1GGCL

Major antigen-induced domain rearrangements in an antibody
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
215
structure length
215
Chain Sequence
b'DIVLTQSPGSLAVSLGQRATISCRASESVDDDGNSFLHWYQQKPGQPPKLLIYRSSNLISGIPDRFSGSGSRTDFTLTINPVEADDVATYYCQQSNEDPLTFGAGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A-KAPPA 50.1 FAB (LIGHT CHAIN)
publication title Major antigen-induced domain rearrangements in an antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 46
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1993-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ggcL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ggcL01
1RIUL 3KLAB 1WBZB 2OJEB 2UWEB 1KFAH 2PR4H 3PWPD 3S36H 3ZE0E 1LNUA 3MBEB 4LSTL 3IETA 5I1IH 4NQEA 5LQBH 1GVIA 4TNWF 4ZOBA 3DO7B 1MCRA 1UCTA 5IHLB 5C6TL 2H3NA 4HIEB 5H37G 1TXKA 1X3DA 3JVGA 3OXSB 4W4NA 1UZ6F 4PJAF 4MCZB 1PX3A 5FM4A 5HVGB 1DP0A 1E4XL 5EZLB 1GC1L 3PP3H 3QI9B 5D9SB 1IEBB 5E95B 5IHUH 3KPOA 1TCRB 5J11C 1YC7A 4TSCH 4PJCB 1XR8B 2YRZA 3O6FB 5HHXH 2WUCL 4G8GA 3ARFA 3UDWA 4MQXC 2VITB 1H3VA 5C0CA 4EN3D 5DLMH 2ADFH 5FECB 5DQDH 4OCXL 3V7AE 2XY2A 1YMME 1Z5LA 4UI2A 5IROC 3CH1B 1NUDA 2X7LB 3EO0B 4K7PH 3SDDA 4KRPC 2JLLA 4PG2C 2NXZD 3F58L 4F2MB 5EO1B 2DBJA 3IDYB 5T3XL 4B53A 1K4DA 1T2QH 1R6VA 3LKQA 3DVNB 5AD0A 4YHLH 2IAMB 1UGNA 3KPRB 4HK3N 4L4JA 1YUHB 4K8RH 1FDLL 1H5BC 2CKBL 1MIEL 2Z92B 1CDJA 3SKUD 3ULUL 3HRZA 2O5XH 1CR9H 4ZFZB 3EZ8A 4Z0XB 3TT1H 1K6QL 4OZ4B 4I2XB 2R2HB 5IJVB 1LE9A 1WTGT 2G60H 4EJ1C 3W9DA 3QUYC 4PJEE 3SQOH 2VUYA 1D6EA 5C86A 1S7XB 4NZTH 5JIPA 5CGYC 3PHQA 3PQYB 3C87A 5IB4A 4NYLA 2OX5A 4MHHG 3B9EA 1LE5B 2EDRA 2K1MA 4CNIB 2CK0L 4IDJL 3TYFB 3RWJB 3GSNL 5A3ID 3DI2B 1LO4H 4PBVC 1UWXK 4G6AC 3VGAC 4HCRH 1INQA 5TDNB 4WV1B 5MERA 3OAUH 4LSPH 1VFUA 1DR9A 4JR9H 1DQTA 3FONB 3KJ6L 5AWNH 3VGDA 2AK1H 2H2PC 3B5TA 2EDLA 4Q6YA 2V5MA 4QHNB 1BGXL 1OAQL 2AJVL 3IS0X 3SE9H 5I8CA 1BVLA 5EZIL 4G8IA 5CWSA 4PG9A 1E28A 4WHYH 4UTAL 2IG2H 2CLVB 2DD8H 4C57C 1U8MA 1F4YL 4ZFOB 3VXUE 4NWTL 1D5BA 4Y19A 1T4KA 3WEXA 2VAJA 2J7LA 2HFTA 4HUVA 1RZ7H 5GGSA 2CKNA 5ESVA 3U2SB 2Y6SD 4NQTA 3WFHA 5AAWA 3C6SB 1IAIL 4CW1B 4P2QD 5DTFB 2EDKA 2VLKE 2F53E 1BIIA 1RZGB 5I1LA 2VYRE 2DQJH 2ZOKB 4ODBD 5D1ZD 2D9CA 4G9DB 4XNQA 1J8HE 1OP3H 2W65A 5IJKA 1AGFA 4EBQH 3OKMA 2D31B 2E6JA 5E08H 1HCFX 3MLUL 5F44A 2E9JA 1SJHB 4PRDB 4M5YH 5ALBL 4I0CC 4Y16A 2NYYC 4X4MA 2HVKB 5LG1A 4M9PA 2X41A 1FC2D 1RZJC 5MEPA 5I0ZA 1HN1A 2C3HA 1TVHA 2DM3A 4W4OC 3UZEA 2R0KH 2N56A 2FO4A 4PLJD 4WO4A 2ZJSL 3W5MA 1T83A 4OGYH 3CVHL 1EH9A 4EQ3A 1PG7H 3QUXC 4U1MB 3QIWB 1RIVL 1NFDE 4YHPA 4GRWB 4NNXA 3VCLA 3DXAE 1JZ7A 5D6DA 4BSWB 3TH4T 4KKLC 3S88H 1QEWB 5IFJA 1GGCH 2VDML 3ULSA 4PY8J 1F11A 3UPCA 1NC2A 1BWWA 4OGAC 5FYKL 5EU5A 1I9JL 3V6OA 1MCLA 4YDLB 5CBEA 4AL8L 1IGCH 4PJ8D 4GAFB 4Q0XL 1OAKH 1K85A 3EYVA 1KB5A 4PJ9A 1Q9WB 2JKXA 4QGYA 3MA7B 3LKSA 4HS3A 4LLVA 4ZPVA 4OLWH 3EYQD 1TVBB 1Y0LA 1PFCA 4XC1H 2VLJE 1UADC 5F3BA 3GHEL 2CXGA 4RFEA 1DBAL 4WWKC 1U8KA 3OSKA 2GCYA 4M8QA 5CMAA 5BJTA 1EEZA 2XIDA 3GI8H 4Q6IA 4WU7B 2R4SL 4YPGB 4PGEB 4FQLH 5EO9B 2W1NA 2BXYA 2LE9A 4LVHC 1HQ4B 4GBXB 1FYTA 3ARBD 4MQ7A 4BQBA 5T1KB 3DETC 4WGWB 3VA6A 3WE6A 5JXAH 5AG9A 3NCYP 4CVZB 4OB5L 4RDQG 3P9WB 1II4E 4I3GA 1UWGL 1TZHA 2VABB 3CGTA 5F96H 3RX7A 3EOAB 1OF2A 2YPVL 4ODSL 2F15A 3CSPA 3CFCL 5TQ2L 5J12C 4KC3B 2E9BA 4TPRL 5B8CA 2B0SL 1N3NB 3K8KA 2XQBL 4P2RD 2OTWA 3MOQA 3RIAK 4A6YA 3D0VA 3RWEA 2HFGL 2WINA 3W39B 1GZPA 1N6VA 1QKZH 1RZJL 1QACA 4PGCA 5C0GB 3OHXA 1A9BB 2N4IA 4NHUA 4J12A 1ZANL 5JXEC 3FQNB 4P57A 3C8KB 4W68A 3L3GB 2Q86A 3IDGB 2CDEA 4LCCB 4Z7WF 2NY2C 5EU7C 3U7WH 2WW8A 1FL6A 2C3VA 4DAGL 2OXHA 1QSEB 2FECI 3A6BL 4FA8A 2VR4A 3VDBA 4EN3B 2X40A 1CFBA 1ZAGA 3SDYL 2WK2A 5DJZB 1H0DA 5FDWA 1K5NA 4UINH 2EDOA 4ZAKA 1P7KA 1OW0C 1QO3B 1A7NH 3OB8A 4L1HA 3M17A 1DLFH 3KDMA 4XWGL 3HTLX 5E24E 2YN5A 4JFEA 2BNRE 1QHOA 3BSZL 5D1QA 2NXZB 5F21B 3EGSB 3DMMD 1OSPL 1BECA 4ELKA 4L3CB 1RHHB 5KVFL 4NQXB 4WI5A 4UBDD 2ZPKH 3TBWA 4QO1A 1IGJB 2A83B 1XGPA 1WVZA 2JK5A 4M6AA 4GG6F 5KG9A 3KPMB 2YZ1A 5ICXB 3NFPB 2K3TA 4WUUE 2Z93A 1KJVB 1RJLB 1X4XA 1WWBX 4YPJA 3GM8A 2DQCL 5DD0L 5TDPB 3ZMRA 1F8TH 3L3OA 3PP4L 5T3XD 4JAMA 3BP6A 1MHPL 15C8H 1J0IA 43C9B 4JJ5B 4YDVA 2DL2A 4X4YB 3KHQA 3PV6A 5ERWA 1ONQA 4IHOB 1B2WL 2AABH 4MA8H 5DR5L 5EG6C 3S96A 4K9EH 3BH9B 5I16B 3HE7A 1U36A 3MNZB 1AXSA 3GSXA 4YX2H 3LV3B 2OL3B 3ULUD 1CFNA 1MAML 2EDXA 2HKFH 4WW2A 1EDQA 4R26H 5A2KH 4U6XB 4XP4H 1FZOA 4YUEH 1DVFC 5BO1L 4MLIA 3D25A 4M4RA 1SY6A 1SMOA 3THMH 3X3GH 1BM3H 1G9MH 3O2DL 1IQDA 1A9EB 2XZQH 3UTOA 4DVBA 4Q9QL 1U93A 3RWCA 4PS4L 1CXLA 4JO2L 3OWEA 3LEXB 1FGNL 1B4RA 1OB1A 2Y5TA 2D2OA 3VU2A 2ITCB 5AUMB 1AD9A 2HJFB 3H0TA 3I6LE 3VXTA 4IMKC 2FJHB 5IEHB 3FO1B 1L0YA 1RI8A 2OP4H 1HSBB 3PJSB 2PTTA 3UTTD 3MXVH 3G6AB 3WIHL 3P9MB 3QNXA 5DJYA 2ICWJ 4X7CC 5ACLA 3B9KC 4P2QB 4F7PA 3RRQA 2P8MB 1DSFL 4LLYB 25C8H 4PRIA 5D1ZB 5ANMB 4C83A 2VAAB 5FCUL 2I25N 5F1IB 5LCVH 2BSTB 1FO0L 2J5LC 1I75A 4ORZC 5AZEH 4M48H 1Q1JH 4MQXD 2AJXH 5GISH 4NSKA 4NM8H 4RFNC 2XA3A 3HA0A 2KZ1B 1QR1A 1DQJB 1OY3B 4OI9A 2O26U 1MREH 5KS9A 4LLWA 3V4UL 4KRPD 2V17H 4Z76B 4HIIB 3REWB 3VW3H 3G5YB 5C07A 1G6RL 4POZC 5BV7H 4ODVL 1T1ZA 1LEIB 1ZOXA 4MNHB 1MAJA 3TO4D 5IIEB 1N2RA 3CFEA 3GI9H 2C5DC 4YXHL 1MCOH 3F12B 3TP4A 1M7DB 3IRPX 5LAXB 3RWIA 5DJXB 4G9FD 3W5NA 5E2VH 4TVPL 3CDFA 4HWBA 4NRXB 1QSVA 1S7RB 1FZJA 1MHCA 1AE6L 4J8RB 2ZG1A 4FQPA 5KSVB 3BAEL 3T65A 3L3JB 4U1KA 3V52H 1SJXA 5IGXL 5TGBB 2VZ3A 4ZS7L 2YMXL 3VD5A 3T08A 3QDGA 1Q9OA 3MX0A 3QIBA 2YA0A 2A77L 4LSSH 3ZE2F 2W0FB 3PDDA 2ARJB 3OG4B 3QUYD 1J88A 4XCNA 1Z0NA 1HWHB 1H3TA 3GUTA 4X6CF 3MRJB 4NNPL 5SWZD 2VXUL 2WBJC 3MRPB 4Z0BL 4N9GB 2V2XB 3VFVA 4N90D 2PYEB 4PREA 1IKFL 3ARZA 1LDSA 3NZHH 3Q2CA 3OR6A 1IM3A 3EFFB 5F71A 5J0BA 3BUTA 1KF9B 5FYKD 4Z7QE 2OBGA 1TZIB 4MJ2A 3WLBA 5KAQG 3N1FC 1WUNT 3MJ9L 4OSUH 3CD4A 2VE6B 2HH0H 5CUSL 2YD4A 3ARBB 1CZ8H 2Q8BH 5DF0A 2XPGA 3QXDB 4CRPA 5KSAC 1QZ1A 2H2PD 4ZD3L 3CU1A 5FO9A 1ADQH 4G8FB 1CF8L 5FOBA 4NO0B 3GHBL 1WK0A 1UH4A 2W92A 3CK0L 3SE3A 2V7NB 4C4KT 3FB6B 5ITFB 3PXJA 1JGLH 1C5CH 4LHUA 2BRQA 1KIQB 3ZDYE 4U6YA 3RWDA 4P2YA 1KT2A 4UMGA 3B3IB 3DHMA 3HG1B 3IKCA 2P24B 4XCFL 2ITDB 2GFBB 5GGRA 4OI7A 3ROOB 2V5TA 3GBNL 5EORL 1AQKH 1MRDH 4LLUB 2R69H 1YMMA 4DN3H 1A47A 1L0QA 3WUWB 4LGPB 2C1PB 2CPCA 4H5SB 5FUOL 5ADOH 2NW2A 1A4KA 3QR2A 3LEYH 5JHDD 2XWTB 1LP9F 3I75A 2VLME 3PIQA 3EJZC 3KPSE 3O2VH 4EVNB 4B41A 4PTUB 2GQHA 5EBMB 4P5KB 2VDOL 1KC5L 3PL6A 4HGKC 4LRIC 1CGWA 5IMOB 4M93B 4OAWB 2NX5D 5JO5B 1MI5E 1QFUH 1I8MB 2NYYD 3A0OA 3F7QA 4XGZB 1CD0A 3UO1H 2A6JA 4DKEH 2NY4B 3DMMB 3OJDB 4PYHA 1YPZF 1KJMA 3QUXD 5F1KC 1C5DA 1LO2H 4PJEA 2Z4QA 5KW9L 2G2RA 4LOUC 4J3OC 3KR3L 1IFHL 5FK9A 2AEWA 4QTIH 3M8OL 4KKLD 3TT3L 1Y6MR 3DBXB 3MRHA 4JPKL 1NMCB 2HKHH 4ZOCA 3GGWB 3RGVA 5CFHA 2NTFA 4OD3L 1LEGA 5HGBB 2ZUTA 2GY5A 3OX8B 4MWFA 5I8EB 5GGTH 4JFOB 2XQYK 4R96B 4Z7NF 1WTLA 1IGYA 3U4EA 4Z78A 3G9VA 1XCTB 1S7VB 4NOBA 1MFDH 4Y5VC 1A7PL 4FZ8L 2P46B 5GSRB 4PGBA 4P46C 3WHXA 4NKMA 3T0EE 5MI0C 2WWKT 3IU4L 3BPOB 2E7CA 3OB0K 5FGBC 4YQXL 4JRYD 3F62A 5C2BL 1R0AL 3TJEH 5E9DE 4KUCD 3MUGA 4WWKD 2FX8L 4DUVA 1C7TA 2F74B 5E2WL 1UVQA 2CKBB 4M5ZH 4TSBL 5I71C 1DBJL 1VEMA 2R2BA 4XZUB 1N8ZB 3VXUA 4LHUG 2ZCKH 3C6LC 5GS1C 4RWHA 1YYML 1NUGA 2ADJB 1W0VB 2HJKB 3X13B 2R2EA 4YHNA 3DETD 4LBEA 2RJMA 1A6WL 4OCSL 1WJ3A 2BVQB 1J0JA 3V7AG 4WFED 3MREA 4LLDA 1V7NH 2F53A 2VLKA 3UJIL 1T1YA 5IM7B 4DEPC 2EXYC 3NZ8A 1MJ8H 3O3AA 3PWLB 3KPQB 1J8HA 3GSNB 3E1F1 5INDB 1HHIB 2VZSA 2I5YL 2ZKHH 3KPTA 3UTTB 2WIIB 4J4PA 2XFXB 4ERSL 1G6VK 1RFDL 2EC8A 1NAMA 3QDJE 5F88B 3JVGC 4P23D 1ZLSH 5GRVL 3E8UL 3WHE0 5JXED 3ESVF 4RAUB 1HCVA 3DTXB 1NBYA 5C0FA 2NY2D 3REVB 2ICES 4JHBA 3E6HA 5J11B 1BX2B 5JLZB 4F33B 4YGVA 1NFDA 4H20L 3OXRA 3DXAA 4JGJA 3ARFC 5GJTL 3X17A 1NCNA 3WIIL 2IH3A 1PSKL 5I1EH 3GK8H 3BW9B 2ZNXA 3O6LL 3MLZL 1QYGL 3NN8B 1IAOB 1WT5A 3SDDC 3NH7H 4KRPB 3U4BL 2P8LA 1UA6H 1INEL 2A6KB 2UUDH 4H1LA 3TNMA 5EWIH 5HYFA 5FO7A 1NGZB 5JDSB 1YA5A 2RQ8A 3EBAA 4OZGB 3QXWA 1R3LA 3FN0H 4WEBL 4CVXB 1S7TA 4JQXA 4AEEA 5E5RB 1J1XL 3VFMA 1KCSL 2YK1L 5CZXC 3X14A 1FHGA 2BOCA 3IJSB 4UT6L 1TJGL 2X09A 2JIXA 4RAHA 1QRND 4G9FB 4HBCH 1RZFL 3GIZH 5EZJA 3BJ91 1BQSA 2VLJA 1H5BB 4UDTB 2H2SD 5IFHH 3AU1A 4PJAB 1WV7T 1FE8H 3EOTL 5EU6D 4ISVB 1OSZB 1SYSA 1CXKA 5K9OA 3AAZB 3MRCA 4FQCL 4RDQF 2VXVH 3CVHB 4ZYKA 3QUYB 4M03A 4GH7B 2H9GA 3IDJA 4XVJH 4JY5L 1H8OA 4OD2B 1P9MA 4H0IA 3HAEA 5SWZB 3GFUA 3RIFK 5HVHC 2FHCA 3BVNB 3GRWH 4Q9RL 2F19H 3NTCH 1A7BA 2QQKH 3GBLA 3VGAB 3U9PH 4P4KD 5EU3B 5HDBE 4TVPD 3ZL4L 2Y36H 2R8SL 3HMWL 3NCEB 4PJ5B 2CGRH 2X9WA 3Q5OA 3IFOA 3AC0A 3FT3B 4MX7A 3D69B 4H8WC 2QR0A 4AEHL 4G80A 4K23L 5JHLH 5EZOL 1EGJH 4R8WH 3QULB 1ODAA 3NACH 3LB6C 1T66D 5FO8A 1DVFD 5FUCE 2X2YA 4OIAA 4QRTB 4FTVD 4MAUH 3LPWA 1P84J 4Y8DC 3GMNB 4L9LC 4FXGB 4XRCA 4D3CL 4FQXA 4S1SH 5TE6L 5DJ0A 1N64L 2EDYA 3L5XL 2HTLD 5C70A 2HJLB 1BLNB 3RUGB 2DOCA 1KJ2A 3ULVE 2APTA 4NDMB 2JJVA 1ZWIA 1JNNL 2YD3A 3G6JE 4WU5A 5F7HA 5DJCB 5I18H 1LILA 5LWYL 3OKNB 4G6ML 2BNRA 1R24B 2BFVL 1C08A 4J23A 5JHDB 3QNZA 4G6KH 3KWWB 1BMGA 5GGUA 4U1IB 4JFDD 4H1LG 4JKPL 4YC2C 5IJKC 4U1LA 4NKIH 1XF1A 3R8QA 3H9HA 4TN9A 3S35L 1JZ8A 2BY0A 2NX5B 4Y16C 3BO8A 4IOIB 3X11A 5DRNA 3MJ6A 1KXVC 4YHYC 3WMSA 1XH3B 3NFSH 3MOAH 4WUUA 2DQGH 2FIRT 4LLMA 4WO4C 3BEVB 1P7QD 2QHLA 3C8DA 4OM1H 5FEBA 3QUXB 1M7IA 3O0RH 4JANB 2X4PB 2XTJC 1AXTL 1BFTA 2D9QB 2YUXA 2Y1VA 1YMHB 3CZJA 4XHQA 2AKRA 3H3PH 5I1GL 3U4AA 2G5RA 2AI0H 4JQVA 3KXFB 2GTWB 3RBGA 2A0LC 3HAEG 1WCBB 5GRJH 3V6OC 3VFPA 2QKIA 2X4QB 3MV9D 1JPGB 5E99L 4EI6B 3QSKB 2IMMA 3UC0H 3U9UB 5I1KH 4XNUH 1NCWL 5T1MA 4MXVE 4O5LH 2HFEA 5F6IC 4PY7B 2BHUA 1YY9D 5BMFL 3RFZC 3ECBA 1KULA 3QUMB 1SJEA 4QRPE 1W72L 5IQ9B 5J7CC 5DSCB 3BRGC 4YJZL 4JFPA 2YPKB 3GSRA 2ZUUA 1MRFH 2NPLX 3OF6D 4JRYB 3MJ8B 1G7HB 4WWKB 3ARWA 3KHOA 4G7VL 1CDUA 3ARDA 3FQXA 1FFNB 3QO1B 1HOCB 1S5HB 5DRZB 5CD3A 3O8XD 1INDH 3LHPL 4AK1A 4D0DA 1MFAH 2ATPA 2FL5A 4LVHB 4D2NA 1GGBH 3OKYA 1EHLH 1GHFL 4OF6A 4BUHA 2X4TB 2YRPA 3O9WD 5DQ9B 4RMRA 1TETH 3UYRL 5LXGH 3BIBX 4JRXD 4HAFA 5JUEL 3KYOA 2X4OA 3ZE1F 4YHZH 5H8DA 2YKLL 2YD5A 2OR9H 2VISB 4GJTB 1TQCC 5D5ME 3NGBC 3UTSE 3PXHA 3MYZA 1EHAA 5J12B 5B8CC 5EUOB 4LSQH 1QA9A 1T04A 3VFUA 4TNVK 3FT4A 5A16B 4HULB 4J6RH 3BKML 4S2SA 2PTVA 4UV7H 4GMTH 5M94B 4CL7A 1AY1H 4HX1B 5BRZA 1HXMB 3O4LE 1A1OB 1EO8L 3DRQA 1NL0L 4P23B 5C0AD 5TDOA 3VG0H 5E2UH 3DUUA 4RMVA 1ORSA 5FYJH 2OZ4L 2EEAA 2GTZB 5H35B 4F7TA 5EDXA 1DBBL 4HPYH 3CDGB 1CK0L 2K7PA 2NY2B 3FQWA 3N1GC 4YHOL 5F72S 1TTUA 4X7SH 3BPLB 1MWAA 2XWBA 3IFLL 3MNWA 1G0XA 1NBVL 5E8EB 4TUKH 3LEVH 5EO0A 1IGIH 3S34H 4M7ZC 1F4WH 4DVRL 3I02A 3HUJE 4NFCA 4ZAKC 1HKFA 3JWDH 1G7JB 3MRLA 1I9EA 4WFFD 4ZTPH 3TPUA 2BSSA 5F8QC 4HGWA 4ODUB 1S78C 3MMEB 5D1QC 5IHBA 3RVTD 2P5WB 4O51A 1T3FA 1U8QB 2FO1A 4WW2F 5T3ZE 5HGHA 2BRRL 2PTUA 3V0VA 4KKBC 1N0XH 3VI4F 1FO0B 4LOUD 3BYTA 1OD9A 1QRNB 5CD5D 2A6IB 1X5KA 3BUYB 5KAQF 4K3GA 1U92B 1NFIB 4HS6A 3EYOA 5E2JA 5EU6B 4HQQH 1KB9K 5I76A 2E5EA 1CGTA 1KELH 5H2BB 1A6PA 4Z7WB 3M07A 4F7MB 1LK3H 3WNPA 4RGND 3VG9C 2PW2B 4PJHE 1TJHL 1KCRH 1G6RB 1WFTA 3QUZC 4X8JA 4NBXB 4FABL 2VIRA 5ITBL 3QEQE 1F4HA 5HBBA 4ZMAT 3ALWA 2XNAA 2H32A 2BVUA 2W9EH 3LQAC 4KZEL 5HYQB 4PYGA 1EVUA 4LK4A 4ZTOH 1D5XA 3HE7C 2P5ED 1HKLH 4JFFE 4M7KL 1OLLA 2XG4A 1RK1B 4F37F 2DTML 5JORB 3C6LD 4WW2C 1UG9A 5DMKB 1A7QL 4WTWA 1FNLA 4JHWL 3PNWB 1F6AA 3EYFB 5KS9F 1XGUB 3F7VA 4HWEL 3BESR 1DVFB 1IEAB 4JM2A 4JKMA 1J1OL 3UTQB 5TFSL 3UTPD 3RWHB 4FTVB 4GG6B 2UY7A 5CINH 1CL7I 3VXPA 3S3SA 3M1BB 2AV1A 5DEFB 3W11D 2EXYD 4D0BA 3UZQA 3KPSA 1HH6A 3HC3H 3RQ3A 2CRMA 2X4SB 2QQNL 3V79C 3GJEA 3HMXL 3HI1A 2GAZB 3MRBB 3NVQA 4YHKH 3UXFA 4Z77B 3MGOA 4NP4H 3H2WA 4NQED 1MI5A 1NKRA 3MSPA 4PRNB 1GIGH 5L2KD 2X9YA 3STLB 3VFRB 5ADPH 3R1GH 4JFYB 2XACC 1BP3B 4M6OH 4H0GA 4R2GD 3DYOA 3B9KB 5E6ZA 4U1NA 3RNKA 3SDXE 3TCXA 3TCLA 4PD4K 4U1JB 4JFDB 3U30C 1VEPA 3WS3B 2A6DB 3O2WH 1YEIH 2J5LB 5C0JA 3CLFH 1RQ5A 2H1PH 3FAWA 1U8LB 1N4XL 2VLLB 1J10A 1I7TA 3GKWH 4RFNB 5CJXA 3BYYA 2VZUA 4MNQD 5JZ7C 1CD1B 4UOJA 3SDDD 2CDFA 5AEAA 2C4XA 1EPFA 3V5KA 1P7QB 5D71H 3ZE0F 4HIXH 5IB3A 4Y1AE 3WNKA 3DX6B 3BZEA 4ZDHB 5MP6H 3TBTA 2ICWA 4PRPD 3QG6B 5D6CB 1NBZB 2HT3C 2FBOJ 4GKZA 4ZO6A 3LQAL 3ZT6A 3T0EA 2Z91B 3FQUA 4PJFB 5DMGC 5E9DA 3DUSB 5HY9A 3MV9B 3K2UL 4ZSOE 4YWGL 3SGEI 2DJUA 4BKLB 1Q72L 3MLRL 5K9KA 3QIBC 3SE8H 1BFVL 4BQ6A 1OAUL 1PY4A 2AXFA 1P4BL 3GMMB 4KTEH 1D6VL 3V6ZA 1SY6L 5GRWA 3PUCA 4G5ZL 1HHKA 2WBJB 2IADB 3PDOA 4L5FL 4KFZC 1FNAA 2XA8L 2HT2C 3TLRA 1MF2L 2Z8SA 4LFHG 3LN9A 1MCNA 1A6AB 1KGCD 2DQUL 1E4XI 1BBDL 4R9HA 3LS5H 1JNLH 3V6BR 2H6PA 1OCWH 3N1QC 3A6CH 3JZ7A 4WFHE 1U8OA 1LDPL 3QXTA 1BBJB 2D03H 3QDJA 3S8WA 1YNTB 3LB6D 1WZ1L 2AERT 4HXAL 1YEKL 4JRXB 3MZGB 5I19L 1L7IH 4KK5C 3DYPA 2B20A 4ODWA 4QRRE 3SE3C 3HC4H 4OIIH 3NCMA 1SYVA 2CDGB 2OR7A 1FNFA 3O4OC 4DOHB 2YWYA 4R4BB 1YEJH 3DX7B 4PJEF 4WTZA 1MCJA 3WXVL 2UVFA 5T33L 1KXTB 3HNTH 4Z7UE 4WI4A 1X5LA 4LGRB 5KVEH 4GG8A 4Y5YA 2J12B 5C0AB 4YXKL 1J0HA 4RZCA 1T6VN 4QHMB 4XPAL 3VXOA 5CJ5A 1A7OL 4F7CA 3W0WE 4QRUB 5D93B 1KTDA 4K94L 3K8MA 4HFWB 1MCCA 1A8JH 3DIFA 2DMBA 4HUUB 1DFBL 3FO9B 1ES0B 2GITB 3PL6C 4FG6C 1U8PB 1I7ZB 3GIVA 3FHAA 4YR6B 1G7LA 1G7QA 1KNOA 4HWBL 4I9WD 4OCWL 3IFNL 4HCRA 5IKCB 3VFOA 2BZDA 1CLOL 1NGXB 3TIDB 2KPNA 5EOQL 3V9FA 5DMIH 2FEDC 4MB3A 3UBXB 4HIJB 1LMKA 3OR7B 1ZMYA 2HFFA 4X98B 4RISL 1IE5A 4TUOB 2BCKB 5I15H 3U46B 4HFUL 1U8IA 1I3RA 4DZBB 5BZWA 2XTJD 3O6KH 2VUOA 1ZS8B 3PGFH 1U8HB 2NY1C 4JB9L 4XP1L 1S8DA 5AG8A 3TBSA 3TBVB 2QQLL 3RGVC 1NC2D 5D1XA 5H94B 3AXLB 1U6AH 3D85D 5C09D 5ACZB 3D39D 3PHOA 1LP9B 3STBA 4XVTH 5JR1H 2YZ8A 4NQDE 4G3YL 3D18A 2GI7A 4XPFH 3SOBL 3VXRE 5BS0A 4O2EA 1S7QA 4Y5VB 4RMWA 4JKKA 1ZVSA 4X6BA 1VFOA 3GMLB 3JV6A 5MI0B 1MFBH 2P5EB 1JK8A 2Q3AA 4MD0A 5I71B 5JNYB 2BX5A 1NFDF 3VRJA 3EJYC 5DGRA 4EDXB 1T20A 1YPZB 3C6LB 5C08D 5GS1B 3G6DL 4N0UE 4I3SL 4AJ0A 1FG2B 3RY5A 4WTZG 1UFUA 2QL1A 1XGTA 3G6JA 3CFDA 4U6VH 5D7JA 2B4CC 3GEWB 2GEEA 3QAZC 4HK0B 4ZS6C 4OJFH 4KVCH 1JYNA 4G7YL 1UH3A 3GM0A 4DEPB 4OT1L 4LGSB 4F3FB 2ZUWA 4M6MH 3UJTL 2D0HA 1LNUB 2OSLB 1B0GA 5E0QA 1N59B 3UYPA 3IETB 3SJVD 3H3KA 5HGDA 2R1XA 4NQEB 1RJZA 5L2KB 2H3NB 1BAFH 2F54E 2OTPA 1K2DA 5EPMA 4R2GB 4XP9H 3ARTA 4RBPH 4FQJL 1MCWM 4NQVA 5GGQL 1JHLL 3F5WA 4LRNH 4OQTH 3TM6A 3CFKA 1A6TB 3EJJX 3TWCL 3ARRA 4DQOH 4N0YH 3WFEL 1KCVH 1CVSC 4G8GB 3ARFB 5D8JH 4RIRA 5KTEL 5GJSL 1J0YA 4JZNB 5DHVB 2IQ9L 3BKYH 4MNQB 1E6JL 4TSAH 6FABL 3JTSA 2XXMB 4ZAKD 3FOLA 3SDDB 2DB8A 1NAKH 4G8EA 1HE7A 2DQDL 2W59A 4JO4H 4TNWK 5KVGH 5SV3A 1M1SA 1J86A 1S78D 4WHYG 5A40E 4U4BA 4JQXC 5F9OL 4J3XA 3EDJA 4CMMA 3IU3A 4KZDH 4PRPB 4LIQH 4QRPA 1J0ZA 4KKBD 4NZUH 5AD0B 2J8UB 4YXLH 1F42A 1BQLL 1XGYH 4L8DB 2FGWH 4LKXA 4XNMA 1CI5A 4EI5A 4NIKB 2W07A 2NY5H 2E7LC 1XIWA 2YXMA 3HRZB 4D8PB 5DT1L 2YXFA 5D7KE 1ZEAH 3MGTA 4NO5A 3T3PE 1S7WA 3W9DB 3GSVA 1H9VA 5I30L 3INUL 2B4CL 1P9MC 1OTSD 3QUZD 3QCTL 5HVHB 2XRAH 1DLHB 5IB4B 1YY8A 4L8BB 3WFCL 2EE3A 3Q48A 3I85A 1Q0XL 1QLFA 3EKCA 5D5MA 1CGVA 5MERB 1INQB 1HILA 3J8F7 3UTSA 1KTLB 2XKSA 3R8BB 1FFOA 4KWUA 3TIEA 3WL9A 4XNYL 4NWUL 3RVVD 3MRDA 4KVNL 3O4LA 4Y4FA 1AHWA 1WIOA 1CE6B 4JFHD 4P5TA 3OAYH 1CFTA 3X3FL 3EUUA 5I8CB 1BVLB 3GSQA 4C59B 5CWSB 2EXWC 4L9LB 1YNLL 4FQXC 3V7MA 1E28B 3CIQA 3KLHC 3CXDH 4V1DE 1U8JB 1E0OB 4HJ0C 2N7AA 1JWMA 4XPHH 1D5BB 5D7LD 3RZCD 1T4KB 4WJ5A 1C1EH 1MNUH 1I7RA 3HUJA 3ZTNH 1TPXC 2FD6L 4HUVB 5TE7H 3BIKB 5ESVB 4NUGH 3WDJA 1AKJA 1B6UA 4GQPH 4J2XA 5IW3A 5CILH 3H9YA 1JPTH 2UZYB 3BH8B 1BIIB 1N5YL 2IH1A 5CGTA 4XNQB 3SQBA 1EEQA 2W65B 2R56H 3OJMB 4YC2B 4LPVA 1AGFB 3FO0L 4I0PA 1EUTA 3MC0A 1J12A 4QRQA 1Z2KA 1Z3GH 4UT9L 3OGOE 3T2PA 1QOKA 1DL7H 1MPAH 4L8SC 2BNQE 1AGBA 2Z8WC 5JZ7D 2MPAL 1PAMA 5DUML 1VA9A 1PQZA 1TVHB 1RZKH 1CDHA 1HHJA 5C07D 2FO4B 4WO4B 5JW3H 3RY4A 3LKNA 2O5YH 4PJHA 3TVMD 3OZ9L 2AJUL 1HK6A 1UJ3C 4NNXB 3VCLB 1CFSA 2XTJB 3FFCD 5J57B 1O7VA 2J6EH 1W2KT 1X5HA 3QEQA 1IAIM 5DXWA 5IFJB 4ODHH 4W6YB 4JQVC 3CUPA 1T2XA 1QFWL 1F11B 1NC2B 4S11A 2FBJL 4PJDE 5EU5B 3D85B 5L0QC 3HNVL 2HLAA 4JFFA 1FNGB 3CCHA 3BE1H 1G7MA 1XF2A 1JPSL 3I2CL 4YNYA 3EYVB 1B9ZA 2QBWA 1QSZA 2IFFH 3SPVA 4MDJA 5HDQH 1DE4A 1HIMH 3RY6C 4LMQI 4O58L 3RJDA 5CEXA 1UACH 1EHNA 1PX4A 4HS3B 1MEXL 4ZFFA 3ALXA 1KN4H 1YDPB 1Y0LB 1CLZH 2IPTH 1KENH 5CMAB 3HFMH 5F3BB 1RUKH 1U8KB 4M8QB 5I1DA 5IVXB 1EEZB 4U7KA 3MCLL 2OCFD 1E4KA 1S7SA 1NCCL 4M7JL 4QOKD 5C08B 2OL3H 4LCIH 4OCMC 4MQ7B 5BOZG 1UYWL 5FYJE 3VD9A 1QNZH 3C60D 1EX0A 1UM4H 3KPLA 3WD5L 4KK5D 1H8SA 1TZHB 4OLZH 2P49B 3SDXA 3QQ3A 1OM3L 2FWOA 4DN4H 5IEKA 3U6RB 4IS6B 1TQCB 1OAYL 3NGBB 4GS7C 4FQHA 4HZLA 1FN4B 2J88H 3G5VA 5B8CB 3G04B 3QCVH 4JHAL 1NEZA 4B7IA 3SJVB 4ONOA 1MHHA 5GGVH 5CSBA 4A6YB 4Z6AT 3RWEB 4K3JL 2WINB 2ZZUT 4F7EA 5DMYA 3ARGD 4ACPA 2W91A 3TESA 4NHUB 4HKBA 1MRCH 1F45A 4Z95L 2QADC 2YPLE 4Z7QF 1Y18A 2Q86B 2CDEB 4OCYH 5CCKL 1RURL 4H88L 1MCSA 4Y1AA 4N8CH 1FL6B 2C3VB 3CH8A 4ODXA 3D48R 3UPRA 1CD8A 2I07A 4X9BA 2ATKA 5I8KL 1HHHA 4J3WA 1H0DB 2BERA 5FDWB 4AZ8A 4M7ZB 1PKQE 5I8OL 2FX7H 2CO6B 3NAAL 4DGYL 2YD8A 4ZAKB 5IVZA 5I66A 3HNSH 3DVGA 3ZDYF 4ZSOA 2WP3T 2VDRH 1XF3B 2FEDD 5D1QB 4N0FA 2DBLH 3S4SA 3MNVA 1YJDH 4L4TE 5CJOL 2J3SA 4XVUD 3AM8A 4JM4H 4ELKB 1ADQA 4UAOC 4XAWL 3V5DB 1MJUL 3O3BA 3HZKA 4I8DA 5E8PA 3K1DA 1I1FA 1CGSL 5C0BE 2AJZB 4JM2F 3TBWB 5C0NC 2ED8A 2APXA 2C26A 2R0LL 1IGMH 4GW1B 2NY1D 2AJSL 5KG9B 4XH2A 1ZT7B 5DK2A 2CIKB 1CE1H 2NLJA 2JE8A 1T6WA 1CL7H 2Z93B 2ZUXA 3DUHA 5EN2B 5D4QA 2EDBA 3U83A 3MODH 1T1WB 4OF0A 4PP1C 3VG9B 3LY6A 4LARL 2DLTA 1IQWH 2ICEB 3L3OB 3QUZB 3L5JA 3LOWA 1VFBA 2EC9U 4HHAA 3DROA 1L6XA 4YDVB 4QRRA 1CDCA 12E8L 2AK4A 3PV6B 5ERWB 3S96B 5GHWL 5IQ7L 4P2CG 1NCAH 1XFPA 3CMOL 3HE7B 1KN2L 3VGEA 1JPFB 3PV7A 5DJ8B 1AXSB 5L88L 3H9SE 3QQ4B 4MJIE 3BPCA 3EJYD 4Z7UA 1WF5A 4NBZB 1H8NA 1FH5L 1JUFA 1MH5A 1O7SA 4LPTA 1Q0YL 4WW2B 3QNYA 1WGOA 2GJZB 4DGIH 1FIGL 5C3TA 1NEZG 1T21A 1FZOB 2VC2H 4JM2C 4MJ6A 1YEHH 2E6PA 1NDMB 3GJFH 4NKOA 4YHMH 4ZS6D 3WIFA 3CFBA 3W0WA 1IQDB 1YN6B 3TNNA 2F53D 4DVBB 7CGTA 2Y25A 1U93B 4Z7VE 3RWCB 4TQEH 3QRGL 5C3LD 1ZLUH 1J8HD 3D9AH 3N50A 1UB6A 1JVKA 4IRSD 5D7LB 4ZODA 3WFDL 4OLYH 1AD9B 3MO1A 5GS0L 3LKOB 4HDIB 3JTTA 1FVDA 1OL0A 3L7EA 3LPFA 3MV7D 5IB1A 4LASH 5I0DA 3BKJL 2NY7H 3GMRA 1BZ9A 3CLEH 2WWMC 4F7PB 5BVJB 2A74A 5GGTA 4E0RA 2EH7H 3PABA 2CLRB 2JCCE 3SGEH 1H3PL 4F8QA 3U30B 2AJ3A 3DV6B 1MCDA 2XZAH 2NW3B 3OAZH 3O6ML 3ZDXE 2GJJA 4GAJH 2DKUA 3SBWA 3S4SG 1TLKA 3OKKA 1F00I 5GGVY 1S9VA 5CJXC 1F6LL 5KS9B 3VFGL 1XF4B 1N7ML 5E00B 2QHRL 4LLWB 1ZTXL 5C07B 3CMGA 3D2UA 2EDNA 5HYJD 4P4RB 3OV6A 1T1ZB 5F7DB 1E4XH 1GC1H 4NQDA 4X7TB 3FFCB 3VXRA 2HTKC 4LPUA 1YQ2A 5KVMC 3MRMA 2Y06L 4YFEA 2WUCH 3RWIB 3CSGA 3MUZ1 4NC0B 1TTFA 1A3LL 1DEDA 3C5JA 2VLJD 5GGSY 2BJML 2COQA 4OCXH 1MHCB 3VWJC 4AIZB 5E1HB 5DHYA 3T65B 4UILL 4U1KB 4HT1L 3QDGB 1Q9OB 5JQHC 2ORBL 3QIBB 3OQ3B 4N0UA 3L6FB 4X6EA 4K3DL 2OI9B 1JZ2A 1OGAE 4OLUL 4XCNB 2FCBA 1KCLA 1BIHA 5T3XH 3GUTB 5K9QG 2EKSA 1AFVH 5D96C 3HPJB 1UB5A 5F9DC 3S37H 1EXUA 3AY4A 4HAGA 4U6TA 4GT7A 1QBAA 1D5ZA 4F9LA 4MXWH 4PREB 4X5WA 3MRNA 3UBXI 1A5FL 5BXFA 3OR6B 1FDLH 1PG7W 2CKBH 2A9ML 4QOKB 3WLBB 3QUKA 1M6OB 1JHKL 1OHQA 3ULUH 3K4DA 1KACB 3W2DH 3D5OF 1K6QH 2F54A 4KHXH 2QSCL 5I2IA 3OL2A 2VDLL 5FOBB 4NBYB 3HPLA 2ZUQC 1VCAA 5D2LE 1ZE3C 3GSUA 1MCQA 1EFQA 3LN4A 4LHUB 4R0LA 5JMOC 2EXWD 2XN9E 3O4OB 4GLRI 5HI5D 2CK0H 4FQXD 3B5HA 4U6YB 2FJFA 4YZFE 3RWDB 3KLHD 3UPAA 1KT2B 5IG7B 1UCBL 2KQMA 4YHIB 1T5WA 3IKCB 3O45A 5JMRA 2R0WL 3C5ZA 4JY4A 4K8RC 4S1RL 4Y5YC 2BVYA 2FH6A 2IBZY 3SDCA 4QXUL 5HDBF 1BGXH 2C7UA 2NW2B 3QXAA 4X83A 5DEGA 1CXHA 1OAQH 4CU8A 2AJVH 4GW5A 2X5PA 3HR5B 5IT2L 5HPMA 2BVPB 4PJBE 2AJYL 5EZIH 3PIQB 2O93L 1OAXH 5GRVK 3HLAB 3QEHA 4EUPG 4UTAH 3PL6B 3GRWA 3IAPA 5FIEA 4LSDA 4RWYL 1QVOB 4TULH 2Z9TA 5HHNA 4NWTH 4F58L 2PR4L 4MMXC 1AP2A 3MV8A 3NABL 2F9BT 1QR4A 5FHAL 4QWWC 4ZUWA 2W9LA 2L0DA 1QFPA 4I2XE 5TE4H 3JXAA 1EGJA 3WJJA 1C5DB 5FA4A 4LL9A 3ULVF 1MJ7H 4PJEB 3IDIA 4IIQC 1U91A 3KVQA 3G6JF 1I9RL 5J1AA 2G2RB 4POYA 5DC4B 1EIBA 5FK9B 2VKWA 3ZHLA 4X80H 2NY1B 5MHSE 3MLUH 1JI1A 1EAPA 4JCMA 1KIRA 3U1SL 4R3SA 5D1XC 3RGVB 4XNXL 5ALBH 3ZDZE 1DQDH 1NCUA 1ZA3B 4ONFH 5DLML 3GO1L 3FT2A 2VDPH 4LNRA 4MWFB 4RAVA 4HG4K 5JOFA 4XBGA 5SWSE 2ZJSH 1ZSDA 2WQ8A 3CVHH 3GSOB 3IDNA 4WGVB 3U36A 1CT8B 5JW4Q 1I1AC 1RIVH 2A1WH 1A6VH 4PGBB 2V5RA 1CU4L 3LPGA 3ORJA 3WHXB 2W60A 5GRUL 4HKJA 1JV5B 2EIZB 2VDMH 3MUGB 4JFXA 5HYEA 1UVQB 4V1DA 4Y88A 2R2BB 4OF3A 4RGOH 2FYYA 3VXUB 1I9JH 4K8RL 4JFZL 4AH2A 4I48B 3ULVC 5LBSL 4AL8H 4Q0XH 3IXTA 4Y4HA 2O5XL 1BF2A 5D7JC 4YHNB 4LBEB 3QAZB 2G60L 1I85A 3FOMA 4YFLF 4LLDB 4HIHB 3RHWK 2F53B 3FB7B 4MXVF 3NZ8B 4UNUA 3O3AB 3H7BB 3WO4C 1J8HB 2IBZX 1IGFL 3L3IA 1LO3L 3GHEH 1DBAH 4IRSB 2R4SH 3SN6N 4HCRL 3MV7B 4LSPL 4Y2DA 2BNQA 1NAMB 4XBPB 3U7YL 5AWNL 2V5SA 2BVTA 4MMZC 4LP5A 1WSST 5FV1L 5EC2A 2AK1L 1Q38A 4BJLA 3QFJA 4CN1A 3QHTC 4GFTB 5IFAH 1NBYB 4OB5H 5C0FB 4R90L 1A3QA 1KLFA 2VLRE 3UROR 3SKMA 3E6HB 5I75C 4LIQE 3AS3A 4LEOA 2B1AL 4H0HB 2YPVH 5TPWL 3SE9L 4ODSH 2RR3A 4YGVB 1NFDB 3OXRB 1PYWA 3CFCH 4LAJH 2FLRT 5DUPL 1MVUB 1TZGL 1U95A 4TPRH 4U33A 1HNFA 1X5JA 2B0SH 5DZOA 4ETQA 1L6ZA 3RVUD 1IGTA 5GS0D 5D5MF 2HFGH 3S5LA 1ZHLB 4H1LB 3TNMB 1RZJH 2VDKL 5ISZD 4NJAH 4M61A 1ZANH 1R3LB 4OLVL 2QSVA 1S7TB 5FKAB 5KSBE 3VFMB 1GZQB 4GRMA 5AYUL 4DUXA 4LVOC 2BOCB 2BP3A 3T8XA 3A6BH 3NCFB 4D9QD 1K8DA 2CLZA 2VDQL 5EZJB 3SDYH 3MJGX 2VLJB 4EI5C 1NGYA 2YOCA 3C2SA 3AU1B 3EIFA 5K9OB 3ULVL 1ND0B 3BSZH 5IWLC 2OJZH 3HUJF 1PLGH 4FFWC 4P9MH 2H9GB 2ZOLA 3BP4B 1OSPH 2DS4A 1AJ7L 4GKOA 1T7XA 4MA1C 4OGYL 1WIUA 2BY2A 3QDHA 5KVFH 2MCG1 4RGMC 4HC1L 1FNSL 4KQ3L 1NBQA 1RU9L 2CJUL 3K3QA 5D7IB 5J6HB 2FB4L 1QSFD 3PWPE 1WISA 4LKCB 5L9DL 3FTGA 1GGCL 5F3HB 4RSVA 1BVZA 3LKRA 4MX7B 4U7MA 3DX9A 4G80B 2B1HH 5C0EB 1FJ1A 2DDQH 2HLFC 4Y4FC 2HWZH 3GB7A 1IGCL 5FO8B 5EFIB 3V4VH 4P5TC 1OPGL 2DQCH 4JM2D 5DD0H 3PP4H 5IV2B 5T1LD 2YPLA 1E27A 1HXYA 3TZVA 1A6ZA 1MHPH 2VL4A 4FRWA 5IVNA 2FX9L 3TGXA 4B50A 4XRCB 4PJHF 4FQXB 3MCG1 4KJWD 1I3UA 5DR5H 5C2UB 5JW4N 1FC1A 1NJ9A 2JJWA 2BVOB 3BQUA 5A2IH 1QBBA 3L9RA 4GUPA 1KJ2B 1PKQA 1G7PA 2PW1B 4KH2A 3K80A 5CAYB 1TPXB 1MAMH 4WU5B 1HEZA 4MS8C 4PUBL 3FB8B 2BNRB 5GIRA 2DTSA 2H26A 3QNZB 4KTYA 4BZ2L 4L4TA 3I3BA 4G42A 3UAJC 2I9LA 3S5LG 3O2DH 1A3RL 3AROA 1KEML 4Q9QH 5HDLA 5F96L 4PS4H 4I0PC 5C0BA 2YSSA 4JO2H 3HZYB 2EYTB 1A0QH 1CFQA 4D0CA 1D5IH 1FGNH 2C4FT 1ZHKB 3BO8B 3LRGA 4K9EC 5DRNB 3V6FA 1MY7A 1D5MB 4L8SB 5HD8C 3ARPA 5ESQB 2GW5A 1JGVL 1AC6A 1VGKB 4LLMB 5F7LB 3WIHH 1UT9A 5J9PA 35C8L 2YD1A 5HVFB 1DSFH 1CXEA 4HJJH 1UJ3B 4M4PA 5FCUH 3ZKXC 4M1DH 1OP5H 3STZA 2VN4A 5KANI 1GXEA 4LCWE 2VDNL 1FO0H 5GGRY 1G9MC 5FM8A 2RAMA 4Z7OE 4NQCD 3N06B 4YIQA 3SDXF 1SJVA 4TNVF 3QA3A 5GS2D 4XXCA 1TTGA 5E9DD 4IRZH 5L0QB 5HI3C 3VFPB 1JHTA 2QKIB 5FF6A 3VWJD 3H9SA 4MJIA 3V4UH 4WI8A 5SX5K 1N6QH 3CXHJ 4U1SA 1DLFL 2GK0A 1SJEB 4ODVH 4K71C 3B43A 4NO2A 1G0DA 4NNYA 5T1DL 3TC9A 4JFPB 5L2JA 3GSRB 3MA9L 4YXHH 1ZLVK 4WEMB 2ZPKL 1RIHL 4Z7VA 5B22A 2X4UA 3FQXB 5CD3B 2DYPA 1E4KC 4TVPH 4QTHA 4D0DB 1AE6H 4JO1H 2HT4D 4PRHA 3W82A 2ATPB 4FQ2L 3BAEH 4AT6A 2HG5A 3NOIA 3BZ4A 1U2CA 4ZS7H 5AYQA 2WNGA 2YMXH 2Q76A 1E6OL 1I9IL 3T0VA 4JZOA 2A77H 4BFEA 3PWUA 1L7TL 5FA3A 2X4OB 1CG9A 5BV7C 3VGGA 2EEBA 4NNPH 4H26A 5T3ZL 2VXUH 2JCCA 4KI5E 4GS7B 1DBMH 1JTPA 1IKFH 1T04B 2P45B 3VFUB 2HVJA 4OLXL 3BGFC 3MJ9H 4S2SB 1CVRA 4K8RD 3P4NA 5I9QC 3RU8L 3U7AA 4GKNB 1QRKA 5CUSH 5TDOB 3DRQB 2ADIA 3LIZL 4WHTB 1ORSB 3DURB 4ZD3H 2DL9A 3UMTA 2QADB 2Q7YA 4LCUA 3MLTA 1CF8H 4QHLB 4UZGA 2ADGB 1NLBH 4L4VD 3WSQL 2CH8A 3CK0H 4WIQA 5FUZL 5CEYA 2XWBB 3MNWB 5CZKA 3PGDA 3EZJB 4UQ3B 1BM3L 1G9ML 1J1PL 2IPUK 3GMPA 3K4AA 5EO0B 5DJDB 3N1PC 3G5XA 2AS5M 2W9DL 4XCFH 5MEOA 4WWID 1N0LA 1A1NB 4JG0L 2EH8H 3GBNH 3D3VD 1DUZA 4HBQA 5EORH 2CR6A 1TDQA 1F4AA 4QWWD 1OT2A 5ISZB 2LQRA 2ZCHL 4NPYA 4HV8A 5GPRA 4Z7UF 5FUOH 5C9KA 1ETZB 4O51B 3ZSSA 5DRWA 2DWDB 5I17A 4O4YH 1T3FB 3AM8C 4MD4A 4WNQA 2EIBA 5HGHB 4UAOB 1OGAA 4X8XA 3RDTA 1KTKE 4KI1A 3TA3C 3SDAC 8FABA 3BZDA 2AQ2A 4BSVA 3GMQB 3FRPA 1RJCA 2VDOH 4R7DB 1KC5H 1RUPL 4Q58C 3KLAA 4U1HB 4WTXA 3BIAX 5ID0A 4HS6B 2UWEA 1FCGA 5I76B 4OFYA 4WUKH 1F58H 2IALB 2VZOA 2NR6C 3SCMD 3DO7A 4KJQD 2V9QA 2JJSA 4X8JB 4OKVB 4YDKH 2VIRB 2J2ZA 3OXSA 4TYUA 1I1AD 4GXUM 5KW9H 5BV7L 2X1QA 1C12B 1M05A 3MRRA 1JPST 2DQFB 3KR3H 2H32B 3TYGL 5D2LA 1IEBA 3T2QA 3GBML 3M8OH 3TT3H 1QSFB 2XN9A 4JPKH 5GZOC 1D5XB 1MCOL 5JDJA 1XR8A 2H45A 3O6FA 3VD3A 4P2RE 4L8CA 3C2AL 3MBED 4OD3H 4UU9B 1AI1L 2PO6D 1FYTE 3RWGB 3ULVD 1BD2E 5DI8A 3FQRA 3EO0A 1TQBC 3V52L 1FNHA 4OUUA 4JM2B 5DFTA 4ZXBA 5T1LB 3UYOD 3RL2B 1JL8A 4HW6A 3LH2L 4MGXA 3QI9D 5CSZA 5F7FA 1A7PH 4FZ8H 3VXPB 2YC1A 1RK0A 2AV1B 4PJBA 3I6GB 4X5XB 5FFLA 1KYOK 5IW6A 2EYRB 3IU4H 4YQXH 3KPSB 1HH6B 5C2BH 1R0AH 3EDDA 4GAGL 3MTRA 3DVNA 2FX8H 3GJEB 3RKDC 5E2WH 3HI1B 4TSBH 2IAMA 5DJAA 4HUWB 5CSGA 1RZIB 1JGUL 3WCYA 1AR1C 1MI5B 1YUHA 4Q9CA 3HC0B 4WRLA 2AXGB 1YYMH 2K9UA 4OZHE 5INCB 4F37K 4ONGL 3KYAA 4ZFZA 2Q8BL 3B2UD 4LF3A 4Z0XA 3RNKB 1A6WH 1PD6A 4OZ4A 4I2XA 4OCSH 7FABH 3IF1B 1RD6A 3L7FB 3UJIH 1F4XL 4NCC2 1S5IH 3SBWC 1S7XA 4DCQA 3Q3GA 3VFNA 5C0JB 4XP5H 1C5CL 1LE5A 1I7TB 3DSFL 3TYFA 3QG7L 3KPRD 4UQ2B 4OFKA 5TDNA 2HYMA 4ERSH 2P8PA 1RFDH 3FRPG 3V5KB 1AQKL 4M6NL 4DN3L 5IB3B 4GAYA 2MWCA 5IBTL 5SWSA 5ADOL 4QHNA 2VXQL 5T3XE 3TBTB 2ICWB 4RRPA 3ZHDA 4MXQC 3IB4A 4JDTL 3CPLB 1QG3A 4H20H 5GJTH 4MDIB 1UM5L 3WIIH 2RFXB 1J5OL 2QJDA 2ZUSA 3O6LH 5E9DB 3MLZH 3BGMB 2CLVA 3VWJB 4ELME 3ULUE 3U4BH 1QFUL 4GLRH 4ZFOA 1RULL 2Y7QA 5DGQA 1T1XB 5AZ2L 2WUBL 4QHUA 1HI6A 2AXFB 4FFWD 4WEBH 1FZMB 1CGUA 4DKEL 4OQTA 5D96B 3NA9L 1KCSH 2YK1H 3AY4C 3FQTB 5DTFA 4OV5A 5I1CH 4UT6H 3PDOB 2YS4A 1TJGH 1WFOA 1IBGL 3N85L 4F9LC 1EAJA 3QWRD 3UTSD 1X6NA 1CXIA 4ZNCD 2D31A 3I50L 4IDLA 2HKHL 1P2CB 1GSMA 1RVFL 3KYMA 3V95A 5ETUA 2H6PB 3EOTH 5TJWK 4ZUSA 3S9DB 4LSRH 4N1CA 5DD1L 3BP7A 4JY5H 5E8DL 2MCPH 4ODWB 2YN3A 2ZUQB 4NHCL 3LVEA 4U1MA 4OM0L 4XX1E 3QIWA 3BZFA 4R0LC 3T3PF 2VLRA 4HKZB 5DVOA 1X4YA 3L1OH 3VI3E 4DWHA 2YA1A 4BSWA 4IMLB 1TNMA 3ZL4H 2R8SH 3HMWH 2I9TA 1XR9B 1S3KL 4Y5YB 3C9NA 4K07A 1VPOH 4X9IA 4AEHH 4NZDA 3ISWA 3SDCC 4K23H 3BJLA 5EZOH 4MS8D 2ZCKL 3U0WL 4HWZA 1AKJD 3QQ9C 2Q8AH 1PEZA 1XF5A 4MNGE 3VXOB 2MHAB 1YEDB 5E7FA 4ZO9A 3Q6FA 4F7CB 1KTDB 5LGJA 1IVLA 1Q9WA 5KSBA 2SEBB 3OTTA 5T3ZD 3KLDA 4PBXA 1RUML 2JELL 4D3CH 5TE6H 3MA7A 2X89D 4KRLB 4I0PD 3TV3L 4B0MM 1N64H 3GNML 1MJ8L 3GIVB 4G9FE 1G7LB 1KNOB 1TVBA 3L5XH 5DHVH 1QLEL 4RRPG 4A2MA 3D3VB 4UUJA 3VFOB 5HD8D 2DQIH 4WU7A 4U31A 1WWAX 1JNNH 5EO9A 4LDOB 2EEDA 2DLHA 2Y07L 5LWYH 4GBXA 4P59H 4G6MH 2EDHA 3D1MC 2BFVH 1F3JB 5CIPB 4ZQKA 1U8IB 1I3RB 5BZWB 1MVFA 3LCYA 4IIQB 5J1TC 3IT8D 3V4PL 3QEQD 3T0WA 3IYLW 4X4ZA 2VERN 3EOAA 3EW3B 4N90E 4NN5C 3S35H 3TBSB 1HQRA 4XHJC 3PWPA 3WS6A 3DWTA 2DLIA 3MACL 4A2LA 3C09C 3PHOB 3RX5A 3SCMB 3NH7L 5IESH 1KCUL 5C0GA 5T1KD 1A9BA 1I1AB 4F9PA 4O2EB 4BA8A 1S7QB 3KNBB 2ZSWA 4MB4A 3FN0L 1AXTH 5HXMA 3L3GA 1J7VR 1RHFA 1IAKB 4U0QB 2WMPA 4NN6C 4X6BB 5LJYH 2W0LA 3WN5B 3JV6B 5D7SL 1QLRA 2NY0C 3VJ6B 5I1GH 1CLCA 2Z31D 3O81A 2VOTA 1FVCA 3VRJB 4EN3A 4HBCL 8CGTA 3ZKMD 5FM5M 5DJZA 1T20B 2PO6B 3RUGE 1C7SA 5E99H 5IFHL 2M1KA 5L7XH 5C7XL 4Y4HC 1NCWH 4QCIB 2EE2A 1QO3A 2EICA 3CFDB 5D7JB 4PJDF 3ZSTA 5BMFH 5E8NA 1L9MA 4LU5L 5JHDE 1NCTA 1W72H 2V2WA 1U58B 4JY6A 4LVNC 5IR1A 1QSED 3WO4B 4L3CA 2J6EA 4NQXA 2KQNA 3GRWL 1OGTB 2F19L 1RV6X 3DI3B 2QQKL 1IGJA 5HGDB 2R1XB 2WBWB 3U9PL 4Y2DC 1HDMB 2Y36L 4P9HL 4GOSA 5ICXA 1T0NA 3NFPA 1GHFH 4XVSL 4IRJD 4DKAA 1FAKT 1X44A 1KJVA 3F5WB 2VTFA 4BH8B 1Q94B 5KVDH 1SM3L 3UYRH 3MZTA 1QFWI 4R8WL 1RJLA 4KV5E 3P40A 5JUEH 4QXGL 2ZCLL 2YKLH 3T1FB 5I75B 5TDPA 1U41A 3UJJL 5HDOA 5DA0B 4K2UH 43C9A 3AFLA 4LCWA 4JJ5A 4X4YA 3L3HB 2CRZA 4IHOA 3FOLB 4HPOL 3TO2A 2D7QA 4G8EB 5I16A 3P11L 3MNZA 1EO8H 1M71B 2OL3A 1QBLH 3R4DA 2OZ4H 5F7EL 2X9XA 1DBBH 4U05A 1M4KA 4YHOH 4QRPB 4LVOB 4MAYC 3TA3D 4KK6D 5DD6B 3QT2A 3SDAD 3FN9A 3QCUH 4XNMB 4LKXB 4M1CC 1YEGL 5C6PB 4NKIL 3E2HC 4XTRC 3BT2L 4DVRH 1WCQA 4CBPA 5T5FH 4NO5B 5AUMA 3NFSL 2OR8A 5IEHA 2AEPH 3FO1A 1HSBA 3FL7A 2DQGL 2NR6D 3D0LA 4WFHD 1YC8A 3G6AA 3P9MA 4MA1B 5TF1L 3QWQB 2BRRH 3CFJB 5DQJA 4P2QA 1LGVA 3O0RL 4WFEE 5BCAA 3UP1A 5HHOD 2YD9A 1V3KA 5D1ZA 5ANMA 3KLSA 2VAAA 1ZHBA 4O2CA 5D5MB 3UTSB 4KKAD 1UEMA 2B7DT 5EUOE 3H3PL 1P5VA 3NCBB 2G75A 4EEEA 4D9RD 3TIEB 4YO0B 3SE4A 3ARSA 3JWDC 1FFQA 3AB0C 2J8HA 3VH8A 3MRDB 3O4LB 1TJHH 4Y4FB 3UC0L 5I1KL 4HIIA 4P5TB 4O5LL 3TZVC 4NQSA 4FABH 3NIDE 5ICZA 2FR4A 3B2VL 3GSQB 3I6KB 3W0WD 5IMLA 4C55A 3C08L 4RQQA 2XV6B 4HZAA 1C5BH 1ACZA 1JWMB 4LMQE 1F13A 4WJ5B 3RKDD 1BOGA 5LAXA 4J3TA 3HUJB 3IXAA 5GRYA 3V8CA 2DTMH 2PETA 1AKJB 4J8RA 2FECL 4JHWH 3OBAA 4NC1E 2ZG2A 2A9NL 4P3CL 5B4MD 4KUZL 4HWEH 4PJ8A 4YEFA 4BK5A 1XGQA 5TGBA 4HF5L 5FHBL 5TFSH 1TETL 3B4NA 2HN7A 2W0FA 4KK9C 1NCDL 2O5ZH 3MRJA 5LKNA 4I0PB 4OKDA 1FAIH 4RA3A 1QRNE 2JJUA 4QRQB 3GSWA 2QQNH 4N9GA 2MKWA 3HMXH 4K7PY 2PXYA 1R3KB 4Z7VF 4KTDL 5EU6E 3EFFA 5FKPA 1PQZB 4J6RL 1HHJB 1TZIA 4ZFGH 3F7PC 5E4EC 4GMTL 3L3DA 5FGRA 1AY1L 4X6DE 4PJHB 3VG0L 2DM2A 4OF5A 4X0KB 3SGKC 5FYJL 3QZWB 4UB0L 1U3HC 4G8FA 1JJUA 2VQUA 3VXRD 3ZKXB 1DZBA 3GJFA 3QEQB 3DLQR 4P5MB 4X7SL 2V7NA 4LLQB 1NGPH 1LHZA 3CUPB 3L5WB 2R15A 3RGHA 3MYJA 4XXCC 2JCCF 2PYED 5JQ6L 1KIQA 1DUYB 2DMCA 4TVPE 3ZDXF 2GK2A 1IGIL 2E27L 2HLAB 3S34L 4X9GA 2XKNB 1G7MB 4P2RA 3WFBL 3JWDL 4YNYB 1OQOA 4JDVB 3ROOA 1FV1B 3SPVB 4MDJB 1BD2A 1C8PA 4CU6A 3PG2A 4K71B 4U3XA 5CEXB 1QQDA 4ZFFB 2HP4A 4NO0D 2OTUA 4FTVE 4JKLA 2YUVA 3VH8G 1JZ6A 1EFXA 4M7LL 2XWTA 2Z31B 5I1DB 1CBVH 1V7ML 4L3AA 2F5BL 3HG1D 5EBMA 4P5KA 5IMOA 3MLRH 4HQQL 3FRUB 1QFWM 3EYSL 3VMNA 4OZHA 1BFVH 5IBUG 3LS4H 1OAUH 1LD9B 1P4BH 3KPLB 3QQNA 1D6VH 1KCRL 1AO7D 3QQ3B 5BV7B 2FWOB 3DMMA 3OJDA 4E42B 4JFDE 1A6UH 4G5ZH 4J3SA 5IEKB 4WY7L 4HZLB 4FQHB 3WXWL 2P1YA 4L5FH 2EDFA 2XA8H 1MF2H 2X1PA 2RIKA 3V2AR 2C3WA 2VQ1A 1MHHB 4ODTL 1GL4B 1BBDH 3BGFB 3VXSE 1U9KA 1HKLL 5I9QB 3IDUA 5ENWA 5I1AA 4MA7L 3GGWA 4IRJB 1AGEA 4HKBB 3BKCH 5I1JL 3EHBD 1LDPH 3SDCD 3WJLA 3OX8A 4HKXA 5I8EA 1WZ1H 4HXAH 3EYUL 1YEKH 2NY4D 1V3MA 3LMJL 5I19H 1IJ9A 4Y1AB 4R96A 5J13C 3MBXL 4ODXB 3QUML 3TF7C 3UPRB 3ZYOA 2I07B 4K7PX 3MLXL 1S7VA 2ATKB 3S3JA 5DDHB 4XBEL 3FO2B 5CBAA 4PJGE 5GSRA 3WXVH 2Y5EA 5T33H 1YZZA 4TTDD 5IVZB 4PJFE 5D2LF 1JIBA 3BN9D 2E7BA 3MV9E 2CKBA 4LPWA 4ZSOB 4YZFF 4ELMA 4NP4L 4YXKH 4XZUA 3S4SB 3BDBA 1N8ZA 5D7KD 3R1GL 1A7OH 1ZLWK 4ZNEE 3X13A 3BXNA 3F7YB 4K94H 2GJ6D 3HZKB 3RDTC 4EDWH 3TA3B 3VXMD 2XWJA 3SDAB 3ZTJH 4PRAB 1AGDA 2ENYA 1DFBH 1BJ1H 2C3XA 2IEPA 4XH2B 4NQUA 5EOCL 5IM7A 1YEIL 1BJMA 3PWLA 4PJBF 3KPQA 1HHIA 3IFNH 4XHJD 4JVPA 1B4JL 1T89A 1CLOH 4NKQB 3LKPA 1VENA 3B6SA 5EOQH 3AS1A 2YEZA 1BQHB 1LO0L 2WIIA 2JJSC 4RISH 1CYGA 4GKSA 5F88A 4NFDA 4HFUH 5JW4R 1VFBB 1D9KC 4L3EE 3DROB 4QRRB 5D2NE 2X4NB 4FQQB 5HHOB 3N0PB 4RAUA 5KJRL 3DTXA 1JYWA 3REVA 2NY0D 4JB9H 3HE6A 4XP1H 1I4FB 2QQLH 2IQAA 3JWOH 5DFWH 4Z7UB 3MCKB 1MH5B 3Q6GL 5KSUB 4URTB 5IROA 4Y4HD 4KDWA 1T21B 3T77A 1TQBB 5IB2A 4PG2A 4MJ6B 3ZDZF 2A6KA 2P44B 2QQQA 1RZ8A 4ZXBC 4G3YH 4MNGA 1ED3A 3HI5H 4Y0GA 3SOBH 5E94A 1PW3A 4M00A 1NGZA 5JDSA 3TJHC 3T04D 3W0WB 4QT5A 3TNNB 4CVXA 3TO4A 2P43B 4BUGA 1P4IH 2ESVD 4LEXL 1UB6B 4RA0C 5E1AA 3T2NL 3VFWB 4G9FA 1FVDB 2FSEA 5IB1B 3AGVA 1EJOH 5BRZE 4UDTA 2BNQD 1KJ3L 5DZNA 4I3SH 3GMRB 4NJ9L 1BZ9B 1L9NA 4ISVA 2YD2A 4MSWA 1OSZA 1GGUA 3A6CL 5JIIA 2D03L 1DQLL 3ZKNC 2AJ3B 3CVHA 4PRBB 3QUYA 1L7IL 3FFDA 4G7YH 2GKIA 1DCLA 4NRZB 3OKKB 4OT1H 2Q6WB 1S9VB 3BVNA 1PG7X 1I8KA 3H42L 3UJTH 5J6GB 2WLYA 3SGDI 2BSED 3H9ZA 4DK3A 5EU3A 3TFKC 1I8IA 3OKEA 1VHPA 1BOYA 2VH5L 4JN2A 2BHYA 4RGNE 4FQJH 3R0NA 4YDIL 3BWAB 5GGQH 3U0PB 2V6HA 1JHLH 4N8VA 1YECH 4KU1A 2D3VA 4NQDB 5ESAA 4QRSA 3VXRB 4XMKH 1D3CA 1EHXA 4R97C 5IBLC 5CGYD 1YQVL 3WFEH 3BN3B 3P2TA 4MAYD 4NKDA 5EU4A 5LGKA 1XGRB 2R1YB 3UEZA 3HZMA 5KTEH 4LVEA 5GJSH 5C9JA 3RL1B 3QPXL 4FXGA 4M1CD 4RFOH 4G6AD 2P5EE 4XTRD 1E6JH 3PP3K 4AYFA 3VMPA 5MEND 1QUNA 4PJ5D 2BVEA 1EZVY 4XX1G 2HJLA 2DQDH 1BLNA 3RUGA 3MOBL 3HI6L 4X6EB 5HYIA 4NDMA 1MFCL 5F9OH 5FYJD 5FYKU 3UTPE 2VB5A 1UB5B 1JGEB 3FMGL 1R24A 4KJYA 5JHDA 1GOGA 3KWWA 4X5WB 3MRNB 3AUVA 2EDQA 1BQLH 3O6KL 5BXFB 2Z8RA 1KBGL 5KSBF 3QYCA 4MA3A 5EA0L 4HEPG 3MV11 1YYLL 3QUKB 2ICCA 2FJGB 1A22B 1DQQB 1MCPH 4OZFH 2JB6A 2NX5A 1G7IA 3QHFH 2JB5L 4IOIA 2NY3C 3JUYA 4O02H 3RJQB 5L2KE 3HS0A 1OT1A 1Z9OA 5I2IB 1P69B 3RTQC 2MQ3A 5E6IC 5I30H 1UH2A 1KIUA 3INUH 3LSOA 4W4OA 2B4CH 1AO7B 2YPLD 1EJ6A 4LSVL 3QUXA 5EB9A 3LN4B 4R0LB 5L6YL 2DI8A 2D4DA 3WFCH 2FJFB 1T7YA 1YMHA 1T5WB 2Q7NA 2NXYC 4EOWL 4WDIB 3KYNB 4MNQE 5A1AA 1YEFL 2NY5C 2GTWA 3JV0A 5BVPL 1A1MA 4Q9BA 3MXWL 4WFGD 4XNYH 3SDCB 5F93C 3DSNA 4YDLC 4KVNH 1RUAL 4GW5B 3U9UA 3MLWL 4JN1L 4S10A 1JBJA 2R4RL 5HPMB 4PY7A 1IC7H 2PUQT 1DQMH 1U2HA 4KK9D 3P0VL 1KLGB 1YNLH 4F57H 3S7GA 5IQ9A 1IKNA 3EOBA 4N8VG 1T0MB 5DSCA 2J8UE 1GAFL 1N5AB 1ITCA 1VEOA 1PEWA 5HHNB 4JRYA 3KXFD 5FYLL 1AP2B 4OGAD 1N26A 1FFNA 1V3JA 4F15C 2XOTA 4ZUWB 3P73A 5JPMB 1NMAL 3X12A 3F6IA 4GBXC 4C56D 4NM4L 3G5ZB 2X10A 2GJ6B 3RHWF 4G43B 1N5YH 1U91B 3VXMB 5J1AB 1KIPA 1MHEA 1RMFL 1U3HD 3NCCB 2AEQL 3DV4B 5HYSA 5C0IA 3FO0H 3D6GA 1KCVL 1KIRB 4NN5B 4R3SB 2CIIA 1CDBA 4UT9H 5EUOA 1KGCE 3WS6C 3T0DA 1DN0A 3FT2B 2Z35A 4RAVB 3BRFA 2MPAH 2VNCA 3VGFA 3C09B 5DUMH 1OP3K 4EUPH 5JOFB 4JPWH 1ZSDB 4JO4L 3U36B 5KVGL 4HX1A 4OZIB 1HXMA 4P23A 4WHDA 5CKGA 4F9PC 2ED9A 3BPNC 1UWXH 2X4RA 3GMOA 5JXEA 2GTZA 2AJUH 5H35A 3L5IA 2W60B 3CDGA 4HKJB 2NY0B 4R7NA 4BK4A 4AMKL 4LAQL 3O2DA 2FEEL 1DJSA 2IFGA 1QFWH 4NZUL 4YFLI 3IRZA 4V1DB 1HINL 2FBJH 1F2QA 2K7QA 2FYYB 1BREA 3HNVH 1AD0B 4Z7OF 4KROC 3O3DA 4HUMB 1JPSH 3IXTB 4Y4HB 1DDHB 3BDYH 1ZXQA 3IDXH 1ERNA 3WIHA 4O58H 1R5IA 2NXZC 3MRFA 1K4CA 3TH2T 1I1YA 3FOMB 5DD3H 1MEXH 3VXNB 4X99A 1U8QA 4LVNB 1FL5A 2ESVB 3UDWC 4CADB 1FO0A 3MROA 2IGFH 3SKOA 1QRNA 2CXKA 4I9WE 2A6IA 1NCCH 2MSPA 4M7JH 5ALCH 2V7HA 4Y2DB 3RVXC 2F58L 2BNQB 1MLCB 4EXKA 1U92A 1EUUA 1NFIA 1S9XB 5EC2B 4TUJA 5EU6A 1BJ8A 1MJJA 3MRIB 5DK3A 1PGRB 2P5WD 3RKPA 3KPPA 4X6DA 1JI2A 1SEQL 3SKMB 5A2LH 4LEOB 1OM3H 1FORH 2XTJE 1PYWB 5SV4A 1OAYH 4JHAH 4ETQB 2IC2A 3P0GB 1IGTB 3CZFB 2KBGA 4P4KA 4PJDB 4K3JH 4V2CB 4KI5F 3C5SA 5C09E 2VZVA 5HYSG 1ZGLM 3D39E 1C1EL 4M61B 5I74C 2LU4A 5JORA 5DMKA 1GGIL 4BZ1H 1MCWW 1BEYL 5CCKH 1RURH 3PNWA 4H88H 4KY1L 1KPRA 4N1EA 5CHNA 1DVFA 4GRLA 2BC4A 4MAYB 5E5MA 1K8DB 3RWHA 2CLZB 1OVZA 2D7NA 4FTVA 5I8KH 1LEKB 3LDBC 2XZCL 2DAVA 3E2HB 3AVEA 5IVXE 5I8OH 3G08B 4DGYH 5MENB 4TRPL 2HA1A 1Z3GL 3NCYS 5K9JL 2X4SA 5C08E 3MJ9A 1WFUA 1OWWA 3KAAA 5CJOH 1UM6L 2Y6SC 2IWGA 4JFYA 5BS0E 1FL3A 1UXSB 2YBRA 1OARL 1K3IA 4XAWH 1D9KD 1CGSH 3NFNA 3MRKA 4U1JA 5HHVL 1BJ1J 4JFDA 4PLKC 1X5IA 4PJIE 4KI5C 1S9KC 5ICYA 2R0LH 3E3QC 4YE4H 2XT1B 2AJSH 1MCIA 2A6DA 5FAAA 3FTGB 3VFSB 4HS8L 1EERB 4PV8A 1U8LA 2VLLA 2BOBB 5D72L 3SE4C 1R5VA 3DX9B 3AB0B 1MCEA 3ARYA 3R06B 2UV3A 3VXSA 4PJXE 1CD1A 2D7TL 4AENA 3GB7B 1F90L 1YJDC 2YPLB 3B9KD 1HSAB 3TZVB 1VERA 1IC5L 1A6ZB 1X5GA 1FPTL 2P48B 1JYVA 12E8H 5DURD 3SY0B 5GHWH 5IQ7H 1NBZA 1KLUB 1U8NA 3CMOH 3QBTB 1KN2H 1JWUB 4PJGA 4GUPB 4Q97A 5BQ7A 4YAQA 5L88H 4G6JH 3HCVA 1G7PB 4XCCL 4PJFA 1FH5H 1HEZB 3DUSA 1GJIA 4HH9A 3MV9A 1P84K 1FIGH 4PJ8C 1T83C 5GIRB 1JF1A 2H26B 2I9LB 3RZWA 4POZD 3UZVB 3ZKND 2OS7A 4ZNEA 3QH3A 4X7EC 1FQ9C 4JE4B 4D9LH 3GMMA 5D6DC 4CVUA 2E8ZA 3QRGH 1CFQB 3EYQC 4D0CB 1LO5A 4CGTA 2IADA 4PR5A 2GSIB 3OF6A 3K46A 2MOVA 5MHSD 3V6FB 3WFDH 5GS0H 2PXYC 2CRYA 3DX8A 1NC4D 1Q9KB 3O8XA 3QDME 1I3VA 4I5BA 2DWEA 1A6AA 4PJ7E 4AG4L 3TFKD 2AEIT 4H8WL 5E4EB 4C56B 5J9PB 4PJ9C 2XICA 1JNJA 3OGCB 5SWSD 1NDGA 3O9WA 1BBJA 2A38A 4X9FA 1YNTA 1U3HB 4JRXA 4OZHF 3O6MH 3UCRA 4L3EA 4QGTA 4N8CL 2WBJD 4LLAA 5D2NA 1UWEL 2F8VA 4ZUUA 3QA3B 4Q6IC 4R4BA 5E5UB 3DX7A 3NCJL 5FYLD 2DQTH 1FVEB 3VFGH 4S0SD 2QHRH 4MJIB 3MLPA 4FN0A 5DD5L 3PGCA 3FCTB 2F8OA 3HNSL 2F5AL 4XC3H 5CP7B 3ARQA 2GK0B 5KSAD 2D7MA 5F70A 5E03A 4JFHE 2QSTA 4QXTA 1QPXA 1YJDL 4PP2A 1PJ9A 2IANE 4QHMA 5L2JB 5ILTH 4QRUA 2OQJA 9CGTA 2Y06H 1T7WA 4CUCA 4HFWA 4Z7VB 5CZVH 5SWQA 2X4UB 1I8LA 5DJ2A 3QEUA 2QLVB 2DYPB 4FQIH 3WUZA 3HN3A 4HUUA 4M43L 1IGML 2BJMH 5E56A 3FO9A 3HKFA 1U8PA 4LRIA 1I7ZA 1KPVB 4UILH 4PV9A 4HUXA 5IMMA 2PYFA 3BZ4B 1YEEL 1CL7L 2NY3D 1K9TA 1F02I 3MJ7A 4BQ8A 2ORBH 4DK6A 5DUBA 2G5BB 4K3DH 2V9RA 2VZ1A 1QFHA 4L29B 5E6ID 3RTQD 3UBXA 1Q9LA 1QHPA 2J4WL 4ELMF 4OQ1A 1CG9B 2R0ZH 3ULUF 3OR7A 3IFPA 1NMBH 5DK0B 3U0TA 4X98A 1GC1C 3T2OA 4TUOA 2BCKA 2VLRD 4DZBA 5LGHH 4FS0A 3EJZD 4U6HA 1FZKA 1WAAE 1A5FH 2PN5A 2VO5A 3RPIB 2HVJB 2A9MH 1JHKH 1K3ZA 3T4YB 2FDBP 3TBVA 4OFPA 1A2YA 2ADIB 4RX4A 3AXLA 2DLFL 3EO1A 1KB5L 5ACZA 5DYOA 2Q7YB 3MLTB 1NUNB 3VE0B 2VDLH 2WQRA 5J13B 5CEYB 1KCKA 3AREA 5DMJB 3PGDB 2BNUB 4ORGA 2D0FA 3GMPB 1IM9A 1UCBH 4TQEL 5GSVB 3G5XB 5MEOB 5FGBA 1V05A 3D9AL 1T5XB 4E41E 2P5EA 3VI3F 2I60L 1A64A 1ITBB 3ULUC 1LVEA 4QXUH 2UYLA 2X1XR 4F8TA 5DRWB 3VA2C 5I17B 5GS1A 4KHTL 4WNQB 1KSRA 1R3HA 2R23A 5CJQH 4NRYA 5IT2H 1JRHL 5I1HL 3RDTB 1OLZA 4Y4KA 1FFPA 2EH7L 4XPBL 5JOEA 4BSVB 2XZAL 4P46D 4FFZL 4GAJL 4LQFL 2RCSL 5ID0B 5GS2H 1EEUA 4RWYH 3P4MB 4F58H 4F3FA 1T89C 4QOKE 3NABH 2MTPA 4A6YL 1H3WM 2OSLA 5FHAH 1TENA 1N59A 2AVGA 3ZKQD 3BMWA 3A6OA 4K3HA 5L2KA 1EEYA 5DS8B 1BFSA 4R4FL 4Y7MA 1D9KB 1M05B 3MRRB 1I9RH 5B39A 1A6TA 5C0DA 5D2LB 3HE6C 1A4JA 2XN9B 5F9AC 3UBXG 3P3YA 1HWGB 3U1SH 2A2QT 2EYSA 4XNXH 1TJIL 1ZT1A 4WCYH 4L8CB 5K59E 4JZNA 4ZPTA 5DHVA 3GO1H 2LV4A 4M7LT 4OBSA 4MNQA 5ELIA 4KROD 4YBHA 5DI8B 3FQRB 3QB7C 1X5AA 4PB9H 4JHZA 1UKTA 4OUUB 4ZXBB 5DRXA 4XXDA 3SGDH 1RUQL 5HHMD 5CSZB 3LRHA 4O9HL 2YC1B 1RK0B 4WI2A 4PTTA 4PJBB 3TO4C 1CU4H 2R1WB 4KKNA 5IW6B 1AR2A 5DURB 1XZ0B 5GRUH 1AFVL 4PRPA 4DW2L 2NY6C 3S37L 1IT9L 1VFMA 3EFDL 1CDYA 4BFIB 4G8GD 3ARFD 3ROLA 5C0CD 3MRQA 2J8UA 3K0WA 5DJAB 1HHGB 4MXWL 4L8DA 4S1QL 5EOTB 3VGHA 4Z9KB 1NFKA 4JFZH 1QTYT 1SBSL 3RVXD 5LBSH 3W2DL 1JFQL 4D8PA 3MRGB 4LF3B 3TN0A 3QPQC 3MFFA 2X70A 1HZHL 4KHXL 3RUGF 5B3JE 4KGLA 5IF0A 5I73C 4UIKL 4DCQB 2DQHL 3MLVL 3Q3GB 5CZXD 3KG5A 3VFNB 1IGFH 3OJVC 1DLHA 1LO3H 4AEIL 1F3DH 4LCWD 1U3ZA 5CEZL 4L8BA 1MFNA 1MQKH 1UJTA 1NC4B 1Z0MA 3DARA 1KTLA 2P8PB 3S6CA 3U7YH 4QYOB 4GAYB 3OKLA 1X7QB 4ZUTB 5SWSB 2DQEH 2XTLA 5CIPH 3P4LA 2VXSH 4R90H 3SGJA 1FGVL 3WKML 2W0PA 4R97B 1CE6A 2B1AH 5TPWH 1W72A 2BMKB 2GSGA 5DUPH 1KV3A 1OAXL 1TZGH 4AM0A 1FNEA 4L9LA 4KV5F 3V5HA 5K33A 1UXWA 1ZHNA 2GT9A 2IMNA 1U8JA 5B39G 2RB8A 4TULL 2V9TA 1C16A 2Y7QB 3GZKA 5CGMA 2VDKH 3FJTA 1XMWA 5KSAB 4QHUB 1HI6B 4EXPX 4OLVH 4JPVL 3BIKA 2DRUA 3OB0H 3QIUA 1BVKA 3CSYA 1A7RL 4JO3L 5TE4L 1IC4L 4OV5B 2E3VA 2NZ9C 5AYUH 1MJ7L 2AK4E 3BH8A 3FN3A 3QEGL 3LRSA 2UUDK 2VDQH 1PKOA 2FLBT 32C2A 4PLKD 4KI5D 4EKXA 4X80L 4HWNA 3KYMB 5ETUB 4Y19D 3CX2A 4ZUSB 3MV7E 4I18A 1AC0A 1DQDL 2NY3B 4ONFL 3ULVH 2MJWA 1H15B 3ZZ1A 2VDPL 4KUCF 4X6CB 5F89A 4P3DA 4P2OA 4XP6L 4LNVA 3RTQB 5E6IB 2YA2A 3BP7B 3V8OA 3ES6B 2OZ4A 1AJ7H 1G1YA 2QV2A 5HHPB 1ZVHA 2KH2B 3BZFB 2VLRB 3WBDA 1YN7B 3TEUA 3K7UA 1FNSH 4HC1H 2A1WL 4KQ3H 4FNLL 1A6VL 3D87B 1IRAY 1RU9H 1CLYL 2CJUH 2BDNL 3HB3C 4UTBL 2FB4H 4ZOEA 2NXYB 2WAHA 4XCEA 5L9DH 2I9TB 3OKDB 4Y16D 4PGDA 4DZ8B 3C9NB 4MJ5B 1NH6A 2LTQC 4YH6A 1EBPA 4RGOL 3D85A 4BYHA 4UDUB 4HWZB 5EUOF 5C09A 1XF5B 2CR3A 5HYJE 3B9VA 1FNGA 3D39A 4WO4D 3Q6FB 5DC9B 4DUWA 1VB9A 1OPGH 3N9GL 1JGDB 5LGJB 5KSBB 1KEGL 2FX9H 1GCFA 1IKNC 3OPZL 3BWUC 5EUKA 5KOMC 1R5WA 1YDPA 3NIDF 4UUJB 4GW4A 5IVXA 3OG6B 1P5UA 2PXYD 2A0LD 5E6YA 4F15B 1EMTH 2RBLA 1CFVL 4AIXA 5C08A 4PUBH 4FXKA 2Q3ZA 4MJ4A 4PJ9D 4ZQKB 3JV4B 4QY8B 1DEEA 4BZ2H 2H8PA 4JDZA 5IFAL 3CDYA 1A3RH 1KEMH 4P46B 3O3EB 3IS1X 3DRTA 2RGSA 4U1GC 5T5NG 4IS6A 5D7IE 5JIHA 3U6RA 4PJIA 2NNAB 5EBWB 1IAII 1HQRB 1FN4A 4LSUL 3PWPB 4P0DA 1UZ8A 3G04A 4X6FA 1S7UB 3EO9L 1Z9SA 4JG1L 3L3KA 1JGVH 4Y5XA 3SJVA 1S9YA 5FCSH 3QFDB 2HMIC 1FYTD 4MCYB 5DWUL 4PJXA 4P23C 1BD2D 4FZEL 35C8H 3CNKA 4LCYA 5EBLB 4NJAL 3BPNB 4LDEB 2ZSWB 3FB5B 1ULVA 3ETBF 1EFXD 1QLRB 4HUNB 3BP5A 2VDNH 3BPLC 4X6DF 1FVCB 5DEZA 4CN6A 2V2TA 3WFZA 1NLDL 4J4PC 4PB0L 3HMXA 4DTGL 3A67L 4KROB 4J3VA 3WDIA 3L95A 4MD5A 1B0RA 5HI4C 4NC1C 4N9OB 5E8NB 1XF3A 5HHMB 4EIZC 2OJZL 2V2WB 5IB5A 3RAJL 1PLGL 4P9ML 3NBNA 3KPOB 5T1DH 1LQSR 4JY6B 5IR1B 1WC7A 3MA9H 4KPHH 3V5DA 4NGHH 5C0CB 1RIHH 3PE9A 2AJZA 3E6FA 3VMOA 2GUOA 4GW1A 1NCBL 4I3RH 1MIMH 1WT5C 1Z5LB 1ZT7A 2H2SC 4FQ2H 2CIKA 4F80A 1T0NB 2AW2A 4Z5RA 3QDMA 1A21A 4K3EL 3QHZL 5EN2A 3RA7L 4JFED 2CRIA 1E6OH 1I9IH 4PJ7A 5D1QD 2B1HL 1T1WA 4M1GL 5F1OB 3QJFA 4GSDH 1L7TH 2DDQL 2HWZL 1K4DB 5AAMA 1VACA 3V4VL 3CFIC 2ICEA 3QUZA 5T3ZH 4GRWH 3LKQB 4P49A 4LCWB 4TOYH 3MV8E 4P4KC 1KPUA 4OLXH 5M7QA 3TO2B 4IOSD 3RU8H 1PZ5A 1JPFA 5DJ8A 3QQ4A 1N6UA 1ACYL 3LIZH 3P9LA 1LE9B 1AGCA 5I74B 3UTZA 4N68A 2GJZA 2VL5A 1D6EB 1T66C 3WSQH 4GRLC 4NUJA 4BFGA 5FUZH 3PHQB 3RI5K 1NDMA 2IANA 4NYLB 5KANG 3RWFA 5TQ0L 3I3DA 4YGAB 2HRPL 3HZVA 4FXLA 4XMLL 3LDBB 2QTEA 1J1PH 4XAKE 5D70L 1J8KA 1YN6A 2LU3A 5CEZD 5E2TH 1VKXA 3PHSA 2W9DH 3ZT5A 1A0QL 3HE7D 5F1SA 1D5IL 4UV4L 4JG0H 2HTLC 3FAXA 5D7LA 3RZCA 2D7OA 1QP1A 3LKOA 1NAML 4HDIA 4PJGF 2ZCHH 3D0LB 4LHQB 4PJFF 1I7UA 1RJYA 2ZNWA 5DQJB 5E7BA 3BD3A 4PGJA 5BVJA 4G8IB 3ZLQC 3PWVA 1G84A 4PG9B 4HJJL 2CLRA 1DBKL 4O2CB