1GFOA

Ompf porin (mutant r132p)
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGPVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of OmpF porin mutants selected for larger pore size. I. Crystallographic analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transmembrane protein
molecule keywords MATRIX PORIN OUTER MEMBRANE PROTEIN F
total genus 104
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 1996-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1gfoA00
4FT6A 4FRXA 6PRNA 1GFQA 2OMFA 5DL5A 4D5UA 3VZUX 4FRTA 1BH3A 3SYBA 1BT9A 4FSPA 3UPGA 3SY7A 4LSEA 4FSOA 3SZVA 5DL8A 2ZLDA 3A2SX 3JTYA 2ODJA 3UU2A 4LSIA 3POXA 1H6S1 4KR8A 2PRNA 4GCSA 1OSMA 2QTKA 5PRNA 5JDPA 3NSGA 1MPFA 3T24A 5FVNA 1PHOA 3K19A 2XE5A 1GFOA 2PORA 3EMNX 3HW9A 3POQA 4GCQA 3SZDA 1GFPA 3PORA 4FMSA 7PRNA 1GFNA 2Y0KA 3VY8X 3PRNA 4KR4A 2FGQX 2XE2A 8PRNA 3VZWX 2XG6A 3SY9A 3T0SA 4LSFA 5DL6A 4AUIA 3VY9X 3O0EA 3T20A 4FOZA 1E54A 2O4VA 4JFBA 2K4TA 4RJWA 1HXUA 4C69X 2XE1A 4LSHA 4D64A 2J4UP 4GCPA 3VZTX 1GFMA 1HXTA 3SYSA 4BUMX 3WI5A 2Y0LA 3WI4A 2Y0HA 5DL7A 2XE3A 2ZFGA 1PRNA 3HWBA 2Y2XA 1OPFA 2J1NA 4D65A 2FGRA 3POUA 4RJXA 3FYXA 4KRAA 1HXXA
chains in the Genus database with same CATH superfamily
2R4OA 4FT6A 5T5FA 4AKRB 5AFUL 4N75A 4FRXA 5KAFO 6PRNA 1GFQA 4C00A 2OMFA 3LK3A 5DL5A 4AYID 5B5EO 4RLBA 4AFKA 4AYDC 4D5UA 4RL9A 2X9KA 3VZUX 2WVPA 4FRTA 4N59A 3RBHA 1P4TA 2F1TA 3AAAA 4IL6O 1BH3A 2WJQA 4G75A 3SYBA 3WU2O 1BT9A 2XMXA 5GTHO 4FSPA 2M07A 3UPGA 1HXXA 4FUVA 3C5OA 3AAEB 4FZMA 4GHBA 3SY7A 4LSEA 4UB8O 3DZMA 4FSOA 3SZVA 2LHFA 2R4PA 1T1LA 5DL8A 2ZLDA 2F1CX 3A2SX 3JTYA 2ODJA 5TISO 3UU2A 4AKMA 2MHLA 5ADXK 2F1VA 4AKRA 4UB6O 5GTIO 5IYUA 3AA6B 3NJTA 2KXPB 4O49A 3PGUA 4AYEC 2AXTO 2KZ7A 1H6S1 3AA1B 3POXA 4KR8A 2PRNA 4GCSA 4LSIA 1OSMA 2QTKA 4N58A 5PRNA 1MM5A 4O4UA 4O3YA 1ZHWA 5G26A 5G38A 5JDPA 5H2FO 1T16A 3LK42 2W80C 3NSGA 4AYMC 1MPFA 3QRCA 1IZNB 4XNKA 3PGRA 5FVNA 5EE2A 3T24A 1PHOA 2N2MA 2N2LA 3K19A 4O3XB 2XE5A 1GFOA 4JCHA 2PORA 4QQ1A 3LK2B 3EMNX 3HW9A 4RLCA 3POQA 4GCQA 3KVDD 2K0LA 3SZDA 1GFPA 2XTRA 3AA7A 3PORA 4FMSA 2IWWA 4AZLA 1ZHTA 2JQYA 4O3ZA 1GFNA 3LK41 2ERVA 2KC0A 4GF4A 4O3WA 7PRNA 1ZHZA 3BRZA 1BXWA 5AFUK 2KDYA 1S5LO 2Y0KA 3VE2A 3VY8X 5ADXL 1Q9FA 5GV0A 3G7GA 3AA6A 3PRNA 3QRAA 4FZLA 4FQEA 4KR4A 2FGQX 3AA7B 4U9CA 4E1TA 3AAAB 2XE2A 8PRNA 5G39A 2X27X 3VZWX 2XG6A 3LK2A 5D5DA 3SY9A 3T0SA 4LSFA 3PQUA 5DL6A 1ORMA 4AUIA 1ZHYA 3VY9X 3O0EA 4O4XA 3T20A 5B66O 4C4VA 3DWNA 2IWVA 4FOZA 1E54A 2O4VA 4JFBA 2K4TA 2KXPA 4RJWA 5KAIO 3LK3B 3A0BO 4G76A 2KZ7B 1HXUA 4C69X 2XE1A 2R4LA 2XTQA 4LSHA 2Y7SA 3AA0A 3HOLA 3VE1A 4CTDA 3BS0A 1QJ8A 3PQSA 4D64A 2J4UP 4GCPA 3KZIO 2GE4A 3VZTX 1GFMA 1HXTA 3SYSA 4BUMX 4PR7A 3WI5A 2Y0LA 4PUXA 3AAEA 3V8UA 3HOEA 4C4VB 3WI4A 2Y0HA 2R4NA 2YPVA 2LFUA 2R88A 5DL7A 2W81C 5E79O 2XE3A 2ZFGA 3JCUO 2JMMA 1PRNA 4FZNA 3HWBA 3TZGA 2Y2XA 3GP6A 4E1SA 4Z3TA 2MNHA 5G3AA 1IZNA 4K3BA 1ZHXA 1OPFA 4FESA 2J1NA 3AA0B 1THQA 3BRYA 3UAQA 3A0HO 4D65A 4F4BA 2FGRA 4AYNA 4XNLA 1MM4A 3PF1A 3POUA 4N74A 2WJRA 3PGSA 3FYXA 4KRAA 2R89A 4K3CA 2YNKA 4RJXA 1G90A 3AA1A 1QJPA 1Q9GA 1YS5A 2M06A 1QJ9A 3DA3A 4B61A 3DA4A 2R8AA 4PJ0O 3DWOX
chains in the Genus database with same CATH topology
4FT6A 5T5FA 4AKRB 5AFUL 4FRXA 6PRNA 1GFQA 2OMFA 3LK3A 5DL5A 4AYID 4RLBA 4AFKA 4AYDC 4D5UA 4RL9A 3VZUX 4FRTA 4N59A 3RBHA 1P4TA 2F1TA 3AAAA 1BH3A 4G75A 3SYBA 1BT9A 2XMXA 4FSPA 2M07A 3UPGA 4FUVA 4FZMA 3C5OA 3AAEB 4GHBA 3SY7A 4LSEA 4FSOA 3SZVA 2LHFA 5DL8A 4AYEC 2ZLDA 3A2SX 4AKMA 3JTYA 2ODJA 3UU2A 5ADXK 2MHLA 2F1VA 4AKRA 5IYUA 3AA6B 2KXPB 4O49A 2KZ7A 1H6S1 3AA1B 3POXA 4KR8A 2PRNA 4GCSA 4LSIA 1OSMA 2QTKA 4N58A 5PRNA 1MM5A 4O4UA 4O3YA 1ZHWA 5G26A 5JDPA 3LK42 2W80C 3NSGA 4AYMC 1MPFA 3QRCA 1IZNB 4XNKA 5FVNA 3T24A 5EE2A 1PHOA 2N2MA 2N2LA 3K19A 4O3XB 2XE5A 1GFOA 4JCHA 2PORA 4QQ1A 3LK2B 3EMNX 3HW9A 4RLCA 3POQA 4GCQA 3KVDD 2K0LA 3SZDA 1GFPA 2XTRA 3AA7A 3PORA 4FMSA 4AZLA 1ZHTA 4O3ZA 4O3WA 1GFNA 3LK41 2ERVA 2KC0A 4GF4A 7PRNA 1ZHZA 5AFUK 1BXWA 5ADXL 2KDYA 2Y0KA 3VE2A 3VY8X 1Q9FA 5GV0A 3G7GA 3AA6A 3PRNA 3QRAA 4FZLA 4KR4A 2FGQX 3AA7B 4U9CA 4E1TA 3AAAB 2XE2A 8PRNA 2X27X 3VZWX 2XG6A 3LK2A 5D5DA 3SY9A 3T0SA 4LSFA 3PQUA 5DL6A 1ORMA 4AUIA 1ZHYA 3VY9X 3O0EA 4O4XA 3T20A 4FOZA 1E54A 2O4VA 4JFBA 2K4TA 2KXPA 4RJWA 3LK3B 4G76A 2KZ7B 1HXUA 4C69X 2XE1A 2XTQA 4LSHA 3VE1A 2Y7SA 3AA0A 3HOLA 1QJ8A 3PQSA 4D64A 2J4UP 4GCPA 3VZTX 2GE4A 1GFMA 1HXTA 3SYSA 4BUMX 3WI5A 2Y0LA 4PUXA 3AAEA 3HOEA 3WI4A 2Y0HA 2YPVA 5DL7A 2LFUA 2W81C 2XE3A 2ZFGA 4FZNA 2JMMA 1PRNA 3HWBA 3TZGA 2Y2XA 3GP6A 4E1SA 4Z3TA 2MNHA 1IZNA 1ZHXA 1OPFA 4FESA 2J1NA 3AA0B 1THQA 4F4BA 3UAQA 4D65A 2FGRA 4AYNA 4XNLA 1MM4A 3POUA 4RJXA 3FYXA 4KRAA 2YNKA 1G90A 3AA1A 1QJPA 1Q9GA 1YS5A 2M06A 1QJ9A 3DA3A 4B61A 3DA4A 1HXXA 3V8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FT6 A;  4FRX A;  6PRN A;  1GFQ A;  2OMF A;  5DL5 A;  4D5U A;  3VZU X;  4FRT A;  1BH3 A;  3SYB A;  1BT9 A;  4FSP A;  3UPG A;  3SY7 A;  4LSE A;  4FSO A;  3SZV A;  5DL8 A;  2ZLD A;  3A2S X;  3JTY A;  2ODJ A;  3UU2 A;  4LSI A;  3POX A;  1H6S 1;  4KR8 A;  2PRN A;  4GCS A;  1OSM A;  2QTK A;  5PRN A;  5JDP A;  3NSG A;  1MPF A;  3T24 A;  5FVN A;  1PHO A;  3K19 A;  2XE5 A;  1GFO A;  2POR A;  3EMN X;  3HW9 A;  3POQ A;  4GCQ A;  3SZD A;  1GFP A;  3POR A;  4FMS A;  7PRN A;  1GFN A;  2Y0K A;  3VY8 X;  3PRN A;  4KR4 A;  2FGQ X;  2XE2 A;  8PRN A;  3VZW X;  2XG6 A;  3SY9 A;  3T0S A;  4LSF A;  5DL6 A;  4AUI A;  3VY9 X;  3O0E A;  3T20 A;  4FOZ A;  1E54 A;  2O4V A;  4JFB A;  2K4T A;  4RJW A;  1HXU A;  4C69 X;  2XE1 A;  4LSH A;  4D64 A;  2J4U P;  4GCP A;  3VZT X;  1GFM A;  1HXT A;  3SYS A;  4BUM X;  3WI5 A;  2Y0L A;  3WI4 A;  2Y0H A;  5DL7 A;  2XE3 A;  2ZFG A;  1PRN A;  3HWB A;  2Y2X A;  1OPF A;  2J1N A;  4D65 A;  2FGR A;  3POU A;  4RJX A;  3FYX A;  4KRA A;  1HXX A; 
#chains in the Genus database with same CATH topology
 2R4O A;  4FT6 A;  5T5F A;  4AKR B;  5AFU L;  4N75 A;  4FRX A;  5KAF O;  6PRN A;  1GFQ A;  4C00 A;  2OMF A;  3LK3 A;  5DL5 A;  4AYI D;  5B5E O;  4RLB A;  4AFK A;  4AYD C;  4D5U A;  4RL9 A;  2X9K A;  3VZU X;  2WVP A;  4FRT A;  4N59 A;  3RBH A;  1P4T A;  2F1T A;  3AAA A;  4IL6 O;  1BH3 A;  2WJQ A;  4G75 A;  3SYB A;  3WU2 O;  1BT9 A;  2XMX A;  5GTH O;  4FSP A;  2M07 A;  3UPG A;  1HXX A;  4FUV A;  3C5O A;  3AAE B;  4FZM A;  4GHB A;  3SY7 A;  4LSE A;  4UB8 O;  3DZM A;  4FSO A;  3SZV A;  2LHF A;  2R4P A;  1T1L A;  5DL8 A;  2ZLD A;  2F1C X;  3A2S X;  3JTY A;  2ODJ A;  5TIS O;  3UU2 A;  4AKM A;  2MHL A;  5ADX K;  2F1V A;  4AKR A;  4UB6 O;  5GTI O;  5IYU A;  3AA6 B;  3NJT A;  2KXP B;  4O49 A;  3PGU A;  4AYE C;  2AXT O;  2KZ7 A;  1H6S 1;  3AA1 B;  3POX A;  4KR8 A;  2PRN A;  4GCS A;  4LSI A;  1OSM A;  2QTK A;  4N58 A;  5PRN A;  1MM5 A;  4O4U A;  4O3Y A;  1ZHW A;  5G26 A;  5G38 A;  5JDP A;  5H2F O;  1T16 A;  3LK4 2;  2W80 C;  3NSG A;  4AYM C;  1MPF A;  3QRC A;  1IZN B;  4XNK A;  3PGR A;  5FVN A;  5EE2 A;  3T24 A;  1PHO A;  2N2M A;  2N2L A;  3K19 A;  4O3X B;  2XE5 A;  1GFO A;  4JCH A;  2POR A;  4QQ1 A;  3LK2 B;  3EMN X;  3HW9 A;  4RLC A;  3POQ A;  4GCQ A;  3KVD D;  2K0L A;  3SZD A;  1GFP A;  2XTR A;  3AA7 A;  3POR A;  4FMS A;  2IWW A;  4AZL A;  1ZHT A;  2JQY A;  4O3Z A;  1GFN A;  3LK4 1;  2ERV A;  2KC0 A;  4GF4 A;  4O3W A;  7PRN A;  1ZHZ A;  3BRZ A;  1BXW A;  5AFU K;  2KDY A;  1S5L O;  2Y0K A;  3VE2 A;  3VY8 X;  5ADX L;  1Q9F A;  5GV0 A;  3G7G A;  3AA6 A;  3PRN A;  3QRA A;  4FZL A;  4FQE A;  4KR4 A;  2FGQ X;  3AA7 B;  4U9C A;  4E1T A;  3AAA B;  2XE2 A;  8PRN A;  5G39 A;  2X27 X;  3VZW X;  2XG6 A;  3LK2 A;  5D5D A;  3SY9 A;  3T0S A;  4LSF A;  3PQU A;  5DL6 A;  1ORM A;  4AUI A;  1ZHY A;  3VY9 X;  3O0E A;  4O4X A;  3T20 A;  5B66 O;  4C4V A;  3DWN A;  2IWV A;  4FOZ A;  1E54 A;  2O4V A;  4JFB A;  2K4T A;  2KXP A;  4RJW A;  5KAI O;  3LK3 B;  3A0B O;  4G76 A;  2KZ7 B;  1HXU A;  4C69 X;  2XE1 A;  2R4L A;  2XTQ A;  4LSH A;  2Y7S A;  3AA0 A;  3HOL A;  3VE1 A;  4CTD A;  3BS0 A;  1QJ8 A;  3PQS A;  4D64 A;  2J4U P;  4GCP A;  3KZI O;  2GE4 A;  3VZT X;  1GFM A;  1HXT A;  3SYS A;  4BUM X;  4PR7 A;  3WI5 A;  2Y0L A;  4PUX A;  3AAE A;  3V8U A;  3HOE A;  4C4V B;  3WI4 A;  2Y0H A;  2R4N A;  2YPV A;  2LFU A;  2R88 A;  5DL7 A;  2W81 C;  5E79 O;  2XE3 A;  2ZFG A;  3JCU O;  2JMM A;  1PRN A;  4FZN A;  3HWB A;  3TZG A;  2Y2X A;  3GP6 A;  4E1S A;  4Z3T A;  2MNH A;  5G3A A;  1IZN A;  4K3B A;  1ZHX A;  1OPF A;  4FES A;  2J1N A;  3AA0 B;  1THQ A;  3BRY A;  3UAQ A;  3A0H O;  4D65 A;  4F4B A;  2FGR A;  4AYN A;  4XNL A;  1MM4 A;  3PF1 A;  3POU A;  4N74 A;  2WJR A;  3PGS A;  3FYX A;  4KRA A;  2R89 A;  4K3C A;  2YNK A;  4RJX A;  1G90 A;  3AA1 A;  1QJP A;  1Q9G A;  1YS5 A;  2M06 A;  1QJ9 A;  3DA3 A;  4B61 A;  3DA4 A;  2R8A A;  4PJ0 O;  3DWO X; 
#chains in the Genus database with same CATH homology
 4FT6 A;  5T5F A;  4AKR B;  5AFU L;  4FRX A;  6PRN A;  1GFQ A;  2OMF A;  3LK3 A;  5DL5 A;  4AYI D;  4RLB A;  4AFK A;  4AYD C;  4D5U A;  4RL9 A;  3VZU X;  4FRT A;  4N59 A;  3RBH A;  1P4T A;  2F1T A;  3AAA A;  1BH3 A;  4G75 A;  3SYB A;  1BT9 A;  2XMX A;  4FSP A;  2M07 A;  3UPG A;  4FUV A;  4FZM A;  3C5O A;  3AAE B;  4GHB A;  3SY7 A;  4LSE A;  4FSO A;  3SZV A;  2LHF A;  5DL8 A;  4AYE C;  2ZLD A;  3A2S X;  4AKM A;  3JTY A;  2ODJ A;  3UU2 A;  5ADX K;  2MHL A;  2F1V A;  4AKR A;  5IYU A;  3AA6 B;  2KXP B;  4O49 A;  2KZ7 A;  1H6S 1;  3AA1 B;  3POX A;  4KR8 A;  2PRN A;  4GCS A;  4LSI A;  1OSM A;  2QTK A;  4N58 A;  5PRN A;  1MM5 A;  4O4U A;  4O3Y A;  1ZHW A;  5G26 A;  5JDP A;  3LK4 2;  2W80 C;  3NSG A;  4AYM C;  1MPF A;  3QRC A;  1IZN B;  4XNK A;  5FVN A;  3T24 A;  5EE2 A;  1PHO A;  2N2M A;  2N2L A;  3K19 A;  4O3X B;  2XE5 A;  1GFO A;  4JCH A;  2POR A;  4QQ1 A;  3LK2 B;  3EMN X;  3HW9 A;  4RLC A;  3POQ A;  4GCQ A;  3KVD D;  2K0L A;  3SZD A;  1GFP A;  2XTR A;  3AA7 A;  3POR A;  4FMS A;  4AZL A;  1ZHT A;  4O3Z A;  4O3W A;  1GFN A;  3LK4 1;  2ERV A;  2KC0 A;  4GF4 A;  7PRN A;  1ZHZ A;  5AFU K;  1BXW A;  5ADX L;  2KDY A;  2Y0K A;  3VE2 A;  3VY8 X;  1Q9F A;  5GV0 A;  3G7G A;  3AA6 A;  3PRN A;  3QRA A;  4FZL A;  4KR4 A;  2FGQ X;  3AA7 B;  4U9C A;  4E1T A;  3AAA B;  2XE2 A;  8PRN A;  2X27 X;  3VZW X;  2XG6 A;  3LK2 A;  5D5D A;  3SY9 A;  3T0S A;  4LSF A;  3PQU A;  5DL6 A;  1ORM A;  4AUI A;  1ZHY A;  3VY9 X;  3O0E A;  4O4X A;  3T20 A;  4FOZ A;  1E54 A;  2O4V A;  4JFB A;  2K4T A;  2KXP A;  4RJW A;  3LK3 B;  4G76 A;  2KZ7 B;  1HXU A;  4C69 X;  2XE1 A;  2XTQ A;  4LSH A;  3VE1 A;  2Y7S A;  3AA0 A;  3HOL A;  1QJ8 A;  3PQS A;  4D64 A;  2J4U P;  4GCP A;  3VZT X;  2GE4 A;  1GFM A;  1HXT A;  3SYS A;  4BUM X;  3WI5 A;  2Y0L A;  4PUX A;  3AAE A;  3HOE A;  3WI4 A;  2Y0H A;  2YPV A;  5DL7 A;  2LFU A;  2W81 C;  2XE3 A;  2ZFG A;  4FZN A;  2JMM A;  1PRN A;  3HWB A;  3TZG A;  2Y2X A;  3GP6 A;  4E1S A;  4Z3T A;  2MNH A;  1IZN A;  1ZHX A;  1OPF A;  4FES A;  2J1N A;  3AA0 B;  1THQ A;  4F4B A;  3UAQ A;  4D65 A;  2FGR A;  4AYN A;  4XNL A;  1MM4 A;  3POU A;  4RJX A;  3FYX A;  4KRA A;  2YNK A;  1G90 A;  3AA1 A;  1QJP A;  1Q9G A;  1YS5 A;  2M06 A;  1QJ9 A;  3DA3 A;  4B61 A;  3DA4 A;  1HXX A;  3V8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...