1GFPA

Ompf porin (mutant r42c)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYACLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX PORIN OUTER MEMBRANE PROTEIN F
publication title Structural and functional characterization of OmpF porin mutants selected for larger pore size. I. Crystallographic analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transmembrane protein
total genus 107
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 1996-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1gfpA00
2PORA 1HXXA 3SZVA 1OPFA 4AUIA 2J4UP 1GFPA 4LSHA 3VY8X 3T20A 1GFMA 3PRNA 3POQA 3K19A 1PRNA 3EMNX 5PRNA 5JDPA 1E54A 3WI5A 2QTKA 3JTYA 2Y0HA 5DL7A 1BH3A 2ZLDA 1OSMA 4KR8A 4D5UA 2Y0LA 3UPGA 4FSPA 2FGRA 5FVNA 3SY7A 3SYBA 6PRNA 2XE1A 4FRXA 3WI4A 2Y2XA 4GCSA 3VZUX 3SYSA 3PORA 3A2SX 8PRNA 1BT9A 1PHOA 3VZWX 3FYXA 4D65A 4FMSA 1HXUA 4LSFA 3SY9A 4BUMX 2XE3A 4LSEA 3POXA 4RJXA 3UU2A 4GCQA 2OMFA 4D64A 3NSGA 4FOZA 3POUA 2XE5A 3T0SA 3HWBA 2K4TA 1MPFA 4FSOA 4LSIA 1HXTA 4KRAA 3T24A 4JFBA 2FGQX 3VY9X 4GCPA 1H6S1 5DL5A 7PRNA 1GFNA 2XE2A 2Y0KA 2J1NA 1GFQA 2ZFGA 2O4VA 3O0EA 4C69X 4FRTA 1GFOA 3VZTX 2PRNA 3HW9A 2ODJA 5DL6A 4KR4A 3SZDA 4RJWA 4FT6A 5DL8A 2XG6A
chains in the Genus database with same CATH superfamily
1YS5A 2PORA 3HOEA 5EE2A 3TZGA 2M07A 1HXXA 3SZVA 1OPFA 3AA7A 4AUIA 4AYID 3QRAA 2J4UP 1GFPA 2KXPA 5GTIO 2YPVA 4LSHA 4FUVA 3VY8X 2F1TA 2IWWA 3AA6A 1GFMA 3BS0A 3PRNA 5KAIO 4AKRA 3PF1A 1ZHZA 5GV0A 1QJPA 2MHLA 1ZHTA 3AA0A 2KDYA 5G26A 3POQA 1IZNA 1PRNA 3K19A 3EMNX 3RBHA 2KXPB 5PRNA 4GF4A 2AXTO 3UAQA 4RLCA 4AKRB 3GP6A 2W80C 4FZNA 1Q9GA 1E54A 4IL6O 5JDPA 5ADXL 1MM5A 3WI5A 1S5LO 1QJ9A 1ZHYA 2QTKA 3QRCA 4FESA 4K3BA 3V8UA 2F1VA 3BRYA 3JTYA 4U9CA 4AZLA 2Y0HA 2KC0A 5DL7A 5AFUL 4AYEC 3LK3A 1BH3A 3DWNA 4FZMA 4XNLA 3DA3A 1P4TA 2R88A 2ZLDA 1OSMA 3NJTA 5B5EO 4KR8A 4D5UA 2Y0LA 4Z3TA 5GTHO 3UPGA 2R4LA 3DA4A 2R4NA 4FSPA 2FGRA 2XTRA 5FVNA 3SY7A 3SYBA 3LK3B 5G38A 4AYMC 2R4PA 6PRNA 5G3AA 2X9KA 1ZHWA 2LHFA 2LFUA 2XE1A 4FRXA 3WI4A 2Y2XA 2F1CX 4GCSA 3VZUX 3DWOX 3DZMA 4N58A 4O3XB 4O3WA 4AYNA 3SYSA 3LK42 4G76A 1THQA 2ERVA 3AAEA 4UB8O 3PORA 5B66O 3A2SX 8PRNA 2MNHA 1BT9A 4E1TA 1PHOA 3JCUO 4GHBA 3WU2O 3PQSA 4N59A 3VZWX 3FYXA 3HOLA 4XNKA 4D65A 5KAFO 4FMSA 1HXUA 3LK2A 4LSFA 3KZIO 5E79O 3SY9A 4BUMX 3AAEB 5ADXK 3PQUA 1G90A 1QJ8A 2XE3A 4LSEA 4PUXA 2XTQA 4RLBA 3POXA 4RJXA 2X27X 2R4OA 4N75A 3UU2A 4GCQA 5T5FA 2OMFA 4D64A 5AFUK 2IWVA 3NSGA 3VE1A 2N2MA 3A0BO 3G7GA 5H2FO 2JQYA 3LK2B 4FOZA 3AAAA 3KVDD 3POUA 2R89A 3PGRA 5TISO 1Q9FA 4B61A 1T16A 2JMMA 2XE5A 4JCHA 3T0SA 2M06A 3HWBA 2K4TA 1MPFA 1T1LA 4FSOA 3AA1A 4LSIA 1HXTA 2K0LA 4KRAA 3T24A 4JFBA 2FGQX 4O3ZA 4G75A 3AAAB 4RL9A 3VY9X 2WJRA 4UB6O 4C4VB 4GCPA 4AKMA 1ORMA 2N2LA 4K3CA 1H6S1 1BXWA 4E1SA 1MM4A 4QQ1A 4PJ0O 4O4XA 5DL5A 5G39A 7PRNA 5IYUA 2WJQA 1ZHXA 1GFNA 2KZ7B 1IZNB 3AA1B 2XE2A 2Y0KA 4N74A 4O4UA 4CTDA 3T20A 4O3YA 2J1NA 1GFQA 2ZFGA 4FZLA 3A0HO 2O4VA 4PR7A 2W81C 3BRZA 3O0EA 5D5DA 4C00A 3AA7B 3C5OA 3PGUA 2Y7SA 4FQEA 4FRTA 3PGSA 3VE2A 4C69X 1GFOA 4O49A 3VZTX 2PRNA 2R8AA 3HW9A 2ODJA 3AA6B 4C4VA 5DL6A 4KR4A 3SZDA 4RJWA 4AFKA 3AA0B 2YNKA 2XMXA 3LK41 4FT6A 2KZ7A 5DL8A 4F4BA 2GE4A 4AYDC 2XG6A 2WVPA
chains in the Genus database with same CATH topology
1YS5A 2PORA 3HOEA 5EE2A 3TZGA 2M07A 1HXXA 3SZVA 1OPFA 3AA7A 4AUIA 4AYID 3QRAA 2J4UP 1GFPA 2KXPA 2YPVA 4LSHA 4FUVA 3VY8X 2F1TA 3T20A 3AA6A 1GFMA 3PRNA 4AKRA 5GV0A 1ZHZA 1QJPA 2MHLA 1ZHTA 3AA0A 2KDYA 5G26A 3POQA 1IZNA 1PRNA 3K19A 3EMNX 3RBHA 2KXPB 5PRNA 4GF4A 3UAQA 4RLCA 4AKRB 3GP6A 2W80C 4FZNA 1Q9GA 1E54A 5JDPA 5ADXL 1MM5A 3WI5A 1QJ9A 1ZHYA 2QTKA 3QRCA 4FESA 3V8UA 2F1VA 3JTYA 4U9CA 4AZLA 5AFUL 2Y0HA 2KC0A 5DL7A 4AYEC 3LK3A 1BH3A 4FZMA 4XNLA 3DA3A 1P4TA 2ZLDA 1OSMA 4KR8A 4D5UA 2Y0LA 4Z3TA 3UPGA 3DA4A 4FSPA 2FGRA 2XTRA 5FVNA 3SY7A 3SYBA 3LK3B 4AYMC 6PRNA 1ZHWA 2LHFA 2LFUA 2XE1A 4FRXA 3WI4A 2Y2XA 4GCSA 3VZUX 4O3WA 4AYNA 4N58A 4O3XB 3SYSA 3LK42 4G76A 1THQA 2ERVA 3AAEA 3PORA 3A2SX 8PRNA 2MNHA 1BT9A 4E1TA 1PHOA 4GHBA 3PQSA 4N59A 3VZWX 3FYXA 3HOLA 4XNKA 4D65A 4FMSA 1HXUA 3LK2A 4LSFA 3SY9A 4BUMX 3AAEB 5ADXK 3PQUA 1G90A 1QJ8A 2XE3A 4LSEA 4PUXA 2XTQA 4RLBA 3POXA 4RJXA 2X27X 3UU2A 4GCQA 5T5FA 2OMFA 4D64A 5AFUK 3NSGA 3VE1A 2N2MA 3G7GA 3LK2B 4FOZA 3AAAA 3KVDD 3POUA 1Q9FA 4B61A 2JMMA 2XE5A 4JCHA 3T0SA 2M06A 3HWBA 2K4TA 1MPFA 4FSOA 4LSIA 3AA1A 1HXTA 2K0LA 4KRAA 3T24A 4JFBA 2FGQX 4O3ZA 4G75A 3AAAB 4RL9A 3VY9X 4GCPA 4AKMA 1ORMA 2N2LA 1H6S1 1BXWA 4E1SA 1MM4A 4QQ1A 4O4XA 5DL5A 7PRNA 5IYUA 3AA1B 1ZHXA 1GFNA 2KZ7B 1IZNB 4O4UA 2XE2A 2Y0KA 4O3YA 2J1NA 1GFQA 2ZFGA 4FZLA 2O4VA 2W81C 3O0EA 5D5DA 3AA7B 3C5OA 2Y7SA 3VE2A 4FRTA 4C69X 1GFOA 4O49A 3VZTX 2PRNA 3HW9A 2ODJA 3AA6B 5DL6A 4KR4A 3SZDA 4RJWA 4AFKA 3AA0B 2YNKA 2XMXA 3LK41 4FT6A 2KZ7A 5DL8A 4F4BA 2GE4A 4AYDC 2XG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2POR A;  1HXX A;  3SZV A;  1OPF A;  4AUI A;  2J4U P;  1GFP A;  4LSH A;  3VY8 X;  3T20 A;  1GFM A;  3PRN A;  3POQ A;  3K19 A;  1PRN A;  3EMN X;  5PRN A;  5JDP A;  1E54 A;  3WI5 A;  2QTK A;  3JTY A;  2Y0H A;  5DL7 A;  1BH3 A;  2ZLD A;  1OSM A;  4KR8 A;  4D5U A;  2Y0L A;  3UPG A;  4FSP A;  2FGR A;  5FVN A;  3SY7 A;  3SYB A;  6PRN A;  2XE1 A;  4FRX A;  3WI4 A;  2Y2X A;  4GCS A;  3VZU X;  3SYS A;  3POR A;  3A2S X;  8PRN A;  1BT9 A;  1PHO A;  3VZW X;  3FYX A;  4D65 A;  4FMS A;  1HXU A;  4LSF A;  3SY9 A;  4BUM X;  2XE3 A;  4LSE A;  3POX A;  4RJX A;  3UU2 A;  4GCQ A;  2OMF A;  4D64 A;  3NSG A;  4FOZ A;  3POU A;  2XE5 A;  3T0S A;  3HWB A;  2K4T A;  1MPF A;  4FSO A;  4LSI A;  1HXT A;  4KRA A;  3T24 A;  4JFB A;  2FGQ X;  3VY9 X;  4GCP A;  1H6S 1;  5DL5 A;  7PRN A;  1GFN A;  2XE2 A;  2Y0K A;  2J1N A;  1GFQ A;  2ZFG A;  2O4V A;  3O0E A;  4C69 X;  4FRT A;  1GFO A;  3VZT X;  2PRN A;  3HW9 A;  2ODJ A;  5DL6 A;  4KR4 A;  3SZD A;  4RJW A;  4FT6 A;  5DL8 A;  2XG6 A; 
#chains in the Genus database with same CATH topology
 1YS5 A;  2POR A;  3HOE A;  5EE2 A;  3TZG A;  2M07 A;  1HXX A;  3SZV A;  1OPF A;  3AA7 A;  4AUI A;  4AYI D;  3QRA A;  2J4U P;  1GFP A;  2KXP A;  5GTI O;  2YPV A;  4LSH A;  4FUV A;  3VY8 X;  2F1T A;  2IWW A;  3AA6 A;  1GFM A;  3BS0 A;  3PRN A;  5KAI O;  4AKR A;  3PF1 A;  1ZHZ A;  5GV0 A;  1QJP A;  2MHL A;  1ZHT A;  3AA0 A;  2KDY A;  5G26 A;  3POQ A;  1IZN A;  1PRN A;  3K19 A;  3EMN X;  3RBH A;  2KXP B;  5PRN A;  4GF4 A;  2AXT O;  3UAQ A;  4RLC A;  4AKR B;  3GP6 A;  2W80 C;  4FZN A;  1Q9G A;  1E54 A;  4IL6 O;  5JDP A;  5ADX L;  1MM5 A;  3WI5 A;  1S5L O;  1QJ9 A;  1ZHY A;  2QTK A;  3QRC A;  4FES A;  4K3B A;  3V8U A;  2F1V A;  3BRY A;  3JTY A;  4U9C A;  4AZL A;  2Y0H A;  2KC0 A;  5DL7 A;  5AFU L;  4AYE C;  3LK3 A;  1BH3 A;  3DWN A;  4FZM A;  4XNL A;  3DA3 A;  1P4T A;  2R88 A;  2ZLD A;  1OSM A;  3NJT A;  5B5E O;  4KR8 A;  4D5U A;  2Y0L A;  4Z3T A;  5GTH O;  3UPG A;  2R4L A;  3DA4 A;  2R4N A;  4FSP A;  2FGR A;  2XTR A;  5FVN A;  3SY7 A;  3SYB A;  3LK3 B;  5G38 A;  4AYM C;  2R4P A;  6PRN A;  5G3A A;  2X9K A;  1ZHW A;  2LHF A;  2LFU A;  2XE1 A;  4FRX A;  3WI4 A;  2Y2X A;  2F1C X;  4GCS A;  3VZU X;  3DWO X;  3DZM A;  4N58 A;  4O3X B;  4O3W A;  4AYN A;  3SYS A;  3LK4 2;  4G76 A;  1THQ A;  2ERV A;  3AAE A;  4UB8 O;  3POR A;  5B66 O;  3A2S X;  8PRN A;  2MNH A;  1BT9 A;  4E1T A;  1PHO A;  3JCU O;  4GHB A;  3WU2 O;  3PQS A;  4N59 A;  3VZW X;  3FYX A;  3HOL A;  4XNK A;  4D65 A;  5KAF O;  4FMS A;  1HXU A;  3LK2 A;  4LSF A;  3KZI O;  5E79 O;  3SY9 A;  4BUM X;  3AAE B;  5ADX K;  3PQU A;  1G90 A;  1QJ8 A;  2XE3 A;  4LSE A;  4PUX A;  2XTQ A;  4RLB A;  3POX A;  4RJX A;  2X27 X;  2R4O A;  4N75 A;  3UU2 A;  4GCQ A;  5T5F A;  2OMF A;  4D64 A;  5AFU K;  2IWV A;  3NSG A;  3VE1 A;  2N2M A;  3A0B O;  3G7G A;  5H2F O;  2JQY A;  3LK2 B;  4FOZ A;  3AAA A;  3KVD D;  3POU A;  2R89 A;  3PGR A;  5TIS O;  1Q9F A;  4B61 A;  1T16 A;  2JMM A;  2XE5 A;  4JCH A;  3T0S A;  2M06 A;  3HWB A;  2K4T A;  1MPF A;  1T1L A;  4FSO A;  3AA1 A;  4LSI A;  1HXT A;  2K0L A;  4KRA A;  3T24 A;  4JFB A;  2FGQ X;  4O3Z A;  4G75 A;  3AAA B;  4RL9 A;  3VY9 X;  2WJR A;  4UB6 O;  4C4V B;  4GCP A;  4AKM A;  1ORM A;  2N2L A;  4K3C A;  1H6S 1;  1BXW A;  4E1S A;  1MM4 A;  4QQ1 A;  4PJ0 O;  4O4X A;  5DL5 A;  5G39 A;  7PRN A;  5IYU A;  2WJQ A;  1ZHX A;  1GFN A;  2KZ7 B;  1IZN B;  3AA1 B;  2XE2 A;  2Y0K A;  4N74 A;  4O4U A;  4CTD A;  3T20 A;  4O3Y A;  2J1N A;  1GFQ A;  2ZFG A;  4FZL A;  3A0H O;  2O4V A;  4PR7 A;  2W81 C;  3BRZ A;  3O0E A;  5D5D A;  4C00 A;  3AA7 B;  3C5O A;  3PGU A;  2Y7S A;  4FQE A;  4FRT A;  3PGS A;  3VE2 A;  4C69 X;  1GFO A;  4O49 A;  3VZT X;  2PRN A;  2R8A A;  3HW9 A;  2ODJ A;  3AA6 B;  4C4V A;  5DL6 A;  4KR4 A;  3SZD A;  4RJW A;  4AFK A;  3AA0 B;  2YNK A;  2XMX A;  3LK4 1;  4FT6 A;  2KZ7 A;  5DL8 A;  4F4B A;  2GE4 A;  4AYD C;  2XG6 A;  2WVP A; 
#chains in the Genus database with same CATH homology
 1YS5 A;  2POR A;  3HOE A;  5EE2 A;  3TZG A;  2M07 A;  1HXX A;  3SZV A;  1OPF A;  3AA7 A;  4AUI A;  4AYI D;  3QRA A;  2J4U P;  1GFP A;  2KXP A;  2YPV A;  4LSH A;  4FUV A;  3VY8 X;  2F1T A;  3T20 A;  3AA6 A;  1GFM A;  3PRN A;  4AKR A;  5GV0 A;  1ZHZ A;  1QJP A;  2MHL A;  1ZHT A;  3AA0 A;  2KDY A;  5G26 A;  3POQ A;  1IZN A;  1PRN A;  3K19 A;  3EMN X;  3RBH A;  2KXP B;  5PRN A;  4GF4 A;  3UAQ A;  4RLC A;  4AKR B;  3GP6 A;  2W80 C;  4FZN A;  1Q9G A;  1E54 A;  5JDP A;  5ADX L;  1MM5 A;  3WI5 A;  1QJ9 A;  1ZHY A;  2QTK A;  3QRC A;  4FES A;  3V8U A;  2F1V A;  3JTY A;  4U9C A;  4AZL A;  5AFU L;  2Y0H A;  2KC0 A;  5DL7 A;  4AYE C;  3LK3 A;  1BH3 A;  4FZM A;  4XNL A;  3DA3 A;  1P4T A;  2ZLD A;  1OSM A;  4KR8 A;  4D5U A;  2Y0L A;  4Z3T A;  3UPG A;  3DA4 A;  4FSP A;  2FGR A;  2XTR A;  5FVN A;  3SY7 A;  3SYB A;  3LK3 B;  4AYM C;  6PRN A;  1ZHW A;  2LHF A;  2LFU A;  2XE1 A;  4FRX A;  3WI4 A;  2Y2X A;  4GCS A;  3VZU X;  4O3W A;  4AYN A;  4N58 A;  4O3X B;  3SYS A;  3LK4 2;  4G76 A;  1THQ A;  2ERV A;  3AAE A;  3POR A;  3A2S X;  8PRN A;  2MNH A;  1BT9 A;  4E1T A;  1PHO A;  4GHB A;  3PQS A;  4N59 A;  3VZW X;  3FYX A;  3HOL A;  4XNK A;  4D65 A;  4FMS A;  1HXU A;  3LK2 A;  4LSF A;  3SY9 A;  4BUM X;  3AAE B;  5ADX K;  3PQU A;  1G90 A;  1QJ8 A;  2XE3 A;  4LSE A;  4PUX A;  2XTQ A;  4RLB A;  3POX A;  4RJX A;  2X27 X;  3UU2 A;  4GCQ A;  5T5F A;  2OMF A;  4D64 A;  5AFU K;  3NSG A;  3VE1 A;  2N2M A;  3G7G A;  3LK2 B;  4FOZ A;  3AAA A;  3KVD D;  3POU A;  1Q9F A;  4B61 A;  2JMM A;  2XE5 A;  4JCH A;  3T0S A;  2M06 A;  3HWB A;  2K4T A;  1MPF A;  4FSO A;  4LSI A;  3AA1 A;  1HXT A;  2K0L A;  4KRA A;  3T24 A;  4JFB A;  2FGQ X;  4O3Z A;  4G75 A;  3AAA B;  4RL9 A;  3VY9 X;  4GCP A;  4AKM A;  1ORM A;  2N2L A;  1H6S 1;  1BXW A;  4E1S A;  1MM4 A;  4QQ1 A;  4O4X A;  5DL5 A;  7PRN A;  5IYU A;  3AA1 B;  1ZHX A;  1GFN A;  2KZ7 B;  1IZN B;  4O4U A;  2XE2 A;  2Y0K A;  4O3Y A;  2J1N A;  1GFQ A;  2ZFG A;  4FZL A;  2O4V A;  2W81 C;  3O0E A;  5D5D A;  3AA7 B;  3C5O A;  2Y7S A;  3VE2 A;  4FRT A;  4C69 X;  1GFO A;  4O49 A;  3VZT X;  2PRN A;  3HW9 A;  2ODJ A;  3AA6 B;  5DL6 A;  4KR4 A;  3SZD A;  4RJW A;  4AFK A;  3AA0 B;  2YNK A;  2XMX A;  3LK4 1;  4FT6 A;  2KZ7 A;  5DL8 A;  4F4B A;  2GE4 A;  4AYD C;  2XG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...