1GGCL

Major antigen-induced domain rearrangements in an antibody
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
215
structure length
215
Chain Sequence
DIVLTQSPGSLAVSLGQRATISCRASESVDDDGNSFLHWYQQKPGQPPKLLIYRSSNLISGIPDRFSGSGSRTDFTLTINPVEADDVATYYCQQSNEDPLTFGAGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Major antigen-induced domain rearrangements in an antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG2A-KAPPA 50.1 FAB (LIGHT CHAIN)
total genus 46
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1993-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ggcL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ggcL01
2OZ4L 3E3QE 2HT3C 3K1KC 5HI5D 5HPMB 3L9RA 5DEZA 3KLHC 4PJ9C 1BJ1J 4UT6H 2I26N 2CXKA 1RQ5A 5I1EH 1NFDB 3OSKA 4FRWA 5I66B 1ZS8B 1FRGL 1C8PA 1U93B 1KPVA 3Q5YA 4K2UH 3DPBA 3L3KB 4X6BA 3QDGD 4FA8A 4NJ9H 1U2HA 4ZS6C 5GRVK 4OZHE 4CGTA 5CEXA 5I1AB 5LGHL 2CO6B 4GBXB 1AD0A 4XP1H 1Q8MA 4OGAD 3K3QA 4YPGA 3RJQB 5CJOH 5KVDH 1R3LA 1CFBA 2FBJH 1RFDL 3OAZK 5TDPB 5GGTL 5EA0L 4MX7B 1K2DA 1A6VL 1A7OL 2XY2A 4JJ5A 1NJ9A 1Z6JT 4NP4H 3BPOB 4CVZB 5HHVL 1Z9SA 1BM3H 2W9EH 3K4DA 4YIQB 5I2IB 2G2RA 3LAFA 2X1QA 3UPAA 3FFDB 3WLBB 3B4NA 4XXDA 1A0QH 2J5LC 4MJ6B 2GJ6D 1YEJL 2IGFH 5DK3A 3MJ9L 4KJPC 4PGZA 5F7NC 3SO5A 4K9EH 4Y4FD 3V4UL 3BN9C 4LAQL 1T66D 1AP2A 2DYPB 4E41E 2MWCA 3IDGA 5D1XA 3B9EA 5GRYA 3RKDD 1UZ6E 1FGNH 2R56H 5DEGB 3VGAB 4W4OC 4Z7UE 1JHTA 4TUOA 4N9OB 2DOCA 2VXUH 5DT1L 4W68A 2VLME 3GNML 1HHIA 1CE6B 1KCUL 4U6HA 4MJIA 3ZKXC 1D5MB 1FH5L 2YD3A 3O8XB 2EDBA 3HHRB 3N06B 3L1OH 2ORBH 3QO0B 3QHZH 1CXIA 2ED8A 1DZBA 3CU1A 5EG6C 4NQDE 1ACYL 5ITBH 1KCRH 1OAQL 3L7FB 1UADC 1FZJA 4X4XA 2APBA 4K9EC 4UT7H 4TUJB 2FIRT 2DD8L 3RWCA 1CG9A 2VDPL 5HHVH 4FN0A 4LCUA 3GIZH 3CX2A 3VFVB 4CNIB 5I17B 1S5IL 3ARBB 3PGDA 4IMLA 4ISVA 1HSBA 5JW4N 4AYFA 2XFXB 3STLA 1EHNA 5IHZB 3CCHA 5D7SL 3TH4T 4I0PB 3VDAA 3FB8A 4XC1L 1DLHB 2BSED 1L7IL 1XGTA 5DDHA 2FZ3B 4ZO7A 4GRWF 2VYRE 4HKXA 2EDFA 5GHWL 3WDJA 2A6JB 2XA8H 4XNXL 3SO3C 4Q9BA 4G9FE 2HT2C 3BWAA 3HZMB 4I5BA 2GFBB 3ELAT 1YJDL 2GKIA 2EEAA 5J6HA 1A5FL 5IB3B 2DDQL 1J0KA 4Z7QF 3S3SA 4XP5L 1E4XL 1O7SA 3LQMA 5J57B 4G8IB 1E4WL 1NEUA 3DVGB 4PGEA 5MEOA 5CILL 5IB4A 2UWEE 4PRPD 5ADOH 3DMMB 3TH3T 1KIRB 4EI5A 4XXCC 5GGSY 2JIXD 2RBLA 1OTSD 1CLZH 2CJUL 3Q6FA 4YHZH 3KDMB 2XNAA 1DLFH 5EFIA 3FT3A 5HHPA 1BWMA 1P7QA 5H35A 4Y5YA 4NO3B 2WBJD 2NX5D 2Q7NA 3F7VA 1VFUA 2A1WH 2JK5B 3SDDB 3BPCA 2VDML 1UWGH 3MZTA 5SX5K 5FB8A 4OZHF 4Z7QE 1F13A 4LCWB 3WNMA 2UVEA 3IXTB 1U9KA 1CLOL 4YDVA 1KFAH 4LHUD 1PQZB 1TJHH 4RGNB 3SY0A 4LKXB 2NYYC 2DWEB 4RFOH 3S34H 5BRZB 2NX5A 3F58H 5C0GB 3TO2B 2PXYB 1BQLH 1RURL 4IRJD 2VDNL 4CVXA 4CVWA 3S7GA 3DECA 4XCFL 3HG1A 4MAYB 3T0EA 4LIQL 1E4WH 2VDMH 5HI3D 1FAKT 4C59B 1ZKAA 3K4AA 5B4MD 5ILTL 2XPGA 1G7IA 3JTSA 2Z35B 3L7EB 2KPNA 1YPZE 3HNSL 4FP8L 1RJYB 4UTBH 4TNVF 4I0PD 3QEUB 4UDTB 3WFCH 4XT1C 4OZFH 2X9XA 3IFLH 2B4CH 3LB6D 5HYJA 1A4KB 5DD6B 5K9JH 3F65A 4YNYA 5T1DH 1U6AL 2VLJB 1WT5C 5FCUL 4JZNA 4M93B 1A1OA 4HKBB 5C92A 3DI3B 3V0WL 4U6YA 1WFOA 4FMFA 2EDXA 3T08A 1SJXA 3CIQA 2AK4E 2DLHA 7CGTA 4FXKA 1FE8L 4NC1C 1Q9KB 2LTQB 1NANI 2I9TA 1NMBL 5C0CA 5EUOA 3GJEB 5LJYH 5HYJD 5DZOA 3IKCA 1FJ1B 4Y1AB 3TBYA 5DQJA 4EIZC 3OPZH 3BZEB 2WBKA 1RK1B 2ZOLB 4JB9L 4NUGH 2NXZC 5ACZB 3RJDA 4UB0H 1EHXA 1FG2A 2A0LD 3LEXA 5TDOA 3HRZA 2EDQA 1XF3B 5JXAL 1B90A 5BO1H 5CLWA 4BQCA 4JO2L 5BXFA 3IJSB 3I3EA 4KAQL 3Q5TA 3DUSA 2ITCA 1B0WA 4KHTL 3HG1E 4KI5C 3T0EE 1AR1D 1FNLA 2ZG1A 2C3VB 3L5XL 5IHUH 4M4PA 4R8WH 1ZA3A 3ZHKA 2B1AH 3P0YH 4F7CA 1HHHB 1T7VA 5JHLH 5KG9B 1VKXA 2BVPB 3SDYH 1XFPA 3ZYJA 2X4QB 3NABH 4BH8B 3TGXA 4CL7A 1I3GH 4P3CH 4HZAA 4XVJL 1ONQA 4IHOB 5I19H 4YQXL 4O02H 5ICYA 2D7QA 1DUZB 2CD0A 3MROA 3B3IB 4NGHH 1NPUA 5DFVD 1T03H 3L3DA 3RZCB 4GRLB 3UO1L 4J3OC 4OZ4A 1CZ8H 4PTTB 1PYWB 5SV3A 1I3GL 2X4UA 1R5WA 1Y6NR 4JPKH 1TQCB 4KY1H 1QKZH 4R8WL 2C4FU 2NYYD 3D3VD 3VD9A 1GZQB 4HIXL 5CP3H 1MWAA 1SBSL 4ZTOL 4Q9QH 4P23A 1B2WL 5B3JF 2YUXA 3ZKND 1HQRA 1MHPH 3VRJA 1NCAH 3CVHA 5C09D 4R7NB 5FKAB 3MRQA 4XAKE 1F02I 3GSUA 4JFDD 4HUWA 1CDIA 1CGSH 4DAGL 2CKBL 4K7PH 4P5TB 5IROA 3D3VE 1DBAL 5HHOB 1HSAA 1GIGL 5C3LD 1FDLH 3PL6C 1XMWA 2Y06L 5C2UB 3UTSB 4J3XA 5DJXB 3DXAE 2EDLA 1PFCA 4PJBF 1YMMA 4NT6A 5HHME 3O41B 5IB5B 1VFBB 1F11A 2CQVA 5B3NA 2VH5H 4MAUL 3C5JA 3M07A 4R4FL 4XBPB 5A2FA 1I3RA 4E41B 4AENA 1HK6A 1MWAL 4JZJC 4X5WA 3RVTC 3V6FB 5IV2A 4OB5H 4YHOH 2ZNXA 1VEOA 1F58L 2BRRL 5JUEL 3I2CH 2VNCA 5T3XL 2VLKA 3WL9A 1IM3A 1PW3A 3EDJA 1DL7L 1Z3GL 3O2WL 3CFDA 2OJEA 1TQBB 4U1KA 4U1NA 1AC6A 3O4LD 2FO1A 1QRNA 4OTXH 4QRQA 4UV7L 3KYOA 5DD1H 1KB5A 4LCIH 15C8H 3T0XA 5A16A 3FOMB 5J56B 4RGOH 3O6FC 4OUOA 5TF0A 4XHJC 4XP1L 4Y4KC 5H37G 3C2AH 4GJTB 3ISWA 1YY8B 3RL2B 1EX0A 1RU9L 4FOMA 4JPIA 3QI9B 4Q74A 1OGAB 4NO0D 4LLVA 3LKQA 4PJEA 4YK4C 5FDWB 1KJMB 4RA0C 3ULVL 4M62L 5GS0L 4MNQE 4XAWL 5HXMA 4ZSOB 1QFWH 3IJYA 4KGJA 4MD5A 4HIEA 1A6WL 1BBJB 4KTDH 2RIKA 3LEYL 5C0IB 5CEZL 5L0QB 1RV6X 4FQJL 2ZCLH 2WSKA 2YA2A 4Q2ZB 5ABDE 1D9KD 5ID1A 4KHXH 2HN7A 1ZHLB 2UYLA 2RCSL 5FM4A 1L0YA 2OJZL 3O4OB 1A8JH 1HI6A 1DBMH 4P59H 3WYRA 4MNQD 5M95B 2NW2B 5C9JB 4R6UA 5KVFH 1UB6B 3I3DA 1W0WA 5BS0E 2W92A 3EJZD 1JV5B 4Z5RB 2WUCH 1RZ7L 1BIHA 4QRPA 5EWIL 5DUMH 2SEBA 3T65B 5C0RH 2ZCLL 3ZTNH 1D9KA 5TGBA 3I9GH 5DEFA 4PJ5B 4YE4L 1ZOXA 1WZMA 4O2CA 3MODH 4YGVB 4HS3A 4X7SL 2GY5A 4LLWA 3FQWB 5JDSB 1MFBL 5J3HD 1BQSA 3NZHL 3GMLB 3RI5K 3MACL 3BQUA 3WHE0 5GRXG 4HBCL 5DRNA 5T5NF 4IOFC 5HVGB 3CVIL 1ZGLA 1YEGH 2M8XA 1AKJA 4FQCL 4Y8AA 4X8XA 2AK4D 3PV6A 4LDLB 4PG9A 1UEMA 3QNYA 4JFZH 4F57L 4L4JA 1ZHNA 4PRPA 2Q6WB 5I1DA 1G7JA 1J1XL 3MGOB 3W9DA 5F6IC 5DMKB 3PGFH 5HI3C 1JGVL 5F9JB 5DLML 2YBRA 3HI6L 4QHMB 1ZHKB 4A6YB 4AMKL 2NY2D 4JRYA 5L2KE 4EN3D 5F9AC 3QHZL 3ILPB 1D5BB 5EZOH 4X5XB 1XIWC 3IDIB 2R1WA 3QDMD 4WI6A 1NGWA 4HJ0D 3PE9A 2YPKB 2YRPA 3P0VL 2XZAH 3NFNA 1T1XB 4U1HA 5T1KD 3BZFB 3ARTA 3MJ7A 4QHUA 3BHBB 1BQHG 2X09A 1EGJA 4OI9A 1PG7H 5D7LB 1T0MA 1N3NA 4M48L 3ARGB 4HK0A 4WWKB 4BQ6A 1YEHL 4EN3A 4AMKH 2EE6A 1JRHH 5IIEB 4ZXBA 1N59B 2XWJA 1KN4H 1L7TL 3OJ2C 1WFUA 3F62A 5LWYH 5I1JH 3EOTH 4JDVB 4PRDA 4FTVB 3I6KA 4QTHA 1B4RA 2W07A 4PJ8B 1MRCL 1A64A 4M6AA 1MCCA 3KHQA 4HWEL 4QRSB 3WBDA 2XA8L 5E9DE 3IF1A 5HHXH 5LWYL 4JGJA 5IBLC 4QY8A 1NAMH 4IJ3C 4G6FB 1KBGH 2QLVB 3MUHL 4WO4D 4XPHH 4P46A 1TVHB 3VXMB 4X5LA 1RMFL 1VERA 1G9ML 2XZCH 4TULL 1LO3L 2J8UB 4OCRH 4JFDE 1SMAA 1VACB 4HLZH 2KZWA 1DANT 5HVHC 2EXWD 4QXGH 2QBWA 3MLUH 3VXSD 3WFZA 5C6WH 2K7QA 1YNTA 3VA2C 1BLNB 5IOPB 1QZ1A 3VGGA 1RHFA 5D71L 3GSRA 3OKDB 3OKDA 2DQDH 1R3KB 4GRWH 4K7FA 1PLGL 4YDJA 4N0UE 1GC1C 3R4DA 4HWUA 4N1HB 5CHNB 4FFYH 4N8PA 2HJLB 2RAMA 4Y4HD 5CSZB 5CFHA 5TJWK 5LQBL 4PRHE 2WINA 1OLZA 2DJUA 4P57B 2W9LA 3KPSD 1NC4A 4PY8J 3D5OF 4K2UL 2QV2A 1AO7A 2WMPA 1TVDA 1HNFA 1TVHA 4XPTL 1LEKB 3GBNH 3HCVA 1PKOA 5GISL 2F54E 1KCVH 4YZFF 3R8BB 3IXAB 1WEJH 3SKMB 1X5FA 2ERJB 5D8JH 3O11A 4JFFA 5D2NA 1KTLB 5CP7A 3U4AA 3D2UA 1NC2A 5T3ZL 2Z8SA 1QEWB 3VA6A 5DFWH 3GSWA 2R0KL 4KKBC 4WFFE 1LK2B 3D69A 3AC0A 2V5YA 4HAGA 3AMLA 3AROA 3QUKA 3LV3B 4LLDB 4M6OL 4NNXB 5C0EB 1A0QL 1JPSH 3MRGA 5HYQA 3VFPA 3WNPA 4Y4FC 3B2UC 2IH1B 2AJZA 1P53A 4PJCE 3QXDA 3FQXA 1AHWA 2P24A 1S3KH 5D7IF 2IEPA 3IFNL 3D2UD 1CLOH 2H32H 5E03A 4ZUUB 3ARYA 3WHXA 3MJ7B 5ESAB 4UV4L 3GSQB 1X4XA 5CILH 1ODAA 5J9PA 4LLDA 4UIMA 4XWOC 3BPOC 3QFJE 5AG9A 1P4BH 2QHRH 4NO2B 2ZSVB 1OAZL 1J0IA 3O6KL 1MVUB 4JRYB 3UTSE 4Z7OE 1FL6B 3CPLA 3BDYL 3B2UD 4EJ1C 1P84K 5J13B 1MCJA 5IFHL 3NZ8A 1LO0L 1G7JB 3IU4L 4H88L 2VLJE 4UTBL 2ZCHH 3FQTB 5IB1A 2BNRA 4H1LG 3UBXI 2NY3B 2E7HA 1A14L 2O61A 3BP5B 3QH3B 4ZTPL 4X9IA 1Q94B 1FFRA 4HIHA 3EHBC 2N7AA 1ZHBA 3OF6D 4YHKH 4LOUC 1XGYL 4G6JL 1NMCB 1T5WB 2H3NB 4PJGE 3OJMB 2PW2A 1KJ3H 2XKUA 5JO5B 4PLJC 5ISZE 32C2A 4AG4H 1QSFA 1A3RL 1I8MB 5EBLA 5I8OH 4FQQA 4JFDB 4CMMB 3OZ9H 1TJHL 4NQED 4NM4L 4X80H 1CLZL 1RK0B 1VENA 3LKNA 2DMBA 1JPSL 2LABA 5DEFB 1R6VA 3C8KB 4Y4HC 3OQ3B 1PSKL 3VU2A 3V6ZA 1P4BL 4ENEC 1I9RH 1ACYH 4KK5D 3N85L 2AJXH 3ARFC 3ROLB 5FYKH 4ZO6A 5E24E 3L3OA 4RAVA 4Z9KB 4POYA 1MH5A 4JQVA 1AC0A 3ULVC 4ORGA 2ICEA 4RMTA 4FQHB 4CDGC 5CD5D 3HI1B 4JFFE 5D2NE 4G8GE 3IAPA 4GQPH 4Q2ZA 4Y4KA 5FO7B 4PRAA 2GJZB 3ABZA 3AY4C 3J7HA 3V5DA 1QFHA 4L4TD 4YHLL 3MREB 1HZHH 2V5RA 1IKNC 3GKZA 4GG6B 4I48B 5ETUA 4MCZB 1OB1A 2DLGA 4N8VA 5K9KB 4GQ9L 1OGAA 4LLQB 4OT1H 4LVOB 2ZSWA 4ODUA 2KQMA 3T1FA 4LQFH 3WIHH 1SJHB 1WC7B 3MJ8A 3MNZA 4HC1H 4RIRA 3MJGX 4DCQA 1MRFH 4NIKB 3T4AB 1A9BB 5EIQA 1XCQA 3U1SH 3UP1A 1CQKA 1KB5B 4OI8A 4U2YA 3PQYB 5DK0B 4U3HA 5ECJE 1FNSL 5BO1L 1VA9A 2AJXL 2N7BA 5DJ0B 5F3BA 4MQSB 5EPMB 2FIKA 5JW3H 1QBLL 5MENE 2FL5B 4UNTA 3H9SA 1HHJB 2ITDB 3OR6B 3QIBB 2X4TB 3GSNL 4LSUH 1GGTA 4WO4B 4PJXE 3VGDA 2AI0L 1EZVY 3ETBF 4E41A 1Z5LA 1WZ1L 4LSQH 1NMBH 2GYSA 1F11B 1VFMA 1OHQA 3LCYA 4LPXA 3LSOA 3WHE1 4DAGH 2GSGB 5CEYB 4K94C 1XGUA 4RGNC 2ADFL 1FP5A 4UB0L 4MJIE 4PJHE 4CN1A 1SYVA 4ALAL 4OGXL 5DK2A 3QIBD 4U49A 2V6HA 5EO9A 4BSVA 1EDQA 5B21A 5FKAA 5EU3A 3O45B 3NCJL 3C6SB 4HGWB 4HQQH 2NTFB 5TGBB 5E1AB 1YNLH 3GSNA 1WGOA 3G5YA 3KWWA 4Z7WA 1AXSA 1MWAB 3GGWA 2F54D 1K85A 4QWWD 1OCWH 3UTTB 3QDMA 4MNGB 2JJSC 4RGND 2W65B 2QSCL 2CDEA 1J0HA 1P7QD 3KXFA 2F5AL 4M1GH 5SWQB 3NIDE 1JWUB 1NEZG 4S0TD 4FTVE 4PJ7B 3C6LC 3MA9H 5D7JD 1OTUD 5CIPA 3RAJH 4PBXA 3UCRA 5GQBA 2JE8A 5ICYB 1DQQB 4U3XA 1BFSA 3RTQC 1YDPB 2EEBA 3OAUH 1MRDH 1TLKA 1Q1JH 4HIEB 4JO2H 1A9BA 1EZVX 1A4JB 4H26A 4JLRA 5D4QA 3FL7A 5DLMH 3QPXL 3MRKB 3MJ8B 1WC7A 4YHPA 5KSVA 1UM5L 1MEXL 1AIFA 4XNZC 3ZKMC 4GFTB 1G84A 4NQDD 1T7YA 1BIIB 4N8VB 2NXZB 3D0VB 1MOEA 5FGCB 1NSNL 1I1AD 1CK0L 3M8OL 5DUBB 3VFGH 1YPZB 3CNKA 4PRAB 1JGUL 3ARPA 2HYMA 3CLFH 1LWRA 5ESQB 5CSBA 5L88L 4HDIA 4H8WC 1N4XL 5ID0A 5J4MA 5KVFL 1NMAH 1FORH 4ODBD 1EHLL 3UBXB 4GRMA 3LVEA 3IJHB 4NQSA 3L3OB 3Q1SH 4PJAF 2NY4D 3CLFL 4MNGA 1YPZA 1QLEH 3BKMH 3KWWB 4Z7WB 5JXED 3CDYA 3CU7A 1PJ9A 3O41A 5KSBF 3I50H 1A6WH 5CEZH 5FHBL 4OGAC 1EVUA 3SGEH 3KS0H 4QHKI 3HNVL 4UTAL 5D1XC 3GM8A 4AEIL 3U7YH 4PJHA 5F9OH 3HE7C 3JTSB 1I7TA 1LP9E 4KQ4H 5A3ID 1JI2A 3K0WA 3V52H 1W72H 4WY7L 1MCBA 4HW6A 2EC8A 2OR9L 4BJLA 4JO1L 5L2JA 4I3GA 2EE9A 4MXQD 1Z5LB 4NNYA 3GBLA 4E0RB 1J8HE 4WO4A 4HUMB 3RX7A 3TZVD 1F6AA 3V9FA 5FYJE 3KPOA 2FL5A 1QLRB 1QRKA 2Z93A 1U8OA 1N7ML 1KBGL 4LLYB 1GVIA 4QRRD 3W11C 4C54A 3SDXB 4FMKA 3D3VB 4EI5C 5EU3B 4DK6A 3VXSA 2PYFA 3EW3B 4XWGH 2FEDD 3H6JA 4X4MA 3GSQA 1VKXB 1G6RB 3IVKA 2DM4A 3RVWD 1Q9OA 2VQTA 1NFIB 1DBBH 3ZYZA 3OX8B 2XNAB 1TQBC 4NQTA 1XGUB 4BZ1H 1IC7H 3ZMRA 1XT5A 3MA7B 5EUOE 2VSDA 3IJSA 3RGVD 1C08A 5HYQB 4KMQA 5KANI 1S7WA 1OB1B 4MCZA 4G7YL 4XPHL 4WGWB 2VC2L 1IARB 1OAKH 3BEWA 1RUKH 3OXRA 4G8IA 5HHQB 2ZOLA 4Y4KB 5E56A 3LS5H 3MRJB 3DO7B 3SQOH 4IOSD 1FJ1A 3V52L 4YK4B 1WBZA 2YSSA 4JZOA 1OAKL 2I9TB 1CD8A 1NC2D 4I5BB 2HJKB 5I75B 4MVBD 2YD4A 1JK8B 1L6XA 2JJTA 2YPVL 1AI1H 2P5WD 3QULA 3RIFK 1JF5A 5HSFA 1ZVYA 1H0DA 1CFTA 3T3MF 3FRUA 4JHZA 5CHNA 2AKRB 4WTZG 4CMMA 5GGTH 3WNNA 4FQQB 5I17A 4LMQI 4KZDL 1RJYA 1W8OA 3L7EA 2AP2A 2H3NA 3VG0H 2B1HL 3QISA 3U79A 3HI1A 3INUH 4RGNE 5F88B 1S9VB 3MNWA 3B9KD 3L7FA 1G9EA 1NBZA 4FQIH 1MFCH 1WWAX 4S1DC 4H1LH 1ZANL 5BW7C 2BNRD 4Y1AD 5EIIB 1JHKL 3CH1B 3DUUB 5IB2B 2EDNA 2OK0L 4PV8B 1HHIB 6CGTA 4QOKD 4K3EL 3V6ZB 3O6MH 3S98A 2CDFA 3K8KA 1L4IA 2DL2A 4FQXC 1BD2E 4JDVA 3T1WA 3RWJB 4JO3H 3HS0B 5FUCE 3V6OA 1YN6B 5E2VH 1N59A 2X1WL 2CLRB 3IDGB 1KJ2A 1LNUB 3GMOA 1KCSL 2DYPA 5ESAA 3C5SB 4ZFGL 1HIMH 4JKLA 3VGEA 3CUPB 5GIRB 1XH3A 3QXAB 2I9LB 2DQIL 3F7YA 4TYUA 2FO4B 2X4OA 3ET9F 3O3UN 5E2VL 3HNSH 1TVBB 3SDDD 3GSVA 1KIRA 2K7PA 3PHQB 5C0EA 3AREA 5E2UH 2OP4H 4XGZB 4X0KB 3X17A 1AJ7L 2O61B 4NJ9L 5HI4D 2NY0C 2AXGA 1DN2A 4JDZB 1ZHKA 2HLFD 4A6YA 2QQQA 4BFIB 5CEXB 5JOEA 2L7UA 1LE9A 2HRPL 4P49A 2YC1A 4PRPB 3SDAA 1OARH 2CGRL 4I2XA 3NH7L 3ARED 1T22B 1E4KC 1OQOA 4MMXC 1NQBA 1NFDA 3PHQA 2EDHA 2DLFH 4YXKH 1S9KC 2OMBA 4PJ8C 2NCMA 4P57A 5CGYC 2P5EA 1YECL 2VZSA 4HWBL 4LEOA 3L95A 2RHEA 4NOFA 3V4VH 3CCHB 3WFEH 1NCWL 3QXDB 3KYMA 4H88H 4KRPD 2Y36H 4LLWB 1JPST 1E27B 5SWZB 5IVZB 3MRGB 3BDYH 3HA0A 3KPPB 1N6QL 3KPQA 1UYWL 4RQQA 1OP5H 2PYED 3HAEB 3LPFA 5C0BA 1T20A 4JY5H 3T65A 4BZYA 4OQTL 5CZVH 1G9MH 4F9LA 1DVFB 3MRLB 5BVPH 4X4ZA 5D72L 1FNSH 1X7QA 3H9YA 4K3EH 2C1PA 3UTPE 5CS7A 2FH6A 5MHSE 2EDTA 5T1LD 4UNUA 3FJTA 5JA8B 1JNHA 5KVMC 3IDMB 3LB6C 1FNAA 1NGPL 3VFOB 1MLBB 2PW1A 4TUOB 2Y23A 4GQ9H 4HH9B 1UACL 5HHOE 2V9TA 2P8MA 1JCKA 5D96C 4D9RE 1UH2A 4XWOD 3G6JF 2D7NA 4NN6C 2ERJC 2VRAA 3GSRB 1QA9B 4D9QD 1NGQL 3OMZA 2BDNH 4JY4B 3VFTB 3NABL 1MHPL 1BD2B 1MCOL 4KRLB 4QNPE 2IFFL 3FRUB 3DYOA 4HKZA 3B9KB 4U1GC 5E08H 4KK8D 2ID5A 3G9AB 2BNQA 5IBTH 5A16B 1JL8A 1IAII 5I2IA 3QULB 4DGVH 5C8JB 2BSRB 4IDJL 4L8CB 1CZ8L 1DBAH 3R1GL 4H1LA 1JK8A 3NIGF 4Y4FB 2P45B 1I1AB 4PRID 4J7RA 1CGTA 4U1KB 3DROA 1GCFA 3OAYK 1TETH 3NGBC 5I6XC 1F42A 2O5YH 2YBRB 4Y7MA 4KJQD 3MRRB 4NHCL 4QRSA 4L4VD 4UDUB 4D0DA 1OAXL 5KOMC 4PRHB 4UQ3B 3QRGH 2R29H 1KG0A 2X7LB 2VN4A 3L5XH 1NC4D 2F19H 4HUKB 1OL0A 5EORL 4K8RL 4OZHA 3PV6B 1G0XA 4PP2B 4GG6F 3MLRH 1J1PL 3ZE0E 3DYPA 2ZUTA 2NY6B 4XMKL 5J13C 5DJCA 4UINL 1YMHB 5INCA 3EYVA 3BKYH 1FO0L 2PNDA 1A7QL 5I1KL 1XR8B 1AQDB 4NQXA 5F70A 1TTGA 3IVKB 4KMTH 3I02A 5E00B 1ZGLP 2AQ2A 4MDJB 1DBJL 1JUFB 1V3KA 3A6CH 1J7VR 3I50L 5T33H 3MCG1 4PY8I 5IFHH 1MCDA 3QB7C 4PJ5A 4UT9L 3VRJB 3VD4A 2GITA 2OTUB 1T89A 4QHMA 4JG0H 3TESA 2ARJA 4G9FB 1R3JA 4J4PD 1I1YA 3BFOA 1SJEB 1HEZA 5C9JA 1BPVA 4NNYB 4QGYA 1N4XH 4GKSB 5GGVY 3VGFA 4WI2A 1SEQL 5L2JB 3RI5F 3QFJB 5FYJU 2A74A 5IEKA 4Y2OA 1S9YB 3ZKQD 3NCYP 4G8GD 1RVFL 3RIAK 1I7TB 2E9IA 4YXHL 1FYTD 3Q6GL 4L9LA 5F1NA 1YY9D 2CKBB 1CVSC 2YN5A 3ZO0A 3WS6C 4FXGB 1RZFH 1CE1L 3I6GB 3IKKA 3MRDA 3MV9E 3ZKSD 4R2GB 4F7CB 5GZOC 5JMRA 2P43B 5CWSB 4EDWL 4G43B 5I1IL 1WJ3A 1F4XH 1IGJA 4D3CH 2FD6H 2GTZB 4LLVB 5C07A 1X5YA 4U0QB 5GGSB 4JPIB 3ZL4L 1LK3L 1PX4A 4ZYKB 4DN3H 3MV7B 4L5FL 4N90D 1Z9OA 1LDPH 3B9DA 4DVRL 4DKEL 2SEBB 2Y4SA 1YUHA 3VFMB 3TO4A 3X3GL 4BUHA 1DANU 4UV7H 1YYLL 3QDJD 1ACZA 1FVCB 1A7NH 1C16B 3BZEA 1YC7A 3DVNA 5FF6A 1JNNH 1N6VA 2OCFD 4U1JB 3Q1SL 3UBXA 3CFDB 4K3HA 5DTFB 3TVMC 2UYLB 3TBTB 1ZT4B 4UU9A 5ISZA 4YBQD 4YXLH 3KPRE 3FRPA 3BGAA 4MLSA 5EO1B 1MCFA 4PGBA 2PN5A 4P2RB 4WJ5B 4YXHH 1P9MC 1XCTA 2B0SL 4X7TA 3LKQB 1IAIM 4P2OC 5GS0H 4P48A 3QIBC 4I18C 4ALAH 1YY8A 4OF8A 3RL2A 3FQNB 4JDTH 1WF5A 1DBML 3JV5A 3WLWD 4B41A 1PDKA 3U2SA 4X6DB 5C0JA 5HGBA 3BIBX 2XPGB 1F2QA 5EU7C 5TQ0H 3G5VB 3UMTA 2VQ1B 1YYLH 2K9UA 5FECA 4U1NB 2XRAL 2FECI 4X9FA 2E7MA 4P23B 2Q8BL 1OGAD 3O3DA 3WMSA 4CVXB 2Y06H 4JPKL 5DJ6B 3ULVH 2WAHA 4A2MA 1KPUA 5DMIL 4WNQB 4HJGA 1F45A 3EOTL 1QHPA 2YD2A 2MHAA 3EJJX 5AZ2L 3H42L 1V7NH 4LAJH 1ORQB 1I3RB 2ADFH 4YHNA 1CR9H 2AEPL 3LKSA 3UJTL 4J3TA 3GI8H 1JNJA 5F96H 5HHXL 1PG7L 4HCRH 3TWCL 4YAQB 4ODVH 1OPGL 2IJ0C 1F8TL 3FT2A 3F7VB 4BH8A 4HGMA 1QYGH 4YDIL 4OF6A 1P7QB 4NN7C 3NFPA 5H35B 4MA1C 3C6LB 5F96L 2OQJB 3QA3A 1OAQH 1DCLA 4POUB 1XZ0A 2DQFB 2ZUUA 5BV7C 3EIFA 4OUUA 1CBVL 2C3WA 2EXYC 1YJDC 4BYHA 4Y19B 4ZFOB 1MHCB 3RTQB 4KROB 4LARH 2EDYA 2EDWA 1J18A 3H9SE 4KRNA 3JV6A 3STBA 1CIDA 4WDIB 2EC9U 3ES6A 3MV8A 3U7AA 2B2XH 3H9HB 4WV1B 3MLZL 5DQJB 5A40E 4XNZB 3G6AA 4MS8D 5TQ0L 1MFAH 2Y5TA 4NZRH 3E6HB 1CL7H 3DARA 1T1YB 2AEQH 4TVPL 2LU3A 3S36H 3TJEH 4BQ8A 3MBEB 3PWVA 2X4QA 5C0CE 2AABL 1A7BA 4YC2C 1XGTB 5DDHB 1GPOH 5E2JA 1P7HL 4Q9RH 2D9QB 5B38A 5HHMB 5GS0C 4MD4B 2K1MA 2IMNA 1M7XA 5I76B 2A77L 2W9DH 1C7TA 1DDHA 4LLQA 2IWGA 4L29B 4UDTA 2OTPA 1I8IA 3MOAH 4JHAL 1IEHA 3NZHH 1CBVH 3BI9X 4MWFA 3V5DB 1J88A 1B3JA 4M1CD 2D03H 5DR5L 5DD3H 1CFSB 2IH3A 4H20H 3NA9L 3KPSB 1JVKA 4NQEE 4MA7L 4OSUL 1RZGB 1UC6A 2EZ0D 4JKPL 5F1KC 4ORGB 4Z8FL 3QAZC 2CLVA 1ERNA 3BXNA 3ARDC 3PABB 3VE0A 5BRZA 2DQUL 3ULUE 4WHYH 3HE7B 5FYJD 3BKCL 4U6HB 1DUYA 1SY6A 2GJ6B 4PJCA 1JPFB 4Z7VA 4EDXB 4HIIA 1VPOL 2KH2B 5FUOL 4K23H 3KJ4C 4H0IA 3UJIL 2BNQD 4XBGB 3E8UH 5DHXB 1RK0A 1NCCL 1ZTXH 4L3AA 4JVPA 1A14H 4DW2L 1KT2B 4DZ8B 2DQIH 4RFOL 1BP3B 5FEBA 5KVGL 4F7TA 3VXOA 1C1EL 2IPTL 2OXGA 5LAXB 4BFGA 1OOAA 5I8EB 5I8EA 4JKWA 1S7RB 3QO1B 4ERSH 4JFYB 1T2QH 1T5WA 4KI5E 3T0EC 3BSZL 1XF4A 4EI5B 1WQVT 3MTRA 1E6JH 1NJ9B 4FQLL 4LHQB 1QLFB 3CGTA 1N2RB 3FQUA 1K2DB 5E8NA 4ZQKB 3ZSTA 2R2HB 1FG9C 4GXUN 4P2OA 4JHAH 4ERSL 2UZIL 1MUJA 1G7HB 4N68A 3SDXE 1ZSDB 1C1EH 2XWBB 4LPTA 3RGVB 3CJJA 4L3EA 1VGKB 4WU5A 4JHWH 3ZDXE 3WFEL 1KPVB 3OL2A 3T3ME 3CFJA 2FB4H 3N1PC 2R23B 3MUY1 3REVA 5I66A 5GPRA 5F1IB 2F5BH 1IGCH 1RUQH 3VG9B 2MQCA 1DLHA 5HPMA 2PF6A 5IW6A 5T3ZH 4X6FA 3IRZA 2E7LC 1U91A 2PO6A 5I75C 3QG6A 1TJIL 2XZQL 3AMKA 1HSBB 3UAJC 2CSPA 4J4PA 5DJ2A 2E9WA 5MEQB 1R3IL 4S1DD 1QO3A 3FOLA 3NBNA 2G9HB 4WCYL 1NGYA 3IFOB 3IAGC 3BE1L 4XPAH 5MENB 1BBDH 3L5IA 2C26A 2I07B 3D2UB 5AWNH 4YFEA 5DC4B 2BOBB 3GEWB 4OLXL 3BPLC 1X5AA 3IXAA 3M17B 4K94H 4G5ZL 1P7KB 3W0WA 1BFOB 5GISH 3CMOH 2XKSA 4UT9H 5C7XH 1AO7B 4RBPH 3U7WH 1UJ3B 1IC5L 5FCSH 1OAXH 2J4WL 1AXTH 2DD8H 1F6FB 1ZLWH 2HKFH 2WINB 1JHTB 1BEYH 2VLMD 1RIVL 3JV6B 4LK4A 5CSZA 2HFGH 2CUIA 5D9SA 2X1OA 3EDEA 4ENED 3GZKA 2M26A 2IPKA 1I3VA 5C1MB 4OV5B 1BOGB 5F7DB 2X6MA 3VFRA 5JOFB 4V1DA 2IPUK 1PAMA 3D6GA 2BHUA 3AS0A 4CDHA 4EBQL 3TH2T 4G8FB 2CR3A 2W38A 3EOAA 4GG8A 4JAMB 3RWCB 3T77B 4TUJA 5IW3A 3SE8H 3U9PH 3A6OA 1UVQB 4EI5D 4PRBA 3T4YB 1G9MC 5FOJA 5HYSA 1ED3A 2DQJL 1C12B 1EBPA 1RJLB 3D39D 3TBWB 4P46B 5JHDE 5AWNL 1EEQA 1AH1A 3MLXL 4RFEA 4JPWH 2EH7L 4MJIB 2BC4B 3V5HA 1JPTH 4K8RH 2WIMA 4WEUD 4PJGF 1KPUB 3U7WL 1RSFA 4R0LC 5J06A 1RJZA 5IESL 1HQ4A 4FQ1H 3CXHJ 5JHDD 4DTGL 1EJOH 4YO0A 2VQ1A 3QEQA 2XIDA 1NCNA 1QHOA 4O2FA 3O2DA 5EZIH 3GI9L 1UZ6F 4KZEL 5C07D 4HLJA 3C9NB 1T0MB 2BFVH 1MCWW 4NYLB 4QHUB 1MI5B 1RURH 4WRLA 4U1MB 1GRWA 3RNQB 4XCEB 4KKAC 3LD8C 4NM4H 4X80L 2VKWA 3FN3A 1BFVL 5TDPA 3CFCL 2EDOA 3ECBB 3P9MA 1U8LA 1X6LA 2FX8L 1UXSB 4FP8H 3UZEA 3KJ6L 4M6MH 2CRIA 3ARGD 4V2BA 1WUNT 4IOFD 1HCFX 3DYMA 5H94B 3U46B 4GLRH 4X6BB 1ZT4A 1T3FB 4BZ2H 5DD5H 1PSKH 4RSVA 4DUVA 5T3ZE 3MSPA 3QNYB 4GXVH 2W0PA 3MUGA 4IIQB 1N5YL 1TZIA 3BEVB 2XYCA 1WTGT 2XN9A 4HWZB 4DFIA 5DRNB 4CAGA 4OD1L 5IEHB 5I8OL 4NKMB 3RL1A 4KI5F 2FHCA 3WD5H 1ZT1B 2MQ3A 5F3HA 1H3UA 1I7ZB 2XXCB 2F54A 4PRPE 1QSED 1UB5A 3DX9B 3N1FC 2X4RB 1OW0A 4F7PA 4JDTL 2FJHB 1S9XA 2GTZA 3DGGA 1PG7W 3QCVL 3GO1L 5K9JL 4ZOEA 5KVEL 1OW0C 1Z0MA 3I9GL 4TRPH 5E99L 3REWB 5EOCL 1DEEA 3G08B 1S7QB 4Z5RA 3QPQC 1T1ZB 4L9LB 3ZT7A 3ARWA 1QFWL 4KTDL 5ELIA 4PJXF 3OKOB 3O2DH 4PJ9B 1XF1A 4C56B 2A74B 4TQEH 4HFUH 4U1GB 2MPAH 5DZNA 2H8PA 4XX1G 4D3CL 4LLMA 4QEGA 3ZKMD 3QNXA 4Q7DA 1XGPB 1Y18B 1T1ZA 5BZWA 4KU1A 2UV3A 3MLRL 5JW5B 3UX9B 4AL8L 4M7LT 3MGTA 3OB0K 1NFDE 2P8PB 1CFVH 2A6IA 1TZHA 3RVXC 3SGDH 1ZLUK 1SEQH 5E9DA 2P5ED 1MSPA 2RR3A 5CD3B 3QEGH 4M03A 2JLLA 4PRNB 3UTZB 3QDGA 4LL9A 1XGQA 4NYLA 4MSWB 5LGJA 2CUMA 1IM9D 2YWYA 4ODTH 3WJJC 4LRNL 4NKMA 1CDYA 3RVUD 1NCAL 4ZUSB 4X6CF 3RIFF 3UYRH 5HD8D 1AKJD 5HDOA 3GMQB 1WFNA 1TZIB 3BEVA 2H2SC 1AGBA 1M71A 5I16B 1EV2E 3WXVH 4GRWB 2F19L 1HQ4B 3MUGB 1NBVH 1EEYB 3TA3A 2HFTA 2P5EE 3QHFL 5DJDA 3FN0H 1FN4A 3QZWB 1J86A 1KYOK 5DGQA 4JQXC 1BGXH 4M5ZH 4NKDA 4UDUA 4D0DB 4Z7UF 1U42A 4POZC 3U0TA 1K4DB 3QWOB 4LHUA 5EC1A 4O5LH 3EZJB 2RFXA 5JIIA 5I16A 3ECBA 5IW1A 3G5XA 5BW7A 2DJSA 4XBEL 2DQGH 3WO4B 3UAJD 5J1SC 1REIA 3HNTL 3MLYH 4MAYD 5D1QA 5CZKA 4ORZC 2VTFA 3P0VH 4MSWA 3EOAB 4GG8B 5HHOA 4HG4K 2NY3D 2F15A 1MCKA 4I9WE 4TTDC 1KV3A 1QRND 4EKXA 2XI9A 3WEXA 3MRQB 4JQIH 4YBHA 2APXA 4NGHL 4Y88A 43C9B 1QA9A 3FB7B 2CMRL 4IRZL 1OSZB 1BREA 4LCCB 4DWHA 3ARBC 1CL7L 1E28B 5IVOA 3SCMD 4PYGA 2ZG2A 3CLEL 2H32B 5F8RC 3MLYL 4HIXH 4M7ZB 5IHLB 1UJ3A 5FO9B 4GRWE 3JXAA 5KSAB 4L8SC 4U2ZA 5TE6L 3VFWA 2AJSL 3DBXA 4Z78A 2R0ZH 4LSRH 1ES0A 2ICWI 4GAGH 5C07E 4GAJL 3W9EB 3A6BH 4JHWL 3BIKA 4MA8H 1YEGL 4FQCH 3ZTNL 3L5WA 4DKDC 4TOYH 2EYSA 3VFRB 1BVLA 4UI2A 5D7KD 3BO8B 4XPFL 3LS4L 3HRZB 3QG6B 4G9FD 4A2LA 4N5EC 2BVOA 5E4EC 3PP3K 3FB5A 4G42A 1JYNA 1FG2B 4NDMB 2CMRH 1UA6L 1RIHH 3ZZ1A 3BRGC 5FYJH 4F9LC 1TNNA 5B8CA 3HN3A 4K3JL 1FORL 4XB8A 2X9WA 2EE2A 3BP4B 3CSYA 2YPLD 3MODL 4E5XA 4OFIA 1KJ2H 4I18B 1GOGA 3V4PH 4Z18A 5TFSH 3IFNH 1OWWA 3O0RL 3SDDC 4GW5B 2PYEE 3SKUD 4WU5B 3BKML 1T21B 1JGEA 4PGCB 4J3UA 2GAZA 3CFBB 3K46A 4XH2B 3G9VA 5MHSD 3KYAA 1NDMA 3GM0A 2F5BL 4LVNC 3FO1B 5DJ2B 4PJFF 3QEUA 4MAYC 3BP7A 2I5YL 1ZLSL 3F7YB 4DUWA 2C4XA 4OJFL 5C3TA 2FHFA 3TBVA 4LSVL 1TDQA 3CUPA 5GIRA 3L6FA 4NKIL 3C5SA 3WKNA 1JFQL 5KSBA 2Y7QA 3MBXH 4R7DB 3VFUA 5FGSA 4OZGB 1MFEL 5CLTA 4PJ8D 3D87B 5FYJL 1HHKA 1V05A 4NRXA 1PY9A 4ELKB 5JLZA 2L0DA 4PJAA 3UTQA 3DUHA 3AREC 4EDXA 1KIQA 1MI5D 1U8JB 2DLTA 4QCIB 4LEXL 2DQDL 4PV8A 1QBAA 4QXWA 3DETC 5SX4I 2HRPH 2HT2D 3PXHA 4MB3A 4YDKL 5HDLA 4NNPL 4Z8FH 5KVGH 1H8NA 3BW9B 3BXNB 4KROC 4HV8B 2QQNL 1AD9A 4BSWB 3VDBA 3HUJE 4KRPC 1AGCA 1JWSB 2LTQC 2W0KA 4IRJB 3RWIA 3VFUB 3TJHD 4M61A 1TJGL 4WV1C 2KBGA 4DGIL 4LSPH 3PDGA 1E6JL 4G6AD 4QGTA 5C70A 5DS8B 2AQ3A 2OK0H 3PWJA 3RPIB 3DNKA 1WEJL 5D8JL 1CIUA 1RUAH 4NWTH 1I8IB 1D5IH 1UWEL 2IBBA 3X14B 4Y5XA 4EUPH 2CDGA 4XPTH 3C60D 1EXUB 2V5MA 3DMMA 1QR4A 2VDPH 3ARDD 5TE4H 4EVNB 3HZKB 2VKXA 3D0LB 3D18B 4LASH 4WW2C 5I74C 2X4SA 4RISL 2COQA 3CFBA 3EGSB 4X8JA 2KKQA 5E6IC 1JNLH 2NLJB 5HI4C 4MHHI 5FHAL 4KZDH 1U36A 4WEMB 4OZGE 3QUZB 4U6VL 5GGRA 1PLGH 4XTRC 1LO5B 1ZMYA 4AT6B 4IDJH 3FFCE 1S5IH 4N0FB 1U8QB 1WBZB 2VDOH 4GMTH 3TT3H 4Y5YC 3CSPA 1S7XB 3RZCC 4HKXB 4U1LA 1JPTL 4WV1A 4NN5C 4OCRL 2IADA 5HHQA 5F7HA 2VDRH 1NGQH 2BNQE 1TQCC 2X5PA 3QAZB 4XCCL 1FFNB 1JNLL 3FZUD 4FS0A 3HZVB 4RDQG 4Y5XB 5GS2H 2IAMA 1UZ8B 2DQJH 1KN2L 2VXSH 3IFPA 1EVTC 3CAFA 4PLKC 3QSKB 3MA7A 2VL5A 4X6FB 2H9GB 3U9PL 2A9NL 5B38B 5EULV 4ELME 3PP4L 2AK1H 3KJ4B 1FNHA 1G6RA 3RIAF 3S5LA 2HTLD 5ANME 2E9JA 3PQYE 4YH6A 3H3KA 3EDFA 5C0FA 1MHHB 4ZUVA 3X12A 1NCBL 1TXKA 4TSAL 1QQDB 4GT7A 1I9EA 3JWNC 4X6CE 3EHBD 3LKOB 4YHNB 3G5ZB 5JNYA 3MV8D 1ZSDA 2XWBA 4N0CD 5E8OA 1F6AB 1IAIL 1CE6A 1CDBA 4QTIL 3H9HA 1U95A 1EH9A 1J0YA 1T83A 3SE8L 4X4YA 3ZE2F 4PJAB 4JZJB 5IR1A 2ZPKH 1X5KA 3MYZA 4ZPTA 3NAAL 2VLKE 3RVVD 1CDCA 4ZQKA 3CMOL 3O3DB 3ALPA 3E6FB 4KGLA 3PIQA 4MXWL 3WSQH 4R7DA 3BKJH 3KLHD 3V8CA 1YEIH 1ZEAL 3G5VA 4OUUB 4XCNB 5FYKL 1JTOA 4WUUB 1AP2B 4JPWL 4N0UA 3IRPX 3MV8E 3QQ9D 3RGVC 2V5SA 2JJVA 4LQ1A 4PJHB 4YHKL 3C6LA 5KS9A 4M7JL 4AIZA 5IFJA 4XCFH 1FPTH 1VADA 3FFDA 1U8PB 4X4ME 2BRQA 1N0XL 4OCLC 1AFVH 2BVQA 1FYHB 2NMSA 1EO5A 4X7TB 2EIBA 1XCTB 1RY7B 2F53A 2MCG1 3OV6A 3RRQA 3W11D 1QBMH 5EBMB 1U2CA 2D3VA 5HD8C 2GAZB 3ARSA 5I1AA 1UWXK 3KAAA 2XOTA 4UU9B 1FZOB 3IJHA 2B39A 4PG2C 3B43A 4KC3B 1MY7A 5EDXA 43CAA 4MJ4A 1U93A 5HHOD 3FFCA 2J4WH 4D9RD 3HC4H 4HIJA 5FECB 5GGUA 3VJ6A 5IMMA 5CBAB 1NBVL 1CXLA 4NPYA 5FYKD 2J8UF 2CJUH 2Y25A 5EU4B 1DFBL 3BPLB 3VXRA 2Z31C 1PKQB 4ZAKB 4OM1H 5C2BL 3MCLL 3UTZA 3EOYG 3GJFH 2QHRL 4RNRB 4LU5L 2A1WL 5JA9A 3MXVL 3TT1L 1WCQA 4W4NA 4XPBH 3W9EA 2PTVA 3MGTB 5CWSA 1WISA 3F6LA 4S1RL 4QWWC 2H6PB 4OD2A 5DVOA 2CKBA 4S1QH 4QRPD 5ISZB 4PJDA 3QNXB 5GSVB 3VFWB 4R96A 5EH1A 5C0BE 1A7PH 5IMOB 4WFED 5D7LD 1BZQK 1LHZA 5KSAA 4HSQA 2W0FA 4YHOL 4JPVH 3G6AB 1F6LL 4LU5H 4PJ9A 5GJSL 2CDEB 4NM8L 3P77A 1P4IH 5I71B 5FYLL 1U8KB 1U8MA 3VD5A 2NY6D 2H41A 5F6IB 3HLAB 3CC5A 4S1QL 2WWKO 4P46C 1MHCA 3RTQA 1IGIH 4P3DA 2H2PD 4TRPL 2O5XH 5E99H 5BJTA 3P4MA 4ZYKA 4XVTL 1N0XH 2A38A 5KSAD 1M05B 4L8BB 4EQ2A 3RX8A 1CXFA 3O9WA 1RU9H 4CU7A 1SYVB 1HWGB 2AK4B 5DRWB 5KSUA 3SGJA 2OL3B 3FT2B 1P2CA 4C83A 3B8YA 3KLAA 3OAUL 3ARGC 5EOQL 2XN9B 2DLEA 4ZPVA 3QFJA 1HHGB 4FHBD 4NQVB 4OF5A 1KB9J 4LRIA 1K4DA 2J8OA 4KDVA 2CRZA 4LP4A 4KMLB 4QF1B 3U46A 4ZNEE 2AVGA 5I1HH 4K7PL 2BY1A 3LD8B 1P69B 1PZUB 3MFGB 1R3JB 1FN4B 2VUYA 3VDCA 5FGBC 3C87A 3SJVE 4F7MB 1U8LB 2YD8A 1G9NH 4X9BA 4HS8H 1A9EB 4JQVC 1BZ7A 1EAPA 3NFSL 1GAFH 1ZT7B 4FZEH 4JRXB 3RA7L 2VR5A 2XZZA 3KXFD 4MDJA 5C8JA 3LRSA 4FZ8L 4LFHD 5JPMA 4JY6A 1OY3B 1BOYA 1C5CL 1HXYB 2DQCH 4LDEB 4XRCB 4MZ3A 4PRNA 4J23A 3RX5A 5E9DB 3U30B 3JV0A 4JFXB 5HVHB 2PR4H 4JY4A 4O4YL 1TZHB 1A2YA 1EJ6A 4LDOB 3QQ3A 1JWMB 3UZVB 3PJSA 2M2DA 1IC7L 5TDNA 1C5BL 1MPAH 5EN2A 5D6CA 1KACB 3MCKA 4P4KB 3SHSA 1A47A 4JVUA 4LSQL 4PRHA 4UQ3A 3B83A 2B2XL 4QT5A 1F4YL 1BWWA 1QKZL 3CZJA 2M1KA 3T0WA 2OZ4A 3DVNB 1UCTA 1E4JA 1I1AA 3HI6H 1HWHB 3QJFB 2BSRA 4BSJA 3TCLA 3WE6B 3TO4B 3DMMD 1T20B 3H3PL 3JWOH 4GSDH 5D7JB 1ZVSA 3RVWC 1Y6KR 2EZ0C 3FMGH 3KPSE 3DGGB 4N1CA 4RAUA 4Q6YA 4XNQB 3L3JB 3S35H 4NP4L 4F7PB 1RZ7H 1KNOA 1IGJB 5EOQH 2F54B 3ULVE 1CLCA 4G7YH 2GIYA 32C2B 5KJRL 2GJ6E 3MRIA 3VFOA 4NZJA 3TIDA 4RZCA 3P4LA 1G1YA 4K07A 3TLRA 4OKVA 1T2QL 3N1GC 1T5XB 1A21A 3W0WB 1JYVA 3I6LE 3T0BA 3V6BR 1A1NB 3T2PA 4MMZC 3ULVD 1T3FA 2YC1B 3LEYH 5E4IA 1S7UB 1MAJA 5DZLA 4PJ7F 1DVFA 2D0FA 3RWFA 1JE6A 2AGJL 3ILQC 3MACH 4JDZA 3SQBA 3EBAA 2QADB 2GITB 1MEXH 4HUNB 2NNAB 3ZE1E 3TN0D 1VPOH 2EEDA 2Y1VA 3W81A 4RQQB 2OJZH 2YMXH 3FOLB 1PD6A 3RKPA 4FABH 3OBAA 3O6ML 2EO9A 2NY3C 5CJXA 2MMXA 3UPRB 1WFTA 2IC2A 4ETQB 3I02B 3RGHA 3BWUC 3TYFA 3SPVA 4PB9L 4X6DF 3SDAC 1LP9F 1SVCP 1NMCC 3O0RH 4G9DA 3FQXB 5HGDB 2CIKB 2P5EB 4WIQA 3O8XD 3N9GL 1YPZF 3VFPB 3EJZC 5GGTA 4W6XB 4CADA 3LV3A 1UGNA 4XNUH 1FSKC 2L4OA 4X99B 2CDFB 3CVHL 1VSCA 2YKLL 2VDLH 4UV4H 3ZKNC 3JVGA 4XPFH 2BC4A 3V5HB 4FFZL 4L3EB 4Y4HB 1IC4L 4LSVH 3K7UA 4UOW1 2IPTH 5EWIH 3ARFB 1EFXB 3HCVB 4LCCC 2WQ8A 5BMFH 5C09E 1V8HA 3TBWA 2VDLL 3ZDZE 4OI7A 1ED3B 1KXVC 4GAGL 4X0KA 3R0MA 4X6EA 5CJXC 5JR1L 4M7ZC 5AG8A 1NC4B 5F97E 5FA3A 1J8HD 1D3CA 2BNQB 4MXQC 3H9ZA 2P5WB 2ADIB 2FLBT 4DVBB 4DKFH 3HPLB 2EC9T 4L8SB 4R26H 1JHKH 3K2MC 2YEZA 5D2NC 3GBNL 2DQUH 5JOFA 5C0AE 4MQ7A 4TUKL 2CRMA 1KJ2B 4OV5A 3LMJH 1T4KB 1HDMB 1QSEB 2P8MB 4ONOA 3HS0A 4O51B 4XBGA 5AAWA 4TNWK 4LNRA 4MNHB 4XMPH 1V5JA 4CN4A 4LVOC 1TCMA 4IMKC 5L2KB 4Y4KD 1J8HA 1KN4L 2HLFC 5IVXE 2CKNA 3TVMD 4R4BA 4PIRF 2RJMA 1TITA 2MKWA 4JFEA 1D6VH 1BFTA 3HE7A 2AEQL 4O58L 2AGJH 5EU5A 3Q0HA 5IBUB 3WKMH 3VXRD 3B5HA 2CLVB 5E4EB 5DMGD 3SJVD 2D0GA 3P40A 3KS0J 3QEHA 2YSSB 2C1PB 1KIUA 1NBZB 1FL3B 2R4SH 4JM4L 4PJIF 4MA8L 5IM7B 1K8DB 3SCMA 4LPWA 1K3ZA 5DVLA 2HTKC 1IAOA 5D70L 1JPGB 4QTHB 4PJFB 4OGZA 5KN5A 3LZFH 1QO3B 3WJLC 2IALA 3PWUA 3KPQB 2BSSA 5I0ZA 1A6PA 4PG2A 3LN5B 4LASL 4XZUB 4IOIB 4M3JA 2X44D 3MJ9H 4TSCH 3MXWL 4EN3B 2ADGA 1W72A 2AKRA 5EZJB 4WWKA 2HFFB 1HOCB 5D71H 1FIEA 5D7LA 2BHZA 5IW6B 3OKEB 1CFTB 2NX5E 1D5IL 1UWEH 5EOTA 3RUGB 4YHYC 1VDGA 3OHXA 4LVNB 3NFNB 4AZ8A 2PYFB 3MX0A 3WIFA 1T22A 3CFJB 1J05A 3BKYL 1FLRL 4I2XB 2B5IB 4ZNCD 2VZTA 3ZTJH 3KG5A 3DVIA 4I77L 3VMOA 4IRSD 4WW1B 1U8OB 5F7MC 4F15C 2OTWB 2Y5TB 3P4OB 2X42A 4W70A 1BEYL 2VLLB 2WLZA 3QJHA 3V7AG 3DV4B 2VR9A 4G7VH 2NR6D 4MJID 1N6QH 2Q6WA 5I1DB 5I1LA 3V0VB 3T3PF 4OZIB 1QSZA 2JJWA 3S4SG 4WHTB 2EDRA 1JI1A 1OAUH 1QLFA 3AREB 1ITBB 4KQ3L 5TQ2L 1FHGA 1H3XA 4IRSA 3X13A 4JFYA 3IU3A 3N85H 4ODXB 4HJJH 5LBSH 1NFIA 1Y6MR 2VDQL 3JUYA 5E6YA 4CU6A 1G7QB 1H5BC 2YOCA 4HXAH 3PP3H 1O5DT 1JZ3A 2MFNA 5E1HB 3RBSA 1LP9A 2YWZA 4ZUWB 1BQLL 4XP9L 1I4FB 3L5HA 3GNMH 4R4ND 1IGIL 2G5BB 3RUGF 4OZGF 3C5ZC 5FOBA 2HH0L 1D9KB 1LE5A 3LKSB 1MFNA 1FFPB 4P5MB 2Z9TA 1QLRA 1DQML 2HFEB 2IQ9L 5EIIA 1KB5H 1TJGH 1UB6A 4HXBH 3D9AH 4I3SH 4OQTH 5HTSA 3GHBL 1HILB 3PWPB 4LLAA 1IGCL 1RUQL 5GRUL 2YXFA 1F2XK 1NAKH 3NH7H 3X11A 1RZKL 1KUMA 2GK0A 4B7IA 5DSCB 4F3FA 1Q9LB 5FUZL 4OLYL 1YEEL 2NY1D 4NQDA 1GGYA 4DN4L 1JTPA 2FYYA 3HKFA 5HGHB 5E6IB 4JM2B 5DUBA 3QUZC 4X6DA 4OZIE 3WN5A 5T1LA 3D0VA 4OGYH 1K4CA 5E8DL 3GMNA 4PJEB 4PTUA 1BF2A 5ILTH 2FJGA 4QXUH 1ROWA 2DI8A 2PCPB 4FG6D 4NN5B 1PVHA 1FYTB 1VEMA 1CWVA 3OKLA 1H0DB 3FOMA 4CMHC 1CGVA 2B0SH 3QDJA 3UTOA 5FO8B 2ICES 4HQQL 4M00A 5L8LB 1YDPA 2WWMC 3MC0A 4NKQB 5T3XD 1WBYA 2N1KA 2V7NA 4XCYA 4DGYL 5IGXL 2LQRA 2HJKA 1NBYA 5I1KH 3MXVH 2F5AH 4NZTL 1T6WA 3D9AL 1X5ZA 4QXUL 5FF6B 4O2EA 1MWAH 3MRJA 5JIHA 2VDNH 1DQMH 1X6NA 3S96A 3VWJC 3QDMB 4ACPA 1G1CA 1UKSA 5IB5A 1JMZA 4NZUL 4OCWL 3G04A 4P3WA 4GBXD 3VI3F 3B8SA 4JRXE 4DKEH 3MV7A 1C08B 4OLYH 3LRGA 5IQ7H 2YD1A 5DC0A 2VJXA 1FPTL 4OF3A 4BSVB 2WV3A 4DN3L 1E6OL 1MJUL 1B88A 2E6QA 1S9WA 3T09A 1R5IB 5HJ3B 3VXQA 4XMKH 4W4OA 3UZQA 4OGYL 2VE6B 3BH8B 4ZO9A 1ZLUH 4YAQA 2VH5L 3C60A 4MAUH 4EI6B 2Q3ZA 1J0ZA 4WI3A 4OD1H 5DJZB 2AJVL 3L3HB 2BMKB 3GJFA 1MJ8L 3OB0H 2Z93B 2X10A 2VXTH 1OTTD 2XTJB 1DL7H 5K93A 2R0LH 2Q87A 1JHLL 2X4UB 5I1CL 1H3VA 4E0RA 1PYWA 3H9SB 4O5LL 2ZUYA 2H26A 3FKUS 4HH8A 1UT9A 1V7NL 3L3HA 4GXUM 35C8L 4L3EE 4NUGL 2DKSA 4N1EA 3C6SA 1MCRA 5EO0B 4OQTA 3CX5K 2DTMH 3NCBB 3SE4C 1UM4H 1GGUA 5E00A 5IBTL 1X44A 3PGCB 3ALXA 3OGOE 1AQDA 1Q0YL 1T7XA 4ODUB 1T1WB 3V0WH 3TV3H 4M5YH 1J1OH 3LKRA 1UH4A 3M1BB 5BS0A 2V2TB 2EYRA 4XVJH 3V7MA 4PGBB 1MJUH 1MAKA 2Z31B 5I19L 1Q0XL 4LNVA 4GG6A 1DBBL 3D85A 3KNBB 2EE3A 4LVEA 1UEYA 3ROOA 3ZE2E 3RWDA 1KG0B 4XP4L 1CFVL 3TN0B 4GKZA 4NQSB 1I9JL 3QCUL 3TBTA 3OKYA 1WTLA 4O2EB 2A83A 3TWCH 4ODVL 2UVFA 4JJHA 4QKXB 1DVFD 2J6EH 5EPMA 1TCRB 3P4NB 3BVNB 1A6AB 4FXKB 1L7TH 5ESQA 4GO6B 1T2JA 4XCYB 4Y4FA 4OZIF 4E42B 5SWSD 4TVPH 4L8CA 3IDYB 3W0WE 5D2LB 4HFUL 3QUYC 5I1CH 1U8HA 1HYSD 1YEKH 1BGXL 2Z31A 3BD3A 3CD4A 1BIIA 3NN8B 2PUQT 4JO1H 1R0AL 4WWID 1BD2A 2R1YA 5CD5C 5KSVB 1KTRL 3EYOA 1JP5A 4S2SB 2OXHA 4WY7H 5EA0H 3MRKA 2WK2A 4R3SB 2CXGA 4U6XA 4BFEA 4G43A 3C6LD 1N0LA 1F90L 1U3ZA 3PGCA 2BNRE 4D2NA 4TNVK 5F1NB 3SKOB 5E6IA 5DJAA 2LU7A 1G7IB 2DQEL 1SJVA 1FO0B 4TQEL 2R0LL 1ZHBB 3MJ9A 3WUZA 5E2WL 4MS8C 5HBBA 2FGWL 5FHBH 1XEDA 2H26B 1F00I 3ZT6A 3MNVA 4GKSA 2NX5B 5C0GA 5KZCB 2XZAL 3EO0A 3HUJB 2QQLH 3HC3L 1HEZB 4FFZH 2W65A 3BD4A 1I1YB 1PQZA 3GGWB 4R9HA 2ARJB 4G9FA 2J2ZA 3OF6A 4HPOL 3GSNB 3IETB 3JWOC 5C0BB 1RIUL 2HVKB 1DEDA 3RHWK 5A43C 3C60B 4EI6A 3WIIL 2NY2C 15C8L 5DMIH 2Z92A 3T3PE 1INEH 4NKIH 1QSVA 1MNUH 2W59A 2HJFB 4KKAD 1E27A 1FRGH 3DXAB 2VABA 1S9WB 4P9HC 5EBLB 4ZUUA 1I8MA 2AJ3A 4MA3B 1MCEA 5FAAA 5EFIB 3BDXA 1EEZB 5JO5A 3KDMA 5HVFB 3L95B 3EYUL 4MLIA 4ODXA 1S78C 1ORSA 2HWZH 2OMNA 1YZZA 4M8VA 1GOHA 1T7WA 1F58H 4NNXA 4K3DL 4HIHB 4YHMH 1RIUH 4PP2A 3U4BH 2E8YA 1QACA 3BMWA 4C57C 2BNRB 2NY5L 4TVPE 5I1LB 1A1MB 2QQNH 1QEWA 3NZ8B 3PWLB 1B9ZA 3T2NL 2C1OA 1QSFE 3BYTA 5B3JE 1MIEH 5IJVA 3CPLB 4UBDD 2QQKL 5DJ0A 4PB9H 1DVFC 1GZPA 2VIRA 3DROB 5EB9A 5F3BB 1LEKA 1A3LL 1LO2L 4OFYD 1FFOB 4PY7A 5AUMB 1U3HC 2VXVH 3S37H 3QUMB 3E8UL 2I60H 2VDKL 1FV1A 3AY4A 2R0ZL 5EOTB 3RUGA 5E8PB 4PJGB 2FZ3A 3T4AA 1E4XH 2B8OT 4HMEA 4OM0L 2FWOB 1SJHA 4XP6L 1XH3B 2ZUXA 3B9AA 2LVCA 1JN6A 2ESVD 2IH1A 2DKMA 3VXMD 1R3KA 4K7FB 1FCCA 2BP3A 4MB4A 3UTPD 2OR7A 3LN9A 4PRIB 1BLNA 4KDTC 1M7DB 2BSSB 3WCYA 1N6UA 5D7JC 1KOAA 1BVKB 3T8XA 5DI8A 3NIDF 2PW1B 5FO7A 3BAEL 4OF0A 4PS4L 1IAOB 4HHAB 4X4XB 2ZKHH 4FQHA 3RVTD 3Q2CA 1EMTL 4AIXA 4BH7B 2ICEB 2JB5H 3AS2A 4H0GA 3MOAL 3H3BC 5E2TL 2VN7A 3VXMA 2HTLC 4KI1A 2NZ9C 5D70H 1YN7A 1I1AC 4U3CA 3QPQD 3BUTA 1QYGL 4YDIH 1NGXA 1D5MA 3MRLA 3S35L 3ZDYF 4JFEB 1INQA 3CK0L 4G80B 3NGBB 1MJ7H 1JF1B 3MRHA 5D1ZA 1MAML 3LIZH 3HFMH 1I7UA 4UNVA 3JTTB 3TCXA 2NZ9D 2F74B 3OTTA 4JR9H 1DTUA 5BRZD 1YYML 3LKNB 1BZ9A 5CMAB 4P99A 1WIOA 1BBDL 2BJML 2IF7A 4M48H 5IOPA 4GAYA 3WSQL 3IDJB 4PR5A 4L8SA 4Z76B 4KV5F 4F57H 4LVHB 5DURB 3TT3L 1VHPA 2MQ0A 5FK9A 1VACA 4TUKH 1CLYL 4YIQA 5T1MB 1F5WA 4CVZA 1MHEB 3BP5A 2R56L 4J3WA 2F58H 4DFHA 3T2QA 2ZKHL 3FQTA 5IB1B 5F7FA 3SDAB 3HMXA 5LGHH 3TNMB 2HFGL 5INDA 2R4RL 1ZA6B 3HUJF 4GBXA 1NLBH 4J1UA 4WFHD 1NAML 4PJXB 4L4VB 4Y4HA 2JCCF 3TNMA 2AXGB 3V95A 4OBSA 4PRDB 5DT1H 4YLQT 3GHEL 1JGLL 4P46D 4EBQH 3U0WH 3AU1B 1ZLVK 4XGZA 1URLA 5F7YC 3RWGA 4O9HL 5K33A 1IC1A 2N4IA 3TIEB 1QFUH 4J6RH 5EZLA 4OQ1A 3S36X 1OP9A 1TVBA 3WKML 3PWPE 3C8DA 5FK9B 5HGDA 4N0RA 5BZDB 3OKEA 3OX8A 2YUZA 3Q3GA 1S5HA 5E8EB 3EO9L 3FQRA 3RVXD 4GAYB 2ADGB 2X9YA 4YFLI 2VISA 5J7CC 1LNUA 3GMOB 2AJUL 2GCYB 3TZVB 2CLRA 1QNZL 1JBJA 3LN5A 2B4CL 1ZLVH 3WUWB 2QR0A 3QUKB 2WUBL 3LRHA 1A6TA 2DQHH 1FNEA 5DMGC 3D3VA 3PWUB 2IALB 5C7XL 2F74A 2HVKA 2ENSA 3AAZA 2DRUA 4LLYA 2Y36L 1BAFH 1ZAGA 1RFDH 3QRFM 4HWBA 4G80A 4HWBH 1INQB 4JFFB 4JRWA 5D2NB 1W0WB 3BIAX 4K23L 3MGOA 2QSTA 4G6JH 3QEHB 1CVRA 4PJBE 1AO7D 3EO0B 1FGVL 3WFHA 4P2YA 4WCYH 3OJVC 3THML 4TTDD 1AKJB 2CGRH 2HN7B 1OSPH 2FGZA 4JFFD 4LSSL 4R4BB 4K7PX 2R2EB 2BHYA 5L9DH 1N5YH 2WW8A 3BQUB 3THMH 1P4IL 2GK2A 3BJLA 1YEFL 5E70A 1QSEA 3WFDH 5BVPL 4YFLF 1KJMA 5MI0C 1I9RL 1XGYH 2DLFL 8CGTA 2OP4L 4HX1B 1Y0LB 3UTTE 4JGMA 5DHVH 3BT2H 4IEFB 3OB8A 5I73B 1A7PL 2FX8H 5FA3B 3WE6A 5EBWB 4U1IA 3QJFA 4KDTA 5TH2B 2ED9A 4X6EB 1QSFD 3QUMA 2GW5A 4E42A 3R06A 1QNZH 5HVWA 4HUXB 3HC4L 3MRCA 1FFOA 4P5KA 1SMOA 1GZPB 1WWBX 2VIRB 3EYFB 3ALWA 3UTTD 4M7JH 2FSEB 1JMXA 4WW2F 3V0AC 1J5OL 4GMSL 4P23C 3KYKL 3DO7A 3MZGB 5ID1B 5IK3B 4R0LA 5DF0A 3MCKB 1JGUH 3QIWD 4P4KA 2PTTA 1WITA 5FYLD 5BS0B 1U8NA 3CSGA 3V5KB 1HINH 2YRZA 5CBEA 1CFNA 4UUJA 1PX3A 5H37H 4DOHB 4HMCA 1Q9OB 2CKBH 3UO1H 4YX2L 4XRCA 1E4XI 4KKLD 5JPMB 2XTLA 5F7EL 4NN7B 5IROC 1X5HA 4OM1L 3RZCD 3KYOB 2Q76A 4NQEA 3CFKB 1CICA 1D5BA 4ZTOH 3T0VA 1P6AB 4BKLB 3ULVF 3IETA 5B38G 3DLQR 3H0TA 2JCCE 4KY1L 1EAJA 2DB8A 3MFFA 5DO2D 4NRZA 2AEWA 3IS1X 5MEPB 2BRRH 5T3XH 5JUEH 1P6FA 5CUSL 3S3JA 1TENA 4KUZL 3C5ZB 5LBSL 4YBLC 5A2IH 1T5XA 4ZPVB 2BMKA 2DLIA 4BQBA 2ZCKH 4OLEA 2WP3O 4ZOCA 5E5RB 2WP3T 3EYSH 3KJ6H 3SDYL 3QT2A 2VXTL 4C83B 2HP4A 5D1QD 2BVPA 1MELA 1HSAB 2AJVH 4D8PA 2CK2A 2VMFA 4R3SA 1D5ZA 5DA4A 4NFBA 2EDKA 4YGVA 2CH8A 3GKWH 1A3QA 2AXFB 5B4MC 1HE7A 2ESVB 5E6ID 5FCUH 1XAUA 4P3DB 4JM2C 5D7LE 4OZFA 3UC0H 3B5TA 4Q6IC 3RVVC 3WUWG 3HLAA 2LVEA 3FO2A 1U8HB 5HPOA 2VUOA 4WFHE 4AK1A 4Z77B 1F4YH 4KFZC 2AAVA 3QIBA 3TP4A 3ZE0F 3S37X 5EU6B 5ID0B 1FC1A 1GL4B 3B3IA 4CMHB 3QG7H 4FNLH 5IMOA 1CR9L 2CLZB 5IT2H 3UJTH 3EAKA 3PQYA 4OCNC 2UZYB 1WBXB 3RWDB 4AM0B 4JFPA 5FV2A 4NRYA 4QXTB 4OKDA 5I1HL 2VZOA 2GHWB 5IQ7L 4AIOA 5L88H 3LKRB 2C3VA 1FZMA 4L4TB 1A2YB 1A4KA 5HYEA 4OV6F 5DFTA 3QDAA 4XWGL 1YQ2A 2JIXA 3NVQA 4NHUA 5ICZB 5D1ZC 3MRMA 3QUYA 4ZOBA 5T5NG 3VWJB 4EUPG 1HXYA 3EJYD 2GTWB 5TDOB 3UPCA 5T1LB 4I4WA 5FM8A 2R1XB 4V2CB 2AEPH 1CTNA 4LSTL 4B53A 2FD6L 3VXUA 4QRQB 4LCWD 2HWZL 4H25B 5CBAA 1AGDB 5K59F 4NQDB 1FIGL 3O2DL 1W0VB 5D1ZD 3HG1B 3T0EB 5CZXD 5DSCA 3MLSL 5J89A 5JDJA 4P4RB 2PXYA 1Q9KA 1JWUA 1CK0H 3M8OH 4LHJB 3VFGL 2C5DC 5C0RL 1TZGL 4OFYA 4QF1A 4U6YB 1DQDH 3P73A 1S7SA 5F1SA 5ALBH 1ULVA 3RAJL 4AENB 4P2QD 1A1OB 4HKBA 1WCBB 2FNBA 5EBMA 1DN0A 2F53E 3EFFB 4U4BA 1K6QH 4PJIE 2MNUA 2VE6A 3BH8A 4K3GA 4KJYB 5EO9B 1M6OA 2RB8A 3EYUH 3AB0B 4RDQF 4HMDA 3UYPA 3CDGB 4G8EB 4H8WH 4UZGA 1D6EB 4LP5A 2G60L 2VZ1A 5HHPB 5KW9H 4L8BA 2Z35A 2ATKA 2PW2B 2WBJA 5ACMA 3T2NH 4OIAA 2MJWA 4PRIE 3P30L 3QFDA 2P44B 1HQRB 2HA1A 4KJPD 4MAYA 1Q94A 2ZNWA 3DJ9A 4U31A 3R8QA 2MKLC 2V9RA 4PGEB 2J1KA 3V0VA 1TMCB 4P2RE 4EZMA 3SY0B 2ITDA 1HHJA 1FLTX 5JNYB 1A7RL 3S4SB 3DX6A 4GRLA 2FIKB 2GQHA 1NBYB 3NTCL 4ZDHB 1QTYT 1QQDA 5FYLE 3MLSH 2UZIH 5FB8B 2IAMC 2F8OA 4R96B 5F71A 3VFSA 1EIBA 4PB0L 4PJDB 3P2TA 3TN0C 5H2BA 4NO3A 3QDJB 5I9QB 5FO8A 1RIHL 1OGTB 1V7MH 3DOSA 4I0PA 2I25N 4R4FH 1AHWB 5D7IB 2XG5A 2FJGB 1JGLH 4LGRB 5IG7B 4IMLB 1XF3A 3ARBA 3BISA 4KWUA 2FHBA 2Y07L 3IDYC 3LEXB 1B4JH 2JELH 1RZJL 3O2WH 1HH9B 4R2GD 2DI7A 4JM2A 2GJZA 4OLVH 4C4KT 4FABL 3KLDA 2E6PA 1JZ4A 1MREH 3B6SA 5IMMB 5GGUB 3VJ6B 1K8DA 1QRNE 3U0PA 3FFCB 3GJEA 2BY2A 1UFUA 1GGCH 2VZUA 5GGRY 4NWUL 3D85D 3RVUC 4QXGL 1H3PL 1RUKL 4G5ZH 4WFGE 1LD9A 4KJWC 2DM3A 5FOBB 1FNFA 3N1QC 4YZFE 3FN9A 4X7DC 5HGAA 1BQHA 3BN3B 1JGVH 1HDMA 1FAIL 4PS4H 1RMFH 4WUKH 2BY3A 4ISVB 1LP9B 3VXPB 1U8PA 5T1KB 2HKFL 3LS4H 2ORBL 2V5TA 4GG6E 1BX2B 1HKLH 3QDJE 1I1CA 1NCDL 1MJ7L 4G6FD 1K3IA 4JM4H 5DUPH 1CG9B 3X13B 5GSRB 2A9NH 3QQNA 2V17H 1FZJB 2NY2B 4NC2B 4PBWD 4R26L 1AGCB 1JWSA 1CD9B 3IAQA 4WHTA 4H5SA 2R4RH 1I1FB 3TO2A 4X6CB 1KCRL 4XI5D 5IR1B 4Y16C 4APQC 4RX4D 1EFXA 3QUMH 4WTWA 5KZCD 4AQ1B 2LU4A 3DV4A 4PB0H 2VLLA 4DUXA 5JW4R 2NTSP 2WBJC 4DGVL 2OTWA 2EDEA 2Z91A 2ZCHL 2YUWA 4NWUH 2X1XR 1I85A 1Z2KA 4NO2A 5C0FB 3DO3A 1WAAE 5E0QA 4CADB 3O4LE 3LQZB 3P9LB 4XAKD 2JK5A 3VD3A 5J9PB 4OM0H 2VXSL 4IIQC 1MCLA 4U7MA 5F89B 5JIKA 2D2OA 3DWTA 3L9RB 4O58H 1CICD 2ZJSL 2OI9C 3ARGA 1AJ7H 1UJTA 2AV7B 4IRSC 2P48B 4JY5L 3V2AR 2IANB 3RDTB 2HFFA 4XXDB 1HZHL 1AY1H 1U3HB 4Y5VA 2R9HC 1I8KB 2VO5A 3VWKA 2YPKA 4M43L 1HINL 3EOBB 3WFCL 2R1WB 3DHJA 3DVGA 3G6DH 1KCKA 1IC4H 3D69B 2BXYA 4QHKJ 2OSLA 4U05A 2JB5L 4U1LB 1RZKH 3MV01 5CJOL 5IM7A 1IEAA 3JWDL 5DMKA 4MHHG 3W9DB 2EXYD 4MCYB 3O3AB 3L3KA 4N0FA 4PJEE 4ZFFB 3WS3B 2FJFB 4N5ED 4PG9B 3QIWA 4P4KD 5IGXH 1K5NA 2EICA 3EGSA 4N9GA 4X8JB 3WNLA 2X4SB 2YZ8A 3TIDB 1KLGB 4DJMA 2FEDC 4XC3H 3ESUF 4YPJA 2AEIT 2HMID 4M7LL 4LNRB 5CJBA 3FB5B 3MLWH 3OXSB 3O6KH 4RMSA 3TPUA 2CDGB 3IGAB 2B1HH 4WU7A 4HS3B 2EYSB 3PGDB 4HXBL 4I3SL 1JTTA 2LAGB 4MGXA 3L3JA 1DQJA 4LCUB 2NQCA 4HZLA 2VWEE 4J2XA 3VRLF 4HS6A 4DGYH 5ERWB 1I1RA 1FNGA 4QRPE 5D7JA 2BVYA 1KJVB 1DLFL 2DN7A 3CDFA 3TCLB 1JYXA 5L6YL 3NAAH 3DBXB 2J88L 1KSRA 3AM8A 1AD9B 2X40A 5KVEH 3U36A 2XWTB 1KJ3L 2ZUVA 4QY8B 4C56D 4PJ9D 5D93B 5FO9A 1ADQA 5DD5L 4XPGL 2R0KH 1N5AB 3AXLA 4PGDB 5E7BA 2WIIB 1J1PH 5AD0A 4CRPA 2HH0H 4Z0XA 1P4LB 2YD5A 2ZPKL 1OSPL 2HAZA 3DRQA 2MTPA 3TA3D 1PEWA 1ZXQA 2CIKA 4QTIH 4QRUA 1TIUA 4RMQA 3TBVB 5BVJA 3WO4C 4HKJB 4NBZB 1QBLH 3GHBH 2A6DA 2XKNA 4MVBC 1F4XL 1NL0L 2P49B 5IMLB 3GI9H 3FO1A 1LEGB 2Y5EA 2IANE 4LCIL 4MX7A 5D5MA 4X5XA 4FQ1L 5LXGL 1T89C 3JWDC 1SEBA 3E0GA 5DRZA 1AD0B 5F9JA 4F37F 3RBGA 1JGEB 1OQXA 4PGCA 4U1SA 4F2MB 4X5WB 2ZCKL 3QZWA 2P8LA 5JXAH 4KPHH 1KTDB 3PQYD 3SJVB 4XBPA 4I9WD 1MLCB 2XQBH 4NQVA 1KEGL 2E9BA 4E5XB 1AGBB 1HXMB 1M71B 1UCBL 4P3CL 4NT6B 2OR8A 3GMQA 3BKJL 1ZWIA 5KSAC 4G6KL 2B1AL 4BUGA 1LO4L 4KKNA 3GMRB 2AK1L 4NDMA 5E94B 2RQ8A 1GAFL 2BVOB 2AI0H 3KPRD 3HI5H 4NQCD 5J1AB 2EKSB 1GJIA 4P5TA 3QDGB 4F58H 4XBEH 1IMHC 4WI8A 4N0YH 5F7LB 3U9UA 3S5LG 5T3XE 3GI8L 2R69L 3ULSA 3DVFA 3O6FD 4ODTL 1EO8H 3CVHB 1WAAA 2D9CA 5CJ8A 5CUSH 4GRLD 2PR4L 3BD5A 4O4YH 4F33B 2BNUA 1U6AH 3OWEA 3DIFB 1A6ZA 4PRHD 3RPKA 4Z78B 1XGPA 1Y18A 5KOVC 5SX4H 3MOQA 2GEEA 1R5WB 3N1MC 5IVNA 2GT9B 2FCBA 2OLDA 2VZ3A 1MVFA 2EH8H 5IVXA 2R2BA 2C3GA 1G0YR 2W0FB 1RUPL 5JPNA 4AG4L 2UWEF 3BX7C 5I73C 3O6FA 5BQ7B 4LARL 1DUZA 3MROB 5JXEA 3UC0L 4NQCB 1JGDA 4OD2B 4ZG1A 1V3LA 5C0IA 4LBEB 4PP1D 4FQPA 4ZSOA 3T2OA 2Q20A 3OKNB 3FB7A 3QHFH 1MIMH 2BSTA 3ZHLA 2QHLA 5GGVH 1R3HB 4FQJH 3KVQA 3P11L 1MCPH 4GW1B 3HAEH 3FAXA 1UQSB 4FQXD 5IKCB 5C08A 1INEL 4AEIH 3DTXB 1CGYA 5F9OL 3LRSB 4Z95L 4C55A 4P59L 4UAOB 3PNWB 3QPXH 3VXME 2VLRA 3QCTH 1MRDL 1R5VB 1DQDL 5C0CB 3QWOA 4LHUB 5EC1B 43CAB 3NACL 2A6KA 3RP1A 1H8SA 3F12B 2BXZA 3I85A 1NKRA 3S8WA 3NMEA 3VXTA 2E7LA 4ELMA 1HHGA 3U7YL 1VFBA 4WTXA 1M7IB 3GIVB 2G75B 4JG1L 4YUEH 1NMAL 4PJDF 3RY6A 1EHLH 3IDXL 3IDUA 1YEDA 3UTSA 5DO2C 1GYAA 1F90H 1P2CB 5FYKE 4KROD 5IMLA 3MMEB 4KRPB 3VRIA 1DQTA 3KPMB 1TZGH 1MI5A 4IRJC 5C0CD 5C08B 4AIZB 5IFJB 1WV7T 4GOSA 5DJ8B 5ANMA 4R7NA 4DVRH 1M1SA 1FC2D 4KUCF 4WUUA 2P4AB 2OZ4H 4WHCA 4YO0B 3TBSB 3PIQB 3PL6A 4ZFZA 4L8DA 3UTSD 4ZS7H 4C56E 4RGOL 1KULA 3TO4D 1HKFA 3CZFB 3P77B 1JFQH 1U95B 2J8UE 2H8PB 3HR5B 1IKFL 1B2WH 3QWRA 1RZIA 4WW2B 5I74B 4Z7UB 1FVEB 3IYLW 3L3DB 3RZCA 5C09B 5IVXB 4Q6IB 3P9WB 4FXLA 1MQKH 2FX9H 2HT3D 5HI5C 1FIGH 2DWDB 3ARDA 4OFVA 5C9KA 3OJDB 4YDLB 4K7PY 3VWKD 5KG9A 3REWA 5DURD 2XZCL 7FABH 4Y5YB 3HZYB 5B22A 1BECA 4ZSOE 4M6NH 1OWRM 1DQJB 5ALBL 4Z0BH 3NA4A 3STZA 4RNRA 3IDNA 2IPKB 3RZWA 2DMCA 3OXSA 5DXWA 4Y5XC 1OVZA 1WT5A 3K74B 1DSFH 4OLWH 3H3PH 3JWOL 1OF2A 4RMUA 4NUJA 1QG3A 4NO0A 5DD3L 1A02N 3W39B 1YA5A 1JZ2A 5EU4A 1QD0A 1FGNL 5GS0D 2RGSA 3DSFL 1K5NB 4N9GB 3IKCB 4Y1AA 2AJYL 5J6HB 3KPRB 3SJVA 5HY9B 2HMIC 4V1DE 4JFHE 4ESKA 1FZOA 2B4CC 4B50A 1PY4A 3GMMB 4XB7A 4NO5B 3MRPA 3GB7A 2WANA 4P2QE 4L4TE 25C8L 3MRFB 5J12C 1B0GB 4FG6C 2I07A 3D0LA 3D18A 2CK0H 1GGBL 3HE6D 3P9MB 4K3JH 3OG4B 2G9HA 4WUKL 1UXWA 3SDCB 2AV1A 5IF0B 5HYJB 1YYMH 5IHZA 4JFHD 4LAQH 4YEFA 5MP6H 5MERA 3LZFL 3GJFK 2IG2L 4C58B 2VDRL 4MDIB 4O9HH 3VFVA 4CNIA 2XACC 5KS9B 1U92A 1QP1A 1FL5A 5ICXA 2KZ1B 1V3JA 3VGHA 2BCKB 2YRLA 5LVEA 4Z7NE 4O2FB 2V2XA 6FABL 3PHOB 3SGDI 3LQZA 2WNGA 4EUPB 4Z0XB 4BQ9A 2R23A 3REVB 4OIBA 3WFBL 4IDLA 4JE4B 4PP1C 4ZPTB 3I75A 1U41A 5MP6L 4G8GB 4QYOB 3BW9A 2Z91B 4LF3A 1FLRH 1VGKA 1N5AA 4D9LH 4QHLA 3G5ZA 3KHOA 3RNKA 4X7EC 4HEME 3JV4B 1OARL 4LCWA 2XWTA 5JLZB 4BA8A 1I1FA 1C12A 4H8WL 4HUUB 5HYSB 3FQUB 1N2RA 1CGUA 4ONGL 5K9OB 1XF4B 1V7ML 3S5LB 1BVZA 3BUYA 1YECH 8FABA 5ICXB 3FT3B 4P2QA 4RCAA 5FM5O 2VL5B 4JN1H 4KDWA 1WLHA 3BP7B 5T1KA 3WLWC 2IAMB 2IGFL 5F7DA 4ZAKC 1KT2A 4Q0XH 3O3BB 3S35X 3CK0H 2ZUSA 3GSXB 3LKPB 3QDGE 4XNYL 4QOKE 1LD9B 2IBZX 1RUAL 4NWTL 2EECA 1JPFA 2GJJA 1DUYB 1B0GA 4PJ5E 3U4EB 2VR4A 4ELMF 2CRYA 1PZ5A 2OM5A 3QIWB 4OCYL 5C6TL 1II4E 1T21A 3EZ8A 4PJDE 5TE7H 1BFOA 2EYTA 4NJAL 3O6LH 4XNMB 3WS3A 1NCTA 1P7KA 1OM3H 4YXKL 2XQYK 4DQOL 3BQUD 3BSZH 3KPRA 3HG1D 3T0ED 3M17A 3SGJC 1IEAB 3GSOB 3H2WA 1NEZB 4LPUA 3TVMA 1T04A 1S3KL 2PTUA 4FFWD 4XNYH 2ICWJ 5MENA 2OBGA 1KC5H 3S3PA 4PJ5D 5D5MF 1FE8H 2J8HA 3KLSA 4NO0B 3CFEA 5DQDH 3H7LA 5I18H 3QI9D 4JN2B 5FDYA 4DKFL 3EOBA 4JKMA 5GJTH 12E8L 5I71C 3HMWL 5KBNC 4JO3L 5MEQA 4AQOA 1EXUA 2X4PB 3JUZA 3BO8A 2D03L 5DR5H 1SYSB 4NJAH 1K8IA 4NBXB 1U91B 2PO6B 1N26A 4KZEH 2ZJSH 5E8DH 1FBIH 2BOCA 4MNGE 3WV0A 3PWJB 4OLUL 12E8H 8FABB 4EXKA 3BUYB 5EOCJ 1EGJL 1PG7X 4PJ7E 5SWSB 4IRJA 2VWEC 3MBEA 1EERB 4DN4H 2AJUH 3JZ7A 5C0AD 4OGXH 3NCYS 1UM6H 3ORJA 3DX6B 4NOBA 2OS7A 3LQAH 5KTEL 4I77H 3OR7B 1WWWX 3K2UH 4F37K 1S7TA 1AXIB 3ES6B 4LF3B 5CAYB 1Z9MA 4H5SB 3GSXA 1E28A