1GGCL

Major antigen-induced domain rearrangements in an antibody
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
215
structure length
215
Chain Sequence
DIVLTQSPGSLAVSLGQRATISCRASESVDDDGNSFLHWYQQKPGQPPKLLIYRSSNLISGIPDRFSGSGSRTDFTLTINPVEADDVATYYCQQSNEDPLTFGAGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Major antigen-induced domain rearrangements in an antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG2A-KAPPA 50.1 FAB (LIGHT CHAIN)
total genus 46
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1993-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ggcL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ggcL01
1F97A 3QFJA 3CZFB 3QUYD 4WO4C 4OLWL 5DZLA 2ARJA 4ZFFB 4FRWA 1B2WH 4JVPA 5DZNA 4MXWL 4XPGL 1KT2B 1CQKA 1JE6A 1GH7A 5BOPA 3SDXA 5C0IA 3VI4E 3SOBL 4FQ2L 5E8EA 4PUBH 2VKXA 1TMCB 5L6YL 2PF6A 3LN4A 4PJAA 3T0XA 4DZBA 3C09B 3OJDB 4GMTH 4X7CC 1S9YB 1AGBB 2ZUQB 3UPAA 1B2WL 2WINB 1MQ8A 5DRNA 5EZIH 4X9GA 3X12B 2VXSL 5C71A 4LKCB 5E2WL 5HGGS 1JMZA 3FFDB 4PRHE 2JJTA 1FSKC 3ULVL 3LIZH 4L3EE 1BFVL 1ND0B 1HSAB 4NZUH 4PY7A 4Z95H 1X5JA 4Z0BH 4Z5RB 5ADOH 2AK1H 3LKSA 4KK5D 3VD7A 4HIEA 4PJIE 1SBSH 3D0LB 1SY6L 3MRKB 2WBJA 2O61A 5L2KB 2X2YA 3MRCB 4FS0A 2LQRA 5D6CA 4PJ5A 5HYQA 4HUVB 1BQHA 4R96A 4LVOB 1NMAH 5AWNH 1U8PA 3K46A 1OAYL 3CDGB 3WXWH 4NNYA 4JRXA 1RQ5A 2BVTA 4NSKB 4GAJH 5C7XH 1NFDA 2RCSH 3RZCA 4PJ9C 5EIIB 1DBKH 3I50L 4HCRH 4D94A 1UM6L 5HYIA 2OSLA 4G8EB 4IBLT 3G9VA 4RMUA 5I2IA 3PWVA 2DQJH 1V3LA 2C4FT 1H0DA 1UH4A 2FJHB 4KROB 4RAHA 4U6VH 4IHOA 5DMIH 3HMWH 1J0HA 1PJ9A 5EUOF 4WWKA 4BQ9A 4W6XB 2Z31B 5J9PA 1X9QA 1YJDC 4LAJH 3O6KL 4Y2DC 4U0RB 4FFWD 2SEBA 4AEIL 1EXUA 4JKLA 1FNHA 3BP6A 1RJLA 3EZ8A 2P43B 4A2MA 2EH8L 4Y4FD 1UXWA 1V3KA 3BT2L 3GSUB 4LCWE 3W0WD 2ZJSL 3SDXB 3MREA 1RUQL 7FABH 4RNRA 4YXHL 3W5NA 1XIWB 4JANB 3L3JB 2PNDA 5DD1H 4UINL 3FONA 1H3XA 2XN9D 4U1SB 1IGFL 3STZB 3UYOD 1KCKA 2W60A 3BD4A 3G5VB 3HE6B 5F7EH 4FTVB 4MJ5B 4OJFH 1VADA 5INCA 4L5FH 1NSNH 2OS7A 2GITA 3MJ7A 1H8NA 1SYSA 4HAFA 3MCG1 5DVKA 3O9WB 5L0QB 3TO2B 1B6UA 3MRBB 4LKXB 1OSZB 1MCKA 1IAOA 2CUMA 3TH4T 1VDGA 1CFQB 5ILTL 3S3JA 2F53E 1OOAA 5MEOB 2MFNA 1FGVL 4X4ME 2HWZL 3BRGC 2A6JB 3VH8A 5B3NA 3RTQD 3V52L 1M6OA 4FP8H 1DLHB 1RIUH 1NFIA 3QEUB 5HYQB 4HUVA 2MQ3A 4FFYH 2Q1EA 3C5ZB 4ZUVB 2DWDB 1U91B 2GQHA 2W59A 4JJ5A 3MLZL 4WWKC 5DD6B 2YA0A 1OTSD 5HTSA 3BPLB 3REWB 2UY7A 1CBVL 3WS3A 2X6MA 5GISH 1EVUA 1G7MA 5DVNA 1CD0A 2HH0H 4YZFF 3HNVL 2OLDA 4HWEH 4G6MH 2YRLA 3BE1H 1P2CA 2F19H 3V5HA 1BX2A 5F96L 3BDYL 4UILH 4UTBL 5EZLB 4MJIB 4MSWA 5GJSL 3DX7B 3MXWH 1WK0A 1RPQA 1NFDE 1OSPL 3CK0H 3FQUA 1PVHA 4EOWL 3CFBB 3V4PL 3F6LA 4I1NB 2VQTA 5A16A 1UWEH 1F11B 3DX9A 5SWQB 1T89A 3V0WL 1N26A 3RPIB 4WWKB 2O5XL 3DVNA 4R2GB 3QQ3B 2HN7B 4HZAA 4KZDH 4UNVA 1FZKA 5DJ8A 1I1AC 4X6FB 4PP1C 1TITA 2XPGA 2X7LA 1NPUA 1S7TB 1BAFH 4DN3L 5MP6H 1MHPH 5D96B 4PJ7B 4PTTB 1NDMB 3EOAA 5D70L 4HUUA 1S8DA 5DHVB 3BP6B 3P4NA 1X5GA 5C1MB 2P49B 2OYPA 2FATL 3SE4A 3S35L 4PJIA 3SKNB 1RVFL 4ZTPH 4JPIA 1BWMA 5E8DH 5ENWA 5GSVB 5I30L 5FGBA 3C8KB 4PJ5D 1JYXA 4JN1L 5CEYB 1CZ8L 1LO0L 1JCKA 1P1ZB 1A0QL 2ADIB 1TJGL 1Y6NR 1I3UA 5CCKH 3O45A 4GBXB 4HXAH 1J8HD 5KSUB 2DQIH 5I17A 5F97E 2UZYB 1IC5H 2CK0H 3QEHB 1MFCL 1FO0H 1I85A 1BJ1J 3JWDH 4JB9L 1D6EA 1BECA 4IIQC 43CAA 3CPLB 2Q8AL 5B4MC 1MFNA 5EOQL 2E7LC 3KVQA 3VD5A 3EO1A 4LLQB 1E4XL 2D3VA 3BKJH 5GJTL 3RVWD 3QUXA 3ZTJH 2X4QB 1V05A 2NY7L 4LNVA 3H9SD 5EOCJ 3W82A 1JNNL 2P5WD 2X4NA 1TZGH 4CL7A 4MA8L 3L3OB 1BF2A 2JB6B 1V7ML 5ILTH 5T3XE 3U4BL 4L1DA 3MRPB 1QBBA 1CXHA 3AREB 2ITDB 5IK3A 4DVRL 2EYTB 4JG0L 3PWPD 3CFBA 1ONQB 3HUJF 3RGVC 2JJUA 1G1CA 1X6NA 5D1ZB 1MREH 2XN9E 2H26A 2CLRB 1YQVL 2V5YA 1PKQA 5GS0D 3FRUB 1TJIH 2ZNWA 3HE7A 2EEAA 4HS6B 3ZE0F 2CXGA 3P77A 4YHPA 3FAXA 5FEBA 3TP4A 3TWCH 1GCFA 4XC1H 3O6FD 5DS8B 4BSWB 2B1HH 3G5VA 3NAAL 2AJ3A 2FBOJ 3O4LA 4ZUWA 1M7IA 1S5IL 1MAJA 3IKCA 3H3PH 2HA1A 2X4TB 2I24N 5DTFB 2DJUA 4OGXL 4M7LH 1FFOA 3DJ9A 2NY0C 1X6LA 2JTDA 3QUMH 3ZDYE 4ONGH 3S6CA 4ZUTB 4AENA 2V2TB 3MV8A 4HWEL 1LP9B 5J1SC 5CD3A 5IFHL 4KJQC 1VKXA 5ICYB 2BP3A 4I3SH 2HG5A 4UMGA 3FO1A 2CKBH 1PLGL 4KQ4L 5HI4D 1OAQL 4LCIL 5D7JA 2V5RA 3WJJC 1I8LC 4RGNE 4DTGL 1KUMA 4XBPA 3UP1A 5M95B 4G8IA 3J7HA 2J8UE 1T0NA 1D6EB 3NBNA 5TFSL 4HG4K 2RCSL 5D7IE 3RI5F 2BNRA 2ZPKL 2HP4A 1G7PB 4Y4KB 3OJMB 4TVSa 4YDKL 4YHIB 2XIDA 2XTJB 2JIXD 2HRLA 2VR4A 4RBPH 4WTXA 4P46D 3LMJH 4MD4A 1Q8MA 4L3CB 4UDTA 1JRHL 3DO3A 5JO5B 1KGCE 1D9KA 5IROC 3H7LA 5DJZB 3WUWG 4LP5A 1YEGH 3RUGE 2E27H 5C2BH 3QNZB 4WJ5B 5FCUH 5MERA 5BS0A 1OAKH 4WFED 4DKAA 3VWKA 1F13A 4M62H 3BEWA 4MNQD 4AQOA 3LQMA 3P9MB 4NN5B 5C0DB 3ECBB 4JQVA 3BAEL 4GMTL 4TVPE 3EYUL 1NLDL 4WFEE 3BP4B 1DUYA 3WFDH 1Z2KA 4KKAC 3EDFA 1RURL 1OY3B 5E03A 1BZ9B 4KHXH 4M03A 3QDMD 1VSCA 2WBWB 1CFSA 1M7XA 3FO0H 4XPTH 1FH5H 1MJ8H 4UDUB 1IRAY 3AU1B 5D1ZD 1HXYB 5KVMC 4JFOB 3VGHA 5GGRA 5EWIL 3SGJC 1MFDL 4AH2A 4LPTA 1ETZB 5C0JB 1TNMA 2IBZY 3BSZH 5I16B 3CGTA 3MNZA 4JDVA 4Y2DB 1JGUL 1P4BL 1XCQB 4WUUB 4JRYE 3ZTNL 2XY2A 5DMKA 1SJHA 2DMCA 2OTPA 1NGPH 4X4XB 3ARZA 3I6KB 5B21A 2IAND 3KHQA 1OGTA 1ZLUH 3MRDB 2JELH 3ARGA 4HPOH 1SBSL 1FYTD 2YRPA 4LHUG 1JPSL 5EN2B 4XVJH 2R1YA 1UM4H 1DZBA 1AXSB 2YPLA 1ZLSL 4G42A 3BZFA 5ADPL 4G7VH 4ZUUB 1W72H 5BQ7B 1JGDA 4HK0A 3X11A 4UOW0 1FFRA 3FQNA 2FL5B 2VAJA 4M43H 3DV6A 2NY0D 1CGYA 5KSBE 4K3HA 5GS0H 5L0QC 4XGZA 3ZL4L 1M7DB 1CQYA 1IAKB 2O5YL 3T3PF 4EXKA 1AE6L 5CSZB 3QCVH 2BHZA 1UQSB 2NW2B 2NZIA 4JO3H 1J1PH 4XXDB 3FT2A 5FFLA 2Z91A 3S7GA 1FBIH 5FV2A 4GRLB 4YK4C 2NLJB 4EDXA 3KPQA 2QQKH 3ES6A 4MLSA 3Q3GA 5IESH 1FNEA 4U1GC 5IEHB 4DFIA 4PJGB 1U8OB 4H0GA 4W6YB 4OZGF 1RZ8A 4L3EB 5K9QG 3TA3A 2A6IA 1C5CH 4ZXBA 4WFHE 2Z4QB 3FO0L 4AEFA 1MCOL 5FO8A 1B0RA 2FX8H 4QHLB 2JLLA 1KXVC 1A3LL 3E2HC 4GW4B 2F74A 4OKVA 5C0GA 1WEJH 4P9MH 5KVDH 5D72L 5D7JD 2QR0A 4K9EH 3ZDXF 2MHAB 3WJJA 4C54A 4RRPA 5DD0H 1RUKL 3GMQB 1QO3A 2W0FB 3PE9A 4RISL 5JIKA 5JDSA 5BW7C 2NX5B 2HKHH 1EUUA 2HT2D 5JQHC 2B5IC 1NBZA 3O81A 5FYJD 3EJYD 3DX6A 1KPUB 2JIXA 3MXVH 4XBGB 5HHNB 4XCEB 2AJYH 3LMJL 5F1NB 4BUGA 5JOPE 1QKZL 1NMCB 5SV3A 1INEH 3GMRB 2R39A 3K1KC 2VDKH 4M6ML 3MCLH 2QL1A 2DM4A 4G8GE 2BNQB 4LLUA 1EHXA 3R1GH 2EEBA 3VMOA 1E6OL 5IMOA 2Y36H 1FYHB 2FZ3B 1WQVT 3G9AB 2XQYK 4JQXA 5D2NA 4QRUB 1S3KH 4DJMA 2APFA 1OGAB 3QH3A 4M5YH 3SE3A 3SCMA 3NH7L 1ZVSB 5IR1A 2E6QA 5DI8A 4EKXA 4FXGA 1CD1A 4K3DL 2R2BB 1PG7H 4N0CD 3IDXH 2PO6D 3C6SB 1GC1L 1DJSA 4QTHB 3JV6B 4KQ3L 3NIFE 2FD6L 2M2DA 1N6QH 1RZ7L 3P73B 5ICZA 5KVFH 2PW2A 3WLWD 2DF3A 3NCJL 2FRGP 3RWHB 3MLSH 4RQQA 1GGYA 3ZE1F 4LEXL 5EU4B 4AYFA 5MHSE 1Q0YH 4ZSOE 2CMRH 2R29L 1I3RB 5MEPB 5DQ9A 4WHTB 3JBG7 4YUEH 3NCCB 5MEQA 3REWA 4M48L 1K6QL 5M7QA 1IGTA 3BGFC 5IGXH 5JXAL 1JK8A 5EU3B 2FCBA 1KJMA 3V2AR 4F37K 3O3DB 2E7CA 3SKUD 2V17H 4NM8H 1S78D 3FFCE 2YUWA 3BN3B 4RFOL 3TBVA 3FQUB 3Q6GH 4OFPA 3KDMB 3BH8B 2X41A 2O5ZL 3P30H 4OV5B 3MODL 4M4PA 5IB3A 2B0SH 1HH9B 5HPMA 4NP4L 1OSZA 3WL9B 1EAPB 2EDTA 4MCYB 4LLAA 4ONHA 2EDRA 1HHHB 4DCQB 4I2XE 3DMMB 1DQMH 2VDOL 4S0SD 1I9JL 3ZYZA 1XR8A 3KJ6L 2P8LA 5BVPH 3GJFK 1IGCL 4I9WE 1MRFL 2OR9L 2HLFC 4RMVA 1QOKA 5IBUG 4NCC1 1PQZA 3PQYD 4Z8FH 1I9RL 1V3MA 4N5ED 3X14B 3QEHA 5D1XD 3V95A 4WEMB 3FCTB 4QWWC 4XNXH 4TULH 5J56B 1TETL 4JKPH 3D39A 5CEZL 3GKWL 1I7UB 1Y6MR 3CFJB 3PIQA 1OCWL 1NBYB 1U2HA 4U6YB 4M93C 3LQAH 3U4AA 4OF6A 3ZE1E 4HWZB 3MFGB 3BWUC 4X6BB 5IV2B 1VA9A 4J3XA 1JPST 1T1XB 1NGZA 1UWXH 3QUXC 4KUZH 2P7TA 5F7LB 2V9TA 4IRJB 2BVUA 3JZ7A 5DHYA 3GKWH 1S9KC 4F7MA 2WAHA 3AS1A 5F6IC 5T3ZE 4X6CA 1BPVA 2EDDA 1SEQH 2AERT 4OD3H 6FABH 5DZOA 5JW4Q 3C8HA 3WYRA 1T03H 2WW8A 4OCYL 1IAIH 3LEVH 5CZVH 2J7LA 4K3JH 2OQJB 4YXKH 1UVQA 5F88A 4H26A 5GXBB 3HTLX 1EHLH 3QDGB 1OP5H 3GSRB 4JM2B 2Q76B 2Y7QB 1E4WH 3QXTA 4XBEH 2A9NH 4H8WC 1FQ9C 3DSFH 4FZEH 2LU7A 2QTEA 3BX7C 2DQCL 1QNZL 3BH9A 3VFWB 3PWPE 4OQ1A 1Y18B 3RY6A 1CN4A 4U6HB 4MAUL 4XAWL 1NAML 4C57C 3U0PB 5DYOA 3WJLA 4KKNA 2V17L 1I3GL 5IF0B 2I07A 3QH3B 3MLZH 2DYPA 3NTCH 4OB5L 5BJTA 3CDYA 3QCTL 4TUKL 1DN0A 5JA8B 1MF2L 5KS9E 1NEZA 4UIMB 1K2DA 2YD2A 2GUOB 4D0DA 1OLZA 2VE6A 5JOEA 4H8WL 4PV9B 2J8UA 3VFNA 1EHAA 1PQZB 2PO6A 1FZMB 4KK8C 5KOMC 3VXNA 2I9TB 1VACB 3I3EA 1JZ7A 2IG2H 3EAKA 1P4LA 3RVTD 4N0UA 4OD1H 3GIZH 2GCYA 3F62A 3GBNH 3V6FB 3B6SA 1LEKB 3FAWA 3P0YH 5GPRA 4OZ4B 3T0EA 5TPWH 3S88H 4DGVL 3QFDA 3FFCD 1FNSH 4K3JL 4PJDE 3D0VA 3FJTA 1RUQH 1JNHA 4HH9B 1A4JA 3IF1A 4JFDD 2DQUH 2DOCA 5D9SB 4PJGE 5B3JE 2EIEA 5KJRH 1QRND 3C8DA 3VG9C 4KRPB 4XMKH 4WY7H 3ZHDA 3PHQA 1CLYL 4NRYB 4C56D 2A38A 4FFVC 5BO1L 3W9DB 4X5XA 3ME0A 4OD2A 3KPSD 1NMBH 3BJLA 2NZ9D 1QR1A 1LQSR 3EGSA 4YHKL 3QO0B 1GYAA 4O00A 4NRXB 1W0WA 3HE7B 4RNRB 4GQPH 5T1KA 2GTZA 1XGUB 4PD4K 1FE8L 4XX1E 4HKBB 4L8SA 4S1QH 5EBLB 2FSEA 1N6UA 4YIQA 3CMGA 4Y4HB 3MNWA 3VFWA 3VXPA 1X4YA 3MQIA 3GSQA 5I1GH 3EYSL 2QBWA 3F65A 1NGXB 2VB5A 5L7XL 4FZ8L 4K7PY 1W72B 4RFNC 5C0DA 1LK2A 1JF6A 5MEND 3S9DB 1SY6A 1DDHA 4D3CL 5D72H 2BHYA 1C12B 1BJMA 1Z5LA 3MGOB 4FQXD 4UQ2A 3NABH 4PREA 2P7TB 5JO5A 4UI2A 1GZPA 2XWBB 3UMTA 2YPLE 2GSIB 4X5LA 3QQ9D 4Y5YC 4XP1L 1YYMH 4ZPVA 5LWYH 5TE7H 1T0NB 2A73A 4XWOD 2GK0B 1LD9B 2O5ZH 3GSNH 4LCWB 1OB1A 1FG2B 3GBLA 4OF8A 1GSMA 3ZKMD 4RMTA 2XOTA 5FA4B 4PJEF 3VXUA 3LZFL 3AFLA 1U8QB 5A16B 4I18C 3RUGB 5D5ME 2OI9B 4Z7UB 5F3BA 3QWRA 3VH8B 3ROLB 3JVGC 4L4TA 1A4KB 3VXUE 4P2YA 1FYTE 1WJ3A 2IBZX 2BC4B 3VI3F 4K3EH 4S1RL 5JW4R 4HV8B 1WIUA 3UTTA 5I15L 3RU8L 4MJ2A 2FX9H 5GS1C 5LAXA 5KVFL 4QXUL 4E5XB 5I1IL 1I75A 2FR4B 2H6PA 2YC1B 3K7UA 2ILLA 4DUVA 2YD9A 5SWSB 1JPGA 1MFBL 4V2BA 2IADB 1O0VA 2OCFD 3RQ3A 3KXFE 2XZAL 2Z4QA 1N7ML 4JEGB 2ORBH 3FMGL 3E8UL 1Q9OA 4NQVA 4MZ2A 5FGSA 3HI1A 5JW3H 2Q87A 4J3VA 1NCWH 3QJFB 4Z7VE 1KCRH 3C2AL 4ZYKA 4BK4A 4I3RL 4ODHL 4EDXB 1HIMH 3MBXH 4KKLC 1CGXA 2OXGA 3SKJH 4HC1H 4G42B 2NPLX 4ZAKA 2A77L 2D7OA 3EOTH 4MA3B 3C6LD 1JZ4A 5A1AA 4K71B 3RWDA 1IMHC 4ODWA 1QRNB 1AXIB 5IT2L 2Y4SA 1SJEA 3MROB 3T4YA 3L6FA 2YWYA 3U1SH 4O58H 5MI0B 3GK8L 2DLFH 3ULUE 4URTB 5CSGA 4PJXF 2V6HA 4XCEA 5BZDA 1B4RA 5C8JA 1JNHB 5DJ0B 2QLVB 3MCKB 3MLVH 5HHOD 4D3CH 1GXEA 1YEDB 2PYEB 3GJFA 2EIDA 5L2KD 3MJ6A 2P24B 1AY1L 2QSCH 3QAZB 3W81A 4K71C 4QYOB 3GMLA 3I6LE 5GRVL 3QB7C 4QRRB 3K8MA 5EZJA 4NWUL 1CF8L 3QWQB 5HI3D 3SCMC 4KGLA 2F58L 4G8FB 4BFEA 3TYGH 3HFMH 4FTVE 4I77L 5E2VH 1HQ4B 4OUUB 1RZKH 3OV6A 1IKNA 1KIPB 4Z77A 3VFVB 1Q72H 1R3LA 3BPNB 4ETQB 4QRPA 1U42A 3HRZA 3RDTB 5LVEA 4MB4A 1MRDH 3I85A 3CMOH 4TSBH 1MQKL 4R0LB 5JHDE 5TE6H 1R3IH 3TH2T 1CCZA 5IB4A 3RL1A 1H5BA 5ID1A 2BFVL 5DHVH 1MJJB 5B8CA 1KJ2A 1AGDA 1HI6B 5DJAA 5E1HB 4X7SH 4NJ9L 4U1LA 1OTUC 1UCBH 1JYNA 3GBNL 3VFPB 5EH1A 3C60B 1L9NA 3BPNC 3IU4L 1T3FB 2A83B 1QQDB 3C87A 3GIZL 3RP1A 4R9HA 4KTDL 1T1YA 5EO9B 1JPSH 3VFSB 1UWGL 1KIRB 5CEZE 1A1NA 2JELL 4NQEB 4KAQH 1HSAA 5MEPA 4HC1A 1J7VR 4BSVA 2R8SH 1FV1A 5K59E 3UTSA 2A6KA 4M1CD 4YPJA 5CD3B 2N4IA 5TQ0L 1NAKH 3IJSB 5GRJH 3LZFH 2Q7NA 35C8H 4LDEB 2V7NB 5BRZD 2P24A 2J1KA 1EJOL 2W9EH 1JIBA 3NN8A 4ISVB 1T2QH 2DQTH 4PJ9A 5I1AB 5I73B 2BSRB 2W0KA 4BFIB 3D18A 1K5NA 5HJ3B 5CILL 3LD8B 3IAGC 3LRGA 1B4JH 3L5JA 1ZGLP 2W9LA 2KBGA 1GGTA 1MCPL 3RAJH 4Z7NE 3NFPA 1YYML 4FMFA 4M6AA 5KTEL 1F3DH 2CRYA 1E4WL 1H3PL 5E8OB 3DRTB 4PJHF 5CIPB 4YFDB 3T4AB 1NGQL 4ORGA 5HY9B 5IIEB 1A5FH 3EZJB 3WBDA 4CGTA 1PKQB 4K8RH 5MEQB 2HJLB 3OSKA 3TN0C 4POZD 5E5RB 3UC0L 3G5XA 4WRLA 43C9B 3ZSSA 5TJWK 1KC5L 3TA3C 5I1JH 6CGTA 1GIGL 2A9MH 2R2CA 1BF8A 3C08H 3L3GA 2QQNL 1UWXK 1CTNA 2HVJA 4XCNA 3JWDL 3WDJA 1F2QA 3BH8A 1IFHH 4F7EA 2VISA 1NQBA 4BYHA 3M17A 3CLFH 4AT6A 3U46A 5T5FL 5KAQF 1EEYB 4PJCA 2CXKA 4X6DE 5C0CA 5D7LA 4TN9A 5IV2A 3GHEL 5BV7C 1QSEE 4WW1A 2VLKD 2D31A 4RWYL 1RZGB 3EHBC 1L9MA 3L3DB 2Y23A 4JN2A 4LPUA 2DWEA 2AJUH 1HKLH 3ZE0E 3MLYH 2IPTH 1C5BL 3D48R 3CCHB 5F72S 2DLHA 5CAYB 4XCFL 5INDB 5E5MA 2IJ0C 2YEZB 1NKRA 5HDQL 3B83A 3Q5OA 2YD4A 3TT3H 1JRHI 3MR9B 5ETUA 2R2HB 1G6RH 2ZWLT 4CW1A 1EGJH 3ULVF 3PJSB 4EBQL 2W65B 3HG1B 5IF0A 4Y2DA 2EDYA 4LSTL 3Q48A 1CGSH 1I1YA 4JREB 4WO4A 1A3QA 5I1KH 3KJ6H 4F3FB 4Y0GA 1TNNA 2C3VA 3VXSE 4K8RL 3BI9X 3CDCA 3MJ8A 2XG5A 5KZCB 4MD4B 1U2CA 1HHJB 3B5GA 4MNHA 4EOWH 2AKRA 3CFEB 2KH2B 1KTKE 4OF3A 4E41B 1L6XA 5C9KA 5J6GB 3NCEB 1IEBB 2AJXH 2CO7B 2QADC 3BZ4A 3QXAB 1ZHBA 1UENA 4LHJB 1MIEL 1U8HA 2BVQA 4XXCA 3SY0B 3WIHH 2R69L 1RJLB 4ZFZA 4HF5L 2CLVB 5CJBA 3WKMH 4Z7QE 1HHKA 1KELH 4RMQA 3EFDL 1A7BA 4RFEB 2CH8A 1LEKA 2ZCKL 5SX4I 3EYVA 1J1OH 2VQUA 1A3RH 1F3JA 1S5HA 4OB5H 5ESQB 4OCWL 4JFEE 4MVBC 1CXIA 3VXRE 4JPWL 4Z7UE 2VSCA 3GSXA 5GGVH 3L3GB 1IL1B 4ZAKD 4JHZA 3MYJA 2GTWA 3QDJB 3C5ZC 4O4YH 4AIOA 1U8IA 2HTLC 1FNEB 3GB7B 5IBLC 4FG6C 2YPKA 4G43A 3RL2A 5IMMA 4I5BB 1KIUA 1MCWM 3ROOA 1MLCB 2NY7H 5DFTA 4DEPB 3JV5A 3IDXL 3C6LA 2A6JA 3LS5L 3KPMB 4UINH 5DRXB 5IMLB 1X5XA 2KKQA 2RFXB 2WANA 5E70A 4K3DH 1RFDH 2NYYD 2DTMH 2FIRT 2GUOA 2FH6A 3QIUA 1CDJA 3GMNA 1YJDL 3D85A 5F1IA 3T3ME 4JFDE 3WS3B 3RWEB 3F6IA 5FK9A 4AEEA 1TZIB 2V2WB 3H7BB 5SWSE 1KTLB 2NY1D 1I8KA 1GL4B 1LK3L 2AP2A 5KSBB 2Y36L 5DQJB 2AJVL 1U3ZA 3THML 2YD5A 2H2PC 4HWBH 4JGMA 1RZKL 4XCFH 4MS8C 3RZCD 4JO1L 3HZMA 3OAZK 4LU5H 4FMKA 1K8IA 4TNWF 1FO0A 4UIMA 4YAQB 3GMOB 3O2DA 3VXPB 4RWYH 1RVFH 3CIQA 4P2RB 2X4OA 4NQEE 3WSQH 5DJ2A 3IFNL 1AQKL 3LKPB 5ACMA 3M1BA 1IEAA 1WWWX 2XFXB 1UM6H 5D1QA 4ZPVB 1WZ1H 3IVKB 1F3DJ 5DEZA 5C7XL 3HS0A 4U1NA 1U8HB 2QKIB 4XVSL 5B39A 1BBDL 1LO2L 2QQNH 4GBXC 2YXFA 1CTOA 4TRPL 2CUIA 1HYSC 3DVIA 5KSAA 5GZOD 4RWHA 3I9GL 2ZUTA 1MCJA 4J23A 1S5HB 1XGYH 3FQRB 3IJYB 1J8HE 2XWBA 1ZA3B 3D1MC 4FXGB 1QHOA 3ORJA 2VAAB 1A5FL 3N1PC 1WBXB 5JIHA 3GK8H 5DDHB 1CFTA 4CN1A 5TF0A 5DVOA 3UDWA 5I17B 2F19L 1J8HB 5EUKA 3RAJL 3HNVH 1KB9K 2EXYC 1CXEA 2BVYA 4YH6A 4F7CB 1LK2B 3EOTL 4PRPE 1CBVH 3S5LA 5K9QI 1LGVA 3QFJB 1EJOH 3SGDI 4JM4L 3CVHH 5T1KB 2P5WE 3B9DA 3T09A 5D1QD 5IHZB 1U3HD 3FB7A 1BZ7B 4ZPTA 4NKMB 3EOBB 1ULVA 3KPRE 3BPOB 1CDIA 3OR7B 4F57H 1HCFX 1HN1A 4IDJL 4MXWH 4JHAL 1PG7W 1AGEB 2C1OA 2Y25A 5AUMA 3MMEB 3C9NA 2ZCLH 2E5EA 1UM5H 1OP3H 1W72A 3HCVB 3GJEB 5SWSA 3ALXA 4LSPL 4LPCA 5DRNB 3OG4B 2VWEC 5C08B 2XZCL 1NBYA 4MNQE 3HZMB 3QO1B 4GW5B 4HULB 1JV5A 3R06A 4NYLA 3S3SA 5IBLD 2B1AH 1DTUA 4KMTL 1HOCB 4L1HA 3LAFA 5GGTH 3SJVD 1G9MH 2NY0B 4L3CA 4RMSA 5EFIB 2DKMA 5CJQL 4HEME 4GKSA 2P46B 4GXUM 1HH6A 4RDQF 5K9OB 1S3KL 3QHTC 4FFWC 3GJFB 4FHBD 4P3DB 3HS0B 4U1NB 2OTWB 3ZO0A 2FO1A 2OK0H 3B4NA 1BVKA 4LSRL 3WUZA 3GHBH 4MWFA 1FFOB 4N1EA 4Y4FC 4TNVK 2Q86A 5EU6D 3RGVA 2DJ4A 2NY4B 5EC2B 1TJHL 4HGWA 1F02I 4PV8B 5F9WC 2M8XA 3HMXL 2CDFA 3LH2H 4QOKD 5KSVB 4E42B 5I2IB 1OGAD 3GO1H 1LEGB 2ID5A 2KPNA 4NZTH 2YN5A 4GLRH 2F58H 3QXDB 2JB5L 5D6DA 1GPOL 3AB0B 3LY6A 5C6TH 4YHMH 5TH2A 4HSQA 1C16A 4JFOA 2V9QA 2YK1L 1B6DA 1CI5A 3BESR 4GG8B 2BVPB 2JCCF 1RUKH 1C7SA 1I1CA 3OX8A 5FCUL 4XHJD 5I1GL 3ULVC 4JO4L 2E9WA 2MNUA 3QWOB 2ZOKA 1QPPA 1MRCL 2LABA 3TLRA 4BH8A 5HYSG 1CU4L 3MZTA 3VFOB 3JWOC 5DJ6B 5FYKD 2G60L 2VL5A 4BZ1H 2ERJC 5LBSL 2R1YB 1R3LB 2VDNL 5KVEH 1F5WA 1Z9SA 4YDLB 1XR8B 4WJ5A 4UB0H 5EZIL 5KN5B 3Q2CA 2CRMA 4D8PA 1HNFA 4L4TD 2ZPKH 4QHKJ 2DS4A 2B2XL 2QKIA 3E3QC 4X80L 1DEDA 5CGTA 4POZC 1UXWB 3GSUA 2XRAL 3L1OH 5JHDD 2AXHA 4CBPA 5DJAB 5E99H 1OP3K 2DQGL 2R56H 4XCCL 3LKOB 3K2MC 2LTQB 1PLGH 4KQ4H 1VGEL 1P4IL 5IVZB 3WDIA 1G9ML 2C3GA 1UFUA 1CDUA 3UTZA 2DWDA 4V1DE 4OLWH 1NKOA 1F2XK 1WWAX 5E4EB 2GT9B 5GGTA 2XZQH 3WCYA 1NGZB 4OGAC 3KPQB 4TSCL 4P4KC 5IJVB 3TBTB 4NQDE 4HS3B 3MSPA 3UPRA 1F90L 2C3HA 4OGXH 1RZIB 4DKEL 3AY4A 4M93B 4Y4KD 4LDOB 4NO0B 3SDCB 5JORA 4M5ZL 3OAUL 4RGMC 4MQ7A 2AJZB 5EA0L 2OTUB 3BP5B 3RWJA 4NBZB 3IDMB 4OIAA 5FUOH 4G8FA 3BXNA 4YR6B 5ACLA 3MJGX 4L8CA 5J8OA 5F6IB 3MV8E 5E08H 2Q7YB 1TXKA 4W4NA 3RVUD 4WV1A 2APWA 3WFHB 4TVPH 2R0LL 3HC3H 3T2QA 3NFNA 3V6BR 3RNKB 2EDKA 5IQ7L 4F33B 3U83A 2BSSB 4QNPE 3MYZA 1ZHNB 1JHLL 1T1YB 2DQHH 4P2QA 5HY9A 3MA9L 5GZND 3TBYA 3W0WB 3R06B 1N59A 1TZGL 2G60H 3BVNA 1CE1L 5CIPH 3A6BL 5SWZA 5B38B 4GRWH 1KCSL 4PLKD 5J57B 1A6WL 4Y16C 3TVMC 1ZANH 4JY6B 4XVUC 5EOQH 4TRPH 5FUZL 1GGUA 5FKAB 3T8XA 1FNLA 3RA7L 3WD5H 3SE3C 1BBDH 1LEIA 5HHVL 3T0ED 5KG9A 4Y1AB 4HFUH 1QBLL 1RIVH 4PJFB 3CFCL 3MLXL 4C56B 3NCYP 2F54D 3RJQB 4KVNL 4XMLH 3L5WB 4I0CC 4WI7A 5CEYA 1A0QH 4M8QA 3IJSA 2OZ4A 1PG7X 2PCPA 4UOJA 2DQEL 4QXTB 3LH2L 1ZKAA 3ARBD 4DKFL 1PX3A 3LPGA 1JF1A 3IF1B 5FGRA 4WW2A 4XP5H 1A7NH 4FQCL 2JB6A 1KG0A 2VLRD 3MLWH 4WVRA 4ZQKA 1OP9A 2CRZA 1PEZA 3PV6B 2Q8BH 3MRJA 1YNTB 1FG2A 1K3IA 4JFED 3PGFL 2OTUA 2X70A 3UTPE 1N5AB 4KJYA 1RJZB 5LJYH 15C8H 3UCRA 1II4E 1DANT 1YY8A 1YJDH 4F9PC 4ZXBC 3VXSD 2Z93A 4G6AD 5T3ZL 4Z7UA 5CP7B 3RIFK 1C7TA 4RGOH 3GNML 1X4XA 5IW1B 4GSDH 5D5MA 3QRGH 5LGHH 1R0AH 1W0VB 4PGEA 3MV9B 4U3CA 5IJKA 2VLKA 1WBYB 4UT6H 4OUOA 2VISB 2VTFA 2DL9A 1SJEB 4LGPB 2CLVA 1T5XA 1S5IH 5C07B 1ORSB 3VXRB 2CIKB 1WC7A 2IPKB 2X42A 1F4AA 2OL3L 3W2DL 5IBTH 1T1WA 1K3ZA 4KKCD 4MA1C 2IWGA 1WAAF 4UV4H 1LE9A 2W9DH 3C8KA 1FNAA 3MRCA 3GSNA 1OT2A 5HHMD 1N0XH 3V52H 2ADFH 3EFDH 3W39B 3QI9D 5F44A 1BGXH 1UXSA 4WI5A 2BX5A 5FYJH 1E27A 5F9JA 1DBMH 1QNZH 3HKFA 4MA3A 3RTQA 1RD6A 1RZ7H 1YUHB 4BFBD 3C60D 3MBEC 3TO4C 3OJVC 1AH1A 2IH1A 2UUDH 3RJDA 4YHIA 1DVFC 1MH5B 3HE7C 4GSDL 1FYTB 4JFZH 2NY6B 2ICWI 2EIBA 3H9SB 1H8SA 4OZIE 3L7EB 5EU6A 4OI8A 2FWOA 1N4XL 3U6RA 1GGIH 3LN5A 1FL6B 1GHFH 4MJIE 2ZJSH 4KUCF 1ZHKA 1JPTL 4JZNA 1B88A 4H1LH 4BKLA 1BD2E 4XH2A 2Q8AH 3F5WB 3DMMC 3O3DA 4E41A 2CKNA 2R0KH 4IRSD 1E4XI 4KDTA 4KY1L 5EO1A 2SEBB 4MA7L 3TFKD 3IYLW 1NGWA 1MCLA 2D4DA 3EDDA 4HLZG 3SE8H 1N5AA 2RJMA 2VZUA 4OM1L 4I18B 1A6TA 5IW6A 5DRZA 4GW1B 5I6XB 5TGBA 4XX1G 1FNGA 5JIPA 1FO0B 2PYEE 3MREB 4U1GB 4Y4FB 5I1HH 4U2YA 4G9DB 3BQUC 1JF5A 1PW3A 5ESQA 4ZD3H 1HHIB 2Y07L 2ZNXA 3G6JA 3FONB 1C1EL 4X6DF 3QZWG 1FIEA 3CU1A 1UACL 5FYKH 3QNYB 1CK0H 2Z8VC 3V8CA 1G6VK 5KOVC 4LCYB 3ARBC 1TETH 4JKPL 5TF1H 4O02H 3HE6C 4LLWB 1SYSB 3DVGB 1LK3H 1T5XB 3VWKD 3SE8L 1DR9A 4P2OC 1TCRA 3JV4A 4BSVB 4ELKA 4BA8A 4M6OL 3MNZB 4R7DA 3STZA 3T3MF 3GSNB 2UWEA 1I7ZB 1DN0B 1MJJA 4L29B 1P7QA 4LSSL 2PTTB 3A6BH 1JJUA 3G6JE 4K23H 2DQDH 4OF7A 3BO8B 1BQLH 4JRXB 3EO0A 4YE4H 5H2BB 3P4MA 3FQTA 1E27B 3NMEA 1HINH 4NZJA 3BDYH 3MRIA 4HWNA 4UILL 4UTBH 1JHLH 2DQHL 3P30L 3JTTA 3I6GB 3GRWH 4GKNB 2HH0L 3VXME 4ERSL 5IWLA 2OMNA 4OLZH 4KJYB 2P45B 2XKUA 3QR2A 4U1IA 2P5EA 35C8L 32C2A 3DROA 4P49A 2WUCH 3KPNB 3VRJA 1RHFA 5E08L 5DFVD 5EZOH 1ZXQA 1RZJH 4YUEL 1Z6JT 4KK9D 4DAGL 1YC8A 2CR3A 2I5YH 2ZUWA 2R23A 5C09D 2E7LA 1FAIL 2X4UB 3RY5A 5FHAL 4ZXBD 2ZSWA 4PRBB 2WP3T 1TCMA 3VFUB 3VGAB 4PJ9B 2CR6A 4FXKB 2IMNA 3ESVF 3OKEB 1T5WA 4IS6B 1A7RH 2VIRB 5C0CD 1TTGA 3N85L 3VRLE 1QFWI 3O6MH 4PJCB 5KSAB 1W0WB 2EDHA 1BREA 2V2XB 5CSZA 4X7SL 4KZEH 3KYKH 5JQ6H 4HKBA 4NHUA 5BV7B 5I66A 5T3ZH 5FCSH 1YEKH 1LO3L 5GS2D 4F37F 1K2DB 1IQWL 2HTKD 1EEQA 1KJ2B 5E99L 3TBWA 3G5XB 43C9A 4ODTL 4LDLB 2IAMC 4KVCL 3QPQC 4PJEA 5DR5H 2AK4D 2DTSA 5I16A 2HFGL 4WEBH 3L5XH 2AQ1A 2IANE 2Z31D 1X7QB 3D3VE 3UTSD 4P23D 1MJ8L 4P5MB 1J8KA 3V6FA 4DKFH 4FNLH 4GQ9L 1XR9A 5IHUL 3VFSA 2AK4E 3ARFB 2IPTL 2IANA 1NCBL 3OKMA 4ODVL 3UBXB 2VERN 3MXVL 3TZVA 3IDNA 2ZUYA 2HVKA 4YFLF 2HAZA 4POYA 4PGBA 4KPHL 4JM2D 3PABA 4UQ3B 4HKZB 3NA9H 3CLFL 2HKHL 1VB9A 4RSVA 4IRSA 2UZXB 2H9GB 3AMLA 1MHCB 4P46B 2ZSVA 1FL5A 2FH8A 5HDOA 1JZ6A 1OAYH 1K5NB 4PB9H 4F8QA 1A6TB 3VFTA 5IW6B 1VERA 2Z35A 5JW5B 2CLRA 3QUZD 2OJEB 5HHNA 3FOMB 4XAKE 2M26A 3QFJE 5T1MA 4JDTH 3G6DH 4PJXE 2FGZA 3VXTA 3DRTA 3T4AA 1JYVA 3FRPG 1DVFD 5FM5O 3HI6H 4HV8A 2Y6SC 4LOUD 3TIEB 2EEDA 4PJHE 1JBJA 4LSUL 1WT5A 3MNVA 3P4OA 5L8KB 3MLRH 4PS4H 5SX5H 3DHMA 2NY5L 4M1GH 3PWPA 4TVPL 1N64H 2EZ0D 3PDDA 3D0LA 3MRKA 2O61B 1FBIL 4J1UA 3QIBB 4R97C 4NGHH 1YY9C 4ZFOA 5JHDA 1NAKL 1M71A 1NCUA 3NGBB 3MRGB 5ANMA 4AY0A 3H9YA 4XNMB 5HXMA 1I8MA 1S7XA 1HXMA 4YBQC 2YRZA 4GMSH 1UGNA 4JZOA 3FMGH 5IQ9B 1C16B 2NMSA 3EIFA 1E0OB 3JVGA 4Q9RL 3MRIB 4ZFGL 5D71L 4OM0H 4Y8DC 5C0RL 1NJ9B 5K9KA 4R8WL 2MQ0A 3RX5A 5CLWA 1PX4A 1URLA 5I1EL 4LVOC 3N06B 2EKSA 3V6OA 4JQIL 4HPOL 5KZCD 4IJ3B 4U1IB 1CT8A 3D3VB 5E4IA 1AD9B 4OFKA 5SWZB 5BCAA 5EU3A 2DI9A 1NGPL 3MLPA 1BMGA 1A2YB 3PABB 5D1QB 5F8RC 5LCVH 1CXLA 1FVEA 1MHEA 5GS0C 3V5DA 4NO2B 2AQ2A 4DGYL 5DFVC 2BSED 5DK2B 3STLB 1RUAH 3SKMA 4QYOA 2EDWA 2PKDA 3ARFD 4BQ6A 1IE5A 4U1KA 2J3SA 3GRWL 5ISZD 4N8VG 5F1SA 1BOGB 1WCBA 3EOYG 3GSWB 3GIVB 1FNFA 5CJOH 4KHXL 4U6YA 2YZ8A 2XA3A 5CFHA 3MBEB 3TO4B 1RURH 3FRPA 3WFDL 2IH3B 1IAIM 1K8DB 1E4XH 5DJDA 3RWGB 4NQSA 2M1KA 5ESAA 4KK9C 1Z9OA 3IFOA 4LLVB 4M6OH 4C83A 1IM9A 2VZVA 3C5SA 1IAOB 5ALBL 5D1ZC 1O5DT 1DBBH 3RVVC 5F6HJ 3KPRA 2EE2A 1R3JB 5HHOB 3QIBA 3U0WL 2DQIL 1NLBH 2AEQL 4ZS6C 5DT1H 3MLVL 1DFBL 4S1QL 3C5ZA 4ZUVA 2NY2B 3BVNB 3RNQA 5B22A 1D5BB 4ODXA 3F58L 1UACH 2VH5H 3NFSH 3BPOC 5EG6C 5AUMB 1DBJL 2YSSA 4X9IA 4PJ5B 5C0BB 4JO1H 4P5TD 1FJ1B 5FO7B 3LPFA 4OGYH 4HKZA 4JM2A 1NC2B 4Z7OF 4WUUA 2ED9A 3RWFA 3TCXA 4TTGA 3T0DA 3OKDA 3BH9B 3IDGB 4Y4HC 5DK0B 4LLYA 3GGWA 4MA7H 3ARWA 4X5WB 2AXFA 1AD9A 2VR9A 4HDIA 4PJDF 1YQ2A 1S9VA 2GJZA 1LO3H 4XP6H 4NKMA 4Q97A 3VDAA 4CVWA 3OKNB 4FFZL 1N5YH 4NQXB 3LRHA 4APQD 1XH3B 4CDGC 1GZQB 5FYLL 5BS0B 3O3UN 5DK2A 3STLA 3QEQA 1KTRL 1MELA 3HA0A 1ODAA 3ARUA 4GRLD 2E9IA 4S2SA 3R0NA 3ZT7A 4DUWA 3P9MA 3O0RH 5LGKA 3DX8A 4L3EA 1BZQK 1MEXL 2IG2L 3KWWA 3HUJA 3Q5YA 1VGKA 3AAZB 2NNAB 2P8PA 2BY3A 2W1NA 3UTQA 2ADIA 1QLRB 1NBVL 1ROWA 4TUOA 4DEPC 4QHKI 4KK6D 4U4BA 1F11A 1FLRL 3DX9B 1U58B 4JJ5B 5DD6A 4GKOA 4TUKH 4L4VA 4PJ8B 1NCDH 3IDYB 3GI8L 3X3GH 5T1DL 1W0VA 5SX4H 3T0WA 1G6RA 1KLGA 5CKGA 5JDSB 3DX7A 4XAWH 3QYCA 1KSRA 1Z0NA 2Y5EA 4Y5VC 1SHMA 4IMLB 3RBGA 4LARH 3O9WA 2DQCH 3B6SB 4MXQC 1YEJL 4ZS7L 4YE4L 2F53B 3LD8C 3QUKB 1R0AL 1D6VH 1JNNH 4TTDC 1IGYA 1WISA 3GNMH 1N3NB 2WM0A 5KSVA 4YX2L 1JN6A 3WO4B 5E2UL 2HMID 3VDCA 2BDNL 5MENA 5I8CA 1XIWD 4B7IA 4AL8L 2ZOLA 4OZHF 5F70A 1T03L 4N8VB 1JPFB 5IVXE 3UZEA 2VDML 2DLGA 3UJTL 1J05A 3R0MA 4KJPD 3REVA 3KPSA 1RUML 3CFDA 5L7XH 1TCRB 1OLLA 3IDIA 4MQXD 1AR1D 3MRFA 3MRMB 4LMQE 3KPSE 5HI5D 3EW3B 3F7RA 1YN6B 2NTFA 4X98B 1PZ5A 2VC2L 4H5SB 1BFTA 4DVBB 4WHYG 3QUZC 3IKCB 2IH3A 5DVLA 3U79A 4D9RE 2VXVH 2X1XR 3BGMB 5IMKB 3RPIA 3DVGA 1CDCA 5CEZH 5BRZB 1DUZA 5H37G 2VABB 1CR9L 4OGZA 4KKAD 1H9VA 4PRPB 1QSFE 1ZHBB 3BWAA 3L9RA 4KKBC 3KNBB 1OAUL 4P5KA 3M17B 4QRPD 3ZE2E 3W9EA 5BXFA 1VFAB 1I8IB 4R3SA 3D39E 2P1YA 3OGCB 4YO0A 5IB2A 3AUVA 3VXOA 1KULA 5T3XD 3A6CL 5EB9A 1EPFA 3FFCA 4AL8H 3WFCL 4Y4FA 1R5VB 1YNKL 1QFHA 2DBLH 3VWJD 1GGIL 2B4CH 3VCLA 3O41B 3OB0K 2B39A 1DQML 2VDOH 3IXTA 3GSXB 2MPAL 3G6JF 4L4VE 5HHPA 4KK5C 3FB6A 1OW0C 1YEJH 5K33A 4R2GD 4Z7OE 3TJHC 4JFYB 4J6RL 4B0MM 1ORQB 4QCIA 3HI5H 4MCZA 5ETUB 4G6ML 1OTSC 1NGYA 2ICWB 2B8OT 4PJXB 5DF0A 1HNGA 1KPUA 2JIXB 3RKDC 4AK1A 2PN5A 3BFOA 4H8WH 4R7NA 4WTWA 4ONHB 2XT1B 3ULUC 4Y88A 4L4TB 1U6AH 4JPWH 3LHPH 3MOAH 3OJ2C 4R0LC 4JY5H 4PY8I 2EH7L 4FQHB 1G7IB 2VN4A 5I1DA 4Y4KC 2X4UA 3Q5TA 1NBVH 3KDMA 1JTTA 5LAXB 3WIHL 4U6XA 4EI5D 1JWSB 3O11A 4Y16B 3BEWB 3OAUH 2ICCA 3QP3A 2FB4L 4ODUB 4WHDA 2BNRB 4APQC 4QHMA 4ELME 3DSNA 5DXWA 3QXAA 2ESVD 4K2UH 1LDPL 4AIZB 5HGDB 2EIZB 1I7UA 5IVXF 1JP5A 5HHOE 3V5KA 3MROA 1EHLL 2NXZD 3F7YA 4HXBH 3G5YA 4RGOL 1UJTA 4O2EB 5DEGB 4NC0B 2VLJE 3ZYIA 5I1LB 3S36H 5I1CH 3C6SA 1G7LB 4PGCA 2NXYB 3I6LD 3ZLQC 1A14H 2UYLB 4HEPG 1A22B 5ALCH 1EEZB 4IMKC 1BQHB 1IGIL 3L1OL 5E9DA 1EA9C 2DI7A 4PRHB 3EJZC 1EGJA 1HSBB 3X12A 1G6RL 3CFJA 3PIQB 1I8IA 1E6OH 1EFXB 4X4YA 4Y1AA 5HDQH 3R1GL 2AGJH 3QCUH 4UB0L 4H0HB 2CKBB 4XPFL 3SGKC 1LP9E 2YPVH 5FB8B 1DBJH 5JDJA 1X5LA 5HHPB 3TEUA 2WMPA 2HG5B 4N8CH 5JR1H 4YDIH 3LQAL 1W0YT 1MVFA 4R96B 3IKKA 1T6VN 4PGEB 4LBEB 3D6GA 1A21A 3U2SA 3EJYC 2VITB 3LV3B 4JFQB 5C0FA 2AJSH 4WU7B 4FQLH 1T66C 4WFGE 3LRSA 1MCDA 4LP4A 4XGZB 2EE9A 5AWNL 4MDJB 3T2NL 4BQBA 3SDDD 5FUZH 1VESA 1BQUA 1YC7A 2Q3AA 1MNUL 1IAMA 1RJZA 2GY7B 5LGJA 5BVPL 4U3HA 1WEJL 1KCSH 1JWUB 3VXQB 5ITBL 2FEDD 4MA1B 2VDLH 3IJHA 2FX8L 1NH6A 3GBML 1IC1A 3O2DL 3K0WA 1ES0B 5J12B 3P11H 2HYMA 5KTEH 4NO3A 3DO7A 1BLNA 3KYOB 4KK8D 1ZHLA 4PJAE 4R0LA 2X1WL 2VXSH 1MHCA 1BFOA 1T83C 1K4DA 5IESL 1OWWA 1KXQE 1U8KB 2UWEE 4EVNB 2ZZUT 2ADGA 1CGUA 2XNAA 3QDME 3TPKA 5I1LA 2X4SA 3AS0A 4PP2A 1J1PL 3V6ZB 1XF2A 4M7ZC 3P4LA 1AC0A 3QIUD 4DW2L 5IQ9A 1YEEL 1P7KA 1Q0YL 1NANI 3CSGA 4RZCA 5C0ND 1RUPL 2HFEB 4MX7A 1R6VA 2NX5E 4X99A 3W39A 4Y19B 3NN8B 3ARTA 2H41A 1UKSA 4QLRA 2H8PA 5IB1B 1KGCD 5EO9A 2FL5A 5CHNA 2QQQA 4Y2OA 1KJVB 2ICWA 3X3FL 5FKPA 4QRRA 4ZFGH 5BMFH 1YMMB 2HFTA 3FZUC 1WCBB 1BVLA 4ZDHA 1A9EB 1KCVL 1J1XH 1FPTH 2J4WH 4XZUA 5CEZD 3K3QA 2F74B 4JFHE 3C5JA 1I8MB 1DL7H 4XCCH 4UT9L 3SDYH 3V4UH 1JFQL 2ICES 4GRLA 3BOVA 5BMFL 4LASL 5E94A 3S37L 3LCYA 4X7FC 1N6VA 3MNVB 3QQ3A 4NWTL 4EDWH 2G5BA 3CUPB 4MJIA 2HVJB 3CMOL 4LVNC 2OR8A 4OZGB 4P5TA 2X7LB 3OX8B 1AFVH 3GSWA 2BNRD 4YDJB 3LKRB 4P2OB 4G6AC 1ITBB 1WBYA 3GSNL 4L9LA 2Q6WB 2CDEB 5JR1L 3DV6B 2R2EA 1EZVY 1D5MB 5F7YC 5LG1A 4BZ1L 5GZOC 2A1WL 4QRSB 5CBEA 5D7LB 4HBCL 3BKYL 5DMGC 3HN3A 4U7KA 2PTTA 4H88H 1IJ9A 1EFXD 3SDAA 5KANG 5AZ2H 1UC6A 3LN9A 5K9OA 3DO7B 5B4MD 4H20L 2D2OA 2VNCA 4KJWD 3QIWC 5A2FA 5E5MB 1Q9LB 2DL2A 2X89A 4WFHD 1TTUA 1FGNL 4HKXB 4FQIL 4JAMA 3MV9E 2IFFH 4QXWA 1U8OA 3G6AA 1NAMB 1CFQA 2WK2A 3KPPA 2D31B 5MEOA 3GIVA 1RJCA 3L95A 3QDMB 1V3JA 5HGAB 4M6NL 1QFUL 3O2VH 4OIIL 5C09B 1A7QH 4HKJA 4KI5E 2YBRB 4LCWA 3QHFH 5FGCB 1EAJA 5F89A 4WU5B 5ESAB 2FB4H 3D18B 4U0RC 1KB5A 2G2RA 2NW3B 4FQLL 4TTDD 2DD8L 2KQNA 4XH2B 1OAZL 1DVFB 3LKNB 3VFGL 3B3IA 2V2XA 4WUUD 5F7DB 1F4XH 4YBLC 2HMIC 3NFPB 4NUGL 3OXRB 1FN4B 1ACZA 3DMMA 2BVQB 1RZKC 4YLQT 5E6ZA 4XZUB 4DTGH 1CE6B 2DB8A 4NHUB 4ORGB 4QRTA 5DJYB 2HFFB 1KCRL 1F4WH 3CJJA 4FQPA 4OCXH 5CWSA 5GRUH 4HG4J 1UA6L 3W5MA 1UB5A 4MQXC 3KYKL 2E9JA 1MWAH 4PB0H 4K7PH 1G7QB 1D5XA 5C0AE 5T33H 3WKNA 5I18H 3LKRA 1VHPA 2Z8RA 2D7MA 1I7RA 4G6FB 4PJ7A 1T2XA 4KKLD 1DDHB 4WI6A 5HI4C 3TNMA 1D5MA 4QY8B 2HT4D 4EI5C 4P3CL 4XWOC 4UZGA 4WUKL 4UQ2B 2BCKA 5GS3A 3OPZL 4TQEH 4DK6A 1N3NA 5D7SH 2GAZB 1H5BC 3DUHA 4NN6B 2VUOA 3FN0H 4ODSL 2GI7A 2DQFB 5F9DC 2IAMA 3VU2A 1TJIL 1MFAL 2VZ3A 3RVXC 4X6EA 2NY3C 2V7HA 4IRJD 2GT9A 2RHEA 4HKXA 4P46A 1I3GH 3JV6A 2Y06L 4IMLA 4ERSH 3X14A 5T5NG 3TPUA 1G9NC 4JKMA 3SGDH 4UTAH 4MAUH 5CHNB 3VRIA 5IKCB 5FM8A 1ND0A 9CGTA 5JHLL 1DSFH 1FP5A 3PJSA 3SO5A 1OD7A 3QNXA 3TNNB 4WO4D 1SMOA 2BRQA 3OF6D 5CEXB 3AAZA 2VC2H 1FZJB 2L7JA 1S9VB 2FGWH 4AMKH 5JPNB 4HIXL 3L7FA 2EZ0C 3MRQB 1RV6X 3ISWA 3QRFM 4NN6C 2CPCA 2BOBA 2GJ6E 3KJ4B 2HRPH 3OR6A 1MI5D 2VXQL 3QA3A 5JZ7C 1KLGB 3QDAA 3KLAB 2GJ6A 4K8RC 2EKJA 3QQNA 3QIWD 1AHWA 3D39B 4FQXC 3X17A 4AEHL 4MD5A 2VRAA 5E2TL 4Z76B 5BJTB 3E6HA 1J0ZA 4JM2C 2L0DA 4P2QB 4ZOAA 4UU9B 2NTFB 3RVVD 3X13A 3WL9A 2H26B 4JPVL 1F6AB 3FL7A 4YWGL 4BQCA 4QGYA 4WHYH 1AO7A 1I1AA 3MACL 1QZ1A 4P2RA 4IRJA 1OPGH 4HZLB 3WFCH 3RZWA 1PKOA 2P8LB 5H8DA 4TOYH 5JHLH 4YFLI 3HB3C 3S35H 5EOCL 3BMWA 4S11A 5DMGD 1VCAA 1RMFH 5DQDL 3MJ7B 2GITB 1XEDA 5DJCA 3VXMB 3DOSA 1CR9H 1T4KB 3ZDZE 1MHPL 3O6LL 1A1NB 3IGAA 1FORH 1QSFD 3QEGH 3ZKND 3MC0A 1AC6A 2VLME 5ID0A 3GDBA 3BRDA 5D7LE 4XNYL 1KC5H 1J0YA 5F9AC 1KOAA 1IC4H 3JWDC 4PRNB 5H35B 1T04B 2OZ4L 1RIHH 4YQXH 3GSRA 4XP9L 5FYLE 1F4HA 1MEXH 4J3TA 2X9YA 2HVKB 4MXVF 5EBGA 2COQA 1JWSA 3DXAD 3CFDB 2Y1VA 1KB5L 1AXSA 2YPLB 1FZOB 1FRGH 2APVA 4GRWE 1B4JL 1RIHL 4OZFG 4YXLH 5GISL 4YQXL 4L3AA 5HDBF 3SPVB 4CN4A 2CLZA 2JK5A 3BIKB 5E6IA 5CINL 1JV5B 3L3IA 4PJBA 4YX2H 5E7BA 2Z92B 4OZHA 4YAQA 5HYSB 2CIIB 1MCBA 3MRRA 3VD3A 1H15B 2IPUG 3UZVB 5EIQA 4PGJA 5DD5H 3NTCL 3WN5A 5C07E 3B5HA 2QQLL 1IM3A 3V5HB 1CXKA 1FZKB 2JCCB 4J3UA 4DN4L 2GJ6B 2LTQC 4UIKH 1D5XB 4C58B 4PRIA 4G7YH 4MJID 4OD2B 1HZHL 2PTUA 3WNNA 4PJ8D 3ALPA 4BZ2L 2ATPB 5TGBB 4PG2A 3FO9B 5LKNA 1NCDL 3Q6FA 3MGOA 4R7NB 3H9HB 2VLJD 2GIYA 1OTTC 1QBAA 1UCBL 1CDHA 3RKPA 2Y6SD 1DUYB 3RTQC 3H2WA 3UJJL 2P8MA 5DT1L 2XI9A 4O9HH 1EEZA 1WITA 4Y5VA 1CIDA 5DC0A 3GKZA 4X0KB 2X4PB 4JO2H 3MNWB 3U4EB 4X6EB 3KXFD 1LILA 5FGCE 3K1DA 4AT6B 1ZWIB 1XF4A 5IHBA 4KXZH 2EICA 1YMME 2O93L 3NZ8A 2XY1A 3UEZA 2W07A 2J8HA 5IROA 1ADQL 5F7WC 25C8L 3QNXB 4YBQD 5CP3A 3MRNA 2W91A 1BIHA 3TESA 4XP9H 2FX7L 5BW7A 4DUXA 4HIXH 5FO8B 3ARGD 5EPMB 1L0QA 3S96A 4FABH 5INDA 4O2EA 5DEGA 2IQAB 3DYOA 1KENL 4JRYA 3D3VA 5ISZB 4YIQB 3IU3A 4ODXB 1P7QD 4Y5XB 3SEPA 4Z7UF 3EO0B 3MR9A 3JTSA 4J3WA 1IGML 2BSTA 2G9HA 2X9WA 1NCAH 1GGCH 3CX5J 2BERA 1DQDH 5I74B 1EO8L 5DA4A 4ODUA 2Y9RT 5D70H 4MDJA 5HHQA 3BZ4B 4O5LH 4LHQB 4DKDC 3WXWL 1R3KA 1JFQH 4ZO9A 1F6AA 2DMKA 5ESVA 5HVWA 3QZWB 3TM6A 4PJIF 1JUFB 3FKUS 3VXMD 2VKWA 1MWAA 2R4RH 5SV4A 5FYJE 3D9AL 3MLTA 4HZLA 3S97C 4GRMA 4JPVH 1HH6B 1CD1B 2IALB 3UZQA 4JHWH 4Z95L 5LXGL 2LU3A 2IFGA 3D69B 4NKQB 3O4LB 5K9JH 3D25B 3H3BC 4NC1C 4P3DA 2IFFL 1BFOB 3MA9H 2BRRH 4LMQI 5GJSH 1K8DA 5L9DH 1WVZA 3IB4A 4HGKC 4NNPL 3CSBA 3G5ZA 5GGQL 4LIQE 4PGDB 1T89C 3TJEH 4PJGA 4Y5YB 4IOIB 1IGJA 1CLOL 2PETA 1F3JB 1YECH 1MLCA 4QOKB 3VI4F 4LPVA 5F3BB 2IEPA 2YPLD 4LPXA 3RWJB 3LOWA 1P1ZA 4KTEL 4EUPH 4Y16D 2N7BA 5FUOL 5DQ9B 4MJ6B 4NHCH 5DURB 2CJUH 1DSFL 3PL6C 2H8PB 1A1OB 4MQSB 2DDQL 5E94B 1L4IA 4HS3A 2IPUK 5C0FB 5IMMB 3HC4H 4DKEH 1QBML 1KN2L 4KKCC 4ZSOB 3CZFA 4U6TA 1ZGLM 3H8NA 5EZJB 4L5FL 4LFHG 4NWTH 2FD6H 4GO6B 5FYKE 1N6QL 2DLTA 3JXAA 3FN0L 4ODSH 3KYMA 1AGFA 3VGAC 4JHWL 5ERWA 5GS1B 2WV3A 2VDLL 4J4PA 3W11C 4OTXH 4WCYL 4HGMA 4PRDA 1PG7L 4FN0A 1U9KA 3T0EE 1KPVA 2BNQD 2PYFB 4JFHD 2HKFL 3OJDA 1G9MC 3FHQA 2AJSL 3UTTE 5MERB 1C8PA 5KN5A 1OP5K 3V0VA 2BNQE 2B2XH 1DQDL 1U8LB 1JTPA 1JVKA 2IQ9H 3C2SA 4HMEA 5TE7L 1LO4H 4U6VL 1FH5L 1X5IA 4WI9A 4DZBB 1YEEH 3ZDZF 5D93B 1UT9A 2WLYA 1QLRA 3QCUL 4LQFL 4JFFA 3RVWC 3RIAF 2VXTH 3KG5A 3LB6C 4WFFE 1A6AA 1AR1C 5ICXB 1RU9H 1WAAE 1ZK9A 2V9RA 5IEKB 4LVEA 5DUML 3BN9C 4PRHD 3BZEA 1DVFA 5AD0B 4NQTA 2BRRL 4QOKA 3PWLA 3PWJA 4NDMA 1LP9A 2Z9TA 4J1UB 5DSCA 1R5WB 3MV8D 4YHOL 4K9EL 4NKDB 3NCYS 2R1XB 3VFRB 1WBXA 5H94A 3CXHJ 1XR9B 4KMQA 4KZEL 3BXNB 4H1LB 4DGIH 1L0XA 4D9QE 1CICA 2WSKA 2NZ9C 3O8XA 4WW2B 3ARGB 4P2CG 2H2PD 3FT3B 5DUBB 5TDOA 5TE4H 4LCWD 1KTLA 3HR5B 3IDJA 4FQIH 4OQTL 3QDGA 1AIFB 1WZLA 1T3FA 5IFAH 1YEFH 2H9GA 1AGCA 2DICA 3GI9H 5E8OA 2YUZA 3WFEH 1YDPA 1J05B 5IG7B 2QQLH 3G6AB 3BPLC 4BZYA 12E8H 5J06A 5LQBL 2BOCA 1JNLL 3MRLA 4YPGA 4XMKL 4P23B 4Q6IC 4P9HL 4D0BA 4O2FA 4PR5A 1CLOH 1AE6H 1JGVH 1I1FB 2H32B 2X1QA 4R4ND 3HRPA 3S4SB 4DGVH 4FTVA 2X09A 4YXLL 2X5PA 1K85A 2NXYC 2YMXH 4G8GA 5BQ7A 1BJ8A 1QQDA 5DHXB 5L9DL 4EUPA 3VFNB 4XWGH 5F7NC 4CU7A 3PL6D 3P11L 2BMKB 4QY8A 3L3HA 3TN0B 4MDIA 1QSVA 1UCTA 2X1PA 3NIGE 4KGJA 3SDYL 3UTSB 2DYPB 1C5DA 2OZ4H 3IFPA 1HILB 4XRCB 5IM7B 1MHHA 5I9QC 2IH1B 4J3SA 2EC8A 5FM5M 3AY4C 4EI6B 4H0IA 2EXWC 3FZUD 4BH7A 1YPZB 3PDOA 4NZDA 1MNUH 4FFVD 4RA3A 3MRQA 4JVWA 1CFTB 1BFSA 3OL2A 1UB5B 1OQXA 2ZUQC 1VFOA 5IB5A 5L2JA 1DQJB 1KYOJ 2ZG3A 3ET9F 3O6LH 1YQVH 2LU4A 5JUEL 5IEKA 1F00I 2VDQH 4GG8A 1EH9A 4EJ1C 3S5LB 5J7CC 2BJML 1QG3A 4U1MA 3MTRA 1FZJA 3OHXA 4F3FA 8FABB 4XPTL 4B50A 2WWMD 3F8UB 3L7EA 4OCNC 3DX6B 4XBGA 1PBYA 1IQDA 1Q9KB 3T77A 3WE6A 4YFEA 1KPVB 1ADQH 5BRZE 3VE0B 1AIFA 1JHTA 2I60H 3I9GH 1U3YA 1KIQB 3AVEA 4XVTL 1G0XA 4ZFFA 3GFUA 4NPYA 1OD9A 1R3HA 2BNUB 3FTGB 4HK0B 4YDLC 1YDPB 4KY1H 4H25B 4F9LC 4OAWB 4F7PA 4NYLB 5F7MC 1U0QA 2R1WA 5FO9A 4QXGH 1A1MB 5HGHA 5FECB 1P69B 5K9JL 1DP0A 4WW1B 2QV2A 3BUTA 1REIA 4N0FB 4O2FB 1ZSDA 4Z7VB 2NW2A 4YHZH 1LE9B 4YNYB 1HDMB 2C3VB 1D6VL 1VFBA 4RAVA 1BOYA 1AGBA 3FQXA 4HMCA 3BDBA 4AG4H 3T2PA 2HFEA 4XNYH 1WGOA 5EBWA 2HJLA 4JLRB 1GGBL 3HZYA 4LLWA 4ZTPL 4Q0XL 3SKOA 1NGXA 1INDH 3Q3GB 3K74B 4UTAL 5EIVA 3B2VL 3KYNA 3MUGA 1B9ZA 4PJCF 1SJVA 4X9HA 1P4LB 1HWHB 1S7QA 2A6IB 3HPLA 2GCYB 2JJTC 4I0PB 4R7DB 2MQCA 4BK5A 4LLQA 1DBAH 1GGBH 5M94B 4HFWA 1F4YH 2N56A 1QSFA 4N8CL 5D7IA 1MCIA 3VWJA 4UV4L 4XTRD 1CICD 3O8XD 5L88L 4ZD3L 1EZVX 4P57A 2AABL 4JPKL 1A6PA 1ZEAL 4S0TD 2CKBL 3L3DA 1RZGA 5IB5B 5TDNA 4EIGB 3BP7A 1JZ5A 3KR3L 2Q7YA 5I8OL 3L3OA 3EJZD 4HHAA 25C8H 4MB3A 4OZFB 3L5HA 5GGUB 1G6RB 3SDDA 1PYWB 5E2TH 3NFNB 2GTWB 3QDJA 3QUML 2NXYD 3RWFB 3UTTB 2B20A 2HT3C 4OD1L 1AQDB 1T22A 5F96H 5E8PA 2AXGB 3MA7B 5D1ZA 2F5AH 3QDJE 3CX2A 5GSRA 5I8OH 3IGAB 4PFEA 1N5YL 4JG1L 2JCCE 3QG6A 3QPXH 1JPGB 2Q20A 1K6QH 1CFVL 5GZNC 1TVBA 5KVGH 4KRMB 3MJ8B 2B5IB 2X4PA 3QEQE 2EYTA 4EI5A 1MREL 5B39B 3VFGH 5IMOB 2F54E 3GSOA 4G6JL 1J86A 3DV4B 4JE4B 4HUWA 3TVMB 4E41E 4DVRH 3BW9A 3PL6B 4BSJA 3ZKXC 3CUPA 2AJXL 1XMWA 3FB8B 3M8OH 5TE4L 4YHPB 3ROOB 1ZA3A 2FO4B 2OP4H 2DQEH 5EOTA 1VGKB 1HDMA 4JZJC 5F7EL 4LRIC 4ZFZB 2D0GA 4Y5VB 3HZKA 4XPBL 5F3HA 1VADB 4XXCC 3OB0H 4XNQA 3ELAT 1U6AL 2FIKB 4JCLA 4JLRA 3WXVL 3VXSB 1KJ3L 3BKJL 5GJTH 2AEQH 2OL3B 4IJ3C 1U8PB 4QXGL 4I2XA 1J8HA 5EUKB 3TBTA 4Z78A 3HG1E 1U41A 3MJ9L 1LO5A 5ALBH 5CZXD 3WO4C 3MRJB 2OSLB 4GKNA 5I18L 5T33L 2VZTA 4XWGL 3T4YB 5AYQA 3HHRB 5C92A 3A67L 2X44D 4GXUN 3KR3H 5EU7C 4Z5RA 1MVUB 2X4RB 2FGWL 4AMKL 3PNWA 2FLRT 1Q0XL 5I0DA 5F93C 1G7MB 1G84A 2AJUL 3D2UD 3AC0A 3INUH 4X7TA 4X6CB 5I19H 12E8L 3IVKA 4N0CC 4J8RA 2MKWA 3WV0A 4J4PC 2XQBH 4XNXL 4CMHB 4HJ0C 3OKEA 2OXHA 4MCZB 3UYPA 3DUSB 3EFFA 2EYRB 2VMFA 3VXRD 5B39G 1BAFL 4DN3H 5DEFA 5HHME 1INDL 1AJ7H 4I3GA 5DQJA 2A74B 4IOIA 3WHE1 3NIFF 5DMJB 2APXA 2YOCA 3QUYB 1BM3L 3MLTB 5JZ7D 1XT5A 5I1DB 1AXTH 2VH5L 3NFSL 1CDBA 4PRPD 4QRTB 5DJYA 2CK2A 2Y5TB 1D5ZA 4OZHE 4U05A 2P5WB 3NCMA 4DVBA 3WS6A 1QPXA 1KNOA 2CDGA 3E2HB 3UYRH 1ZWIA 3DTXB 3DV4A 5DJ2B 2E7HA 4U6HA 3CXHK 4HFUL 4WEUD 5A2KH 1KN2H 2E7MA 1KLUB 1FVCB 3TYFB 4L8BA 3DBXA 5J6HA 3BD3A 2EE3A 1YUHA 4I0PA 4FFZH 4LCUA 4X6DB 4DK3A 5DD3L 3AGVA 1XCTB 1BEYH 1BD2D 1QLFB 4YK4B 4P9HH 5T1LD 2DIJA 1VEPA 3B9KD 2EO1A 1XFPA 2NY6C 1KEML 2W60B 3D69A 1QSEA 1WTLA 4PGBB 3WFEL 1OAZH 1PYWA 3K2UL 4OFVA 3KJ4C 5JNYB 3FB6B 2BY2A 3VG0L 3B9VA 1CLCA 4ORZC 3SKMB 4DGYH 2K1MA 4KK6C 4X4XA 3IU4H 3EYQD 4LCCC 1K4CA 3PV7A 5ITFA 3WNLA 1CL7I 1ZHKB 1G7HA 4NKOA 3IS0X 4U3XA 5IHZA 3PWVB 1FG9C 1NLBL 1G7IA 3QQ4A 2ZKHL 1J10A 4WCYH 3FQWB 2PW1A 1H0DB 4F9LA 3OXSB 1DBBL 4PB9L 1O7VA 2FZ3A 2GK2A 5F21B 1J5OL 3P4NB 3C9NB 5IW3A 4F58L 4O5LL 2ADJA 4ZUSB 3WIHA 3OAYH 2A74A 3ARDA 1MAML 1T7ZA 4KI1A 4LEOA 3PWUB 5J1AA 4UT7L 4E9LA 5AAWA 4ZXBB 3D2UB 3EYOB 2WWKO 2CJUL 3VGEA 3VWKC 3ZE2F 2A1WH 3PHSA 3G5YB 5KS9B 2NTSP 4Y4HA 3B9EA 4PRDB 4GQ9H 3PXJA 5DJ6A 3GJFH 3IT8D 4EZMA 2W92A 4RX4D 4K8RD 1WZMA 3STBA 4UT7H 4NO3B 3T0VA 3BPCA 3N9GL 2NX5D 4CDHA 5EO0B 1KF9B 3AS3A 4ZSOA 4UV7H 4IEFB 3QHZH 3SDCD 4ONFL 5D1XA 4J12A 4OQTH 2NYYC 3U7AA 1Y0LB 1IQWH 3LSOA 3PQYA 1Q38A 4HW6A 4GW4A 3NIDE 3GBMH 5I1CL 4QWWD 2QR0B 2QHRL 4PJFE 4LRNH 4W70A 3D87B 4JO4H 2G75A 4R8WH 3LEXB 3RY4A 3TZVD 1EK3A 4G9FD 2L4OA 3ARSA 4ONFH 3DYMA 3QHZL 4MXQD 2AI0H 1IC7H 1RUPH 4X5WA 1TDQA 4XCYA 1HHHA 4NM4H 2I26N 3TFKC 4QRRE 4KRPC 1HIML 3MBXL 5AZ2L 1HILA 5IM7A 4A6YB 2JK5B 3DETD 2NNAA 2E9BA 2P8PB 1B0WA 4ZNEE 4FQ2H 5J13C 3S4SA 3LHPL 1XIWC 3MOAL 3VXQA 1BEYL 3I02A 5C0IB 5IHUH 4PJ7F 1KNOB 3UTPD 2NY5H 2WP3O 2YWZA 3O9WD 2ORBL 4LPWA 2NY6D 2AW2A 3HNSL 3C60C 4S2SB 1TIUA 2HFGH 4WEBL 1MAMH 5E0QA 3WEXA 1KPRB 3QDHA 3TYFA 3WNKA 3SY0A 3N1MC 1K4DB 4G7VL 4RQQB 2DQDL 4M7KL 1N2RB 3HI1B 4EI6A 3BP5A 1KT2A 3AM8A 3FRUA 2E3VA 3F12B 3MRLB 2AV1A 4EN3B 2IANB 1PEWA 4NRZB 4UDUA 1NUFA 5T1LB 4K94H 4X9FA 1IGYB 4HUXB 3KPMA 5DRXA 4F7MB 3GEWB 5ICZB 3ULUF 5IVZA 2WIMA 5I71C 2I9LA 2DKUA 5I1EH 4JFFE 3VE0A 4FQQB 3X3FH 3VFMB 1A6VL 5HHQB 5EC1B 4U1MB 1NEZG 2N1KA 4N0UE 3ZKNC 1EO8H 4O02L 3FT4B 3RWEA 1Y0LA 4TSAL 1NCAL 2CSPA 4I0KA 1XGQB 1AHWC 3K2UH 3DROB 5FHAH 1S9WA 3VRJB 2VDPL 4LHUB 1X44A 4YPGB 1UKTA 3B8YA 2OQJA 4XP1H 3PDGA 2MCPL 1U3HA 4WI4A 2I5YL 3K8LA 4UDTB 5IMLA 4WO4B 4DAGH 1WFTA 3PDOB 4EIZC 2E7BA 4F80A 2BVOA 4LIQH 4XHJC 1SVCP 4KI5F 4R2GC 1EO5A 5DR5L 1T5WB 4IS6A 3E6FB 5DJXB 1S9XB 3BQUD 1U95B 3QQ9C 2XFXA 1T7YA 3NPZB 3WFHA 1P6FA 4G5ZL 4JO2L 2HRPL 4N0FA 5FAAA 3BN9D 3PWNA 2D7NA 4KDVA 4HXAL 3VXOB 2MPAH 1P6AB 4NN7C 4JQXC 4P0DA 1V8HA 3PGCA 5DURD 2V5SA 5A3ID 3SGJA 2OP4L 5L2JB 3VFVA 3KXFA 5HGBB 5DUPL 2P8MB 5D5MB 2VABA 3I75A 3T2NH 1KG0B 1QR4A 2Q3ZA 5MHSD 4ZAKB 1YYLL 5EBMB 2MSPA 5CZKA 1PFCA 4IOFC 2X4TA 4XPAL 1KEGH 1LEIB 1WZ1L 1DANU 3LB6D 2AEWA 5F6HI 4G9FB 2BCKB 1S7XB 1CK0L 4QT5B 4G9FE 5CZXC 4NQCA 1U8JA 5DRWA 1BZ9A 3MCKA 4OLVH 1H3GA 4OLZL 1LWRA 1QSED 2C3WA 2YD8A 3SE4C 1KN4H 1R5IB 1U93A 2YZ1A 5D1QC 1S7VB 5CD5D 4G8IB 4RA0C 1KB5B 2G2RB 2QADB 1ZOXA 2FEEL 5GSRB 2ICEB 2VQ1A 1ZV5A 4CMMB 5LGHL 1DQLL 5EZLA 4ESKA 4Y1AE 1MWAL 3O4LD 4PB0L 4D2NA 3O3AA 5ALCL 3ARFC 1ZS8A 1ZMYA 1FN4A 4JCMA 4YEFA 2MMXA 4NBXB 5CJXC 1ZEAH 2B1HL 3NAAH 3S36X 4CRPA 1F42A 1KJ3H 4ZOEA 2A6DB 3UJJH 5EU6B 2AS5M 3I02B 4J7RA 4OCSL 4KC3B 5F7FA 1S7RA 3BGMA 5IMKA 1J18A 2X89D 1VACA 5GGUA 3V6OC 2BHUA 2XWTA 3D25A 3SCMB 1CGWA 3KLSA 3V7AG 2GJ6D 5HDLA 4V1DB 3DHJA 5DSCB 1MI5A 1QRNE 3V5KB 4UAOB 1ZGLB 4WNQA 3DSFL 5GGVL 1V7MH 2Y07H 4N0YL 4Q6YA 3VWJB 4MA8H 3MUJA 4AM0B 4EXPX 5GRVK 4PPTA 5EZOL 3SDXE 2WUCL 2W9DL 3BP7B 4U1SA 1U3JA 3KLHD 2VAAA 3DETC 3B43A 2I9LB 3HG1D 2OL3H 4GAYB 1CFSB 1RY7B 2RIKA 3KLDA 3W2DH 2DQFA 5BOZG 2CGRL 4U31A 4RBPK 3ILPB 3RWHA 2HJKA 5GHWL 4HUUB 5ICXA 4R4NC 1T4KA 4RX4A 2EYRA 4JB9H 1H3VA 2GYSA 2J12B 3E3QE 4JY4B 2CK0L 1UEYA 2J2ZA 4JN2B 1R5WA 1I1YB 1QUNA 3DUUA 3GZKA 3HMWL 4NJAL 3WJLC 1CDYA 1A47A 4Q6IA 4OCXL 4LARL 5A3IC 1B90A 4N1CA 2HLAA 3ULVD 1OL0A 2WWMC 3KGRA 4CW1B 2HLFD 4S1SH 4C56E 1M1SA 4NRXA 1BLNB 3KYOA 3GI8H 3X3GL 3FB8A 4YGVB 4Z0XA 1V7NH 3U36B 5I75B 3V0VB 5D7JC 1CGVA 3FQNB 5AG8A 3OKNA 1GOFA 4UT9H 4BH8B 1XH3A 1AKJB 1FNGB 3FN3A 3ZSTA 4LSVL 4OZHB 4HIIA 1HKLL 3QBTB 2F53D 4HS6A 3V6ZA 3F58H 5E6ID 4YHZL 3G6JB 4GKSB 2FEEI 4N8PA 4APQA 3K80A 1IM9B 1S9YA 1ZA6B 3U30B 1RK0B 1ZT1A 3DBXB 3O0RL 1OAXH 3JTTB 1IT9L 3ABZA 1YEIL 4EUPB 1YMHA 3UJTH 4PJ5E 4X8JA 3SQOH 2LAAA 3L3HB 2YPKB 4G43B 2K9UA 3IAQA 3EO9H 3RL2B 4CVZB 5IEHA 1JPTH 4NM8L 2D4FA 4PJFF 1UA6H 1XF2B 4WHTA 5AD0A 3PHOB 1UZ6E 3H9ZA 3TZVB 3IFPB 1A6ZB 4P4KD 3VRLF 1ZT4A 4YHNA 1GAFH 3QDGD 1I7ZA 1XGRB 4QHLA 3SOBH 4C59B 4PRNA 2GFBA 2ZOLB 4LBEA 4DFHA 3HE7D 4NFDA 2EYSB 4M1GL 1FL5B 2BK8A 5KW9H 3GI9L 4PS4L 3QI9A 3SBWA 4L8DB 3ARPA 2H3NB 1NUNB 5IQ7H 2ADJB 4ZUSA 3VXUB 3P40A 5CILH 1F58L 1JGEB 3HMXA 5TQ2L 3VW3H 4H26B 4C4KT 2C26A 2UWEF 3ARQA 3P9WB 1A7PL 2CLZB 3BIKA 2UY6A 4YNYA 1L6ZA 4MMXC 4XPHL 4GAFB 1T0MA 2HT3D 4MMZC 1I4FA 3PGDB 1Q9KA 4IHOB 2H1PL 4NKIH 3D3VD 5GQBA 4CVUA 4OI7A 3HC0A 5B3JF 1HWGB 4MVBD 1IC7L 3NH7H 2F5BH 5HD8C 1GC1C 3HRZB 1WWBX 4DZ8A 1KIQA 2HJFB 1UZ8A 4H20H 3D2UA 3EYOA 3U0TB 1QA9A 1A6WH 1R3KB 2XXCB 4FA8A 5J4MA 1IVLA 2OM5A 1HHKB 1QSFB 2YMXL 5FYLH 3FO9A 3FFCB 4E0RA 1ERNA 3WO3B 4ODVH 1FIGH 4HBCH 1NC4A 2D9QB 2XTJD 4HIEB 1CD8A 4JFEB 1KJ2H 2EDEA 4IOSD 4ZG1A 2VLLB 4F15C 3SGEH 1WSST 15C8L 3SDAC 1TZHB 1JNLH 1WICA 3GSVA 5T1KD 1CFNA 2IGFL 4M4RA 5DGRA 4GG6A 5K9KB 1R3IL 3CU7A 2PR4L 4LPYA 3CDGA 1VFAA 1S7WB 5I73C 3KLHC 2OK0L 1G7JA 1YEFL 2D7TL 3S37H 3U7WL 1CT8B 4KV5F 4JY4A 4XP5L 4OGYL 3RZCB 4ODHH 1VENA 3SDCA 1A14L 1ADQA 1CLZH 4PY8J 3HI6L 1KTDB 4OI9A 5JXEC 1WIOA 3J8F7 3QXWA 3TYGL 4KJPC 1QFUH 3O2VL 2VLJB 4OIIH 1N7MH 4Q6IB 2B1AL 4KMTH 5GGTL 4JRYB 3FQWA 2XTLA 1T1XA 3Q1SH 4ODBD 1TFHA 2XWJA 3BKCL 2NQCA 3VD4A 4RRPG 2J8OA 1F3RB 3UPCA 3ULVH 3O4OC 4Y16A 1ZT7A 2VR5A 3P2TA 4OM0L 1VPOH 2FX9L 3IDIB 3RU8H 4ZAKC 4AIZA 1T21B 4M7JH 3QUMB 4U2ZA 4GMSL 1PKQE 5ID1B 2H1PH 4HWUA 4NKIL 4NCC2 4HD9A 4WDIA 3UTOA 4NOFA 3UBXG 1T80A 3KS0H 2NY4D 4H5SA 2EDLA 5DK3A 3RVTC 3QI9C 4H88L 1IAKA 5IVNA 4NN5C 4KHTL 1XZ0A 4B41A 2PO6B 1S78C 2JE8A 4M61B 1XGPB 3HLAB 3QCVL 5JOFB 3WUWB 4FQQA 3L9RB 3SQBA 1X4ZA 1VFUA 4S10A 4U33A 3MFFB 3SKOB 5FF6B 4OLUH 4N9GB 2EXYD 5C07A 3PL6A 3I2CH 1YEHH 1RHHA 2IMMA 4E0RB 3P0GB 4KROD 1Q94B 2CKBA 3CH1B 4LASH 4L4JA 3ZKQD 1QP1A 3WHXB 1XIWA 4Y19E 3NA4A 3OWEA 5CGYC 1XGRA 1AP2A 4MJ5A 4D9QD 3A6CH 3N1FC 5E1AB 4JQIH 3V5DB 5IHLB 3OKYA 4ISVA 2RBLA 5D2NC 3OKDB 2BY1A 4MNGE 4U7SA 4X4YB 2EDNA 2UUDK 2VYRE 5FA4A 1JGLH 4ZO7A 4OZGE 4Z6AT 5F9JB 5C6TL 4X7EC 4WFFD 4JR9H 3ILQD 2XZQL 1FSKB 3IFNH 5CEXA 4HDIB 4HIHB 1N2RA 4I18A 1SJHB 1CE6A 4OKVB 5C0GB 4LSVH 3BRFA 5JPMA 2P5WA 4UAOC 4F57L 4KTEH 2XWJB 5I1AA 3QG6B 3OKLA 1UVQB 3U7WH 2FEDC 4LLDA 5C6PB 3HR5A 1U95A 1TQBB 5TDPA 3QA3B 3DX8B 2Q76A 1RSFA 3RGHA 5GGQH 4MNGA 4NNPH 2VLKB 1CLYH 2R9HD 2VDMH 3E6HB 4OLYH 1HINL 1P5VA 3VJ6A 4JRXD 4FQXA 1BIIA 5HVHB 3HNTL 4PRAB 2IPKA 1U58A 2E27L 5GGRY 4JPIB 4C4KO 5C2BL 3S36L 4PREB 3NABL 1ZTXL 2CD0A 2R4SL 5TPWL 3UBXI 3G6DL 4NQCB 1IARB 2HN7A 2R2BA 3CXDL 2WBKA 4P2OD 5DC4B 3RBSA 4IRZL 4MS8D 4RZCB 4ENEC 4ZODA 2APTA 1OM3L 2Z31C 1L7TH 4HUMB 3DECA 3T65A 4GAGH 5EC1A 2NY2C 5DJDB 5FOJA 4O4YL 1E6JH 3IDGA 5FYJL 3U9PL 4G8GD 5E95B 4TNVF 5DVMA 4DN4H 1U8QA 4QTIL 5TF1L 5TFSH 4LAQH 5I74C 4YHLL 4AIXA 1IGMH 1G7HB 4PIRF 4OZIB 1P7KB 4OCWH 1ZLWK 3FO1B 3GMPA 1FLRH 3BUYA 4IDLA 4U7MA 1BJ1H 1PY4A 4N0YH 5D7JB 2PW1B 1RJYB 5KSAD 4Q9QH 3VW3L 3UO1H 5ELIA 3SGEI 4NZRL 1F58H 4PG2C 1S7UB 4MJ4A 3RWCA 2ENYA 4E5XA 1KFAH 4M1DL 4HX1B 2PXYD 5F7HA 5AZEH 1T1ZA 3O9WC 1UH2A 4WI2A 1ED3B 1NC2A 4X5XB 2GW5A 2L7UA 4X9BA 1Q9OB 3BD5A 4G3YL 4LVNB 1QHPA 3C6LC 4GW1A 4ZNEA 3HAEB 4PJBB 5EU7E 2BOCB 3RUGF 4C55A 3RUGA 3QPXL 2AXFB 2BDNH 3VFOA 1RFDL 2DBLL 1J9CT 1KV3A 5HYFA 4G9DA 4LGRB 2FDBP 1H15A 1M4KA 4X7DC 3TWCL 2XG4A 2Z31A 2F5AL 5J9PB 4I9WD 3MV01 1U3HC 3WIFA 4KRPD 3PP3K 1TQCC 4PJBE 5EBLA 4HJGB 4YDJA 3WNOA 2ZUSA 4MYWB 4J3OC 2VZOA 3T8XB 5IB3B 1U8IB 2ITCB 3OGCA 4GJTB 1AR2A 2OJZL 4YO0B 5IB2B 3KS0J 2C4XA 2H6PB 5D7IF 3U7YL 3MPCA 5CBAB 3TIDA 4PJFA 1FAIH 1PDKA 3IDYC 5C0NC 3UO1L 4JHAH 4Z7WA 3L3JA 2IADA 1JWMB 5DO2C 5B38A 3L95B 3QSKB 4OCRL 4LCUB 2RAMA 1Z9MA 4JY5L