1GFOA

Ompf porin (mutant r132p)
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
340
structure length
340
Chain Sequence
b'AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGPVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX PORIN OUTER MEMBRANE PROTEIN F
publication title Structural and functional characterization of OmpF porin mutants selected for larger pore size. I. Crystallographic analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transmembrane protein
total genus 104
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 1996-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1gfoA00
4RJXA 1BT9A 4LSEA 4D5UA 4FRXA 3PRNA 4D65A 3POUA 5FVNA 1OPFA 2J1NA 2Y0KA 3FYXA 4JFBA 3HW9A 6PRNA 4KR4A 1GFNA 2XE2A 3K19A 3SZDA 3UPGA 1GFOA 3VZWX 2O4VA 3VZTX 1PHOA 4FSPA 4C69X 3SZVA 3NSGA 4GCQA 2Y0LA 5PRNA 2FGQX 5JDPA 3T20A 3WI5A 4LSFA 3SY7A 4RJWA 2Y0HA 2PORA 1HXTA 2ZLDA 1GFQA 4GCPA 3SY9A 1GFPA 2XE1A 2FGRA 1OSMA 1HXXA 2K4TA 4LSIA 5DL7A 5DL5A 4D64A 4FT6A 4FMSA 2J4UP 2PRNA 2Y2XA 2XE3A 3POQA 4KR8A 5DL8A 3VY9X 4AUIA 7PRNA 1BH3A 1MPFA 1HXUA 2QTKA 2XG6A 3WI4A 4KRAA 3T0SA 2OMFA 3EMNX 3VZUX 2ZFGA 3T24A 1E54A 4FOZA 3SYSA 5DL6A 4BUMX 3POXA 2ODJA 3SYBA 8PRNA 4GCSA 3HWBA 1PRNA 4LSHA 3UU2A 3JTYA 3VY8X 2XE5A 3PORA 1GFMA 3A2SX 1H6S1 4FSOA 4FRTA 3O0EA
chains in the Genus database with same CATH superfamily
4N59A 4RJXA 4AKMA 4RL9A 4E1TA 1BT9A 2R4PA 1Q9FA 2WJQA 1S5LO 4LSEA 4XNLA 1THQA 5KAFO 2AXTO 4D5UA 4AYDC 4O49A 1MM4A 3PRNA 4FRXA 4PJ0O 5EE2A 2IWVA 2MNHA 2YPVA 4AKRA 4D65A 1P4TA 3POUA 2IWWA 4AKRB 2R4LA 1OPFA 4JCHA 2J1NA 2Y0KA 3FYXA 5FVNA 4Z3TA 4JFBA 2X9KA 5D5DA 3HW9A 6PRNA 4PUXA 2JQYA 2F1CX 4KR4A 1GFNA 2XE2A 2XMXA 3PQUA 5GV0A 1ZHXA 5AFUL 4O3WA 3BRYA 4O4UA 1ZHYA 3QRCA 4U9CA 2KDYA 1ZHTA 3K19A 4G76A 2WVPA 3SZDA 3UPGA 3PGUA 1GFOA 3VZWX 2O4VA 3VZTX 1ORMA 1PHOA 4FSPA 5TISO 5GTHO 4O4XA 4F4BA 4C69X 3DA4A 4GHBA 3AA7A 2LHFA 3HOLA 3QRAA 1Q9GA 3NSGA 4FZNA 1ZHWA 2W81C 2Y0LA 4GCQA 3SZVA 2R89A 3AA7B 5B66O 5H2FO 4N58A 5PRNA 3PGRA 2KC0A 3LK3B 2FGQX 5JDPA 5B5EO 3T20A 5G26A 2XTRA 4FUVA 4O3XB 3WI5A 3A0HO 4LSFA 1IZNA 2N2MA 3G7GA 4UB8O 1BXWA 4N75A 3SY7A 2GE4A 3AA0A 1IZNB 3BS0A 3LK42 4RJWA 4UB6O 3AA0B 4CTDA 3DZMA 5GTIO 2Y0HA 3KVDD 2KZ7A 3UAQA 1T1LA 3WU2O 2KZ7B 1MM5A 2PORA 3PF1A 4FZLA 4AZLA 4XNKA 1HXTA 2ZLDA 1GFQA 4GCPA 5G39A 1GFPA 2KXPA 2FGRA 1OSMA 1HXXA 2K4TA 2N2LA 2XE1A 3AAAA 3NJTA 4LSIA 5DL5A 2WJRA 5DL7A 3LK3A 5G3AA 4C00A 2KXPB 4FT6A 4AYNA 3AA1B 3AAAB 3DWNA 3VE2A 4D64A 4FMSA 3TZGA 2J4UP 3AA6A 3JCUO 5AFUK 5ADXK 1G90A 2PRNA 2W80C 1YS5A 2X27X 2Y2XA 2XE3A 3POQA 4KR8A 5DL8A 3AA6B 4O3ZA 5G38A 3VY9X 4AUIA 4FZMA 2YNKA 4QQ1A 7PRNA 1BH3A 1MPFA 1HXUA 2QTKA 4B61A 2XG6A 4K3BA 3RBHA 1QJPA 4FQEA 2XTQA 3WI4A 2ERVA 4AYMC 4KRAA 2R4OA 3KZIO 3PQSA 4AFKA 3DA3A 4E1SA 3T0SA 3HOEA 5ADXL 2OMFA 4RLBA 1QJ9A 1T16A 3A0BO 3EMNX 4G75A 3VZUX 2ZFGA 3T24A 2F1TA 1E54A 5T5FA 4FOZA 2LFUA 3AA1A 5IYUA 4FESA 5DL6A 3SYSA 4C4VA 4AYID 2K0LA 5E79O 4BUMX 4O3YA 3V8UA 3POXA 2ODJA 3SYBA 4C4VB 8PRNA 2F1VA 3C5OA 4RLCA 4GCSA 3GP6A 3HWBA 2Y7SA 1PRNA 4AYEC 3SY9A 4LSHA 3UU2A 4K3CA 2R88A 3VE1A 1QJ8A 3DWOX 3JTYA 3VY8X 2XE5A 3PORA 3PGSA 4GF4A 1GFMA 2JMMA 2R4NA 3LK41 3A2SX 2M07A 3AAEA 3BRZA 3LK2A 1ZHZA 2R8AA 4IL6O 5KAIO 1H6S1 4FSOA 4N74A 3AAEB 2M06A 3LK2B 4FRTA 2MHLA 4PR7A 3O0EA
chains in the Genus database with same CATH topology
4N59A 4RJXA 4AKMA 4RL9A 4E1TA 1BT9A 4XNLA 1Q9FA 5AFUK 4LSEA 4D5UA 1THQA 4AYDC 4O49A 1MM4A 3PRNA 4FRXA 5EE2A 4AKRA 2MNHA 2YPVA 4D65A 1P4TA 3POUA 4AKRB 5FVNA 1OPFA 4JCHA 2J1NA 2Y0KA 3FYXA 4Z3TA 4JFBA 5D5DA 3HW9A 6PRNA 4PUXA 4KR4A 5GV0A 1GFNA 2XMXA 2XE2A 3PQUA 1ZHXA 5AFUL 4O3WA 4O4UA 1ZHYA 3QRCA 4U9CA 2KDYA 1ZHTA 3K19A 4G76A 3SZDA 3UPGA 1GFOA 3VZWX 2O4VA 3VZTX 1ORMA 1PHOA 4FSPA 4O4XA 4F4BA 4C69X 3DA4A 4GHBA 3AA7A 2LHFA 3HOLA 3QRAA 1Q9GA 3NSGA 4FZNA 1ZHWA 2W81C 2Y0LA 4GCQA 3SZVA 3AA7B 4N58A 5PRNA 2KC0A 3LK3B 2FGQX 5JDPA 3T20A 5G26A 2XTRA 4FUVA 4O3XB 3WI5A 4LSFA 1IZNA 2N2MA 3G7GA 1BXWA 3SY7A 2GE4A 3AA0A 1IZNB 3LK42 4RJWA 3AA0B 2Y0HA 3KVDD 2KZ7A 3UAQA 2KZ7B 1MM5A 2PORA 4FZLA 4AZLA 4XNKA 1HXTA 2ZLDA 1GFQA 4GCPA 3SY9A 1GFPA 2KXPA 2FGRA 1OSMA 1HXXA 2K4TA 2N2LA 2XE1A 3AAAA 4LSIA 5DL7A 5DL5A 4AYMC 3LK3A 4D64A 2KXPB 4FT6A 4AYNA 3AA1B 3AAAB 3VE2A 4FMSA 3TZGA 2J4UP 3AA6A 5ADXK 1G90A 2PRNA 2W80C 1YS5A 2X27X 2Y2XA 2XE3A 3POQA 4KR8A 5DL8A 3AA6B 4O3ZA 3VY9X 4AUIA 4FZMA 2YNKA 4QQ1A 7PRNA 1BH3A 1MPFA 1HXUA 2QTKA 4B61A 2XG6A 3RBHA 1QJPA 2XTQA 3WI4A 2ERVA 4KRAA 3PQSA 4AFKA 3DA3A 4E1SA 3T0SA 3HOEA 5ADXL 2OMFA 4RLBA 1QJ9A 3EMNX 4G75A 3VZUX 2ZFGA 3T24A 2F1TA 1E54A 5T5FA 4FOZA 2LFUA 3AA1A 5IYUA 4FESA 5DL6A 3SYSA 4AYID 2K0LA 4BUMX 4O3YA 3V8UA 3POXA 2ODJA 3SYBA 8PRNA 2F1VA 3C5OA 4RLCA 4GCSA 3GP6A 3HWBA 2Y7SA 1PRNA 4AYEC 4LSHA 3UU2A 3VE1A 1QJ8A 3JTYA 3VY8X 2XE5A 3PORA 4GF4A 1GFMA 2JMMA 3LK41 3A2SX 2M07A 3AAEA 3LK2A 1ZHZA 1H6S1 4FSOA 3AAEB 2M06A 3LK2B 4FRTA 2MHLA 3O0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RJX A;  1BT9 A;  4LSE A;  4D5U A;  4FRX A;  3PRN A;  4D65 A;  3POU A;  5FVN A;  1OPF A;  2J1N A;  2Y0K A;  3FYX A;  4JFB A;  3HW9 A;  6PRN A;  4KR4 A;  1GFN A;  2XE2 A;  3K19 A;  3SZD A;  3UPG A;  1GFO A;  3VZW X;  2O4V A;  3VZT X;  1PHO A;  4FSP A;  4C69 X;  3SZV A;  3NSG A;  4GCQ A;  2Y0L A;  5PRN A;  2FGQ X;  5JDP A;  3T20 A;  3WI5 A;  4LSF A;  3SY7 A;  4RJW A;  2Y0H A;  2POR A;  1HXT A;  2ZLD A;  1GFQ A;  4GCP A;  3SY9 A;  1GFP A;  2XE1 A;  2FGR A;  1OSM A;  1HXX A;  2K4T A;  4LSI A;  5DL7 A;  5DL5 A;  4D64 A;  4FT6 A;  4FMS A;  2J4U P;  2PRN A;  2Y2X A;  2XE3 A;  3POQ A;  4KR8 A;  5DL8 A;  3VY9 X;  4AUI A;  7PRN A;  1BH3 A;  1MPF A;  1HXU A;  2QTK A;  2XG6 A;  3WI4 A;  4KRA A;  3T0S A;  2OMF A;  3EMN X;  3VZU X;  2ZFG A;  3T24 A;  1E54 A;  4FOZ A;  3SYS A;  5DL6 A;  4BUM X;  3POX A;  2ODJ A;  3SYB A;  8PRN A;  4GCS A;  3HWB A;  1PRN A;  4LSH A;  3UU2 A;  3JTY A;  3VY8 X;  2XE5 A;  3POR A;  1GFM A;  3A2S X;  1H6S 1;  4FSO A;  4FRT A;  3O0E A; 
#chains in the Genus database with same CATH topology
 4N59 A;  4RJX A;  4AKM A;  4RL9 A;  4E1T A;  1BT9 A;  2R4P A;  1Q9F A;  2WJQ A;  1S5L O;  4LSE A;  4XNL A;  1THQ A;  5KAF O;  2AXT O;  4D5U A;  4AYD C;  4O49 A;  1MM4 A;  3PRN A;  4FRX A;  4PJ0 O;  5EE2 A;  2IWV A;  2MNH A;  2YPV A;  4AKR A;  4D65 A;  1P4T A;  3POU A;  2IWW A;  4AKR B;  2R4L A;  1OPF A;  4JCH A;  2J1N A;  2Y0K A;  3FYX A;  5FVN A;  4Z3T A;  4JFB A;  2X9K A;  5D5D A;  3HW9 A;  6PRN A;  4PUX A;  2JQY A;  2F1C X;  4KR4 A;  1GFN A;  2XE2 A;  2XMX A;  3PQU A;  5GV0 A;  1ZHX A;  5AFU L;  4O3W A;  3BRY A;  4O4U A;  1ZHY A;  3QRC A;  4U9C A;  2KDY A;  1ZHT A;  3K19 A;  4G76 A;  2WVP A;  3SZD A;  3UPG A;  3PGU A;  1GFO A;  3VZW X;  2O4V A;  3VZT X;  1ORM A;  1PHO A;  4FSP A;  5TIS O;  5GTH O;  4O4X A;  4F4B A;  4C69 X;  3DA4 A;  4GHB A;  3AA7 A;  2LHF A;  3HOL A;  3QRA A;  1Q9G A;  3NSG A;  4FZN A;  1ZHW A;  2W81 C;  2Y0L A;  4GCQ A;  3SZV A;  2R89 A;  3AA7 B;  5B66 O;  5H2F O;  4N58 A;  5PRN A;  3PGR A;  2KC0 A;  3LK3 B;  2FGQ X;  5JDP A;  5B5E O;  3T20 A;  5G26 A;  2XTR A;  4FUV A;  4O3X B;  3WI5 A;  3A0H O;  4LSF A;  1IZN A;  2N2M A;  3G7G A;  4UB8 O;  1BXW A;  4N75 A;  3SY7 A;  2GE4 A;  3AA0 A;  1IZN B;  3BS0 A;  3LK4 2;  4RJW A;  4UB6 O;  3AA0 B;  4CTD A;  3DZM A;  5GTI O;  2Y0H A;  3KVD D;  2KZ7 A;  3UAQ A;  1T1L A;  3WU2 O;  2KZ7 B;  1MM5 A;  2POR A;  3PF1 A;  4FZL A;  4AZL A;  4XNK A;  1HXT A;  2ZLD A;  1GFQ A;  4GCP A;  5G39 A;  1GFP A;  2KXP A;  2FGR A;  1OSM A;  1HXX A;  2K4T A;  2N2L A;  2XE1 A;  3AAA A;  3NJT A;  4LSI A;  5DL5 A;  2WJR A;  5DL7 A;  3LK3 A;  5G3A A;  4C00 A;  2KXP B;  4FT6 A;  4AYN A;  3AA1 B;  3AAA B;  3DWN A;  3VE2 A;  4D64 A;  4FMS A;  3TZG A;  2J4U P;  3AA6 A;  3JCU O;  5AFU K;  5ADX K;  1G90 A;  2PRN A;  2W80 C;  1YS5 A;  2X27 X;  2Y2X A;  2XE3 A;  3POQ A;  4KR8 A;  5DL8 A;  3AA6 B;  4O3Z A;  5G38 A;  3VY9 X;  4AUI A;  4FZM A;  2YNK A;  4QQ1 A;  7PRN A;  1BH3 A;  1MPF A;  1HXU A;  2QTK A;  4B61 A;  2XG6 A;  4K3B A;  3RBH A;  1QJP A;  4FQE A;  2XTQ A;  3WI4 A;  2ERV A;  4AYM C;  4KRA A;  2R4O A;  3KZI O;  3PQS A;  4AFK A;  3DA3 A;  4E1S A;  3T0S A;  3HOE A;  5ADX L;  2OMF A;  4RLB A;  1QJ9 A;  1T16 A;  3A0B O;  3EMN X;  4G75 A;  3VZU X;  2ZFG A;  3T24 A;  2F1T A;  1E54 A;  5T5F A;  4FOZ A;  2LFU A;  3AA1 A;  5IYU A;  4FES A;  5DL6 A;  3SYS A;  4C4V A;  4AYI D;  2K0L A;  5E79 O;  4BUM X;  4O3Y A;  3V8U A;  3POX A;  2ODJ A;  3SYB A;  4C4V B;  8PRN A;  2F1V A;  3C5O A;  4RLC A;  4GCS A;  3GP6 A;  3HWB A;  2Y7S A;  1PRN A;  4AYE C;  3SY9 A;  4LSH A;  3UU2 A;  4K3C A;  2R88 A;  3VE1 A;  1QJ8 A;  3DWO X;  3JTY A;  3VY8 X;  2XE5 A;  3POR A;  3PGS A;  4GF4 A;  1GFM A;  2JMM A;  2R4N A;  3LK4 1;  3A2S X;  2M07 A;  3AAE A;  3BRZ A;  3LK2 A;  1ZHZ A;  2R8A A;  4IL6 O;  5KAI O;  1H6S 1;  4FSO A;  4N74 A;  3AAE B;  2M06 A;  3LK2 B;  4FRT A;  2MHL A;  4PR7 A;  3O0E A; 
#chains in the Genus database with same CATH homology
 4N59 A;  4RJX A;  4AKM A;  4RL9 A;  4E1T A;  1BT9 A;  4XNL A;  1Q9F A;  5AFU K;  4LSE A;  4D5U A;  1THQ A;  4AYD C;  4O49 A;  1MM4 A;  3PRN A;  4FRX A;  5EE2 A;  4AKR A;  2MNH A;  2YPV A;  4D65 A;  1P4T A;  3POU A;  4AKR B;  5FVN A;  1OPF A;  4JCH A;  2J1N A;  2Y0K A;  3FYX A;  4Z3T A;  4JFB A;  5D5D A;  3HW9 A;  6PRN A;  4PUX A;  4KR4 A;  5GV0 A;  1GFN A;  2XMX A;  2XE2 A;  3PQU A;  1ZHX A;  5AFU L;  4O3W A;  4O4U A;  1ZHY A;  3QRC A;  4U9C A;  2KDY A;  1ZHT A;  3K19 A;  4G76 A;  3SZD A;  3UPG A;  1GFO A;  3VZW X;  2O4V A;  3VZT X;  1ORM A;  1PHO A;  4FSP A;  4O4X A;  4F4B A;  4C69 X;  3DA4 A;  4GHB A;  3AA7 A;  2LHF A;  3HOL A;  3QRA A;  1Q9G A;  3NSG A;  4FZN A;  1ZHW A;  2W81 C;  2Y0L A;  4GCQ A;  3SZV A;  3AA7 B;  4N58 A;  5PRN A;  2KC0 A;  3LK3 B;  2FGQ X;  5JDP A;  3T20 A;  5G26 A;  2XTR A;  4FUV A;  4O3X B;  3WI5 A;  4LSF A;  1IZN A;  2N2M A;  3G7G A;  1BXW A;  3SY7 A;  2GE4 A;  3AA0 A;  1IZN B;  3LK4 2;  4RJW A;  3AA0 B;  2Y0H A;  3KVD D;  2KZ7 A;  3UAQ A;  2KZ7 B;  1MM5 A;  2POR A;  4FZL A;  4AZL A;  4XNK A;  1HXT A;  2ZLD A;  1GFQ A;  4GCP A;  3SY9 A;  1GFP A;  2KXP A;  2FGR A;  1OSM A;  1HXX A;  2K4T A;  2N2L A;  2XE1 A;  3AAA A;  4LSI A;  5DL7 A;  5DL5 A;  4AYM C;  3LK3 A;  4D64 A;  2KXP B;  4FT6 A;  4AYN A;  3AA1 B;  3AAA B;  3VE2 A;  4FMS A;  3TZG A;  2J4U P;  3AA6 A;  5ADX K;  1G90 A;  2PRN A;  2W80 C;  1YS5 A;  2X27 X;  2Y2X A;  2XE3 A;  3POQ A;  4KR8 A;  5DL8 A;  3AA6 B;  4O3Z A;  3VY9 X;  4AUI A;  4FZM A;  2YNK A;  4QQ1 A;  7PRN A;  1BH3 A;  1MPF A;  1HXU A;  2QTK A;  4B61 A;  2XG6 A;  3RBH A;  1QJP A;  2XTQ A;  3WI4 A;  2ERV A;  4KRA A;  3PQS A;  4AFK A;  3DA3 A;  4E1S A;  3T0S A;  3HOE A;  5ADX L;  2OMF A;  4RLB A;  1QJ9 A;  3EMN X;  4G75 A;  3VZU X;  2ZFG A;  3T24 A;  2F1T A;  1E54 A;  5T5F A;  4FOZ A;  2LFU A;  3AA1 A;  5IYU A;  4FES A;  5DL6 A;  3SYS A;  4AYI D;  2K0L A;  4BUM X;  4O3Y A;  3V8U A;  3POX A;  2ODJ A;  3SYB A;  8PRN A;  2F1V A;  3C5O A;  4RLC A;  4GCS A;  3GP6 A;  3HWB A;  2Y7S A;  1PRN A;  4AYE C;  4LSH A;  3UU2 A;  3VE1 A;  1QJ8 A;  3JTY A;  3VY8 X;  2XE5 A;  3POR A;  4GF4 A;  1GFM A;  2JMM A;  3LK4 1;  3A2S X;  2M07 A;  3AAE A;  3LK2 A;  1ZHZ A;  1H6S 1;  4FSO A;  3AAE B;  2M06 A;  3LK2 B;  4FRT A;  2MHL A;  3O0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...