1GFOA

Ompf porin (mutant r132p)
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGPVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of OmpF porin mutants selected for larger pore size. I. Crystallographic analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transmembrane protein
molecule keywords MATRIX PORIN OUTER MEMBRANE PROTEIN F
total genus 104
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 1996-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1gfoA00
3VY8X 2FGQX 3SY7A 4GCQA 3FYXA 4FMSA 2PRNA 5FVNA 4FT6A 3A2SX 1GFPA 5DL8A 1MPFA 3POUA 3VZWX 3SZVA 2Y0LA 3WI5A 4LSIA 2ODJA 4JFBA 4KR4A 3PRNA 1PRNA 4LSFA 3PORA 3UPGA 1HXXA 2Y2XA 3VY9X 4RJXA 4FRTA 3POXA 3T24A 4GCSA 4FSPA 5PRNA 4FOZA 2OMFA 4D64A 1GFQA 1OPFA 7PRNA 3NSGA 4FSOA 2XE2A 2O4VA 1E54A 1GFNA 2Y0HA 5DL7A 2XE3A 4C69X 5JDPA 3EMNX 3VZUX 4KR8A 4LSEA 1HXUA 4D65A 3HWBA 3JTYA 3T0SA 2PORA 5DL5A 2K4TA 5DL6A 3SY9A 4GCPA 3VZTX 1GFOA 2XG6A 3POQA 2ZFGA 2ZLDA 1H6S1 4LSHA 2FGRA 4D5UA 2QTKA 2J4UP 3O0EA 2XE5A 3WI4A 4AUIA 3T20A 3HW9A 1OSMA 2XE1A 4KRAA 4FRXA 3K19A 1BT9A 8PRNA 3SYBA 4BUMX 6PRNA 3SYSA 3UU2A 1HXTA 2J1NA 4RJWA 1BH3A 2Y0KA 1PHOA 3SZDA 1GFMA
chains in the Genus database with same CATH superfamily
3AAEB 3LK2B 4IL6O 1ZHZA 3LK2A 3VY8X 4AYNA 4CTDA 2FGQX 5G26A 3SY7A 5AFUL 3G7GA 4E1TA 4FZNA 4RLCA 4GCQA 3FYXA 2KDYA 2N2LA 3BRZA 2PRNA 4FMSA 4G76A 5FVNA 4FT6A 1T16A 3A2SX 4O3WA 4GHBA 1GFPA 1Q9GA 2X27X 1MPFA 5DL8A 4C00A 5TISO 1MM5A 3AA6B 2X9KA 3POUA 3VZWX 3SZVA 2YPVA 5GV0A 2Y0LA 3QRAA 3WI5A 2W81C 3DA3A 4LSIA 2ODJA 4JFBA 2WJRA 2F1VA 4KR4A 3RBHA 3UAQA 1MM4A 3NJTA 3PRNA 4U9CA 1P4TA 1PRNA 4UB6O 5G3AA 3V8UA 3LK41 3BS0A 3QRCA 4LSFA 4O3XB 3PORA 4N58A 2XTRA 1ZHWA 3PQUA 4O49A 4PR7A 3UPGA 1HXXA 5AFUK 2R4OA 2Y2XA 3PGUA 4O3ZA 2KXPB 2XTQA 2KXPA 3VY9X 4C4VA 4JCHA 2ERVA 3DWNA 3PGRA 4G75A 2R4NA 3AAEA 4PUXA 4RJXA 4FRTA 1QJPA 3SZDA 2Y7SA 5D5DA 2R89A 3POXA 4O3YA 3C5OA 3LK3A 5IYUA 2R4LA 3PQSA 3T24A 3A0BO 4GCSA 3KZIO 1IZNB 1ZHTA 4FSPA 2K0LA 5PRNA 2R4PA 4AYDC 5ADXK 4FESA 4FOZA 4AYID 2OMFA 4D64A 1GFQA 1OPFA 4XNKA 2R88A 5G39A 7PRNA 4UB8O 3GP6A 3PGSA 4K3CA 4AKRA 1ORMA 1S5LO 3NSGA 4C4VB 4FZLA 5G38A 4FSOA 2XE2A 4RL9A 1T1LA 2O4VA 4N59A 1E54A 1GFNA 2Y0HA 3DZMA 5DL7A 5ADXL 2XE3A 3AAAB 4C69X 3DA4A 4AKRB 5JDPA 2GE4A 2YNKA 3AA1A 3AA1B 4N74A 5E79O 2M06A 3EMNX 5T5FA 5KAFO 4RLBA 3VZUX 5GTHO 4KR8A 4FUVA 2MHLA 2M07A 2WVPA 2IWVA 3LK3B 4LSEA 1HXUA 4D65A 4F4BA 3AA7B 4FZMA 2IWWA 4B61A 3HWBA 3A0HO 1THQA 3JTYA 2PORA 5DL5A 3T0SA 2K4TA 5DL6A 2LFUA 3AA7A 3SY9A 4AFKA 4AYMC 3LK42 4GCPA 3VZTX 2LHFA 4N75A 5B66O 1GFOA 2KC0A 2XG6A 3PF1A 3POQA 4AYEC 2ZFGA 4Z3TA 2ZLDA 3AAAA 3JCUO 4GF4A 4O4XA 2AXTO 4PJ0O 1H6S1 3WU2O 4AZLA 2KZ7A 3DWOX 4LSHA 2FGRA 4FQEA 4D5UA 2F1CX 2QTKA 3O0EA 5KAIO 2J4UP 5GTIO 3TZGA 2XE5A 3HOLA 3WI4A 4AUIA 3T20A 5EE2A 3HW9A 1OSMA 1ZHXA 4XNLA 2WJQA 3VE2A 2XE1A 4QQ1A 4KRAA 4FRXA 3K19A 1BT9A 3VE1A 8PRNA 3BRYA 3AA0A 3SYBA 3AA0B 1Q9FA 3HOEA 3AA6A 2XMXA 4BUMX 4AKMA 4E1SA 6PRNA 1BXWA 2F1TA 2JQYA 1QJ9A 2MNHA 1ZHYA 2W80C 3SYSA 3UU2A 5B5EO 1G90A 1HXTA 2N2MA 2J1NA 1GFMA 5H2FO 4O4UA 4RJWA 3KVDD 4K3BA 1BH3A 1YS5A 2Y0KA 2KZ7B 1QJ8A 1PHOA 2R8AA 2JMMA 1IZNA
chains in the Genus database with same CATH topology
3AAEB 3LK2B 1ZHZA 3LK2A 3VY8X 4AYNA 2FGQX 5G26A 3SY7A 5AFUL 3G7GA 4E1TA 4FZNA 4RLCA 4GCQA 3FYXA 2KDYA 2N2LA 4FMSA 2PRNA 5FVNA 4G76A 4FT6A 3A2SX 4O3WA 4GHBA 1GFPA 1Q9GA 2X27X 1MPFA 5DL8A 1MM5A 3AA6B 3POUA 3VZWX 3SZVA 2YPVA 5GV0A 2Y0LA 3QRAA 3WI5A 2W81C 3DA3A 4LSIA 2ODJA 4JFBA 2F1VA 4KR4A 3RBHA 3UAQA 1MM4A 3PRNA 4U9CA 1P4TA 1PRNA 3V8UA 3LK41 3QRCA 4LSFA 4O3XB 3PORA 4N58A 2XTRA 1ZHWA 3PQUA 4O49A 3UPGA 1HXXA 5AFUK 2Y2XA 4O3ZA 2KXPB 2XTQA 2KXPA 3VY9X 4JCHA 2ERVA 4G75A 3AAEA 4PUXA 4RJXA 4FRTA 1QJPA 3SZDA 2Y7SA 5D5DA 3POXA 4O3YA 3C5OA 3LK3A 5IYUA 3PQSA 3T24A 4GCSA 1IZNB 1ZHTA 4FSPA 2K0LA 5PRNA 4AYDC 5ADXK 4FESA 4FOZA 4AYID 2OMFA 4D64A 1GFQA 1OPFA 4XNKA 7PRNA 4AKRA 3GP6A 1ORMA 3NSGA 4FZLA 4FSOA 2XE2A 4RL9A 2O4VA 4N59A 1E54A 1GFNA 2Y0HA 5DL7A 5ADXL 2XE3A 3AAAB 4C69X 3DA4A 4AKRB 5JDPA 2GE4A 2YNKA 3AA1A 3AA1B 2M06A 3EMNX 5T5FA 4RLBA 3VZUX 4KR8A 4FUVA 2MHLA 2M07A 3LK3B 4LSEA 1HXUA 4D65A 4F4BA 4FZMA 4B61A 3HWBA 1THQA 3JTYA 2PORA 5DL5A 3T0SA 2K4TA 5DL6A 2LFUA 3AA7A 3SY9A 4AFKA 4AYMC 3LK42 4GCPA 3VZTX 2LHFA 1GFOA 2KC0A 2XG6A 4AYEC 3POQA 2ZFGA 4Z3TA 2ZLDA 3AAAA 4GF4A 4O4XA 4AZLA 1H6S1 2KZ7A 4LSHA 2FGRA 4D5UA 2QTKA 2J4UP 3O0EA 3TZGA 2XE5A 3HOLA 3WI4A 4AUIA 3T20A 5EE2A 3HW9A 1OSMA 1ZHXA 4XNLA 3VE2A 2XE1A 4QQ1A 4KRAA 4FRXA 3K19A 1BT9A 3VE1A 8PRNA 3AA0A 3SYBA 3AA0B 1Q9FA 3HOEA 3AA6A 2XMXA 4BUMX 4AKMA 4E1SA 6PRNA 1BXWA 2F1TA 1QJ9A 2MNHA 1ZHYA 2W80C 3SYSA 3UU2A 1G90A 1HXTA 2N2MA 2J1NA 1GFMA 4O4UA 4RJWA 3KVDD 1BH3A 1YS5A 2Y0KA 2KZ7B 1QJ8A 1PHOA 3AA7B 2JMMA 1IZNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VY8 X;  2FGQ X;  3SY7 A;  4GCQ A;  3FYX A;  4FMS A;  2PRN A;  5FVN A;  4FT6 A;  3A2S X;  1GFP A;  5DL8 A;  1MPF A;  3POU A;  3VZW X;  3SZV A;  2Y0L A;  3WI5 A;  4LSI A;  2ODJ A;  4JFB A;  4KR4 A;  3PRN A;  1PRN A;  4LSF A;  3POR A;  3UPG A;  1HXX A;  2Y2X A;  3VY9 X;  4RJX A;  4FRT A;  3POX A;  3T24 A;  4GCS A;  4FSP A;  5PRN A;  4FOZ A;  2OMF A;  4D64 A;  1GFQ A;  1OPF A;  7PRN A;  3NSG A;  4FSO A;  2XE2 A;  2O4V A;  1E54 A;  1GFN A;  2Y0H A;  5DL7 A;  2XE3 A;  4C69 X;  5JDP A;  3EMN X;  3VZU X;  4KR8 A;  4LSE A;  1HXU A;  4D65 A;  3HWB A;  3JTY A;  3T0S A;  2POR A;  5DL5 A;  2K4T A;  5DL6 A;  3SY9 A;  4GCP A;  3VZT X;  1GFO A;  2XG6 A;  3POQ A;  2ZFG A;  2ZLD A;  1H6S 1;  4LSH A;  2FGR A;  4D5U A;  2QTK A;  2J4U P;  3O0E A;  2XE5 A;  3WI4 A;  4AUI A;  3T20 A;  3HW9 A;  1OSM A;  2XE1 A;  4KRA A;  4FRX A;  3K19 A;  1BT9 A;  8PRN A;  3SYB A;  4BUM X;  6PRN A;  3SYS A;  3UU2 A;  1HXT A;  2J1N A;  4RJW A;  1BH3 A;  2Y0K A;  1PHO A;  3SZD A;  1GFM A; 
#chains in the Genus database with same CATH topology
 3AAE B;  3LK2 B;  4IL6 O;  1ZHZ A;  3LK2 A;  3VY8 X;  4AYN A;  4CTD A;  2FGQ X;  5G26 A;  3SY7 A;  5AFU L;  3G7G A;  4E1T A;  4FZN A;  4RLC A;  4GCQ A;  3FYX A;  2KDY A;  2N2L A;  3BRZ A;  2PRN A;  4FMS A;  4G76 A;  5FVN A;  4FT6 A;  1T16 A;  3A2S X;  4O3W A;  4GHB A;  1GFP A;  1Q9G A;  2X27 X;  1MPF A;  5DL8 A;  4C00 A;  5TIS O;  1MM5 A;  3AA6 B;  2X9K A;  3POU A;  3VZW X;  3SZV A;  2YPV A;  5GV0 A;  2Y0L A;  3QRA A;  3WI5 A;  2W81 C;  3DA3 A;  4LSI A;  2ODJ A;  4JFB A;  2WJR A;  2F1V A;  4KR4 A;  3RBH A;  3UAQ A;  1MM4 A;  3NJT A;  3PRN A;  4U9C A;  1P4T A;  1PRN A;  4UB6 O;  5G3A A;  3V8U A;  3LK4 1;  3BS0 A;  3QRC A;  4LSF A;  4O3X B;  3POR A;  4N58 A;  2XTR A;  1ZHW A;  3PQU A;  4O49 A;  4PR7 A;  3UPG A;  1HXX A;  5AFU K;  2R4O A;  2Y2X A;  3PGU A;  4O3Z A;  2KXP B;  2XTQ A;  2KXP A;  3VY9 X;  4C4V A;  4JCH A;  2ERV A;  3DWN A;  3PGR A;  4G75 A;  2R4N A;  3AAE A;  4PUX A;  4RJX A;  4FRT A;  1QJP A;  3SZD A;  2Y7S A;  5D5D A;  2R89 A;  3POX A;  4O3Y A;  3C5O A;  3LK3 A;  5IYU A;  2R4L A;  3PQS A;  3T24 A;  3A0B O;  4GCS A;  3KZI O;  1IZN B;  1ZHT A;  4FSP A;  2K0L A;  5PRN A;  2R4P A;  4AYD C;  5ADX K;  4FES A;  4FOZ A;  4AYI D;  2OMF A;  4D64 A;  1GFQ A;  1OPF A;  4XNK A;  2R88 A;  5G39 A;  7PRN A;  4UB8 O;  3GP6 A;  3PGS A;  4K3C A;  4AKR A;  1ORM A;  1S5L O;  3NSG A;  4C4V B;  4FZL A;  5G38 A;  4FSO A;  2XE2 A;  4RL9 A;  1T1L A;  2O4V A;  4N59 A;  1E54 A;  1GFN A;  2Y0H A;  3DZM A;  5DL7 A;  5ADX L;  2XE3 A;  3AAA B;  4C69 X;  3DA4 A;  4AKR B;  5JDP A;  2GE4 A;  2YNK A;  3AA1 A;  3AA1 B;  4N74 A;  5E79 O;  2M06 A;  3EMN X;  5T5F A;  5KAF O;  4RLB A;  3VZU X;  5GTH O;  4KR8 A;  4FUV A;  2MHL A;  2M07 A;  2WVP A;  2IWV A;  3LK3 B;  4LSE A;  1HXU A;  4D65 A;  4F4B A;  3AA7 B;  4FZM A;  2IWW A;  4B61 A;  3HWB A;  3A0H O;  1THQ A;  3JTY A;  2POR A;  5DL5 A;  3T0S A;  2K4T A;  5DL6 A;  2LFU A;  3AA7 A;  3SY9 A;  4AFK A;  4AYM C;  3LK4 2;  4GCP A;  3VZT X;  2LHF A;  4N75 A;  5B66 O;  1GFO A;  2KC0 A;  2XG6 A;  3PF1 A;  3POQ A;  4AYE C;  2ZFG A;  4Z3T A;  2ZLD A;  3AAA A;  3JCU O;  4GF4 A;  4O4X A;  2AXT O;  4PJ0 O;  1H6S 1;  3WU2 O;  4AZL A;  2KZ7 A;  3DWO X;  4LSH A;  2FGR A;  4FQE A;  4D5U A;  2F1C X;  2QTK A;  3O0E A;  5KAI O;  2J4U P;  5GTI O;  3TZG A;  2XE5 A;  3HOL A;  3WI4 A;  4AUI A;  3T20 A;  5EE2 A;  3HW9 A;  1OSM A;  1ZHX A;  4XNL A;  2WJQ A;  3VE2 A;  2XE1 A;  4QQ1 A;  4KRA A;  4FRX A;  3K19 A;  1BT9 A;  3VE1 A;  8PRN A;  3BRY A;  3AA0 A;  3SYB A;  3AA0 B;  1Q9F A;  3HOE A;  3AA6 A;  2XMX A;  4BUM X;  4AKM A;  4E1S A;  6PRN A;  1BXW A;  2F1T A;  2JQY A;  1QJ9 A;  2MNH A;  1ZHY A;  2W80 C;  3SYS A;  3UU2 A;  5B5E O;  1G90 A;  1HXT A;  2N2M A;  2J1N A;  1GFM A;  5H2F O;  4O4U A;  4RJW A;  3KVD D;  4K3B A;  1BH3 A;  1YS5 A;  2Y0K A;  2KZ7 B;  1QJ8 A;  1PHO A;  2R8A A;  2JMM A;  1IZN A; 
#chains in the Genus database with same CATH homology
 3AAE B;  3LK2 B;  1ZHZ A;  3LK2 A;  3VY8 X;  4AYN A;  2FGQ X;  5G26 A;  3SY7 A;  5AFU L;  3G7G A;  4E1T A;  4FZN A;  4RLC A;  4GCQ A;  3FYX A;  2KDY A;  2N2L A;  4FMS A;  2PRN A;  5FVN A;  4G76 A;  4FT6 A;  3A2S X;  4O3W A;  4GHB A;  1GFP A;  1Q9G A;  2X27 X;  1MPF A;  5DL8 A;  1MM5 A;  3AA6 B;  3POU A;  3VZW X;  3SZV A;  2YPV A;  5GV0 A;  2Y0L A;  3QRA A;  3WI5 A;  2W81 C;  3DA3 A;  4LSI A;  2ODJ A;  4JFB A;  2F1V A;  4KR4 A;  3RBH A;  3UAQ A;  1MM4 A;  3PRN A;  4U9C A;  1P4T A;  1PRN A;  3V8U A;  3LK4 1;  3QRC A;  4LSF A;  4O3X B;  3POR A;  4N58 A;  2XTR A;  1ZHW A;  3PQU A;  4O49 A;  3UPG A;  1HXX A;  5AFU K;  2Y2X A;  4O3Z A;  2KXP B;  2XTQ A;  2KXP A;  3VY9 X;  4JCH A;  2ERV A;  4G75 A;  3AAE A;  4PUX A;  4RJX A;  4FRT A;  1QJP A;  3SZD A;  2Y7S A;  5D5D A;  3POX A;  4O3Y A;  3C5O A;  3LK3 A;  5IYU A;  3PQS A;  3T24 A;  4GCS A;  1IZN B;  1ZHT A;  4FSP A;  2K0L A;  5PRN A;  4AYD C;  5ADX K;  4FES A;  4FOZ A;  4AYI D;  2OMF A;  4D64 A;  1GFQ A;  1OPF A;  4XNK A;  7PRN A;  4AKR A;  3GP6 A;  1ORM A;  3NSG A;  4FZL A;  4FSO A;  2XE2 A;  4RL9 A;  2O4V A;  4N59 A;  1E54 A;  1GFN A;  2Y0H A;  5DL7 A;  5ADX L;  2XE3 A;  3AAA B;  4C69 X;  3DA4 A;  4AKR B;  5JDP A;  2GE4 A;  2YNK A;  3AA1 A;  3AA1 B;  2M06 A;  3EMN X;  5T5F A;  4RLB A;  3VZU X;  4KR8 A;  4FUV A;  2MHL A;  2M07 A;  3LK3 B;  4LSE A;  1HXU A;  4D65 A;  4F4B A;  4FZM A;  4B61 A;  3HWB A;  1THQ A;  3JTY A;  2POR A;  5DL5 A;  3T0S A;  2K4T A;  5DL6 A;  2LFU A;  3AA7 A;  3SY9 A;  4AFK A;  4AYM C;  3LK4 2;  4GCP A;  3VZT X;  2LHF A;  1GFO A;  2KC0 A;  2XG6 A;  4AYE C;  3POQ A;  2ZFG A;  4Z3T A;  2ZLD A;  3AAA A;  4GF4 A;  4O4X A;  4AZL A;  1H6S 1;  2KZ7 A;  4LSH A;  2FGR A;  4D5U A;  2QTK A;  2J4U P;  3O0E A;  3TZG A;  2XE5 A;  3HOL A;  3WI4 A;  4AUI A;  3T20 A;  5EE2 A;  3HW9 A;  1OSM A;  1ZHX A;  4XNL A;  3VE2 A;  2XE1 A;  4QQ1 A;  4KRA A;  4FRX A;  3K19 A;  1BT9 A;  3VE1 A;  8PRN A;  3AA0 A;  3SYB A;  3AA0 B;  1Q9F A;  3HOE A;  3AA6 A;  2XMX A;  4BUM X;  4AKM A;  4E1S A;  6PRN A;  1BXW A;  2F1T A;  1QJ9 A;  2MNH A;  1ZHY A;  2W80 C;  3SYS A;  3UU2 A;  1G90 A;  1HXT A;  2N2M A;  2J1N A;  1GFM A;  4O4U A;  4RJW A;  3KVD D;  1BH3 A;  1YS5 A;  2Y0K A;  2KZ7 B;  1QJ8 A;  1PHO A;  3AA7 B;  2JMM A;  1IZN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...