A;  4JLI A;  2GTO A;  2ZPI B;  1XTD A;  2FPE A;  1BCO A;  3OYC A;  1WQW A;  4PJO D;  2E41 A;  4DQ2 A;  4B6M A;  2DD5 A;  3QJY A;  4C8Q G;  4ELZ C;  5CKF A;  1VQM T;  4OB2 B;  3CC4 A;  2DER A;  4PJM A;  2VB6 A;  3LH0 A;  2A3L A;  1BU1 A;  4J6Y A;  2AIR B;  1VQL T;  2CDT A;  1MMD A;  4DBH A;  2EYQ A;  4XTX A;  3VS1 A;  1SHF A;  4JS4 A;  3CCR Q;  1G2B A;  1ZBJ A;  2COY A;  2V8J A;  1RAB B;  4ZN3 A;  1VQ8 T;  4PL6 A;  1JXM A;  3TU4 K;  3M55 A;  3CMA A;  1YJW A;  2DBM A;  1EX4 A;  5KYY A;  2E3I A;  1X43 A;  3VU3 C;  1N9R A;  2DX1 A;  2M0Y A;  4CC7 A;  2XDD A;  4X9C A;  4QVD A;  4OMN A;  1U5S A;  2RA2 A;  1VQO A;  3MP1 A;  4Q5W A;  3MHX A;  1B3Q A;  2RK1 A;  1CSK A;  2QK0 A;  1S72 Q;  3JCM J;  3JCM g;  1Q95 G;  4AT1 B;  2W0Z A;  3HP9 A;  3EG3 A;  3RKX A;  3LWH A;  1DJ7 B;  2CH4 W;  2COW A;  2OTL A;  1V29 B;  2RJD A;  4Z88 A;  1G8X A;  2DK3 A;  1G3T A;  2CP3 A;  2DAQ A;  2EAY A;  4HKE A;  2RJE A;  5KYW A;  5GAM f;  3WVE B;  3JCM e;  2BTT A;  3NHN A;  3QJ6 A;  3THK A;  2KAF A;  2HL5 C;  3VRY A;  3PT9 A;  2DA9 A;  3GNG A;  5KYU B;  2LJ0 A;  3VS3 A;  3OS5 A;  2CZ0 B;  1KD1 C;  1I8F A;  4M7A E;  1IRE B;  2F5K A;  1KQ2 A;  4LNP A;  1SEM A;  4PNO A;  4QVZ A;  1U8R A;  2ZPF B;  4OB1 B;  2HL3 A;  2VVK A;  4RUG A;  5GAM g;  4PJO A;  2X4Y A;  1VQ6 T;  1M2O A;  1ZLM A;  3UDC A;  2BE9 B;  4KRT A;  2H8H A;  2A37 A;  2EGC A;  1ABQ A;  1KD1 U;  5LL6 S;  4J5Y A;  4C0D C;  4OML A;  4Z02 A;  4A53 A;  2CP0 A;  2FVU A;  3P8H A;  3C12 A;  3FJP A;  3RBB B;  2QQS A;  1GRI A;  3A8G B;  3VJP A;  5GAM e;  5GJV B;  1VQ7 A;  3EFO B;  2O4X A;  2L0A A;  4JJD A;  1M4Z A;  4BY6 B;  1VQP T;  4LD6 A;  2OI3 A;  3RDV A;  2PUO B;  4NL3 A;  3CPW S;  3CCR T;  1W2B S;  2A08 A;  3OW2 S;  4M7A B;  1K73 R;  5DM7 R;  1WYX A;  1YJW T;  1IHW A;  3X25 B;  5KCH A;  2VV5 A;  1M1K U;  3MP6 A;  1Y57 A;  2NYS A;  4IIM A;  3CPF A;  2EGA A;  1YIJ T;  2A28 A;  3VV0 A;  4RG2 A;  1JU5 C;  4KBM B;  4E2F B;  1W2B A;  3HL8 A;  1NBE B;  1BB9 A;  1KQS A;  2PUK B;  3JB9 F;  1VQ4 A;  2YT6 A;  3V7R A;  4C0Z A;  3M56 A;  3LH5 A;  3M57 A;  1OU8 A;  1LCK A;  4M78 C;  4RTZ A;  1VQ9 A;  1RL2 A;  3C94 A;  3CCU T;  4BE2 A;  2PNI A;  5LJ5 f;  3HRU A;  4XQ3 A;  5FLX E;  2DL5 A;  2FEI A;  2QI2 A;  3G6E A;  1Q81 R;  2JVV A;  4J6W A;  2YUP A;  1T0J A;  1FWZ A;  2MCN A;  4C92 E;  4C92 F;  4J8O A;  3M9Q A;  3VRZ A;  4DOV A;  3OSV A;  3M59 A;  3CXC A;  3QSU A;  2J6K A;  3LYI A;  4OF1 A;  3E19 A;  2VXE A;  4ANJ A;  3JCM Q;  3GP8 A;  5GMK h;  3HHT B;  2A0F B;  2JZ2 A;  3CC7 A;  2JN0 A;  2C0O A;  2J6F A;  5LJ5 g;  1OPL A;  1AWJ A;  5HK0 A;  3GOX A;  2QG9 B;  2OTJ T;  2VKN A;  1YWO A;  3DB4 A;  4NOY A;  2EQU A;  1QKW A;  1WDX A;  4IUT A;  2EQI A;  3PIP A;  4R55 A;  4TVR A;  1H3Z A;  2RB6 A;  3VS7 A;  2GBQ A;  5KYU A;  4C8Q F;  5KE2 A;  2DRK A;  1YBY A;  2E65 A;  1NEG A;  3E2U A;  5FRO A;  2EPD A;  1Q7Y C;  5LJ5 e;  2MOX A;  2YUN A;  4J6X A;  4M78 G;  4KUI A;  3MP8 A;  4E6R A;  4FSX A;  3FLG A;  1D0Z A;  2X4W A;  2PZ1 A;  1BI1 A;  4GBQ A;  1K0S A;  5GAN e;  2YWW A;  1AEY A;  3UF4 A;  3OMG A;  1W4S A;  1PSF A;  4C92 B;  3CCE T;  1H3H A; 
#chains in the Genus database with same CATH homology
 1QWF A;  1BBZ A;  2RPN A;  4CC4 B;  2PTK A;  1UDL A;  2KYB A;  1PHT A;  1T0H A;  2CRE A;  2X3X D;  1SHG A;  2CT3 A;  4HCK A;  1UFF A;  2KT1 A;  1J3T A;  2ECZ A;  3EG0 A;  2I0N A;  2NUZ A;  1KIK A;  3ZL7 C;  2G6F X;  2QDL A;  4K11 A;  4ORZ A;  5IXB A;  4DEY A;  2HCK A;  2AKK A;  2O2O A;  1NM7 A;  1M27 C;  1UEC A;  1MV3 A;  2J05 A;  2JW4 A;  5IHK A;  2JS0 A;  3M0Q A;  1E7O A;  2C0I A;  1PKS A;  4LN2 A;  1SRM A;  3JV3 A;  1I07 A;  4JPB W;  2FRW A;  1HJD A;  1K0X A;  1M3A A;  1EFN A;  2DL4 A;  2FG0 A;  1I0C A;  2O88 A;  4ZNX A;  1V1C A;  2DYB A;  2DL3 A;  1AWW A;  2DE0 X;  1MUZ A;  1SPK A;  2GTJ A;  2RQV A;  2SEM A;  3EG1 A;  1GFC A;  3PE0 A;  1UE9 A;  2OJ2 A;  2KNB B;  2JM8 A;  3UA7 A;  2HDA A;  1UHF A;  2K3B A;  2FPD A;  1S1N A;  2ESW A;  3REB B;  2JS2 A;  3O5Z A;  1QLY A;  2A36 A;  4JJC A;  1E6G A;  3PVL A;  1JXO A;  3NMZ C;  2DJQ A;  1YNZ A;  3NGP A;  2B86 A;  2LJ1 A;  2HEQ A;  2ABL A;  3RNJ A;  1PRL C;  4QT7 A;  4OMO A;  1PWT A;  1CKB A;  1NYF A;  2KRS A;  1T3S A;  1NG2 A;  3TVT A;  1FYN A;  2IIM A;  1Z9Z A;  2CUB A;  3UA6 A;  4HVV A;  1U3O A;  2YDL A;  1E6H A;  1B07 A;  1AVZ C;  2YUQ A;  2C0T A;  1RLP C;  2V1Q A;  1WXB A;  4RTU A;  4Z8A A;  3ULR B;  2K9G A;  2EW3 A;  1GL5 A;  2EYW A;  2AK5 A;  2DM1 A;  1X2Q A;  1A0N B;  1JQQ A;  3EG2 A;  4FSS A;  1Z9Q A;  4Y92 A;  4AG2 C;  2MIO A;  1T3L A;  1VYU A;  1JEG A;  1WXU A;  1AZE A;  1I1J A;  3QWY A;  4CC3 A;  2BZX A;  3I35 A;  1OOT A;  4OMM A;  2EGE A;  2LP5 A;  5GJW B;  1UJY A;  2D0N A;  5FW9 A;  4AFZ C;  1CKA A;  2KGT A;  2EBP A;  2P4R A;  4RTW A;  1SRL A;  1H8K A;  2EYX A;  2JMA A;  1K76 A;  4IIO A;  2W10 A;  1X6B A;  3KFV A;  2ROL A;  2O9S A;  2O31 A;  1ARK A;  1QCF A;  3M0S A;  1YWP A;  1NYG A;  2K7A A;  2AZV A;  2GTO A;  2FPE A;  1X2K A;  1WFW A;  1UUE A;  1PKT A;  3C0C A;  4RTY A;  1QKX A;  5HCK A;  2ENM A;  2K2M A;  4WCI A;  1M30 A;  2DL7 A;  2LJ3 A;  2M51 A;  1RI9 A;  2CH4 A;  1BU1 A;  1BK2 A;  4J9D A;  1UHC A;  1GFD A;  2CDT A;  2CUD A;  2KRO A;  2F2V A;  3VS1 A;  1SHF A;  3TSW A;  1G2B A;  1W70 A;  1ZBJ A;  2D8H A;  4AFS C;  3I5R A;  4J9G A;  2DF6 A;  1IO6 A;  1GBR A;  1JXM A;  4HXJ A;  5I11 A;  2YSQ A;  3I9Q A;  4J9H A;  2DBM A;  1NLP C;  2DBK A;  1M8M A;  1UG1 A;  2ED1 A;  2LZ6 B;  2O9V A;  2ROT A;  1X43 A;  2FO0 A;  2DX1 A;  2L3Q A;  2M0Y A;  1UGV A;  2HSP A;  4CC7 A;  2DNU A;  2ED0 A;  4OMN A;  1XOV A;  4DEX A;  4F14 A;  1U5S A;  1ZUK A;  2GGR A;  2L2P A;  4LE9 A;  4M4Z A;  1B3Q A;  1CSK A;  1AWX A;  2RQW A;  5FWC A;  4F17 A;  1OPK A;  3EGU A;  2EYZ A;  2JM9 A;  2W0Z A;  2K6D A;  3H0H A;  5FWB A;  3EG3 A;  1PNJ A;  1M3C A;  1VA7 A;  4RTV A;  3SHW A;  1SSH A;  2CH4 W;  2D1X A;  1H3H A;  4Z88 A;  2KXD A;  1TUD A;  4X1V A;  2KEA A;  3H0I A;  2L3S A;  3NPF A;  3IQL A;  2KT8 A;  1VYT A;  5IHN A;  1AOJ A;  2DLP A;  2BTT A;  3M0P A;  1QWE A;  3NHN A;  4A63 B;  1G83 A;  3THK A;  2KBT A;  2V1R A;  3VRY A;  2DA9 A;  2RQR A;  2LJ0 A;  4D8K A;  3VS3 A;  1X27 A;  2SRC A;  4EIK A;  2J6O A;  4AG1 C;  5I22 A;  4J9B A;  1GCP A;  1OV3 A;  2CSI A;  2KRM A;  4GLM A;  2LQN A;  4LNP A;  4Z89 A;  1SEM A;  4F16 A;  1HD3 A;  2GNC A;  3H0F A;  1K1Z A;  3VS4 A;  2VVK A;  1X69 A;  2LNH B;  2JTE A;  4RUG A;  1JO8 A;  1FMK A;  2VWF A;  2F2X A;  1ZLM A;  3VS0 A;  3REA B;  1ZSG A;  4KRT A;  2H8H A;  1ZX6 A;  2A37 A;  2EGC A;  1ABQ A;  1UTI A;  1WLP B;  1YCS B;  3PVQ A;  4JZ4 A;  4OML A;  3A98 A;  3U23 A;  3RBB B;  1GRI A;  1GCQ C;  2RF0 A;  5GJV B;  1NLO C;  2L0A A;  4JJD A;  4AFU C;  2EVR A;  1ZUU A;  2CSQ A;  1MV0 B;  4LUE A;  2KXC A;  2RMO A;  2OI3 A;  3R6N A;  3VS5 A;  2DVJ A;  1RLQ C;  3QWX X;  2EKH A;  2A08 A;  2J7I A;  2LX7 A;  3M0R A;  3I5S A;  1N5Z A;  2RN8 A;  2KR3 A;  1WYX A;  2KE9 A;  2JXB A;  2LMJ A;  1AZG B;  2K79 A;  2D8J A;  3FJ5 A;  1Y57 A;  4IIM A;  1ABO A;  5IXF A;  2EGA A;  2KYM A;  1H92 A;  1KJW A;  1WX6 A;  2L3P A;  3UAT A;  2A28 A;  5IHI A;  1JU5 C;  4LUD A;  1NEB A;  4D8D A;  5EC7 A;  2XMF A;  4OMP A;  1BB9 A;  3M0T A;  2LCS A;  1Y0M A;  2YT6 A;  1YP5 A;  3LH5 A;  4RTT A;  2FRY A;  4J9F A;  1LCK A;  2GQI A;  1WA7 A;  4RTZ A;  1TUC A;  4J9E A;  1K4U S;  2RNA A;  2JT4 A;  2PNI A;  2RQT A;  3VS6 A;  2DL5 A;  2FEI A;  4J9I A;  3H41 A;  2YUP A;  1T0J A;  2MCN A;  3TSZ A;  5IH2 A;  4ESR A;  4OMQ A;  2RQU A;  3VRZ A;  2FPF A;  2J6K A;  3M0U A;  1KFZ A;  1AD5 A;  2BZY A;  1WXT A;  2KRN A;  3EHR A;  1HSQ A;  5ECA A;  2NWM A;  4AFQ C;  2C0O A;  4R0K A;  2X3W D;  1PRM C;  2J6F A;  4RTX A;  1OPL A;  1UJ0 A;  1AWJ A;  1W6X A;  1KSW A;  2VKN A;  1YWO A;  4HVU A;  1QKW A;  1WDX A;  5L23 A;  1ZUY A;  2J06 A;  2OAW A;  2DL8 A;  2JMC A;  2EQI A;  4JZ3 A;  2HBW A;  1RUW A;  4J9C A;  1W1F A;  2DIL A;  2LQW A;  3VS7 A;  3CQT A;  1VYV A;  2GBQ A;  4CC2 A;  1WI7 A;  1YN8 A;  2DRK A;  1TG0 A;  1NEG A;  4HVW A;  2EPD A;  3GBQ A;  2E5K A;  2F2W A;  1AWO A;  2MOX A;  2YUN A;  2DRM A;  1GBQ A;  2DMO A;  2AKL A;  2BZ8 A;  2CT4 A;  3SEM A;  4E6R A;  2EYY A;  1WIE A;  2YUO A;  2PZ1 A;  1U06 A;  4GBQ A;  1K0S A;  3EHQ A;  1OEB A;  1M3B A;  1AEY A;  3UF4 A;  3VS2 A;  1K9A A;  1GCQ A;  4JJB A;  1X6G A;  2AZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...