1GFOA

Ompf porin (mutant r132p)
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGPVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX PORIN OUTER MEMBRANE PROTEIN F
publication title Structural and functional characterization of OmpF porin mutants selected for larger pore size. I. Crystallographic analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transmembrane protein
total genus 104
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 1996-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1gfoA00
3T0SA 3EMNX 3POQA 1PHOA 3PRNA 4D64A 4FT6A 1OPFA 1BT9A 1GFMA 2J1NA 1E54A 4AUIA 5DL6A 2OMFA 4FSPA 2Y0HA 5JDPA 3SYBA 1H6S1 2XE2A 2ZLDA 3FYXA 2QTKA 5FVNA 4KRAA 4FRXA 1MPFA 8PRNA 1HXUA 2J4UP 3HWBA 4KR8A 3PORA 3UU2A 4FMSA 4GCQA 4GCPA 2ZFGA 4D65A 4D5UA 3POXA 5DL5A 1PRNA 3O0EA 4RJWA 1OSMA 2XE5A 1GFPA 2K4TA 2XG6A 3WI5A 4JFBA 3VZUX 4LSFA 3NSGA 1GFNA 3WI4A 4KR4A 3T20A 2PORA 5PRNA 1GFOA 1BH3A 2FGQX 3T24A 2O4VA 2Y2XA 4RJXA 4C69X 3UPGA 1HXXA 3VY9X 5DL7A 3A2SX 3SZDA 3VY8X 4FRTA 3SY9A 1GFQA 2XE1A 1HXTA 4FSOA 2ODJA 3SZVA 3VZWX 6PRNA 3POUA 2Y0KA 4BUMX 4LSIA 4LSEA 3JTYA 3SYSA 2Y0LA 2FGRA 3HW9A 3VZTX 4LSHA 5DL8A 2PRNA 3K19A 4FOZA 7PRNA 4GCSA 3SY7A 2XE3A
chains in the Genus database with same CATH superfamily
2R4PA 4FZLA 3UAQA 3T0SA 4FZNA 3EMNX 3POQA 1PHOA 1ZHYA 3PRNA 4D64A 5G38A 4C00A 4JCHA 1THQA 4O4XA 4AKRB 4IL6O 4FT6A 1YS5A 3PQSA 1OPFA 2M06A 1BT9A 3AAAB 4AKMA 1GFMA 2J1NA 2WJQA 2Y7SA 4O3XB 4CTDA 1E54A 1ORMA 2YPVA 2KXPB 4PUXA 4UB8O 4AUIA 2ERVA 2R4LA 2MHLA 3DA4A 5DL6A 2OMFA 4FSPA 5E79O 2F1VA 4AYMC 2Y0HA 5JDPA 3NJTA 4N59A 3AA6B 5KAFO 3SYBA 2F1CX 3AA1A 3TZGA 5ADXK 1H6S1 3PGUA 2R89A 2W80C 2XE2A 5G26A 2ZLDA 2R8AA 4AYNA 3FYXA 2QTKA 5FVNA 3HOLA 3KVDD 3LK3B 4FRXA 4KRAA 1MPFA 4O4UA 5D5DA 4BUMX 3C5OA 8PRNA 1HXUA 2KZ7A 2J4UP 2JQYA 2N2MA 3HWBA 5GTIO 4AYDC 2M07A 4KR8A 3PORA 4UB6O 3DZMA 4GHBA 3PQUA 4O49A 4FESA 3UU2A 1BXWA 4FMSA 4GCQA 4GCPA 3A0HO 2YNKA 4AKRA 5AFUL 2F1TA 2ZFGA 2MNHA 4C4VB 5B5EO 4D65A 4AYEC 4D5UA 3AAAA 2KDYA 2WJRA 4XNLA 3POXA 4N75A 1PRNA 3AA0B 1P4TA 3BS0A 3O0EA 5DL5A 4RJWA 3PGRA 4AYID 1QJ8A 1OSMA 2XE5A 2KXPA 3BRZA 1GFPA 2IWVA 2K4TA 2XG6A 4FUVA 4G75A 4O3ZA 4U9CA 2R88A 3LK42 3VE1A 3WI5A 4JFBA 2R4OA 5T5FA 3VZUX 4AFKA 4K3CA 4LSFA 2JMMA 3AA6A 4RL9A 1QJPA 4RLCA 1S5LO 2W81C 4G76A 1MM4A 3NSGA 4XNKA 1GFNA 1ZHXA 3WI4A 4PJ0O 3BRYA 4E1TA 4KR4A 1ZHWA 5G3AA 3T20A 4GF4A 2PORA 3LK3A 3VE2A 1Q9GA 2LHFA 2XTQA 3A0BO 5EE2A 5PRNA 4O3YA 3V8UA 5GTHO 1ZHZA 1GFOA 2XMXA 1BH3A 3G7GA 3QRAA 3AA7B 4N74A 2FGQX 4QQ1A 2AXTO 3T24A 3WU2O 5IYUA 2O4VA 2Y2XA 4RJXA 1MM5A 1ZHTA 1HXXA 3VY9X 2R4NA 4C69X 4E1SA 3UPGA 5DL7A 3A2SX 4N58A 5KAIO 3SZDA 2IWWA 3VY8X 4FRTA 3SY9A 1GFQA 1Q9FA 2XE1A 3AA7A 5AFUK 4C4VA 1HXTA 4FSOA 2ODJA 2XTRA 4O3WA 5G39A 3DWOX 3LK2B 3LK41 4F4BA 1IZNB 3SZVA 5H2FO 3AA0A 3VZWX 3RBHA 3QRCA 1G90A 4AZLA 6PRNA 2WVPA 3POUA 1T16A 1T1LA 2LFUA 2Y0KA 4FQEA 4LSIA 3JTYA 3LK2A 2Y0LA 1IZNA 4LSEA 4PR7A 5TISO 3SYSA 2FGRA 3HW9A 2X9KA 4RLBA 3VZTX 1QJ9A 4K3BA 3AA1B 2K0LA 4FZMA 4LSHA 5ADXL 5B66O 3AAEB 5DL8A 4Z3TA 5GV0A 2N2LA 3PF1A 3KZIO 2GE4A 2PRNA 3DA3A 3JCUO 3PGSA 3K19A 4FOZA 7PRNA 3HOEA 4GCSA 2KC0A 2KZ7B 2X27X 3AAEA 3DWNA 3SY7A 3GP6A 2XE3A 4B61A
chains in the Genus database with same CATH topology
4FZLA 3UAQA 3T0SA 4FZNA 3EMNX 3POQA 1PHOA 1ZHYA 3PRNA 4D64A 4JCHA 1THQA 4O4XA 4AKRB 4FT6A 1YS5A 3PQSA 1OPFA 2M06A 1BT9A 3AAAB 4AKMA 1GFMA 2J1NA 2Y7SA 4O3XB 1E54A 1ORMA 2YPVA 2KXPB 4PUXA 4AUIA 2ERVA 2MHLA 3DA4A 5DL6A 2OMFA 4FSPA 4AYMC 2F1VA 2Y0HA 5JDPA 4N59A 3AA6B 3SYBA 3TZGA 3AA1A 5ADXK 1H6S1 5G26A 2XE2A 2W80C 4AYNA 2ZLDA 3FYXA 2QTKA 5FVNA 3HOLA 3KVDD 3LK3B 4FRXA 4KRAA 1MPFA 4O4UA 5D5DA 8PRNA 3C5OA 1HXUA 2KZ7A 2J4UP 2N2MA 3HWBA 4AYDC 2M07A 4KR8A 3PORA 4GHBA 3PQUA 4O49A 4FESA 3UU2A 1BXWA 4FMSA 4GCQA 4GCPA 5AFUL 2YNKA 4AKRA 2F1TA 2ZFGA 2MNHA 4D65A 4AYEC 4D5UA 3AAAA 2KDYA 4XNLA 3POXA 5DL5A 1PRNA 3AA0B 1P4TA 3O0EA 4RJWA 4AYID 1QJ8A 2XE5A 1OSMA 2KXPA 4FUVA 1GFPA 2K4TA 2XG6A 4G75A 3VE1A 4O3ZA 4U9CA 3LK42 3WI5A 4JFBA 5T5FA 3VZUX 4AFKA 4LSFA 4RL9A 2JMMA 3AA6A 1QJPA 4RLCA 2W81C 4G76A 1MM4A 3NSGA 4XNKA 1GFNA 1ZHXA 3WI4A 4E1TA 4KR4A 1ZHWA 3T20A 4GF4A 2PORA 3LK3A 3VE2A 1Q9GA 2LHFA 2XTQA 5PRNA 5EE2A 3V8UA 4O3YA 1ZHZA 1GFOA 2XMXA 1BH3A 3G7GA 3QRAA 3AA7B 4QQ1A 2FGQX 3T24A 5IYUA 2O4VA 2Y2XA 4RJXA 1MM5A 1ZHTA 1HXXA 3VY9X 4C69X 4E1SA 3UPGA 5DL7A 3A2SX 4N58A 3SZDA 3VY8X 4FRTA 3SY9A 1GFQA 1Q9FA 2XE1A 3AA7A 5AFUK 1HXTA 4FSOA 2ODJA 2XTRA 4O3WA 3LK2B 3LK41 4F4BA 1IZNB 3SZVA 3AA0A 3VZWX 3RBHA 3QRCA 1G90A 4AZLA 6PRNA 3POUA 2LFUA 2Y0KA 4BUMX 4LSIA 4LSEA 3JTYA 3LK2A 2Y0LA 1IZNA 3SYSA 4B61A 2FGRA 3HW9A 4RLBA 3VZTX 1QJ9A 5ADXL 3AA1B 2K0LA 4FZMA 4LSHA 3AAEB 5DL8A 4Z3TA 5GV0A 2N2LA 2GE4A 2PRNA 3DA3A 3K19A 4FOZA 7PRNA 3HOEA 4GCSA 2KC0A 2KZ7B 2X27X 3AAEA 3SY7A 3GP6A 2XE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T0S A;  3EMN X;  3POQ A;  1PHO A;  3PRN A;  4D64 A;  4FT6 A;  1OPF A;  1BT9 A;  1GFM A;  2J1N A;  1E54 A;  4AUI A;  5DL6 A;  2OMF A;  4FSP A;  2Y0H A;  5JDP A;  3SYB A;  1H6S 1;  2XE2 A;  2ZLD A;  3FYX A;  2QTK A;  5FVN A;  4KRA A;  4FRX A;  1MPF A;  8PRN A;  1HXU A;  2J4U P;  3HWB A;  4KR8 A;  3POR A;  3UU2 A;  4FMS A;  4GCQ A;  4GCP A;  2ZFG A;  4D65 A;  4D5U A;  3POX A;  5DL5 A;  1PRN A;  3O0E A;  4RJW A;  1OSM A;  2XE5 A;  1GFP A;  2K4T A;  2XG6 A;  3WI5 A;  4JFB A;  3VZU X;  4LSF A;  3NSG A;  1GFN A;  3WI4 A;  4KR4 A;  3T20 A;  2POR A;  5PRN A;  1GFO A;  1BH3 A;  2FGQ X;  3T24 A;  2O4V A;  2Y2X A;  4RJX A;  4C69 X;  3UPG A;  1HXX A;  3VY9 X;  5DL7 A;  3A2S X;  3SZD A;  3VY8 X;  4FRT A;  3SY9 A;  1GFQ A;  2XE1 A;  1HXT A;  4FSO A;  2ODJ A;  3SZV A;  3VZW X;  6PRN A;  3POU A;  2Y0K A;  4BUM X;  4LSI A;  4LSE A;  3JTY A;  3SYS A;  2Y0L A;  2FGR A;  3HW9 A;  3VZT X;  4LSH A;  5DL8 A;  2PRN A;  3K19 A;  4FOZ A;  7PRN A;  4GCS A;  3SY7 A;  2XE3 A; 
#chains in the Genus database with same CATH topology
 2R4P A;  4FZL A;  3UAQ A;  3T0S A;  4FZN A;  3EMN X;  3POQ A;  1PHO A;  1ZHY A;  3PRN A;  4D64 A;  5G38 A;  4C00 A;  4JCH A;  1THQ A;  4O4X A;  4AKR B;  4IL6 O;  4FT6 A;  1YS5 A;  3PQS A;  1OPF A;  2M06 A;  1BT9 A;  3AAA B;  4AKM A;  1GFM A;  2J1N A;  2WJQ A;  2Y7S A;  4O3X B;  4CTD A;  1E54 A;  1ORM A;  2YPV A;  2KXP B;  4PUX A;  4UB8 O;  4AUI A;  2ERV A;  2R4L A;  2MHL A;  3DA4 A;  5DL6 A;  2OMF A;  4FSP A;  5E79 O;  2F1V A;  4AYM C;  2Y0H A;  5JDP A;  3NJT A;  4N59 A;  3AA6 B;  5KAF O;  3SYB A;  2F1C X;  3AA1 A;  3TZG A;  5ADX K;  1H6S 1;  3PGU A;  2R89 A;  2W80 C;  2XE2 A;  5G26 A;  2ZLD A;  2R8A A;  4AYN A;  3FYX A;  2QTK A;  5FVN A;  3HOL A;  3KVD D;  3LK3 B;  4FRX A;  4KRA A;  1MPF A;  4O4U A;  5D5D A;  4BUM X;  3C5O A;  8PRN A;  1HXU A;  2KZ7 A;  2J4U P;  2JQY A;  2N2M A;  3HWB A;  5GTI O;  4AYD C;  2M07 A;  4KR8 A;  3POR A;  4UB6 O;  3DZM A;  4GHB A;  3PQU A;  4O49 A;  4FES A;  3UU2 A;  1BXW A;  4FMS A;  4GCQ A;  4GCP A;  3A0H O;  2YNK A;  4AKR A;  5AFU L;  2F1T A;  2ZFG A;  2MNH A;  4C4V B;  5B5E O;  4D65 A;  4AYE C;  4D5U A;  3AAA A;  2KDY A;  2WJR A;  4XNL A;  3POX A;  4N75 A;  1PRN A;  3AA0 B;  1P4T A;  3BS0 A;  3O0E A;  5DL5 A;  4RJW A;  3PGR A;  4AYI D;  1QJ8 A;  1OSM A;  2XE5 A;  2KXP A;  3BRZ A;  1GFP A;  2IWV A;  2K4T A;  2XG6 A;  4FUV A;  4G75 A;  4O3Z A;  4U9C A;  2R88 A;  3LK4 2;  3VE1 A;  3WI5 A;  4JFB A;  2R4O A;  5T5F A;  3VZU X;  4AFK A;  4K3C A;  4LSF A;  2JMM A;  3AA6 A;  4RL9 A;  1QJP A;  4RLC A;  1S5L O;  2W81 C;  4G76 A;  1MM4 A;  3NSG A;  4XNK A;  1GFN A;  1ZHX A;  3WI4 A;  4PJ0 O;  3BRY A;  4E1T A;  4KR4 A;  1ZHW A;  5G3A A;  3T20 A;  4GF4 A;  2POR A;  3LK3 A;  3VE2 A;  1Q9G A;  2LHF A;  2XTQ A;  3A0B O;  5EE2 A;  5PRN A;  4O3Y A;  3V8U A;  5GTH O;  1ZHZ A;  1GFO A;  2XMX A;  1BH3 A;  3G7G A;  3QRA A;  3AA7 B;  4N74 A;  2FGQ X;  4QQ1 A;  2AXT O;  3T24 A;  3WU2 O;  5IYU A;  2O4V A;  2Y2X A;  4RJX A;  1MM5 A;  1ZHT A;  1HXX A;  3VY9 X;  2R4N A;  4C69 X;  4E1S A;  3UPG A;  5DL7 A;  3A2S X;  4N58 A;  5KAI O;  3SZD A;  2IWW A;  3VY8 X;  4FRT A;  3SY9 A;  1GFQ A;  1Q9F A;  2XE1 A;  3AA7 A;  5AFU K;  4C4V A;  1HXT A;  4FSO A;  2ODJ A;  2XTR A;  4O3W A;  5G39 A;  3DWO X;  3LK2 B;  3LK4 1;  4F4B A;  1IZN B;  3SZV A;  5H2F O;  3AA0 A;  3VZW X;  3RBH A;  3QRC A;  1G90 A;  4AZL A;  6PRN A;  2WVP A;  3POU A;  1T16 A;  1T1L A;  2LFU A;  2Y0K A;  4FQE A;  4LSI A;  3JTY A;  3LK2 A;  2Y0L A;  1IZN A;  4LSE A;  4PR7 A;  5TIS O;  3SYS A;  2FGR A;  3HW9 A;  2X9K A;  4RLB A;  3VZT X;  1QJ9 A;  4K3B A;  3AA1 B;  2K0L A;  4FZM A;  4LSH A;  5ADX L;  5B66 O;  3AAE B;  5DL8 A;  4Z3T A;  5GV0 A;  2N2L A;  3PF1 A;  3KZI O;  2GE4 A;  2PRN A;  3DA3 A;  3JCU O;  3PGS A;  3K19 A;  4FOZ A;  7PRN A;  3HOE A;  4GCS A;  2KC0 A;  2KZ7 B;  2X27 X;  3AAE A;  3DWN A;  3SY7 A;  3GP6 A;  2XE3 A;  4B61 A; 
#chains in the Genus database with same CATH homology
 4FZL A;  3UAQ A;  3T0S A;  4FZN A;  3EMN X;  3POQ A;  1PHO A;  1ZHY A;  3PRN A;  4D64 A;  4JCH A;  1THQ A;  4O4X A;  4AKR B;  4FT6 A;  1YS5 A;  3PQS A;  1OPF A;  2M06 A;  1BT9 A;  3AAA B;  4AKM A;  1GFM A;  2J1N A;  2Y7S A;  4O3X B;  1E54 A;  1ORM A;  2YPV A;  2KXP B;  4PUX A;  4AUI A;  2ERV A;  2MHL A;  3DA4 A;  5DL6 A;  2OMF A;  4FSP A;  4AYM C;  2F1V A;  2Y0H A;  5JDP A;  4N59 A;  3AA6 B;  3SYB A;  3TZG A;  3AA1 A;  5ADX K;  1H6S 1;  5G26 A;  2XE2 A;  2W80 C;  4AYN A;  2ZLD A;  3FYX A;  2QTK A;  5FVN A;  3HOL A;  3KVD D;  3LK3 B;  4FRX A;  4KRA A;  1MPF A;  4O4U A;  5D5D A;  8PRN A;  3C5O A;  1HXU A;  2KZ7 A;  2J4U P;  2N2M A;  3HWB A;  4AYD C;  2M07 A;  4KR8 A;  3POR A;  4GHB A;  3PQU A;  4O49 A;  4FES A;  3UU2 A;  1BXW A;  4FMS A;  4GCQ A;  4GCP A;  5AFU L;  2YNK A;  4AKR A;  2F1T A;  2ZFG A;  2MNH A;  4D65 A;  4AYE C;  4D5U A;  3AAA A;  2KDY A;  4XNL A;  3POX A;  5DL5 A;  1PRN A;  3AA0 B;  1P4T A;  3O0E A;  4RJW A;  4AYI D;  1QJ8 A;  2XE5 A;  1OSM A;  2KXP A;  4FUV A;  1GFP A;  2K4T A;  2XG6 A;  4G75 A;  3VE1 A;  4O3Z A;  4U9C A;  3LK4 2;  3WI5 A;  4JFB A;  5T5F A;  3VZU X;  4AFK A;  4LSF A;  4RL9 A;  2JMM A;  3AA6 A;  1QJP A;  4RLC A;  2W81 C;  4G76 A;  1MM4 A;  3NSG A;  4XNK A;  1GFN A;  1ZHX A;  3WI4 A;  4E1T A;  4KR4 A;  1ZHW A;  3T20 A;  4GF4 A;  2POR A;  3LK3 A;  3VE2 A;  1Q9G A;  2LHF A;  2XTQ A;  5PRN A;  5EE2 A;  3V8U A;  4O3Y A;  1ZHZ A;  1GFO A;  2XMX A;  1BH3 A;  3G7G A;  3QRA A;  3AA7 B;  4QQ1 A;  2FGQ X;  3T24 A;  5IYU A;  2O4V A;  2Y2X A;  4RJX A;  1MM5 A;  1ZHT A;  1HXX A;  3VY9 X;  4C69 X;  4E1S A;  3UPG A;  5DL7 A;  3A2S X;  4N58 A;  3SZD A;  3VY8 X;  4FRT A;  3SY9 A;  1GFQ A;  1Q9F A;  2XE1 A;  3AA7 A;  5AFU K;  1HXT A;  4FSO A;  2ODJ A;  2XTR A;  4O3W A;  3LK2 B;  3LK4 1;  4F4B A;  1IZN B;  3SZV A;  3AA0 A;  3VZW X;  3RBH A;  3QRC A;  1G90 A;  4AZL A;  6PRN A;  3POU A;  2LFU A;  2Y0K A;  4BUM X;  4LSI A;  4LSE A;  3JTY A;  3LK2 A;  2Y0L A;  1IZN A;  3SYS A;  4B61 A;  2FGR A;  3HW9 A;  4RLB A;  3VZT X;  1QJ9 A;  5ADX L;  3AA1 B;  2K0L A;  4FZM A;  4LSH A;  3AAE B;  5DL8 A;  4Z3T A;  5GV0 A;  2N2L A;  2GE4 A;  2PRN A;  3DA3 A;  3K19 A;  4FOZ A;  7PRN A;  3HOE A;  4GCS A;  2KC0 A;  2KZ7 B;  2X27 X;  3AAE A;  3SY7 A;  3GP6 A;  2XE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...