1GGMA

Glycyl-trna synthetase from thermus thermophilus complexed with glycyl-adenylate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
442
structure length
442
Chain Sequence
AASSLDELVALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAWWRRNVYERDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNAKARYWTPPRYFNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNVLDATSRKLGFGIAQIGKAFRNEITPRNFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSRENLVPYQQPPESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVAVIPLVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKDGTTRLKDTVTVRDRDTMEQIRLHVDELEGFLRERLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Glycyl-tRNA synthetase uses a negatively charged pit for specific recognition and activation of glycine.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ligase
molecule keywords Glycine--tRNA ligase
total genus 115
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 1999-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1ggmA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 1ggmA02
3HRKA 4CS2A 2FYKA 1HC7A 3QO7A 2PMFA 3REUA 2DQ3A 1YFTA 2DZ9A 3PCOA 4XU2A 1EFWA 2Q5HA 4ZTUB 2C7IA 3ERRA 3UFGA 2ZIOA 4YRKA 4YROA 2Q7GA 3M4PA 4X5OA 2E65A 4XTYA 4CH3A 3VQVA 2ZR2A 1QF6A 3HY1A 2AKWB 4G84A 4HWTA 1QE0A 3TEHA 4H02A 4Q6GA 1NNHA 3R07A 2CJBA 3TUPA 3W3SA 1EVLA 2RHQB 1WQ7A 4UPAA 1B8AA 2ARTA 5HGQA 2DJZA 3M4QA 4H2UA 1NYRA 2ODRC 2DTHA 1C0AA 2DQ0A 1G51A 4CS4A 3A74A 1FYFA 2RHSB 1NJ5A 1ASZA 3BFMA 4YYEA 5C53B 1ATIA 3HFZA 1X01A 4H2XB 2DKGA 2I4MA 4P74A 1YFRA 1X2HA 1X2GA 4EO4A 4YRCA 3NENA 4CH5A 3P8VA 3ICAA 1E22A 2ARSA 4XTXA 1WPYA 3A32A 2E1HA 3QTCA 5C52B 2ZT5A 3HXUA 4UP8A 4XTZA 3L1AA 2ZCEA 1W66A 5C51B 2DTOA 3IKLA 1EIYA 3EFRA 1X56A 4Q15A 4WF2A 4K87A 1EOVA 3PCOB 11ASA 2QHUA 3UGQA 4TVAB 1VQZA 2ZR3A 3P8TA 3P8YA 2EJGA 3RKYA 5K1PA 2AMCB 2DEQA 4H2WA 4P3PA 4EX5A 2RHSA 4XU0A 3HRIA 2EWNA 4YPFA 4YDQA 3QNEA 4YRTA 2EJFA 4H2SA 4P75A 3QO5A 3HY0A 4WJ3M 1E1TA 2HNIA 4HWPA 4P72C 3A5ZA 1B70B 4YCWA 4UP7A 4YRGA 2I4LA 4TQFA 3V7SA 2Q7EA 2ALYA 4L87A 4KR2A 3LC0A 1H4SA 4YRJA 4P73A 4LNSA 2CJ9A 4P71A 2ZZFA 1EIYB 12ASA 3HXWA 1YGBA 3RGLA 3L4GB 4UP9A 2ZT7A 2DVEA 1NYQA 1JJCA 3KFUA 4TVYA 4RMFA 1USYA 3RACA 4CH4A 5K1XA 3UH0A 4G85A 3HFVA 2AMCA 4HA8A 3E9HA 2E41A 1KOGA 4YRLA 3UGTA 1HTTA 2CIMA 1V95A 4DQ2A 2QHTA 1G5HA 2XTIA 1B76A 4P71C 1SRYA 3TEHB 2ZZGA 4KR3A 4CS3A 2ARUA 2EL9A 4BW9A 4XEOA 1J5WA 4XU1A 2I4OA 2DXTA 1X54A 2PMEA 3A7AA 3RKXA 4XEMA 2ALYB 3V8JA 4YRMA 1E24A 1NJ6A 1H4TA 3V8LA 1WYDA 3RL6A 3HXYA 3HTZA 3FJPA 1L0WA 3L4GA 1SETA 3DSQA 1HXDA 1LYLA 1ADYA 2EJ9A 4YRSA 2EAYA 3WQZA 4P3OA 3RKWA 1PYSA 4AH6A 4H2TA 2I4NA 3V7CA 3LSQA 2DXUA 3VQYA 1B7YB 1KMMA 4BWAA 2RHQA 4P74C 3BJUA 1N9WA 1JJCB 2C8MA 3NELA 4WJ4A 4ZTZB 2ZXFA 2DU7A 1ASYA 3A31A 3PZCA 3NEMA 4NCXA 4ZIBA 3A7UA 4XTUA 1SERA 4YRQA 2QHVA 1EQRA 4XTVA 1BBWA 2G4CA 2AKWA 3V8KA 3VQWA 2ZGWA 4H2XA 2ZINA 3A7RA 1GGMA 2E5AA 2ODRD 3L2ZA 4YRIA 2P0LA 4WI1A 2IY5A 4YCUA 3HXZA 3RUXA 3HXXA 3MEYA 4P3NA 4P72A 1KMNA 4YREA 4H2YA 4HWOA 4YRFA 1B70A 3A5YA 3LSSA 4TTVA 1X55A 2J3MA 2P5IA 5F5WA 1BBUA 4YCVA 2E3CA 4TVAA 2Q7HA 4TVWA 3REXA 2Q5IA 3MF2A 4J15A 3VQXA 1WLEA 2E64A 1NJ1A 3QO8A 2DDZA 3G1ZA 2LW7A 3HXVA 2DTIA 4RQFA 2ZIMA 4XU3A 1RIQA 1YB3A 4HWRA 3V7RA 1H4QA 4HWSA 2CGHA 1Z7NA 1PYSB 4TWAA 5KNNA 1BIBA 4H2VA 3RF1A 2ZTGA 4RDXA 4P75C 4OLFA 2E10A 4OP0A 5E3IA 2ZZEA 1NJ8A 2IY5B 5ELNA 1WU7A 1IL2A 1B7YA 4DPGA 4YRRA 1E1OA 3I7FA 4PG3A 2DU5A 3E9IA 1Z7MA 4K86A 4CH6A 2XGTA 1YFSA 3IG2A 3OD1A 2ZNJA 2QHSA 4RQEA 4YRPA 2ZT6A 4KQEA 4TQDA 2DZCA 2J3LA 5ELOA 4YRNA 3NETA 4K88A 4P73C 4O2DA 3HFZB 4E51A 1USYC 3TEGA 4HVCA 3RIRA 1H4VB 2ZT8A 1ADJA 1SESA 4PHCA 3EFSA 1G5IA 1BIAA 1WNLA 4YP0A 3MF1A 1NJ2A 1EVKA 3IALA 3IKMB 1WQWA 2ZNIA 2CJAA 4XTWA 3VBBA 3CMQA
chains in the Genus database with same CATH superfamily
3ESDA 1Y4ZA 1GFZA 1RBQA 4C4AA 4HRAA 1I7PA 3K8OE 4WK4B 2OCPA 1TGYA 4RO0A 3U3XA 5HOEA 1JHYA 1HE2A 1UZNA 2PL1A 4UAJA 3I62A 2R2AA 1BWRA 1BMQA 3PCOA 5BSMA 4K6MA 2PYIA 1V9LA 1C3JA 2C7IA 3GZ4A 4LECA 4IIXA 4QNNA 2EGHA 4MGZR 3ZIUA 1S3GA 4EITA 3K15A 1NU8A 4X5OA 4IVRA 1QGZA 4CE6A 3S1AB 1ZDMA 2ONYA 4E5PA 1NIJA 5FUQA 2B1QA 4CH3A 2WSYB 3C48A 4KPYA 2RHTA 1C9DB 2CKMA 3AHGA 1W49A 4GPD1 1N75A 4J16A 1B15A 3H83A 1F6DA 4E1VA 2WKSA 4W5OA 4RH1A 4OX9B 4NZPA 1M6WA 3N6RA 2GN6A 2I78A 4MW2A 1O9HA 3A6JA 4RGQA 1U8TA 3TEHA 1VPLA 4JJ8A 1L7QA 2NYRA 2NZJA 2PIAA 4Q1VA 5AHXA 3G02A 4E7OA 1A2BA 4MUKA 4QBGB 1KQNA 1YZGA 2VZ9A 1FFBA 2C4HA 1VL8A 2DWQA 3I01A 4O08A 1D09A 2A8EA 1JUDA 3C6MA 3PQ8A 4DGSA 3UJNA 2CY0A 3KE9A 3CVWA 1KEUA 1PV2A 4FX5A 1DELA 3FUVA 4H7EA 4DARA 4WDRA 2XYRA 1GCUA 1YB1A 1EVLA 2FJ0A 3QSYA 1QHIA 1G8SA 5C35A 3D8UA 2OV4A 1N6NA 3FDXA 1H5QA 1LLCA 2BZGA 2QVXX 5JRJA 1UFQA 3LFHA 3QKSB 5IEJA 4GKAA 2P11A 1COWA 1FUKA 1MQ8B 1OASA 1ZJYA 4NABA 2NACA 2A14A 4PAQA 4PZ0A 5IXJA 2QUBA 2Q4TA 3E9CA 3OSUA 1C0AA 2BEKA 3ZWKA 2DQ0A 4ZOCA 2VQ6A 3LUBA 3SNKA 2QE7D 2C2HA 2HCFA 5DN6D 1GRNA 2GVDC 1P7VA 2FR0A 1TI7A 3M1LA 4IOJA 2PSFA 4B87A 1UK8A 2Y9PB 1RE0A 4G01B 4EHLA 4H7FA 1Z7YA 1JR3E 3RAFC 4JROA 3H2HA 1UWLA 2E21A 3BZWA 1FXUA 2XUPA 4IUBS 3TTWA 1OLSA 2FLVA 4MARA 4N8EA 4XTRA 3WHKA 2YHIB 4W9NA 4K1LA 1RSZA 5EJAA 4ARZB 3S27A 3GRPA 3P2MA 1HNXB 3DA8A 1PN3A 3LHDA 2YJ4A 3FMIA 3IX7A 3PQ2A 1YR9A 1Z8NA 1WWKA 2PHZA 2HW8A 4L73A 1I6KA 2HHJA 4LVMA 3C6ZA 3L2OB 1USKA 2E1HA 2ZG6A 3OF2A 5EG5A 4KPFC 4YCNA 1Z63A 1J0EA 1PJSA 4N03A 1EX9A 3DLHA 3GJQA 1TF2A 3NHZA 2QZSA 3B6IA 3LYUA 5JNUA 5EWLB 4L57A 2GT1A 2LP4Y 4OATA 1HWYA 2ZCEA 2D1RA 3IQGX 3KV1A 1NRWA 3G85A 1LC0A 1YBVA 5DK4A 3UW3A 1SPXA 3I4CA 4J16C 4UTVA 2O8FA 5JLAA 1CEYA 4L4XA 3RTEA 4I55F 4GLJA 3AETA 4M1OA 3RIGA 4JX8A 1I2MA 5ALZA 1UADA 1CYEA 1T9GS 1AIPA 1XTRA 2AGVA 2Q3BA 3OJLA 5EFZA 2VJQA 2ONJA 3SICE 2PS0A 2SNIE 1YL5A 1PT8A 1U7UA 2VHZA 3KAPA 5LN1A 2O23A 2QMYA 2YMQA 3JD0A 4NE9A 5IJ0B 2EFYA 4J4HA 3OBIA 2NP7A 2GHTA 2OO5A 3BGDA 1L8AA 4IUCS 4B9AA 2PKYX 3DDUA 3DDSA 4H35A 2IPOA 3RREA 3TDMA 3WFZA 3GJ0A 5LJIA 1I7QB 3AH8A 4DCPA 2X0RA 3CUVA 1U2EA 4H3VA 2RHSA 4XU0A 2BFBA 4BIMA 1ZCJA 4JJAA 2BM1A 2R0QC 1L0BA 3BUSA 4X6UA 5AW3A 2R66A 4U7TB 4YPFA 5D86A 3T9AA 1RZUA 4DLSA 5JC1A 3RU9A 1WY5A 3IKJA 4AN0A 3ZCUA 3R2JA 3IODA 1BN7A 1LJUA 3H2YA 1WZ2A 5JAZA 3QO5A 2RONA 3ZK7A 3TXYA 2JI9A 1J56A 3PHGA 1PJBA 1HY3A 4L4SA 3IEVA 2H4ZA 4RTRA 4KIGA 5BWBA 2A5GA 4ZMBA 2DR3A 3F6BX 3LZ6A 1PS0A 4OPMA 2IPXA 3I73A 1Z5NA 3PT5A 3OQJA 4PNHA 1TM1E 1E2JA 1US8B 5CYOA 4K9PA 2HSJA 3FUXA 3ELYA 1XNQB 4JL8A 3GJ4A 3KLPX 3W04A 2G4VA 4AZ3A 3U7HB 5JQGA 3G0GA 4L87A 1QIEA 2DX7A 1M1YE 2XECA 3KLNA 3P2IA 3WKDA 2Q6VA 1N5KA 4X94A 3TQRA 1R8QA 2XQFA 4IIDA 1IPEA 2FOIA 5CU7A 1FJ2A 3AVWA 2QRVA 3VZPA 3L7MA 1UJ2A 3GNSA 2C4NA 1O9GA 2AFHA 1IL0A 2YBDA 3ZE6A 8GPBA 4Y67A 1KEEB 3OKCA 2QT1A 4PFJA 4HB2A 4LRQA 4HT3B 5CEFA 2ZYDA 1TM7E 3K9FC 3TVDA 2OMEA 2QX8A 3IIJA 1T2CA 3QMVA 2M6LA 4MGHA 3EVGA 4RK4A 5DIFA 4DB4A 4GW3A 4QHTA 3KKZA 1Z17A 4BOYA 3KSUA 1VHJA 2VNJA 3H7AA 4LZJA 2PCLA 3TIGA 1UAAA 1CDDA 3GRKA 1ZIYA 2XH8A 2J5BA 4JB2A 4P38A 1RWQA 3PD7A 4HC4A 4G85A 4RF4A 2JARA 4TWJA 4EHNA 3BT7A 2HJVA 4A8PA 4FFLA 2VBCA 2ZZMA 16PKA 4PPNA 3V7FA 2DCUA 2QM3A 2RAUA 4B09A 2BCJQ 4FFSA 2L2QA 1SEVA 2GETA 3BREA 3HNRA 5HE8A 1Q0RA 1E59A 1SUPA 4LHZA 2ZBEA 3TIIA 2GPBA 2JCSA 3HJAA 1FP6A 3O93A 4TVKA 2P1RA 4OSEA 3EA4A 4GQBA 4UD6A 3B1WA 3DBOB 3HY4A 4MSUA 5C8ZA 5HBRA 2CK3D 4UE2A 4ZAGA 3EXHA 1HETA 3ZNPA 2XTIA 3UMMA 2LIPA 4Y0NA 4QUJA 4EEZA 2ZIWB 3UFBA 2C00A 4YXWA 3ZHOA 2XB2A 1XTVA 2P77A 2OCKA 1XIVA 3I6ZA 4DR2B 4I5EA 4Y18A 1VKHA 4WLVA 3WYFA 2QNIA 1VIDA 4D9IA 1P2VA 2AX3A 3AVOA 2RAFA 5TQVA 2Y0PA 4CCAA 4F04A 1J5WA 2A3RA 2PWYA 1KIMA 3SM3A 2QVYX 1E5DA 2A5YB 2YXDA 2ODAA 3KJNA 3OCWA 4RDCA 5DHRA 3RUFA 3GFVA 2WQ6A 1E20A 1ZQ9A 3GD5A 1J8DA 5FA8A 2PPVA 1AS2A 3FKQA 4Z6KA 1VKOA 4PQRA 3TR0A 4JXZA 1ZESA 2VHQA 3RK0A 3D3NA 1RQXA 2HX1A 3O26A 5FUXA 2A78A 4V38A 1E6MA 2XXAB 3EA0A 5SZJA 4B3GA 4D45A 1IRIA 2GF9A 1QMGA 1YI8A 3IUMA 2GCOB 2IY7A 3DG9A 4JBNA 2XTAA 4N1AA 2HJHA 5AQEA 5T4EA 1KDTA 3D4NA 3EAQA 1USGA 4NP6A 4Q3OA 4QGBA 1TCUA 1NA5A 5JH7A 2PY6A 3DT6A 4DQDA 2QTTA 2IHKA 5F33A 1ZK0A 3WB1A 5A4MS 4C0SA 1M1UA 1E2HA 3DSQA 1U0BB 3U1VA 5KQMA 3GA5A 4MUNA 4QODA 2E4YA 3EVNA 1DQNA 1HXDA 1I1HA 3HKEB 2D0DA 3LP5A 4S0ZA 3PTZA 4X8OA 1YVPA 1TZ2A 4FGLA 2EJ9A 2D1SA 2DG2A 3O6VA 4WNIA 3H8JA 4PAOA 2VC2B 3O8LA 4QU0A 5BVGA 2L82A 4E6EA 3LCUA 2I7XA 3OZBA 3SAJA 2OO3A 3RC9A 4FSHA 1R6AA 4LMPA 3WGYA 3UB3A 5JOQA 3OQBA 1TF7A 1QG4A 2H3HA 5A7HA 3PX7A 1XZCA 4K9MA 1JQDA 3TGPA 2IW3A 3B5EA 3B8HA 1B0AA 4OQPA 1G6HA 1A5TA 1JG1A 3KAKA 3MJRA 3EMKA 2XTZA 5K0NA 3MTJA 4HATA 3BK1A 4JC0A 3OHMA 2A1TR 2I4IA 3ER9A 1WHSA 2G1UA 2YIDA 3HCPA 1SK8A 1WHTB 1OGYA 2CNKA 4H15A 4I55B 3RS3A 5EXDA 4P54A 2VJPA 4DMHA 1JT9A 3CLRC 3KELA 3ZV7A 3AJEA 1X1DA 2L18A 1UEJA 4FGKA 4AJOA 4CIWA 4YJ2F 1G3UA 2PK3A 1O95C 2FQYA 4JFAA 4EGCB 1L7PA 2YN0A 4GZ6A 3EEIA 3UGKA 5F23A 5TVGA 2ZXFA 5FFNA 2XTNA 1O58A 3ZCXA 3MINB 1SQ5A 3NTXA 4PLPA 1LPBB 3RVJA 1NJFA 1JDJA 1NQOA 2J1LA 4ZIBA 2VP0A 3MRVA 3ONDA 3OT1B 4OJQA 4XTUA 1SUCA 1XEXB 3M34A 3O82A 1NOIA 4UEOA 2IV2X 4ZTBA 1HH4A 2PZJA 1CS0A 2ONKA 5JUWA 3VNRA 2GJ8A 2OLEA 4XTVA 2CXQA 3O47A 3P0RA 4E2WA 1O54A 1QWOA 1ZVMA 2XD4A 4Q9NA 1CPYA 1H8ED 4PX2A 3RJ9A 1J5XA 4CKZA 3L4BC 4RTOA 2EVWX 3RYHB 4K0KB 5JSKA 2QZJA 4LVIA 2CVQA 4XYEA 4E7PA 4JLAA 2FR8C 1LRJA 1U4NA 1YFLA 1L1QA 2ZIXA 2C04A 2BGJA 2WJ6A 1KAOA 3GH3A 3ZHYA 4ZOBA 3ETNA 1Z15A 4OGFA 5EIXA 3ETCA 1H2EA 1JSXA 4N5HX 4KHPB 2XGJA 2XOEA 1WEHA 1ID1A 1ZNYA 1PZNA 4G23A 5HR5A 1CZKA 2YQZA 4I36A 4MS1A 4HBZA 2AK2A 4NCIA 2W00A 4MQ6A 4Q9KA 3MCVA 2HGZA 2P67A 1GZ4A 2YYAA 4MVJM 1IY2A 4NCKA 4QTZA 4U3JB 5G41A 2Y2VA 2FDRA 2R6GA 1ACLA 4GWGA 4ZOLF 2E3CA 2NWQA 2ZTVA 4UFOA 3M4NA 3JQCA 3V8PA 4TUYB 3H2GA 1MO2A 2IEYA 2P1DA 5DTRA 1N4DA 4EB6A 4ZYTA 2ZUUA 4AX8A 1FDOA 1D0SA 3MF2A 1HG0A 2F6RA 1H42A 5H7XA 2WFLB 3W2FA 1MV8A 3R0ZA 4NQZA 3VR4D 5IM5A 3DCIA 4AKEA 5L6MB 2OHVA 3G0CA 2QN9A 1WULS 3NOQA 3NTRA 3S5JA 1Z7WA 3I9NA 4KI7A 4WDQA 4KCGA 1DEOA 3S2UA 4G24A 3W6UA 3IERA 2ZIMA 1UPAA 4JITA 5FCDA 5BVHB 5FH9A 4MMZB 4NFSA 4XB1A 2WWIA 3TLXA 5K4GA 1EWTA 1QP8A 3LSYA 5EL0A 3NIGB 1DEKA 2FZ5A 1H3EA 2A35A 2GZAA 3O1HB 3N2IA 1II8B 2SECE 2TMYA 2WAOA 2G40A 5DNDA 2Z3ZA 2FFJA 4D82A 3CVVA 2PVPA 1DFGA 3A70A 3PQDA 4MQEA 3UHAA 3ZWCA 3RKUA 1I4EB 5FNVF 5EOVA 1XXLA 4LF6B 5IWAB 3OPYA 3VO2A 4ZQBA 4M7OA 2ZZEA 3IEUA 3SBXA 1W4RA 1TQ4A 4IMJB 4H7HA 4RKRA 3KUUA 4FJ0A 3Q0TA 2AFHE 2IYOA 3O4HA 4HQ0A 2W8ZA 1K63A 4HTAA 4ISCA 3W77A 3DDZX 4NZOA 3ASUA 3HRHA 3PPXA 1OZGA 4MKXA 3A28A 2PTHA 4PG3A 4ZC8A 4F2HA 2OG2A 4L3OA 3TCKA 3IVMA 5HNKA 4DGQA 5K3BA 1LX7A 1VECA 3NV9A 1K8QA 1M1XB 2P27A 4HYEA 4Q3DA 4HEQA 2GMWA 2O2GA 3IAS1 1J21A 1DRKA 3D6UA 2QKYA 3ZGVA 1Y1TA 5GZ6A 3R9XA 5ECGC 1E7WA 2BOVA 4YAWA 1U04A 2NUPB 2I5PO 4ITUA 4ZARA 4Z0TA 3ZI0A 2QG9A 1GCAA 1KAGA 1OI3A 3HXPA 2GR9A 3ILHA 1EWRA 2HAEA 3ANMA 4GDMA 2R5WA 1OWMA 1UPFA 1Q15A 4FFNA 2DZCA 4Q01A 4ZHQB 2Y0BA 3I30X 1DTWA 3LDAA 1VG0B 1H6AA 2EG5A 2HEGA 1DIOB 2YMPA 2FJPA 1CUZA 4IS3A 1VPWA 4G9EA 4QTTB 4XR9A 1GTJ1 2OZEA 1TC1A 3GLRA 5FNVA 5H02A 3KZNA 3U56A 2G4LA 5JZSA 2P6NA 3NBZC 4MVCA 4Q24A 3R0VA 4BQSA 4W5TA 1NVXQ 1Y34E 3I58A 4QOIA 1E1RD 2A88A 2J9GA 4Q7JB 2IVZA 3AIKA 4B6FA 4KODA 1I0ZA 1W94A 1Q11A 1TU0A 4Q4JB 4WFJA 2BJVA 5EWMA 5IKMA 3EASA 3SOPA 3EFSA 1GLGA 4EYGA 4W8HA 4MAMA 2IBMA 4JJZA 4NVRA 4EA9A 4NU6A 3WWCA 3CLRD 3QTBA 3DVRX 3OQNA 4DDTA 4DV4B 4YGXB 5AHOA 4C7KA 2AUTA 3E5RA 2ZNIA 4U2FA 1OX5A 1YRYE 1Q7BA 1IOZA 2H2FA 3O8OA 3EG9A 4ZVPA 3ZWXA 5KNDA 2B4YA 2VJBA 2B83A 1LBTA 1KO5A 2WTXA 3VYVA 3QE0A 2D5LA 2AC2A 2IQIA 3QXHA 4KVFA 2G1JA 2H06A 4DA6A 4F7DA 5A9SA 3TQCA 4CS2A 1N4AA 3W4JA 4DMRA 1X1QA 5DI3A 4V0KA 4GE0A 2W22A 1S7GA 1TKRA 2JIZD 2BKVA 3KEGA 4P93A 3U4GA 3Q3HA 2OB1A 2WDPA 3B9QA 3HYLA 1LD3A 1HQKA 4F46A 3UJAA 2ZRFA 2Q5HA 3DEIA 3G5LA 3Q7EA 4GBMA 3ZEIA 4MTLA 3K5PA 3FG9A 2GPTA 2I55A 4RTKA 4HH3C 3EIUA 1Y7HA 2PKQP 4GSYA 2GUWA 4S1VA 4E31A 1R0ZA 1GG8A 1Z3CA 1QO0A 4WIAA 5B37A 5I8ZA 3TEJA 4CLRB 4EDFA 1LKZA 3C15C 1OXSC 4RHCA 3W78A 3VQVA 3TQIA 2GTPA 1XMPA 3MS2A 3BHMA 3TKLA 3HY1A 1F2UB 3HVUA 3L1HA 2Q0QA 5HCIA 1KI3A 4PW0A 7MHTA 2OBNA 4KE6A 1WKBA 3M4ZA 2CW5A 5M5BA 1Y7LA 4JJGA 3VU9B 3AI1A 4C7BA 1C2YA 2YINC 3R07A 2W4IA 4M9UA 5ITWA 2MINB 2ZUBA 3O1LA 2PZFA 2VYVD 5GOTA 3VJMA 3WISA 4ZZ3A 1EXNA 1IJBA 1Z2EA 3L6OO 4IF6A 4UBJA 1H5UA 3P2OA 1TW2A 4HSEA 5ELLA 4PM4A 4P7JA 1RKBA 3OEHA 4BUJA 1X7YB 3TOVA 1X92A 3GR6A 1CUJA 4JJ7A 3I6IA 3LK7A 1VRVA 2IYUA 2JRLA 2OK7A 3PJEA 1T15A 4EB8A 2H1OA 1QCCA 3EXAA 2P0EA 1UDAA 2HRRA 1SIOA 5JAUA 4ROTA 2W8BB 3L7LA 3HXQA 4UNSA 1ODJA 4UXHA 3L7KA 3R3JA 1YTLA 4BVEA 4BUZA 121PA 1AKEA 2LR0A 2BFOA 3VZBA 5LOVA 1X1EA 3S8MA 3A10A 3G9UA 3L79A 4YQEA 3RRFA 3TZCA 3KVYA 2QZZA 4NMWA 1I7NA 4URHA 3NZEA 1FBTA 1DJQA 1A04A 1YULA 4WCFB 3UT5A 4BWGA 4CI9A 4TROA 3AY0A 1NJ5A 3AF1A 3VU1A 4M1YA 3BFMA 3IP1A 2FSVA 4DCNA 4YYEA 5KMGB 3AR3A 4ER7A 4QXRA 4ODIA 2BMEA 2RGYA 3KB6A 1GDTA 4A1FA 1TLLA 4MYDA 3HU1A 3N07A 2EW8A 4BNZA 4D44A 1ZI8A 3SE7A 4UBNA 1BVUA 2H57A 2JKZA 3P8VA 3M4JA 2W70A 5DGCA 4IOKA 3ZW7A 1XZEA 1EA7A 1VHWA 2CNBA 2XUKA 4HMOA 4NKRA 3WLKX 1QFZA 4DG8A 2C5BA 1WDMA 4BATA 3WDLA 5JI3E 2WUWE 1Q95A 2HM7A 4RJ2A 4X1YA 4UU0A 4D9NA 1AC5A 4F9EA 3O03A 1A2KC 3OCZA 3RASA 2OY0A 4MGYR 4JP5A 1EP1B 4EHIA 4TTAA 4IS2A 5D87A 1DADA 1K86A 4JCCA 1VE5A 2ZT5A 4J0QA 3OJ0A 2VCHA 2XKJE 4YHHB 1AGRA 1MIOB 2G09A 2ZDQA 1IJFA 3ZHRA 4BFUA 2QHXA 3Q3VA 1ODIA 1LV7A 1JAZA 4B6RA 5JJKA 3OE5A 4WLNA 4KVAA 4RLSA 2O07A 2H4XA 3K9NA 4GZLA 5CK5A 2PUDA 1BHJA 3IKLA 1QONA 4N18A 3EFRA 3Q41A 4RD4A 1C1DA 2X8BA 4R84A 5GVSA 1OREA 3PPYA 3UXYA 2R47A 1QYCA 2PZEA 1SUWA 3OOJA 4KXNA 3GQBB 2C0PA 4IJUA 2G8NA 1DSSG 2CWDA 3PCOB 2HQ1A 2Y1GA 3LT0A 11ASA 1YFKA 1ZOIA 2RGNA 2W71A 1QHNA 4Q3NA 2W8BA 4G4IA 4CCYA 1XXHA 2CNWD 3HLKA 3PTLA 4FUTA 3CGGA 5I9BA 3TFWA 4Q9DA 4M76B 2SKEA 4PO3X 1EGQA 4NWIA 1Y7TA 4QTYA 4P3PA 2XAAA 4JR1A 5K0SA 2J9RA 3ICOA 1XHLA 2IYXA 3HYSA 1JNYA 4RAQA 3AEZA 4WBNA 3VKVA 1TMYA 4HGRA 2IOYA 2DWPA 2CWWA 3BEDA 4Q5IA 6Q21A 2B8TA 3QFHA 1A9QA 3IEIA 4B40A 5HK9A 3MJSA 2EQAA 4RELA 1KI9A 1Q3HA 3K0CA 5DBGA 3HB1A 3E48A 2G71A 4TLBA 1GKKA 4XRGA 3TJMA 3TLCA 2XCIA 4HB3A 1GRRA 1D0VA 5CT8A 1O03A 2HBZA 4GEGA 2Q5CA 4EJFA 4OREX 4K3UA 4Q4JA 4QJ4A 5MFPA 4AKGA 4UP7A 1FU4A 3EY9A 4KIFA 1EFVA 1F17A 3L4JA 1E5VA 5EZYB 4F3KA 1Z8HA 4X45A 2KLHA 2I4LA 2WUDA 2GAOA 2D7CA 3RWOA 5LP6A 1V3QE 1K8YB 2HBQA 1L5FA 3QHPA 3TOCA 4ZV4A 4QWMA 1OXKB 1T2UA 5ALVA 5JZ9A 5LNK1 1Y4DE 2G0NA 2OB2A 3KALA 3TNJA 4F06A 4XEHA 3OBBA 2DTEA 2F1OA 4HFMA 1U6KA 4B82A 3THXB 4DCSA 1A5BB 2QPLA 1GTL1 4LW8A 4L76A 4QOGA 1TYCA 2BZ0A 2Q9UA 1A0OA 2X2EA 4IZOA 3T3IA 4WZ6A 1TUGA 1QORA 2IHZA 4MQUA 6NULA 3GLTA 3S2IA 3UMFA 4Q1EA 1E9DA 1G8YA 3STYA 4YUZA 1G17A 3KXPA 5KB3A 2E49A 2R4TA 3NHSA 1T5SA 2X0NA 3INNA 4QYIA 4HDKB 1QO0D 2AX4A 2ORED 1M8KA 2XE7A 3EARA 3A4VA 2GYVA 4L5CA 3TGLA 3SQXA 2I8AA 3BTOA 4CN8A 2WU8A 1TT5B 2FSFA 2RH4A 3CLTD 5DYGA 4A2CA 1K92A 1GL6A 3A14A 2Q46A 2FPWA 3A6LA 4OHRA 3A2NA 5KOJA 1G18A 2GNOA 1XEWY 3G5TA 4YRLA 3N76A 4O4IB 4Q0MA 2VFAA 1HE1C 5CD1A 2P2GA 5T3YA 1DG3A 2VDOB 5BSTA 1R6VA 3P2KA 1M67A 3LIIA 3LVQE 3L4BA 2LD4A 4X0EA 3W90A 4BWVA 1E9CA 2Q07A 3QVGA 3V48A 2R1UA 1EJ6A 4C4YA 1T0HB 4WY5A 1VLVA 4KN9S 1KO4A 2ZZGA 3MXOA 4NJEA 3NKVA 1KRHA 1QIFA 4PYQA 5HIJA 1DGQA 1MHPA 4GLBA 3B51X 1VPDA 2PU7A 5A9SB 4DG5A 3D4OA 3B7PA 3OKAA 1ULTA 3PNPA 5IT5A 3QXGA 2QI9F 4ESOA 2G9ZA 3HKBA 3FVWA 3MYYA 5DU2A 2IE8A 2ZTLA 3ZE0B 4FTWA 3AGPA 3I2JA 4BO1A 4TV9A 5HUHA 1F06A 4YRMA 1FFSA 3I5AA 4G0YA 2XMPA 3N2YA 4KK4A 4BRZA 2WWYA 5CIYA 1M8FA 1QMPA 4ZJYA 3O83A 4H1WA 3HY6A 5AVOA 2FLKA 2R97A 3ET4A 3P20A 4PZAA 3CNOA 3T5GA 5EJGA 3RS8A 3VU3A 1G2PA 4PZCA 2OV1A 3MVEA 1P5ZB 3QJYA 4INZA 3KKEA 3S7TA 4OMCA 4Q4DA 1GPKA 4NEGA 1X1CA 2NPIA 3TOSA 1H2BA 3UB4A 4HVTA 3QKWA 2MHCA 3WBKA 1QG6A 2O52A 4GPAA 4QJ3A 3QI2A 4NXMB 2F67A 3BMQA 1PNQA 1IHOA 1R64A 2ZRKA 3IMKA 1N6KA 2JC3A 3MSXA 4MXDA 4DREA 3U7GA 3OG9A 3R5KA 2HCTA 4NBUA 3O4RA 2BSXA 2ZI3A 4HNUA 2X3FA 1BEEA 4IMIB 4LRXA 3GJ7A 1KEPA 3ONNA 1DIGA 1XQWA 3AX6A 3FXAA 3MUEA 2G77B 5ICGA 2Q3FA 1H65A 4Q4LA 1ML4A 1I2DA 1M2OA 1HMPA 3E0QA 3CZ5A 4HPWA 1RQ7A 2ZETA 4JGGA 4JV5B 2R8PA 3IMFA 2O5RA 3SZOA 5C5CA 3OEYA 4LWPA 2J9XB 1A5AB 4LKOA 4OAQA 4D6PA 2HK9A 2XODA 5ALRA 5P21A 3R7FA 1QKIA 1RPZA 2SHKA 3V7CA 5EE0A 1WPRA 2BC9A 3WZLA 4I5DA 1U90A 3IPRA 1MEOA 1YSCA 2D54A 1EK0A 1CBUA 2DXUA 1G20E 3IVRA 1JQAA 4FFOA 4M8NE 3UK1A 2HRZA 4CPDA 2ZWMA 4E4YA 5CA1A 1LI4A 1OF1A 1Z6QA 3P52A 4PFKA 1PR5A 2CL7X 4WCFA 3UT5B 2C3YA 4KGDA 2GD1O 4K3VA 5DLEA 4C0KA 4OHYA 4PHHA 3D7NA 3I0MA 3L77A 4XAQA 2GEJA 5JALA 4X6LA 4O25A 5KAMA 5JEEA 4AG3A 2AR9A 2GM4A 1ASYA 5HUJA 3WI7A 3D1VA 3G9QA 4GUDA 4E33A 2BHNA 4PXSA 3G89A 1NI3A 4U1RA 1BDIA 4RK1A 3RU3A 1E0DA 5GM2A 2W2VA 1NXPA 1T13A 2E4XA 4DRXA 4EGQA 3N87A 1VL2A 2QB5A 4TV8F 3FTDA 7YASA 4DCGA 3K92A 5HJEA 2ZRIA 3HI4A 1KBOA 2WG1A 2NGRA 4WVLA 3ZCQA 2BRUA 2UXCB 3BMOB 2G4CA 2JNWA 2W0SA 3VNQA 4CXMA 4W5QA 2HIGA 2P2NA 2CD9A 3ENWA 3H0CA 2EHJA 3P45A 3AUUA 4O3FA 3WG9A 2DR0A 3FYUC 3PXAA 3TSYA 5I7FA 1WEKA 3L2ZA 3BMQB 5DTEA 2EWWA 2X13A 3DVAB 3E81A 1ITZA 3MQZA 2REXB 2XX3A 4Y6GB 5FD8A 3RYTC 4CL2A 1NXVA 3HXZA 1TDJA 4J0DA 5D3KA 1MO5A 3HXXA 4OYLA 1XTPA 4RPHA 5EXPA 3NRCA 3UJBA 4DMUB 5E6UB 1C8BA 2NO0A 2PGLA 5DMHA 5DP2A 2ZIVB 5FULA 4A16A 4ARVA 4ZD6A 3LUKA 1X7YA 2B9VA 4GX1A 2C7OA 3LBAA 1RYBA 1XTKA 5F1KA 1B70A 3QNWA 5IAJA 1EPUA 2QJTA 2FX5A 2ET6A 2Y6UA 2R44A 3KR0A 3K2EA 2WWRA 1U7WA 1UPUA 1GSAA 3MT8A 3N74A 5BSUA 5THQA 3DKIA 4UNNA 1BDHA 3UJHA 3W7VA 3HCBA 1CETA 3VR2A 4C1NA 5REQA 4LYFA 4INAA 1BBUA 1UFVA 2IHUA 3A4NA 3F4BA 1E2GA 1C30B 3P32A 5FPKA 2QWXA 2LUOA 4XDHA 2JJQA 3ZHVA 3DZKA 4GO1A 3VBEA 2PT6A 3K1ZA 3BHIA 3B6JA 4DV2B 4D3SA 3WHIA 3DKKA 1UT5A 2IC5A 4GNKA 2RHCA 2HMAA 1I8TA 3SQLA 2VDUE 1H05A 3CCCA 4OP2A 1T2VA 4JZKA 3H4IA 5D1HA 3S7ZA 3T5PA 1XZPA 1O6GA 2X2OA 1U7ZA 1YDEA 3DVQX 4MMXB 5F7ZA 3G9XA 1WETA 2NPOA 1B1AA 1G41A 1ZL2A 3DM5A 3QFCA 4LYGA 4XWAA 4QELA 1CUGA 1XVAA 1MHTA 1T3LA 3RVBA 2X6RA 1MA3A 1YVUA 2IOQA 3GL9A 2BIFA 2ORYA 3RSQA 3G7NA 4CG1A 4WNYA 1Z6XA 4HDMB 1LQTA 4MRMA 1XALA 3LP6A 2BM8A 3IXQA 1BIBA 4FGWA 3PGKA 4NYJR 3PRYA 4M8SA 2HA3A 3JR3A 4KZKA 2DBZA 1OZHA 2V45A 3H4TA 1QZXA 4WXEA 1U2ZA 3TZBA 1L1EA 2C59A 2VAXA 4YIKA 4EK9A 3ANYB 3FLBA 4H3KB 4ETNA 4WOBA 1XP8A 1VMEA 1J8YF 4G1BA 2V54A 2I3DA 3ZZMA 5B7PA 1M1NA 1IK6A 3PLAE 1N0VC 5B2EA 1IL2A 1Q1AA 4P4TA 4WN3A 2GS9A 3DEJA 4JLBA 5FUBA 1NR5A 1G9TA 5G2OA 3BFKA 1E1OA 1RWOA 1XRPA 4MK4A 1NKVA 1YO6A 2XT9A 5DIZA 4OI2A 4K86A 4CH6A 2BKUA 3LWZA 1YCFA 3ZU2A 2M1XA 4H7KA 1EZ1A 1KJQA 4OQFA 2H1IA 1YFSA 2HREA 2WIKA 4KNVA 3ZTWA 4B33A 5JATA 3HU2A 3ZR4B 1CNMA 3CIOA 4K81B 3HPQA 2VYNA 5DISB 1KMCA 2ZNJA 1DBVO 2R7MA 3MRTA 1G0NA 4N48A 1BEUB 1JQLB 1CZUA 3JRXA 4I81A 5COAA 3TQQA 5EIFA 2OZVA 5LYJA 4KPEC 1M6YA 1J1ZA 4R1OA 4IQ4A 2QUAA 1X14A 4MKFA 1IU9A 2Q2QA 1UJNA 5TDHA 2BH9A 4L0DA 4OHXA 2IUUA 4TQDA 1W25A 2H8GA 4UMFA 2NVUA 4XX0A 2BMAA 1JX6A 1HYGA 4PLWA 4WASA 1W5EA 2IF0A 3I28A 1M54A 1MT3A 4YRNA 2E82A 5A7GA 4HNVA 4MR9B 1G7TA 1XCMA 4P73C 1SA0B 2EX0A 4JY7A 2K6GA 2QPTA 3PB3A 1WMAA 4NNPA 3E84A 3VNSA 2F3QA 1V9SA 3D7SA 4FWBA 3H19A 4N7JA 4AUEA 1YB5A 1Z2OX 5FDFA 4MVJF 1IBSA 3GLVA 3ANTA 3K0AA 5C1IA 2H7VA 4JVMA 4C7JA 3RU2A 1ILWA 2F00A 2G9QA 4M87A 4XW2A 2H52A 5DXAA 3RLIA 3LDHA 4PGGA 4LPKA 3PRJA 5IYZA 1DAKA 1H8HD 4PAGA 3W4IA 4XD7A 3WLFA 2QLNA 4GLFA 1NXQA 1G5PA 1VHLA 2LDXA 2QRHA 3IH5A 2PSSA 3K96A 2QN7A 4J2HA 1O2DA 4E94A 3AILA 1IWOA 4ECAA 5BWLA 5B3AA 4HCJA 2WZDA 4RPLA 2CFTA 2WNHA 3GLFA 4MNTA 1CT9A 2GA9A 3C70A 2I7TA 1WQWA 3A27A 1E3QA 4UZEA 3MWDA 4FDTA 4GX0A 4FR5A 4AF6A 4KJZA 3IVAA 4R1UA 1KNXA 4OUKX 2WJVA 2CKDA 2JLZA 3CVXA 1O7JA 2ASEA 5BN3A 3HBLA 3B5JA 3TQOA 3EXHC 4TS9A 2WG2A 1FU7A 4E5MA 2D7JA 1OA1A 1YCGA 3U4AA 3WYBA 4IVQA 2IDKA 1XRRA 4ZIRB 2A1UA 1Y1RA 2R8OA 2E9SA 3ZY5A 4CIVA 4F71A 1IVYA 2NOAA 3GLIE 1CJUC 1SCJA 3KP1A 4MWSA 3SBEA 1WL8A 2YV5A 1R0RE 2BELA 3C24A 3WLPA 3ZDZB 4BFSA 3EPLA 2ZB7A 3FGOA 4AL4A 2HR1A 2JIMA 1WPQA 4OFZA 2TMDA 5GMOA 5J5AA 2WJWA 2NZXA 1Z5PA 3BXZA 5EGNA 4M2LA 2WLTA 3P96A 1EINA 4X9XA 1NLUA 1SVOA 5GP1A 4D4LA 1AQNA 1IUKA 1WCV1 4PANA 2NSHA 1OU4A 1YNOA 3R3YA 4OQYA 3H11A 2AOVA 4R1QA 1VLMA 1TCAA 3CPJB 4RMJA 1QF6A 3ZDQA 3ROZA 1UM9B 4IWYA 4XD7D 2OPHA 4DLVA 4ZGGA 3DBHB 1EP2B 4UXIA 2F4NA 2IS4A 1JWLA 1V5EA 3PENA 2FPGA 3RC1A 4FONA 3WADA 4HGOA 3KVNA 5F78A 9MHTA 3RODA 1L4YA 3H5NA 2PGJA 3GBVA 1PNOA 4JBGA 4RZ2A 3LUCA 3WDSA 4OXYA 5HMLA 2D2VA 1LLFA 3AF6A 4FEAA 3DBVO 1XA4A 2J8ZA 2YWGA 1Z26A 5K5EA 2IIPA 4N76A 2ID8A 4RSMA 3K0BA 5FTNA 4ZZ2A 1PVDA 5E3HA 1XVTA 1BU5A 2BFCB 4RPKA 5K0LA 1ORIA 2UUBB 5DM2A 3FWNA 3FETA 2Q3EA 1VRWA 2NU7B 1UBEA 2DTHA 3M70A 5EERA 2YJ6A 6LDHA 5L8VA 1LI5A 1RM0A 5HILA 5CJ2A 1ESMA 4HLNA 1LVGA 5LXTA 4FOOA 1AXRA 1JPUA 1YI1A 2HZBA 2VUHB 1XQ1A 4R71A 1L5ZA 4MVJG 3K9BA 1ZIPA 3CC8A 3SWWA 1FYFA 4LVJA 1V4VA 1A7AA 1U9JA 2HYDA 3I76A 4PC1A 3S3TA 3PC3A 1H1LA 2PMCA 4ID3A 2JJMA 3RRNA 4G1FA 1QE5A 4CUKA 2WUEA 2A0XA 1DO2A 3DE1X 3GFFA 4Z3DA 5A6SB 3ZD9A 5L7WA 4P53A 1OFHA 1SU4A 5G3ZA 1X01A 1DU4A 1YUNA 3KHSA 3N7TA 4U6QA 5A9RA 4II2A 3OZXA 4IIGA 2W6JA 2KW5A 3R20A 3HXOA 5T4FA 1JXQA 2GCPA 4Y2UA 5CDGA 3O8BA 1RW4A 4CH5A 3FZYA 3ROTA 2CL5A 4IDPA 1TQ8A 1WVGA 2FTKE 3W1EA 5CBKA 2I1LA 4MKRA 4OK5A 3DR3A 3WBJA 4TLMB 4LYJA 1DZ3A 4L16A 4D41A 3DL4A 1ZVQA 2CLKB 1K7YA 1P60A 3RQSA 3SD7A 2O8VA 4PBRA 4XJTA 4DNQA 1O0SA 1UXOA 2RH8A 2JL1A 2A5LA 3TQFA 2HKIA 1TECE 3FYSA 3BKWA 4LOLA 1CY7A 1JDVA 1WB5A 3NYIA 3F5DA 3W1VA 3G8AA 3UXEA 1ZD3A 3HKDA 2XGMA 3NBUA 4B6GA 4EBFA 4ID9A 2I6XA 4ZJZA 1VBFA 3BXXA 5KVQA 2HHCA 1ZG3A 1NWHA 3DHEA 2P4SA 3H2SA 5BXQC 1X56A 1B0PA 1G1MA 1BTOA 1E3LA 4QIHA 3O7WA 2DULA 1E18A 4BC1A 4ZCTA 5BMVF 1NKTA 5KYNA 3ULKA 5EWJB 1INLA 2QHUA 1IZ0A 1ZMOA 3N75A 3UUFA 4TVAB 3BX1A 4BXOB 4HMQA 1GL7A 3O75A 2DM6A 4OVKA 3NUQA 1V8PA 2EJGA 1JVSA 4ESEA 4QGFA 3DLCA 4Y2YA 1J42A 3BL8A 3PT9A 3TRKA 3OKPA 4DLUA 1L8LA 4LJ8A 4LY9A 1NNLA 1TD9A 3HRIA 4B3DA 2C78A 1KS9A 1IK4A 4LXUA 2WB2A 1N6OA 5JH7B 4FW8A 3FOCA 3FHLA 2BR4A 5DGTA 4R51A 1U2QA 3GK3A 4EKYA 1VDZA 1O95D 3I8OA 1R15A 1RKVA 1P0FA 3G2QA 1ZRHA 2C03A 4ONEA 1ENOA 4HNSA 4C7XA 1NL3A 1HYQA 1XUOA 4ZT7A 2OZKA 3K0FA 2C83A 2POQX 3NUGA 4FDAA 4WKOA 2H7XA 1HTBA 2OLJA 1B70B 2VT7A 3DOOA 1NATA 3EXG2 3H05A 4BV8A 2R8BA 5BW6B 3VO8A 4A6EA 1I7LA 2GFQA 2V8BA 3I23A 1JR6A 4J76A 4GQIA 4DM7A 5FOWA 4FFRA 3JWEA 3VR3A 4FILA 2H2WA 5BYBA 1FSPA 1FP2A 3C16C 1H2YA 3MJHA 4N3AA 2WTBA 1FSSA 2VJNA 4KPGA 4MWOA 4QUHA 5CW2A 3OLXA 3R75A 1VIYA 1C9EA 2JCBA 3HA5A 3O2QB 3NDBB 4H1VA 1LJLA 1MIOA 3HL4A 3CF2A 2Y8EA 2V0NA 4TTIA 5JAQA 1AHPA 2Y1KA 4XIJA 3E7DA 1ZOOA 1YIDA 5F64A 1B6TA 3PGMA 4P73A 4MV6A 3WL4A 1BJKA 3BH6A 3IAS6 2GTHA 2HU5A 4CF7A 5EPOA 4TZTA 1TEZA 4CMKA 1C1DB 4GMKA 2O3TA 5K99A 1NN1A 2B5VA 3MTDA 2A59A 1XC7A 4P22A 5E7MA 2AOTB 2RB5A 1JEDA 2FU5C 3NNSA 4CU5A 1O6ZA 1VE6A 2BN4A 4IXTA 1L5VA 1M5UA 2B1GA 2V7QD 3AB3A 3GEEA 4HDRB 1UC9A 4RGYA 5JT1A 4KJXA 1M2GA 4LRYA 4XKJA 1QYIA 3UPDA 3W6OA 3WMXA 3QE4A 1RAEA 3P0HA 3H9EO 5ESXA 4US1R 5I47A 2Q6LA 2QF7A 2HUPA 1UJCA 4Q9HA 2LWIA 1FQJA 3IP8A 2QR5A 1A4IA 3CN9A 1QUEA 3K20A 3R5JA 1X1TA 4G5XA 5ARDA 4ZVOA 4QPCA 4WBNB 1PWYE 3GHHA 4H7IA 4I3GA 1SOWA 3EZLA 4OJTA 3D59A 3QF7A 1UT6A 3Q3JB 3JXEA 1Z13A 3QG1A 3ZG6A 4II7A 3PA6A 4COKA 1CZHA 2H08A 3ZY4A 3ZTYA 3Q3IA 2RDMA 1N8NA 4AULA 1IEVA 4RMNA 5TMDA 5FP0A 1YJXA 3DHYA 1SRYA 4ZHQF 1VMKA 1U98A 3M6AA 3DWFA 1SOVA 5KYXA 2FETA 3O9MA 4JEIA 4CS3A 2P2SA 2UVPA 1L5HA 3V4FA 4C89A 1DFHA 4BO5A 2NVWA 3Q3CA 3HGTA 2Y66A 1D1SA 1WB4A 3W2TA 2Y92A 1XRNA 4F9FA 1IIRA 1V96A 4X8MA 4PEVA 4YPVA 1L4LA 2WYVA 1TAUA 1WZNA 3V6MA 4L4ZA 3V1TC 1C9NA 3NG1A 4NULA 1WCIA 2Q1UA 2AR0A 2WT8A 3TBKA 4DCJA 3K2QA 4ZIRA 2PXXA 2FB9A 4KFTA 2PAAA 3H42B 3DE2X 4P35A 1QP0A 3OMLA 5I9LA 1A1VA 1L3IA 2YWHA 1NWCA 2YHAA 4JJEA 1C3EA 1LBIA 1OWPA 2NU8A 4LRWA 2FZWA 3SKYA 4I8IA 2M98A 4WNAA 4KLNA 1Q1GA 2GK6A 1LH0A 1W34A 2YV3A 3IP7A 5DHUA 4EH1A 4URYR 1FZTA 4B1FA 5EHXA 3W3AH 1JSCA 1SURA 3IBCA 5ESWA 5IN4A 4GWLA 3JQ8B 3TZLA 4ZVSA 3ROEA 3C0KA 4MYRA 4K6KA 3OZTA 2NT4A 1G2IA 4EATA 1Y9AA 3L0OA 4KQ9A 4E2YA 2FG5A 3B3JA 1M8PA 3L7DA 3DZHA 5IAGA 4D92A 4ZDKA 2IX3A 1UUFA 3BQNB 1H2HA 3MA0A 5JO0A 2PZGA 5AJTA 3LUAA 3TE7A 4MDYA 2NADA 2G25A 3LGXA 5AM3A 4LBYA 5AKYA 4KN8A 4B81A 1QH1A 2FZCA 2C58A 1P2DA 1ZH4A 3RABA 3F78A 4HAYA 5BPHA 1AHHA 3P9NA 2BUAA 4A91A 4FBLA 1MF7A 4DCTA 3BD9A 2P5TB 1E8NA 5KHAA 1FBNA 4OB8A 4HF7A 1ORTA 3ONWA 5EIHA 4ZV7A 3C3JA 4OJMX 1WDLA 4OYHA 1X3SA 4ZVLA 2R6CA 3ND9A 4E3ZA 2POCA 4BN5A 4NZNA 4LHSA 3C7AA 4U00A 1YZFA 1N6RA 1FRFS 1WPXA 3HZHA 2QMOA 3I9V1 4M46A 4P80A 4Q4HB 3TLEA 4E11A 4ENWA 5JFTA 221PA 5A5EA 5KYXB 3FF1A 2VK1A 3E9MA 5F21A 4KMRA 3G2HA 2PUBA 4EWLA 1SBCA 3WGLA 2WFLA 4CG0A 1NI4A 1P5RA 1YF3A 1KY5A 2KBEA 4C2TA 3KXKA 2BWJA 1CUEA 2WFZA 4R5HA 1JZSA 2JANA 3YASA 4FCWA 4TL6A 2R60A 3HK2A 1DMSA 5JBQA 1NONA 1Z5UA 3A9WA 4JT4A 5CXXA 3RVKA 3ZDFA 4BNWA 3A31A 3PZCA 3Q1KA 5KX5A 1N3YA 2GUGA 5IDXA 4EENA 1KAQA 1YQQA 2JGAA 2NO7A 1C8VB 2WIJA 2KYRA 1YD7A 3F47A 3OE4A 4HT4A 3L5OA 3RJTA 1HQCA 1UBRS 1YJ5A 3DAFA 3ELDA 1ZXLA 4FOLA 5B4UA 4HX2A 1I7DA 1SHLA 5L7TA 1O0CA 3Q0EA 4H7JA 1RKUA 2IEIA 3ZIAA 3JAKA 3OQHA 4CQJA 2O2DA 1CKEA 2XCOA 3ETEA 3OY7A 4TOIA 5TGTA 2ZINA 2Q4OA 3EDRA 3UFXB 2IZOA 1QNLA 1P80A 1NMYA 5KX5F 2WF5A 1A4XA 1YZKA 4Q02A 1QIGA 2EHDA 3RRZA 2XI4A 3TLMA 4HHEA 4NJEB 3RUXA 1HZZC 1FY2A 1NXOA 5EWLA 3ZU4A 1QH1B 4BP1A 4M0EA 3TOXA 1LW6E 1KVUA 1MFZA 2DPYA 5LLDA 2IXTA 1PFQA 4QGSA 2AEFA 4YRFA 2HXYA 2HK6A 3MXTA 1GVNB 5C8XA 5AFSA 4BZXA 4QAQA 4UCWA 1IOWA 3AGQA 2MR5A 3V7UA 1KK2A 3D54D 3WLJA 4OXNA 1OC4A 4Y98A 4C05A 3GLSA 4Q39A 2IFTA 2FLWA 2JBAB 4JODA 3D6FA 2Q49A 1UEIA 1R50A 3C5HA 3KZXA 3Q10A 4OD0A 4M9SA 1KFKB 3R7AA 4X62B 5FLXA 1IWBB 1J0AA 3NKFA 1LZKA 2BFMA 3MILA 3PEVA 1LVUA 4P7FA 4Y7DA 5IWCA 4E88A 1AN9A 4M53A 1Z4PX 4P4SB 1JZQA 2I2DA 3CH6A 2OAP1 4BB9A 1JAYA 4M9RA 4YHBA 2VXCA 2XR1A 5E4JA 1OIVA 4A27A 5F76A 4YT4A 3KOWA 4GVPA 2G9NA 2MMGA 1IMJA 4DLYA 2ZJ5A 4HNTA 5D51S 2P78A 5ALOA 3V7RA 5EKSA 4AROA 3KKMA 4MJ7A 3D8NA 4HG2A 1UK6A 4EKNB 4HWSA 2VJDA 1JDTA 2C4VA 2J3QA 4FNMA 2HDNB 1R1DA 4OAOA 5F1YA 5J4VA 1C7EA 1MJHA 1OOEA 1DKPA 1Y8CA 3VR6D 2BT4A 3AOGA 3WXBA 4TWAA 3J81k 2OBBA 3ZXUB 5CTJA 3ZQ6A 2MOKA 5DN6A 3L6RA 2P9EA 2ZAYA 4Z0PA 1EVZA 1KNQA 3VBCA 2PL3A 1JNXX 4Y9DA 5BR7A 2ZJBA 1OWOA 5EMHA 5E3IA 1HT0A 4EVRA 2ZAGA 3TAXA 3MD0A 8ADHA 1DAIA 1CX9B 3RSSA 1FFHA 1QR2A 4MV7A 5KTYA 2ZCJA 3CGWA 1U1GA 4KYVA 1LGYA 1HLGA 1EESA 4E2ZA 4YRRA 2WV7A 4QVKA 3N28A 1NLFA 1WJGA 3QP9A 3T1NA 3IAXA 5ADVA 3B1VA 5K8TA 3J81A 4OXKA 2XGTA 2AI2A 1XQYA 3DT8A 3QEMB 5DSTA 4BMDA 4C03A 1JJBA 5DW0A 5L4LA 4NV0A 4Q93A 4RK7A 2QHSA 2IZ0A 4WESB 2CBGA 4A6DA 3VPGA 4KQEA 1PDWA 3OP1A 2P7HA 4JOCA 4K6HA 4MPPA 3KDAA 3ZGNA 4BLVA 3KQHA 2RE8A 3X44A 3GZNA 3HM9A 1XO1A 3HFJA 4S1TA 4FWIB 1CG6A 1S8NA 2PLAA 3ZV4A 4L9RA 3GFSA 2UUOA 4P4SA 3HV2A 1X87A 5FLKA 5AKZA 2VAWA 1X77A 1M6HA 3DF9A 3RBXA 3QITA 4RFSB 3T1QA 2XWJI 1WXGA 2RG1A 2YJTD 3A3KA 3ZCTA 3MMSA 3DKRA 4P2BA 2HA7A 2ILVA 3W8FA 3UMSA 4NDAA 2R7KA 2FZVA 1AKMA 1U28A 3PGA1 2ZYHA 4BCDA 5BUZA 3TEGA 4BTVA 2JAWA 1R0SA 1WDKA 3QH4A 4L5IA 4LZZA 5IUKC 1T36A 2PT7A 3KZCA 3ND7A 1I3KA 1SVLA 3V1MA 3O8CA 3HMQA 1ZFNA 3FJ1A 4JLJA 4WACA 5CG2A 1IQPA 4Y1RA 2VF5X 4A8JA 2K5UA 3HHEA 1V1RA 1YK0A 5CH3A 1L4MA 4XVRA 4YBRA 2PZKA 3MTBA 3DXFA 3OLCX 1DP4A 4XFDA 2C3OA 1FDRA 3M6MD 4B7XA 4DDUA 4I4CA 1H1TA 1D2NA 3OTIA 3TEFA 3KVRA 2QE6A 4A0SA 5A0VA 4ZI7A 4BJ5A 1I6LA 4X1YB 3IPAA 4L5YA 5IVHA 1HI9A 1TD1A 3KHTA 4CMGA 4TLLB 1YTUA 2R6ZA 3LVFO 3WO1A 3ZWNA 2PX2A 3H4MA 5ALNA 4IPTA 1HYHA 1Z0FA 5D2CA 5LBTA 4EQ6A 4I7EA 1LLDA 3A25A 3OIGA 2PR7A 1W4CA 5IBPA 2QSZA 1GN9A 4YA6A 1VMIA 4HUTA 2I03A 3LKVA 3G82C 2Q1WA 4I50B 4JX9A 5BV0A 3H65A 4PAWA 4BDTA 5F73A 1X7DA 1Z34A 2J59A 5JIBA 1AE1A 4H7DA 1ZS9A 2DECA 2X0FA 3NT5A 4X7PA 1A7UA 4R7TA 2X8WA 4UEJA 4PSCA 5JTTA 1R9JA 3ON5A 3H0EA 2AUMA 1NW5A 3PUYA 3TEMA 4RA6B 1ZJ4A 2BKEA 4DSNA 4F5ZA 2O2YA 4V0SA 2Y67A 3HFRA 5A04A 4B3HA 3D4IA 4IH9A 1GCGA 3EOBI 1F60A 4V3CA 1X0XA 3DFMA 2ILTA 5LQSA 2BTEA 1HL7A 1H0RA 4GR4A 2V3CC 4I1SA 4OMUA 2FPMA 2FMUA 3V1YA 1VC2A 1ZUWA 2F3SA 1Y3IA 4GXNA 1PEDA 4K9LA 3V8EA 1ZVKA 2VH5R 4NCNA 2ZB4A 5DH9A 5FEMA 2E89A 2BD0A 2QP9X 3OPNA 4FHZA 4MS3A 5ARCA 4ZDWA 4G81A 3HS3A 4LZPA 3TDNA 5TGZA 2HEIA 3CJQA 2GXQA 1BW9A 4ATNA 1XF1A 3X1YA 2P3QA 4FB4A 2XE8A 1IPHA 3HJTA 1YUBA 4CR8A 5EJ8A 1P29A 3AQIA 4EJMA 4AO6A 3GPLA 3EXFB 3LFTA 5L51A 4BPRA 5AJUA 3C8DA 1XRQA 1JG3A 4WW0A 1IUNA 3KFXA 1XI2A 4PC3A 4R54A 3SN6A 4PGAA 1U1DA 3VYUB 3G59A 3DMRA 5DYTA 4PVDA 4NQRA 5HBGA 5AW8A 2NO4A 1AZSC 1R5BA 1SD2A 2YOFA 3KR1A 4H2UA 5H9VA 4NG4A 4ZOQI 1R8SA 1V11B 1NYRA 2OEPA 2VTEA 3CIFA 3OU7A 5G0TA 2XQKA 4FBGA 5BT9A 5HRUA 5TE9A 1IE3A 2ZI5A 1VLLA 4C0HA 4KRFA 4K40A 1R8YA 1E2LA 3W79A 4JI0B 3THXA 1QFSA 2ZS7A 3LOUA 4JLWA 4MQMA 1CQPA 1XTQA 2C2OA 2Q3DA 3JPWA 4XSHA 5HMMA 2UYGA 3FW1A 3IUNA 2XIQA 3R3VA 4BC0A 4RGBA 4B84A 2QD3A 2YXEA 1CLEA 4QECA 1P44A 3ZXYA 4URVR 3WGQA 3FOFC 4CUZA 4CQLA 2BF7A 3D31A 2BFDA 3UK6A 4B6SA 4CEHA 2Z6VA 2MWMA 2WYHA 4UULA 2DBQA 3L0PA 5AKEA 1NBME 1NUPA 2AK3A 1PJQA 4PV7A 2I6TA 3HXLA 3ZY6A 5LPNA 2UYCA 1YNSA 1R4MA 2P9CA 2GDJA 2A30A 4TV8A 4XTXA 3R5SA 3HJRA 5EE1A 3WLOA 5JS6A 1JJIA 1HDXA 2MYUA 3A9TA 1FE8A 3GGOA 3RSGA 4GFDA 1CW2B 4EKEA 5TQ0A 2C98A 2J7PD 4RXUA 3RBZA 1V16B 4G8CA 1F7UA 2PSHA 3FPGA 1L9XA 1V39A 4CLEA 4KN5A 3GLKA 1XMOB 2PV0A 2VVTA 4GPTA 1E7MA 2OZLA 3G2JA 3B9PA 4U7JA 5H3CA 2H1LA 2UXBB 3SEZA 1KS2A 3P9ZA 3GELA 4GT1A 3H1FA 1A82A 1XJCA 1BWPA 2XF8A 1CY1A 2QBYA 5C1DA 2P9GA 1EOVA 1XVIA 2KWIA 1JIUA 1XCOA 3BIWA 4I6JA 4CM9D 4BFZA 1FW8A 4NJMA 3WDMA 2ZYUX 5IVKA 4FKMA 2ERXA 2CVHA 4HDQB 3CLVA 1PTJA 2OG1A 1CC1S 4DCUA 4CMIB 4F93B 5HG0A 2WU3A 2ZR0A 2A5DA 3D0RA 2GD0A 2VBIA 2JFBA 3BWVA 1KZ1A 1VI6A 4RUKA 1V3VA 4FE3A 1U4SA 3MC1A 4TS1A 1QLJA 1ST3A 4HAWA 1P9LA 1DV2A 2Q0SA 4BTLA 2EWNA 4NEQA 3DOJA 2WMDA 1T9KA 2EZ8A 4CLOB 4CQMB 5HTOA 3RVPA 2BMFA 2BY4A 2SICE 1BNCA 4ZPJA 2VDWA 3V34A 1CVIA 1Q19A 3HO6A 3JQDA 3LL4A 4C0XA 2R4UA 4OUDA 1SUIA 4EMBA 4PNEA 3QPWA 2J6IA 2W6CX 3ZDYB 2DHRA 5L3RA 2IV3A 2AEEA 2ENUA 5G1PA 3VDMA 1Z0IA 3E9RA 5CX1A 2YFHA 2GGSA 1YL7A 1EP3B 3FSRA 1XR3A 3N8IA 4J0CA 4ZFNA 3H5TA 3UENA 4OHMA 1C7IA 1VQ1A 4UM7A 2WSIA 4CLHA 4UUPA 5ITVA 1BCSB 2A0WA 1O6FA 1U0FA 2HGSA 4FINA 3U1TA 1M2OB 4V2IA 4YMTA 3CN7A 3O0TA 2J32A 4DIOA 2ZJFA 2ZS9A 4RPJA 2ZR8A 3LUDA 4YMLA 1LTKA 4RVNA 5KIAA 2WU1A 3MD9A 4WGFA 1JLRA 3C8MA 1K7XB 1JN0A 2WP8J 4DUPA 5KEIA 4O4JB 3GJXC 4MW9A 3CEJA 3HEAA 2B99A 4A5SA 5KYTA 4OX9Y 4IJWA 4OLJA 3ZV6A 3TN7A 3HTXA 1CQJA 1XLVA 1M2EA 5IAKA 3PUZA 1CUUA 5AK5A 2HNAA 3SCZA 1REQA 3I04M 3KLOA 1BRTA 1YGBA 1E6CA 4X91A 1PR1A 3F6SA 4L9AA 1KDOA 3U6KA 1T4CB 1DCFA 1HRDA 1I1OA 1RQ2A 3FWHA 1J1IA 4AVYA 4DQKA 4DPLA 5JCPA 1Z7GA 1OH5A 4NV3A 2P62A 4A8TA 3WKCA 4CKCB 3B1JA 4CH4A 3UH0A 3PQ6A 4MKIA 1ZGAA 3JD2A 5ALPA 3WK5A 1GNQA 2WRZA 2Y1LA 3JTMA 4HYYA 2KPOA 3AOEA 3QLTA 1JEQB 4ZPXA 3E9HA 1E99A 1RQRA 3C39A 1P4JA 1RJGA 1ZO8A 2LTAA 4KWHA 4QFDA 3T7RA 4E5VA 4F3CA 2CIMA 1NNEA 4F84A 3DV9A 1IZZA 3NNNA 1E60A 1L1RA 5HM8A 1ORWA 4MLZA 4CGZA 2AYXA 1T26A 1Y89A 3ASVA 2C9OA 4K5QA 1NYLA 4WUTA 3MF4A 5FPQA 1XQ9A 3WWDA 3RS2A 4M37A 2CLDX 1F20A 1K8ZB 2BTOA 3T4PA 1BWSA 3GVCA 4AZ0B 5AVUA 1DC8A 3B9RA 4FNGA 3ZXIA 4EYOA 3WYGA 3A04A 4BX2A 1QFMA 1ELOA 1BA2A 3VGPA 1KTIA 2PQ0A 3JAWB 2YIVX 1M2WA 1JKJA 2VR1A 3SS9X 1UBSB 4ZZ0A 3UKDA 2DUNA 1GITA 4LGMA 2I9PA 1VMAA 4Z54A 1JPVA 3L7AA 3U80A 3HEBA 4DMFA 3OCVA 3USCS 3HDQA 4AJHA 4RQAA 2OC9A 5TMPA 2R1VB 2HZ7A 3WYEA 4E2FA 1TRKA 4DLNA 1N2CB 4PHFA 1VE1A 4DNPA 1G5QA 1GT6A 1RI3A 1ZMBA 2BFAA 3IJPA 3JYOA 3QOXA 5JSQA 2G5TA 3C3CA 4EG0A 2J33A 4R3NA 1NVMB 4P92A 3HG7A 1U7OA 3O8DA 4KTTE 1F12A 3K1YA 4HLUA 3K35A 1UR5A 3W0LB 1WYDA 3BIFA 2P9QA 2WVHA 4Q7KA 4PRKA 2ONZA 3PI6A 4BE4A 4RTMA 1BMFA 1SR8A 1EXMA 4FQ8A 4PYKA 1M7HA 2BUBA 5IAEA 3EDYA 1EHYA 1KY3A 1XMJA 1EBFA 3P4XA 2FWJA 1WTAA 2WB4A 3B6EA 4A8JB 4CMHA 4JAVC 1WXHA 3FPJA 4KO2S 3CRVA 1WVIA 3EC1A 3DMYA 5E6UA 3NWJA 4PLFA 2GEDA 4UFNA 3HNPA 2NV2B 3G13A 1PK9A 3PQ5A 4P3OA 2WFMA 5IZCA 3PE3A 2R5NA 1Z4QA 5E4FA 3MJDA 1M0WA 3HBMA 4WH0A 2CJWA 2GNAA 2X19A 4EKGA 3IOYA 2G8LA 3KDSE 3IBGA 5I9IA 1ECFA 3CR8A 2I4NA 2I7CA 2F1HA 2UYOA 3U4QB 5CAEA 3O7MA 3NDRA 2HWKA 2WK1A 2HSWA 4TQ9A 5FAXA 5K3OA 4GG1A 4ZVUA 1DC5A 3S6JA 3WIBA 3UK7A 1YA6A 1R74A 2UVPB 3AHIA 1VCOA 5FOXA 3LY5A 2OZLB 3E27A 4QU8A 3ZS8A 5JNTA 1DQZA 1J4AA 4X44A 4R8RA 1A9TA 4K2AA 3T3HA 3ER8A 2NN3C 1GTVA 1CP3A 4U02A 4M1EA 1N9WA 1L1FA 2R6AA 2CZCA 4KXMA 3VYWA 3S40A 4EKIA 4HUQB 4Z3OA 4ASUA 1N2CE 1CQWA 1N5MA 3BRSA 3JASA 4Q12A 2UVQA 1JLHA 4YR9A 1C4XA 3GLUA 1GY8A 3PFWO 4LVOA 2JFVA 1SCUB 4B76A 3DS8A 2ZGVA 4MUXA 3JVEA 4E03A 2XGSA 1WXWA 5LYJB 4HDCA 5C34B 3R4CA 4D81A 1DIRA 1FDSA 4J07A 5ERGB 4A9AA 2C5LA 4G0NA 4PBSA 2IZ5A 1BKSB 2B1RA 2Y0EA 4UPVA 1F2UA 2GWRA 3GLQA 1YZTA 3VQWA 4XVHA 3W5IA 4TS4A 4D4HA 5CJPA 4H2XA 3L01A 5DDIP 2D0PB 3NP9A 4ZREA 1JSZA 4ALKA 2WMOB 1ORDA 1XSEA 3R9WA 5ITZB 3WRXA 2MINA 1VHDA 3PDWA 3GD7A 2PBLA 2ZE8A 4MULA 3R3XA 2OFXA 3I5MA 1ZINA 3COZA 3NCTA 3CBGA 5TRTA 2J6HA 2FPIB 2E87A 3ITEA 4OHVA 2P2LA 3U09A 4OOFA 1HFKA 3EYWA 3O31A 2I4RA 5JS7A 2YICA 5AUPB 3ORQA 4Y6RA 1G20B 5DASA 1Y8RA 1SNYA 4TKMA 2IH2A 3GF4A 2WWHA 3NVMB 4KOAA 2Z98A 5JW6A 2PH1A 3COWA 2WJYA 3RTBA 1UDRA 4U5QA 3V8MA 1OI7A 5TIIA 1M6EX 2Q9BA 3CZCA 3K31A 1K4KA 1FFXA 1YR6A 1UDBA 3V9AA 3VV3A 2GDZA 4DEYA 3WWPA 3A8TA 3LOPA 1M75A 4MR7A 2PA3A 4ZQEA 3ZPXA 5KVAA 3PNKA 3LSTA 1P4HA 4PHGA 5KJ6A 1NHWA 3N2ZB 4ZV9A 1NP3A 2VYVA 3PHBE 4HDSB 3BTSA 3VPCA 3VR6A 4F6RA 5IM4F 1H6BA 1X7XB 3WAGA 2DKOA 2RGUA 2YW9A 4I55A 3ZK8A 5BN1A 3FHTA 3ECSA 1TOAA 1QRDA 1WW2A 3GXBA 3TX2A 2A9RA 3KJZA 1SWWA 2GF0A 2JVIA 1YRHA 6YASA 2RHDA 4R1MA 1OYOA 5A3VA 4RVDA 5LLSA 5L3SB 1T6XA 1C14A 4W6ZA 3V32A 3W9SA 3L46A 1ESZA 1V47A 1WUHS 2B9EA 3BZUA 3HDVA 3MAAC 4HWKA 3T1VA 3TRJA 2BFEA 3GFBA 2DR2A 3F6EX 4UU8A 2V6IA 1Z4NA 2ZR7A 4DDHA 1RI1A 4E21A 2QA5A 1ZNWA 4D79A 1RKQA 1UPTA 2ODTX 2Q8PA 3P97A 4V1CA 4HGPA 4H2VA 2C9YA 5C9ZA 4WKPA 5IHPA 5K8IA 1AUPA 2XADA 2ZYAA 2GN4A 5KKAA 3S8EA 4BX3A 5CM8B 3NU1A 2FFAA 1O4VA 1E92A 1LPNA 5JO9A 2QYOA 3VZDA 1IHYA 1IMOA 3D6JA 3ICVA 3L8FA 5CX4A 2XNCA 3QPCA 5FUMA 2G80A 1AKUA 2BBWA 1RRPA 1JFVA 1ZXBA 3ZE9A 3E82A 3AFOA 2V4ZA 1B7YA 1XWIA 1Z9BA 4Z86A 1Y42X 4AUNA 3T1HB 3QE9Y 1L7DA 4H6XA 1CE8B 2IHNA 2I6UA 1Z22A 4KAAA 4OJNA 5JAIA 5JNSA 3PC6A 1SKQA 4BHTA 1WXQA 2F59A 4P7BA 3T94A 3PGJA 4RETA 3SXUA 3WL6A 4CEJA 4QG7A 4IIFA 2P9HA 2I76A 4EO7A 3D4BA 3FZEA 2BI7A 3H5IA 2HF8A 3WFJA 1B7GO 4IRUB 3GJYA 3KVOA 1SHKA 3BVPA 1ZSVA 3CNBA 3WKEA 3M9WA 1N6LA 1BVRA 4RPGA 3I6BA 4MO9A 4U4AA 2JFYA 3O5AA 4IJ6A 3WK7A 1AF7A 3LNTA 4LX0A 1G5TA 2WF6A 3UH1A 1SB9A 3VISA 4DANA 1QVAA 4FMPA 1TW3A 4KE9A 3EGXB 4M3NA 3GEMA 1TIKA 2B0CA 1T1JA 1NDUA 3NETA 1ZH6A 3Q2IA 5T64A 3SC2B 3AVXA 4F85A 2H18A 2ZSAA 3C3BA 4XJSA 4J1TA 4DBLE 5TVKA 5IUNC 3TSAA 4ETMA 1Y1SA 3WL5A 4OV6B 3HCEA 3PEEA 5KJFA 2R62A 4U7FA 1BWQA 5CDSA 2HO4A 3EXHB 1U28C 4ZHSA 2F8SA 3KT8A 3TNDA 4F4FA 5A4IS 3HUFA 2IH4A 3R77A 2QSUA 5AKHA 3ZE1B 1NG1A 2H85A 2QTAA 2NTEA 3DHVA 4Y1EA 1BS2A 3SIWA 1ZBDA 2O0LA 1YGPA 3JAWA 4P3XA 4Y0AA 5GAJA 3DO8A 1J2JA 1M34A 4KLAA 4BEJA 4UM9B 1EVKA 3SQMA 1B00A 2RI1A 2V97A 4W63A 3GLGA 4HNAA 4JLOA 1E9RA 4G1MB 3QBDA 5TXGA 1KY2A 2O8NA 2TS1A 4WWHA 2I3BA 4EFNA 3ZD7A 4XTWA 4MTCA 4N0EA 4PRYA 5SV2A 1XD8A 3WQBA 2JGDB 5G53C 4BFCA 4PLTA 4J75A 3PKIA 4G1EB 1T8UA 4AY2A 1FDWA 4RMHA 1VOTA 4UM8B 1QAMA 4DJAA 5H4GA 1FDUA 3ZS9A 3J7AC 3L4EA 3REUA 3TO5A 1U0JA 1Z5OA 3L0CA 3W1WA 3FJYA 3GI1A 2DQ3A 2FCRA 3NANA 3SZ3A 3M6XA 2C2YA 2HWUA 1QNFA 1X2BA 1UXHA 2DTDA 2PH5A 4FR0A 2E4WA 4EUHA 2IY8A 1SVNA 2GAAA 3IHWA 1J70A 1DKQA 2X40A 1UKZA 3ERRA 2CHQA 5G0SA 3T35A 4D02A 4CEIA 4ZI3A 3L7JA 1ZJ5A 3QKRA 1I6MA 4FSXA 4EL5A 2ACKA 1JDPA 2OV8A 2PQ6A 4N6OA 4D5EA 2M6RA 4EFLA 2ZVJA 1O1YA 3FNIA 4JS0A 2XB8A 1SXJC 5IC6A 1K06A 3WL7A 4LWOA 1ZC4A 2YTZA 3KWFA 2XKAA 2QL6A 3FHOA 3UJ7A 2DPHA 4HNHA 1E1CB 2IUTA 2CJXA 1G8GA 3RW9A 2WAXA 4J3FA 5JMPA 2XCSB 1OKKA 1SXQA 3BTVA 2ZDGA 3ENVA 2FMXA 3KJEA 1CR4A 5FV7A 3L0SA 1FDTA 2ZSBA 4L9WA 3UNXA 4JSYA 2PL9A 3MB5A 3AVPA 4ZOLB 4Y30A 1U3VA 2CXUA 3B2EA 2QMQA 2JGEA 1M5TA 1P7CA 2XBUA 1Y4UA 4KX5A 3FF4A 2DZDA 4LTMA 5F7JA 1M6NA 3SHTA 4DFDA 3E3AA 4J8PA 3N0WA 5J4KA 2OILA 2QD2A 2Z2KA 3I9V6 1U63A 4MCIA 2NPFA 2WM8A 5DX0A 1TJPB 4QGAA 1EJ2A 1RFGE 4NARA 3VC3A 5HZHA 2CLOB 3IC5A 2XCRB 3CZQA 5ALFA 4DAEA 2IXAA 2O0HA 4RDHA 4C5AA 1J23A 3EWNA 3O9VA 3B1KA 1KPHA 4UVDA 3K8QA 2HK8A 3JASB 1BCRB 2CXXA 4B6QA 2RCYA 3UOAB 3OQPA 4NU0A 3KT0A 4FW9A 2VOJA 2BEUA 1HT1E 4G0MA 1QCYA 4EVIA 1I7SB 3HZZA 6ABPA 3CINA 2HQBA 2QT0A 1FLVA 5EJIA 2I80A 3ICQB 4QTUB 1QOPB 3OJWA 1KMHB 2C7GA 2D1FA 1GGFA 3CURA 3B3QA 4P31A 1R8XA 4P84A 2PO5A 4G67A 1G5FA 4FOTA 2Q1YA 4PAMA 4RSHA 4K28A 1ZK4A 5F35A 2PLNA 2V1XA 2A6PA 3ANXA 3RC8A 1Z33A 1ZU5A 3K0FB 3BWEA 1W5AA 5DSXA 4HYTA 3SC3A 4LHYA 3IAHA 3JQAB 4NNJA 1VMDA 3FH0A 3UHOA 1VKRA 4TKUB 4GOXA 3FPBA 1WPYA 1YZUA 2MSKA 5F2KA 1K89A 1U5BB 2QRKA 4BJ3A 4U6NA 4P0QB 5DBHX 3BBLA 3WB2A 2IEAA 5DYNA 2PXAA 5J63A 1L3BA 5ALGA 2HU8A 4WZBE 2ZULA 1Z4IA 1QRUA 4UP8A 3DYIA 1X8JA 1PX0A 3PWTA 3WMWA 3X1JA 1KJJA 5K0TA 3ZCSA 1KQPA 1WPGA 3L1AA 4WT7A 5G3YA 5K2OA 1L5MA 2O2HA 3JAMA 3LX4A 1RS0A 3IDZA 4JEHA 4HLUC 3ADDA 5C7OO 2NM0A 2YUIA 5FWDA 3SKVA 1U1EA 5B5SA 1IN1A 3C7DB 1LK5A 3FWPA 4YRZA 3PQ7A 1OUMA 4OFWA 3DL7A 4J7CA 3G8BA 1V8DA 3A06A 4JKOA 3F2VA 5LQDA 4LJAA 1FVOA 4I9UA 3QJGA 2J0SA 1C1XB 1R0YA 2PJUA 2PWZA 1JFLA 1P61B 2CHEA 1T1EA 1DEHA 2PJZA 2PKRA 2NO1A 5HSGA 1JJAA 4X8LA 3P8TA 1GPBA 2O8EA 1GNSA 4CU2A 2A9PA 3DE7X 1YAJA 3DWGA 3P5SA 4HR7A 4JDUA 4W1SA 5F5NA 3F90A 1V43A 4KXLA 4KR7A 3OWHA 3JARA 4QZVA 4RWEA 8ABPA 3HMKA 1PQYA 4TT3D 4C2AA 2ZRPA 4QBKA 4IOLA 3LWDA 3AF5A 5EGSA 4ZVKA 5FOQA 3SS8A 5JYCA 2PUVA 2H65A 4QDUA 1XOIA 3KPWA 1GPNA 4YDQA 1XVLA 4RHTA 4JQYA 4PX3A 4TKZA 3H16A 1R4NA 2YJ3A 2R751 5AVKA 1T6ZA 2JLAA 3FTPA 4NI5A 3WGOA 4A0HA 1P1FA 2I4TA 4RKEA 1GWNA 3GJZA 1SA0A 4B2YA 4LYAA 3GYBA 1E1DA 4ILKA 1S4QA 1SOUA 1KDVA 1M6VB 1QVVA 4I9GA 3RC2A 5B55A 3A5ZA 1S9HA 3RHZA 3V4RA 5EHIA 5T57A 4W1PA 5DBEX 1MN6A 1X94A 2HIMA 2Q3JA 4N7MA 3UAWA 2B37A 2H1FA 3GMIA 5BQPA 3ZWBA 1U5BA 5CB8A 1WS6A 2QIPA 3KYIB 3HUDA 4K05A 4D9CA 2CYBA 4HD8A 2AXPA 4HVAA 2VP3A 3FDZB 3KX2A 3PS9A 4Q00A 2GWHA 4Q3AA 4QGGA 5IW8A 4DB2A 1YS4A 2W2OA 1OXMA 3R8XA 3N7UA 2NZ8A 1GRCA 1YVRA 4HPJB 3I2HA 4FU0A 4N5IX 4ZO6A 3UHJA 6REQA 4O1HA 4JYCA 1EDOA 1XA3A 2P91A 3HP1A 2FW7A 4YRJA 3RRXA 5HCUA 1MX3A 4O4LF 4DILA 1OFIA 5F77A 3VDXA 3QRWA 1Z3IX 3RYIB 1TVEA 5CEEA 2IS1A 4FFBA 3UM9A 2P35A 2UUCB 2VK4A 4JA2A 4X6YA 5G02A 3KQYA 5EIEA 3FLAA 4ZCMA 5KTTA 1IVSA 4ZA2A 1QQ5A 4BB0A 2CV0A 2VAVA 3JSXA 5TGDA 3W7BA 1KIFA 1ESNA 1E6LA 3PFGA 2PZBA 2RK6A 3P9CA 1U8XX 4G1VA 4LNUA 2BZ1A 3IQIX 5AJZA 1ABFA 4ABYA 5BW5A 1W29A 4L8GA 4EPYA 5CHEA 1S2GA 4N47A 3U2QA 4PG8A 5BSHA 5EJ5A 2O0KA 4BNDA 4EYKA 2FZGA 2VN8A 3LA6A 3AYXB 1DUSA 3T9BA 2DQKA 2XNSA 2Q1SA 4IO0A 4ISBA 3AT1A 3T5TA 5B12A 2E41A 1KJ9A 3LX8A 1L7NA 5HJ5A 1T24A 2JLCA 4K46A 4ITVA 1VJDA 1C3OA 2IKQA 3FNBA 3X1MA 3OCYA 1CY0A 2WTUA 4MAFA 1A7KA 1T10A 2BUCA 1TLTA 3CZAA 3E9EA 4GR9A 1E4YA 3S99A 1BE0A 1UWVA 3X1WA 1UAYA 4J49A 3FGPA 4DCVA 5JECA 1QRSA 2YZGA 5J43A 5C37A 5A1JA 2LZ0A 1JXOA 4XPIB 3KQQA 4K8OA 1OMOA 4KR3A 5BRJA 1VXRA 1V5GA 4H0NA 3AF4A 1NMEA 2Z8YA 1E1QA 2DFDA 5JJIA 2G28A 3VQTA 1BMDA 1TL7C 5BN3B 2IYEA 1GA4A 2C2GA 1KO8A 4ZU1X 5HX7A 4WBSA 2I4OA 1NQTA 3NJRA 5TR9A 1BMFD 3DJYA 4D4IA 3NVKI 2GAFA 2JCGA 2W6NA 4PZDA 4V1CI 1HLFA 2WBLC 4OXRA 621PA 4ARIA 3OA0A 1P45A 5T67A 1A8HA 3FNGA 4GP6A 4JGIA 4YO7A 4TYWA 2NQ8A 1EQUA 4LOKA 4U5XA 1FC0A 2AQHA 7MDHA 4ZOAA 1G2OA 4FOPA 2JDIA 1Z39A 3C7KA 3R09A 4JBWA 2W2XA 1RHRA 1T0JB 4NS4A 1JHRA 3ZTTA 1E66A 2G0AA 2JFFA 2IEGA 1OFTA 2WKRA 4FDMA 4FP9A 4NBLA 2FK7A 4ZI5A 1Q0PA 4XE5A 4K6CA 3VVLA 1K5GA 3FLEA 2E1PA 3RT7A 1WSAA 1XCPA 2RAVA 1CNFA 2F3RA 2I6QA 3BMXA 3BCUA 4NZ9A 3EFOA 4PCVA 5A6SA 5AVTA 3GAZA 3WL8A 1TJYA 4LXXA 3AERB 5KUTA 3EPPA 2NU9B 1LDNA 4WZBA 5KTNA 2VF8A 1ADYA 3SS7X 1VSQA 2IXGA 2ZYTX 3IMGA 1KVSA 2Z30A 2H11A 1Q7RA 1LDEA 1WKVA 2UUAB 4DLBA 2AMJA 1U9CA 4ZOLA 4DMLA 5KSZA 4FLMA 2IYTA 4IBOA 2HMUA 1L6RA 1N0UA 3MG9A 1FTSA 3Q1LA 1WUJS 3PCXA 5F4BA 1FFGA 3AHHA 3C5EA 5IJ9A 3ZBUA 5A9TA 4JQZA 2WM2A 3OM9A 3MGKA 1ONNA 4MINA 4F4CA 1IHUA 2AG1A 1F1JA 3H5AA 3U6BA 3JQFA 1RWPA 4J0GA 5ESRA 5F1PA 1PJLA 2XB6A 4XWWA 2RHBA 2ZUWA 3VZCA 2N9UA 1QTQA 3PKZA 3D4LA 5CFOA 3SE0A 3E6AA 1U81A 2R11A 1NVFA 4NE7A 3CONA 3RQIA 4F12A 1FNBA 3H5OA 4NBNA 5EP1A 5H1YA 3DTVA 1IY1A 3BD8A 5LDDC 1YOVA 2OSVA 1BIFA 3GGDA 3IQXA 4JXJA 4LSZA 1MOQA 3BGWA 1AHNA 1I3OA 1OROA 2PRYA 2RHOA 3MWGA 5BOVA 3TRIA 4E1AA 3RNOA 4RCVA 1N34B 4E6PA 3QLVC 2B4RO 3EZ9A 5IAAA 2ASVA 4FMCF 4HUJA 1N78A 2G5CA 1F9AA 4JNCA 4R9VA 2HJRA 4C4XA 2OGTA 4XB6B 2PU5A 1JXMA 1YS9A 4DKXA 3EUFA 4ZU6X 1TT5A 4RK0A 2VJMA 3ED5A 5KKNB 4DLXA 3QELB 3LWBA 4L74A 5I48A 1G66A 1OVMA 1PWZA 3P2YA 1EJ0A 3TSWA 1I80A 1Y9ZA 2GKGA 3KCQA 3E4CA 2AKWA 2GPYA 4EUNA 1GL3A 4F4UA 4ZRMA 4X63A 1R5JA 1T5IA 1K5PA 1QZZA 2QT9A 1GGMA 3NVDA 4WOKA 3OZCA 3FPHA 1HG1A 3LGSA 3AERA 4IG9A 2NMVA 3E18A 3H1GA 1UFOA 5TQJA 1FFEA 4AMUA 4YCUA 5KSPA 2CN1A 2BI4A 3I9KA 5JDCA 4OP1A 3TRDA 4HP8A 3AIOA 2Q27A 3AL3A 4Y1RB 2AN5A 4ND3A 1MO6A 1GFWA 2QE7A 2W6QA 3O3OB 4GMXA 4PZPA 5THXA 2RI0A 2PYDA 4MA4A 2X86A 5ELMA 3PCTA 1Q83A 3B6ZA 1X55A 4WMLA 2X0EA 4G89A 3UG7A 4A36A 4IH1A 5DM0A 5BNIA 4EI2A 1TAGA 1X1AA 3M33A 4GDFA 1E2NA 2IUFA 3SQOA 4CIBA 3HKDB 4Z9AA 4X95A 2Y0CA 1Q92A 1QR6A 3BE8A 5H81A 1JEEA 1EK1A 3NEYA 3ZE7A 2W6OA 3KAQA 3R5TA 1LQUA 2RK4A 4Q03A 1RP1A 2GKSA 2YMLA 3EIOA 3L7YA 2D8AA 5JC8A 1NQAO 2FCAA 4L15A 3D6HA 3WGIA 2PJDA 2AXNA 2ID9A 4CCWA 2P1ZA 4C07A 3QO8A 3GGCA 3B52X 1KMHA 3D2BA 3Q7QA 1CVRA 2BVNA 2FRDC 2LW7A 4GXTA 3ADBA 3U9