1GGMA

Glycyl-trna synthetase from thermus thermophilus complexed with glycyl-adenylate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
442
structure length
442
Chain Sequence
b'AASSLDELVALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAWWRRNVYERDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNAKARYWTPPRYFNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNVLDATSRKLGFGIAQIGKAFRNEITPRNFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSRENLVPYQQPPESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVAVIPLVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKDGTTRLKDTVTVRDRDTMEQIRLHVDELEGFLRERLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine--tRNA ligase
molecule tags Ligase
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
publication title Glycyl-tRNA synthetase uses a negatively charged pit for specific recognition and activation of glycine.
pubmed doi rcsb
total genus 115
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 1999-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1ggmA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 1ggmA02
4H2WA 2ODRD 2DU7A 3NEMA 3RL6A 4WJ3M 1EFWA 1QE0A 3RF1A 4YCWA 2EJ9A 1EQRA 1PYSA 2ZZGA 3L2ZA 4YPFA 4TQDA 1B70A 3L4GB 3TEHB 3M4QA 1WPYA 2ZR3A 1YB3A 1L0WA 5K1PA 4H2TA 5HGQA 1YFTA 4RQFA 1GGMA 1WQ7A 4G84A 4UP9A 2ZNJA 4XTXA 1QF6A 2QHTA 2EAYA 3REXA 4YRIA 4YP0A 1H4TA 4CH5A 3LC0A 4OLFA 1G51A 2E64A 4YRKA 3A31A 4YCVA 4HWPA 2ZTGA 4E51A 4TVWA 2DZCA 2PMEA 1IL2A 2AMCA 2CJAA 3M4PA 4ZTUB 3I7FA 5ELNA 2ARSA 2DXUA 4J15A 5K1XA 1BIAA 4UP8A 2DZ9A 4P74C 2AMCB 1WNLA 1N9WA 2QHVA 2FYKA 2ZCEA 2XTIA 2DEQA 1WU7A 4LNSA 3V8KA 3W3SA 1USYC 1G5HA 4TVAB 4EO4A 3MF1A 3RACA 3ERRA 1X2GA 2ARUA 3A74A 4H2VA 1BBUA 2J3MA 1HXDA 2RHQA 3ICAA 3RKYA 1WYDA 4H2YA 4YRFA 2Q5IA 4TQFA 1ATIA 1J5WA 4Q6GA 4XU3A 1B70B 4P74A 3E9HA 1PYSB 4K88A 1E24A 1H4SA 4P73C 3HXVA 3E9IA 4TWAA 3QNEA 4UP7A 3VQYA 2E65A 5C53B 3DSQA 5E3IA 4CS2A 5KNNA 2XGTA 3IKLA 4XTYA 4KR3A 2ZINA 1LYLA 2AKWB 2EJGA 4HWTA 2DQ0A 4HVCA 4K86A 1ASYA 5ELOA 4P72C 4P75C 3V7CA 1ADYA 3NETA 4HWSA 2DDZA 1X56A 2ZIOA 4DQ2A 1E1TA 4YREA 2ZR2A 11ASA 4YCUA 3HFZA 1JJCB 4EX5A 3MF2A 3RIRA 3PCOB 3UH0A 3BJUA 1YFSA 4HWOA 1H4QA 2RHQB 1NJ5A 1KMMA 4YRRA 2J3LA 3HXWA 4P71C 2ZGWA 3HXUA 3VQWA 4UPAA 2EWNA 4O2DA 4TVAA 1BIBA 2ZT7A 2P0LA 4ZTZB 3A5YA 4HA8A 4HWRA 3HY1A 4XEMA 2P5IA 1NYRA 3VBBA 1SETA 1YGBA 3G1ZA 1NYQA 4XU1A 4P75A 3QO5A 4XTZA 3LSQA 12ASA 1B76A 1EIYA 2Q7HA 2EJFA 2DTHA 1WQWA 3BFMA 2PMFA 4G85A 4P3PA 1KMNA 1EIYB 1ASZA 2DVEA 3PZCA 3HXZA 3A7AA 2Q5HA 1VQZA 3UFGA 4P71A 4K87A 4YYEA 3A7RA 3HXYA 4KQEA 2E41A 3LSSA 1HC7A 4XTWA 3IALA 4P73A 3WQZA 1NJ8A 3QTCA 4CH6A 4CH4A 3VQVA 2QHUA 4RMFA 3R07A 1B7YA 1X01A 3P8VA 1EVLA 2Q7GA 5C52B 3NELA 2E10A 2G4CA 2DU5A 2C7IA 4P72A 2ZZEA 1E22A 1C0AA 4YROA 3P8TA 4CH3A 3PCOA 3IKMB 3V7RA 1NJ6A 1JJCA 3HFVA 2ZNIA 1EOVA 2E1HA 3V8LA 3VQXA 3HRIA 4CS3A 4XU2A 1BBWA 4YRTA 1ADJA 4P3NA 2I4OA 2ALYA 4TVYA 4RQEA 2IY5A 2ZIMA 1EVKA 1USYA 3V7SA 1X55A 4YDQA 1SERA 3KFUA 2AKWA 3CMQA 3NENA 4PHCA 4RDXA 4PG3A 1WLEA 4WJ4A 2CIMA 2I4MA 4NCXA 2E5AA 4WI1A 4H2XB 4BW9A 4CS4A 2HNIA 4XTVA 4YRJA 2DKGA 1B7YB 4DPGA 4BWAA 3REUA 2ZXFA 3L1AA 4WF2A 3QO8A 3EFRA 1HTTA 2DTIA 1NNHA 4X5OA 4OP0A 2LW7A 1X54A 2E3CA 4YRPA 2ODRC 4XU0A 1B8AA 1SESA 3A32A 1Z7MA 4YRGA 4YRQA 3TEGA 2RHSB 1E1OA 3HRKA 1SRYA 3A5ZA 1YFRA 3IG2A 1FYFA 2DQ3A 3OD1A 2CGHA 1RIQA 2ZT5A 5C51B 1H4VB 3RUXA 2ARTA 1X2HA 4AH6A 5F5WA 4YRMA 1Z7NA 4ZIBA 2I4LA 3RKWA 2DXTA 3P8YA 3RKXA 1NJ1A 2CJ9A 4H02A 4KR2A 4H2SA 4Q15A 4YRLA 2DJZA 3UGQA 2I4NA 2ZT6A 1NJ2A 2RHSA 4L87A 1W66A 1V95A 3UGTA 2C8MA 1G5IA 4XTUA 3EFSA 2DTOA 4TTVA 2CJBA 3FJPA 4XEOA 3MEYA 1KOGA 2EL9A 2IY5B 2ZT8A 2ALYB 3TUPA 3RGLA 3QO7A 3HFZB 2Q7EA 3HTZA 3L4GA 3TEHA 4YRNA 3A7UA 3HXXA 2QHSA 4H2XA 4H2UA 3HY0A 4YRSA 2ZZFA 4YRCA 4P3OA 3V8JA
chains in the Genus database with same CATH superfamily
3W8FA 1N2CA 1SBHA 4OA8A 5DX0A 4MVCA 5A0FA 3S70A 4EGSA 5JH7B 4L78A 5DGTA 3VKFA 4D0GA 3EGDA 4KKVA 3BHJA 1H69A 2IY9A 4AFNA 2JLYA 4WKBA 4JFRA 1T0JB 3PHBE 1XZLA 4N7MA 3OIFA 1TKRA 5DFAA 4IQFA 4WIAA 5L51A 4QRHA 2XNDD 3IH5A 1QHEA 4OI2A 4E07A 1LQTA 3Q5DA 1GAJA 2KQUA 1YL6A 1ZFNA 2RBKA 2PIDA 3H8VA 4KNYA 2DP4E 3W2GA 2R5WA 1TFUA 4QTYA 1OIWA 3AI7A 3QV2A 1U6JA 4PLCA 2V55B 3ZZ1A 5H59A 2VDWB 2V3CC 3D6JA 3M4QA 1IZ7A 1EM6A 1Q0PA 1SUBA 4EG7A 5BR8B 3E03A 4OLBA 2VPPA 1V5FA 2QSYA 1GPWB 1QCZA 3I09A 3K92A 4D9GA 3GRFA 4W5WA 5TIIA 3T9AA 1AS3A 2YWBA 5LOVF 4RTOA 2PX0A 1TGVA 2Z3WA 2RGNA 3L05A 3MRVA 2VP4A 3IEXA 3L6OO 2ZJ5A 4PNPA 3ZI0A 3ZV6A 1F8FA 4EVQA 2OCDA 4GU5A 5JNSA 3P4YA 2HRBA 2WSIA 3TTXA 4I4TB 1XYYA 2Q49A 3A1UA 3DL4A 1IM5A 3PSHA 5AVQA 5JATA 2AXNA 3FRJA 2I7VA 4KE6A 2V7QA 2ZR0A 2B21A 1JHPA 1DX6A 1AF4A 2PBZA 5LBTA 3DYBA 4GX0A 5ES3A 1N4AA 4G09A 3RVQA 3HKBA 4BNDA 1S1CA 1VCNA 4J1NA 3O9VA 1I1QB 1YA6A 5E4YA 4AY5A 5I3CA 2XADA 2FMKA 4GZ3A 2A3RA 2DC1A 2CZCA 5FO0A 3DLPX 2I3ZA 3LKDA 1TPZA 1V1MB 5HOQA 2VPTA 1XHFA 3ITDA 1G51A 4OKNA 1JFFA 4AKSA 3BFJA 2E64A 3ZQJA 4I50F 2FMTA 1EDEA 5BQ3A 1BDBA 3HA5A 3H8JA 4OHXA 1MX3A 3CUUA 3W77A 3ZCQA 5AESA 4FONA 4RD6A 3UV6A 2M1XA 1NYTA 3O74A 2RGGA 4R81A 2VHQA 3FB4A 1RWVA 2DHDA 4N40A 4D9EA 4CCYA 1R6BX 4Y9RA 5H82A 1TGYA 3UEOA 3VZSA 4CLEA 2JHCA 3OY2A 3M6IA 2Q7XA 4ASUD 2NSHA 2I99A 3IMFA 4H59A 2F4NA 5L7TA 3CVVA 2VBGA 3BN3A 3GT0A 5J4VA 3AT1A 3TR5A 3W2TA 4X7RA 4K1XA 4RGYA 1G8KA 4NCAA 2Y2VA 3BQ9A 2G7MC 2KWIA 5TF0A 4C43A 1R5JA 4RLHA 3CMMA 5GAJA 1O6BA 4DLKA 3R3YA 3E9YA 1W5TA 4RH0A 3WLKX 5MDHA 4DUGD 4FOSA 2XUIA 3AEKA 1I4WA 5F3RA 1CPYA 1X2BA 3FDFA 5CVCA 5K3DA 5BRAA 3DPSA 4AMBA 1E6MA 1VE1A 2M32A 3R9KA 4DCGA 5HPYB 2QJTA 3EGEA 2OGUA 1ESNA 1RQPA 3AP1A 3M4XA 4G01B 4KB5A 1P2SA 1Y6FA 1PVVA 3HKBB 1N5JA 4NQZA 1ISSA 1OGJA 3GT4A 4TLLB 4S3MA 2ZI3A 3SXPA 3TNDA 3TMYA 4TL8A 3UMMA 4KWCA 2W58A 4NF2A 1OUMA 2R9VA 2AA3A 4I4TA 2IW3A 4CT4B 5EQTA 5G2OA 3PYXA 4C0AC 2JLUA 3QE9Y 2RHQA 4B74A 5AVZA 1Z6PA 3PHHA 1IY0A 2O14A 1MC1A 2BRUA 2J59A 2VNHA 1J06A 2PKRA 1AU9A 2QL6A 3JQGA 3OEHD 2ZDQA 4Z3DA 4UTNA 1AO3A 1QS0A 3C3MA 3I76A 2OVFA 5AHKA 1PJ8A 3A36A 5H4GA 1BVRA 1JKMA 1JT2A 1UQUA 1Z0ZA 3VR6D 1J5WA 1KHTA 3GJ5A 5E1OA 1WDTA 1PDWA 4AJ2A 1PL8A 4NLLA 2J6BA 3FSRA 2TSYB 4YJDA 3WWEA 2O3TA 4LDRA 1WMEA 2CNBA 2VTKA 4QODA 3NQ41 1XX6A 4IDPA 1N2CE 3LG2A 3NOXA 5HUQA 4J7XA 4A16A 5KTSA 5K3FB 3G7SA 1KEVA 2NXEA 2ZJYA 4LVUA 1IQUA 4PLZA 4PS1A 4YJ3B 3PRYA 3JZAA 4KI7A 2XUZA 3ETDA 4QA9A 3SVLA 3EUAA 3E27A 3MS2A 2GFQA 2Q3FA 2OFFA 2MYNA 2DHRA 3CX7A 3VOSA 1EWYA 3ZE0B 3AUXA 2DQ4A 4E3WA 3IE2A 4F5ZA 5AOBA 5C3MA 2GYVA 1JEJA 1NFRA 2DCMA 4DOMA 3CQ9A 5E38A 4AD8A 3CNEA 1SHKA 3L9XA 4Q4HA 1DBWA 1O1YA 3TOCA 4M6WA 5LSAA 1R9MA 4MOWA 5J2TB 1P5ZB 3GWGA 1QX4A 1TB4A 2VHTA 3OIWA 3PQ3A 4ROSA 4DEVA 3RBZA 4NG4A 4X6YA 5F12A 1RYNA 1ZMTA 2EQ5A 2CFCA 1FP2A 4FR0A 3UT5B 2I29A 2WV7A 2AD1A 3LBFA 3LK7A 4D5EA 1XGKA 5KNCD 2DDZA 5KPDA 1ESCA 4AP6A 5DIZA 5I9TA 2G28A 4HVAA 1BAPA 5FBLB 4C1BA 4S05A 3L0IB 2O8CA 1KH1A 1PWXA 3H3JA 1RWBA 2UVQA 4DG9A 2IS2A 3ZYCA 3WA6A 1M6WA 3V2UA 2Q3MA 1OE0A 4RZQA 4IF6A 5AHWA 4EPVA 1FVOA 3T7JA 2DUNA 4EPTA 3VNSA 4V1CB 3B2EA 1F2TB 7REQA 3ZDEA 4FYPA 4JJGA 2QR5A 4Y0NA 3PCOB 2FP3A 1B3RA 2WJAA 2EBUA 2PD6A 4PSCA 1H4QA 1VJ5A 1LH0A 1R16A 1HH4A 1ZUNA 2FFHA 2WJ6A 3HZRA 1HLDA 1R3UA 1NJ5A 5JVDA 2VR1A 5KDOA 2YY6A 2FDCA 1WPXA 1WBJB 3MGAA 4EJMA 2G70A 3C7DB 4P71C 3EVGA 1E7RA 3TSOA 1SVMA 3WWYA 2VK1A 4ZZIA 1Z06A 1P2VA 4OY3A 5JD6A 3F4LA 3H4IA 2HU8A 2EWNA 4W82A 1NBMD 2VP9A 3KQYA 4KZPA 5GADl 3AHDA 3O2QB 5EIBD 4CDGA 3QY9A 4HX2A 1FNSA 1U0TA 4UNNA 4NENB 4L4RA 2NSYA 4L95C 2FZCA 2QL9A 3KPVA 4D26A 3I2YX 2CJFA 2Z9BA 1PQ4A 1S2IA 1UPFA 1Z6QA 3E7XA 4GP7A 2R6ZA 2HCFA 3OLCX 3SJCA 3AVYA 4WN3A 3QFFA 2MHCA 2F3SA 1PGPA 5JZBA 2XKKA 5EYPA 4E5SA 3B6ZA 2Q46A 2C83A 3O2NA 1AS2A 5DGHA 4DR5B 1CQIB 3A4VA 2DFLA 3QEMA 1CIPA 2ORVA 5U9CA 4W5RA 4FYXA 4BS9A 4L6AA 4UFOA 5F23A 2Z43A 1E1CB 1ISHA 2OORA 3A9RA 3VH2A 4CGYA 1Z0SA 2QZ4A 1VL1A 1YJXA 5CXSA 4INZA 4BNJA 4K2AA 4OV6B 3D6NB 3PD0A 4MW5A 1YHNA 3PQCA 3U5ZB 1JDPA 1A4IA 1PJQA 2HHJA 3PITA 3ER6A 5ALSA 4CMCA 5JBIA 4D0SA 1JH9A 3I30X 5FYQA 4DZRA 2J5QA 3GT7A 4IGFA 4Q12A 5DTRA 1PWYE 1YZUA 1TJ5A 2NXCA 2ZYHA 1XCOA 3P9CA 2WWTA 4K6HA 4MS3A 4XFDA 1M2HA 1H2HA 3DB1A 4Z4EA 3DMRA 3EDYA 3KWMA 4PF1A 1XQ1A 3EGXA 3AWIA 2YDYA 2X1LA 1J8MF 3NCTA 4G1VA 4A8JA 3ROXA 1K7YA 1AKYA 1YD7A 2WTMA 3GD5A 3KB8A 1BHO1 2Q3JA 3CY6A 4OYRA 1Q17A 1XTRA 3RQIA 2VAVA 4XVCA 4HCJA 5DLEA 4XDYA 1T9ZA 4TN5A 1S2NA 2GILA 3ZV5A 1SCJA 2RH5A 3I92A 4NBVA 4ARVA 3K71B 5DBFA 2CDAA 1C9YA 5AMXA 2H2DA 1JECA 1G2OA 3H84A 4LDZA 4LXGA 5ECYA 1H5NA 2DQZA 3CUKA 1JVBA 2RARA 4GYKA 1X1SA 3X43A 4U0KA 1KK3A 3BGWA 4UM8B 1LPOA 3VC1A 1IIRA 3KUXA 5EHZA 4K05A 5ERYA 1MW8X 2RJNA 1T9BA 1W76A 3UH1A 5AW5A 3MD0A 2HSZA 5C52B 1XZFA 1OA1A 2NV2B 3UKDA 4HQKA 2H0AA 4EDFA 1VI6A 4LVJA 3T61A 4ZCRA 4D97A 3JD4A 4AM8A 5AIAA 2XZOA 4JI0B 4TMYA 1KYQA 2DM6A 4B81A 2ZAMA 1GQFA 4FHCA 2VL7A 1APBA 2DH5A 3CEPB 3OTQA 3K2EA 3N5CA 5D5PA 1X7WA 1RIFA 1GIAA 3AJ8A 1H93A 4MR7A 4Y2YA 4DEYA 1M1YE 2WICA 5AHRA 5JQWA 3K6RA 5FR2A 1L7VC 2PKWA 1YRQA 3NJ4A 1YE5A 1IN1A 1QIMA 2ZVPX 1NU6A 3L18A 1ADGA 4HQOA 4IMIB 2R6GA 2SKEA 1RVV1 4XQCA 1KA9H 1MF7A 4PWYA 1JIIA 3SCZA 3GRVA 3UBTA 4MYRA 1U4OA 3U3OA 1OWNA 1E62A 4KJZA 1SFRA 1EVZA 4B3MB 2ZIWB 2XB8A 1P0IA 2QTBA 1ZD9A 1WW3A 2ZWMA 1NBOA 3DMHA 5DHQA 3EXHA 5KJEA 3OZBA 1TYZA 2LCQA 1EBBA 3HJCA 4P3NA 3DZ8A 1G2QA 2YNMA 1QIKA 1Q3KA 3FNQA 4PYNA 2FUG6 2GTHA 3ODPA 4WJLA 1CX9B 1PFUA 1Z7WA 3GG9A 4MKIA 1X55A 3CW8X 5CM2Z 2HQ1A 4JBIA 2EJVA 1ZUIA 3BB1A 3TFOA 4RDXA 5IU6A 3V33A 3QV1A 3SP1A 2WV9A 3KDPA 1QV9A 3I9OA 3VDRA 4X7PA 2JNWA 1Q84A 2DT5A 1ML4A 2XNKA 1I14A 1QJCA 2KSQA 3ZTTA 1M1YB 3B3JA 3PQ4A 1UZNA 1L4NA 3FWZA 3Q0TA 5CLQA 3ZX5A 4WPGA 5AI0A 3PUIA 1U2ZA 3DDNA 3A1FA 2Z5LA 3OHPA 1KGSA 2J0UA 5AJXA 221PA 2DBZA 4ZOBA 5TQ0A 1BVHA 3LDHA 3JQPA 2FCAA 4JC0A 3SHVA 2G9NA 2CBXA 2CMGA 3MB5A 1K8XB 1VJ0A 3U61B 1T4MA 3QPCA 3Q7RA 1H1TA 2EYQA 2Q27A 3I37X 2A8EA 2QX9A 4HC4A 4IJ6A 5A02A 5ICCA 1IPHA 4LTNA 5JANA 2XYHA 3T4XA 1UOPA 4X44A 1Q12A 4GGOA 1U8YA 5CVTA 1U3UA 1MJNA 3UUFA 5KCZA 4NPCA 5JMTA 4PXYA 2VT7A 4DLNA 1WX1A 3CLSC 1VGVA 5EZYB 1XJ0A 1N6RA 2H65A 1I3CA 1RCFA 4UMVA 4YMWA 3X1DA 3O9MA 2I8AA 5BR4A 4Q1DA 3ZHSA 1Z8DA 2PRKA 2ZCUA 2D5IA 3E35A 5I8ZA 6GPBA 5J40A 1CDDA 1TAQA 2YWXA 3PQFA 4JQYA 4WT7A 3S40A 2RHSB 1EFKA 5H3CA 2H57A 2JD2A 3R9WA 1SXJC 1FZTA 1Y1LA 4HFJA 1AE1A 3BFVA 1KZHA 2FQXA 1AKUA 3A6HA 3AEUA 3OD5A 2GCGA 1WVGA 2AEMA 1P39A 4JNCA 4AN0A 3RVJA 4P54A 4OAOA 5HVNA 1ENYA 3OY7A 3QQ5A 5KVQA 3AWDA 1LRLA 1GOTA 2FFQA 3NRJA 4TTAA 1YACA 3H7AA 4H6VA 4MQEA 4J07A 1EINA 1NJFA 2BI7A 1RBMA 3M6MD 2OHFA 5GTDA 1Z22A 2H4YA 3UB2A 1S9DA 2SKDA 3QUBA 3C6BA 1H9BA 2VNJA 2ZANA 4LJ7A 3VSBA 4HFRA 3WB9A 5CLFA 1UL1X 2I4LA 3Q3IA 1QKIA 4TV8F 2BHSA 2EBFX 3BMOB 1AQNA 1UBCA 2CGEA 1DKOA 5KNBD 5AVUA 2GN4A 3A9VA 2VUIB 3BFPA 3LAWA 2F9LA 4IJ5A 4PV7A 5LR6A 3L8HA 2AX4A 2ZI5A 3NYIA 4J75A 1C3OB 1W9HA 3ZCXA 4M54A 4MYDA 3GEDA 2OYRA 3R40A 2YRFA 1FQOA 2OUKA 1PG0A 3WAGA 5BQOA 2GPBA 3H75A 4B9AA 2V7TA 4QOHA 2YJZA 5ALFA 4BRUA 1VMDA 3M6XA 5TQ2B 2CMDA 1GUFA 3UGTA 2PIAA 2FPGB 1V6SA 3JD0A 2EWVA 2ODPA 4WKOA 4BFTA 5BNWA 3DPUA 4F96A 1H3NA 4C0KA 4JU9A 3WADA 1GTL1 3PC3A 3UMGA 4O5OA 2REQA 2O2XA 1KJJA 1GR0A 4BJ1A 5FDFA 4GZMA 4G4SO 1J1UA 3BXPA 2PKXA 4MA5A 5CU7A 4UREA 4ITVA 3X3HA 4E09A 1EVIA 2R25B 1Y63A 2R44A 1X39A 4FFBB 4MINA 2H08A 3A37A 5HWSA 1Q6ZA 1V7PC 3TUPA 2PRJA 2ANCA 2V9PA 3TM4A 4EW2A 5I7WA 1GZUA 1TI7A 2GK3A 5EWLA 2NUPA 1HV8A 1SCBA 4KDRA 4HH4A 3GO4A 3GPBA 4QYSA 4RJ2A 1W29A 5E1BA 2CE7A 2IKSA 2XD9A 3IIMA 3U4CA 4P5PA 1Y7PA 4H1VA 3KTAA 1PR5A 1IZ0A 4OFBA 5EWJA 1D0SA 1LSJA 2V9ZA 2J4CA 1TM4E 2Q62A 4MAAA 2QHSA 4PG6A 1KXJA 3SYMA 4H2UA 3T3OA 4EFKA 4URWR 4B3TB 3KR2A 3WOVA 2DLNA 2FUG1 4HQ6A 2O8EB 3O8QA 4WZBB 1QNFA 3NGLA 4JA0A 4G4SP 2J0EA 4MR8B 5CAEB 2QLMA 2X86A 3BXXA 3HFSA 4MWTA 4QQ8A 4Y7DA 4A6PA 5EE5B 3LXXA 3CGGA 4P3OA 1YR6A 3UJAA 2IBSA 1ZG3A 1P19A 3A1NA 3KXIA 4N5NA 4RM3A 1KU6A 2HB6A 5EE0A 2N3ZA 2QORA 1DLIA 4DC0A 5JCPA 3VZRA 1N5RA 1HDEA 3ROEA 4ZN6A 1J1ZA 3RODA 3KKZA 4OU4A 1L5YA 1FNDA 3B70A 4LG1A 2BPOA 2AJCA 1NV9A 2LP4Y 3RTCA 1XEFA 2H4WA 3R7AA 1EFPA 4OHKA 4EECA 1VGRA 1NTOA 2Y71A 3NI2A 2FZEA 5KAPA 2EKLA 3MW8A 4LOIA 3ROZA 3ZWKA 1BJTA 5BYKA 3T1HB 1GKKA 1JX6A 2NTEA 4Y1EA 3I6IA 2ZI6A 5H1YA 4JUIA 1YMVA 4EFLA 4WADA 5MFZA 2R5FA 4RVGA 9LDBA 2QD2A 2EDAA 4M60A 3GLRA 3BIWA 4U3JA 5FO1A 5LBUA 3WIDA 4OBBA 3OCWA 1ZIDA 2A2ZA 4JMPA 3WIBA 4CTJA 1RADA 4JJ7A 4WW0A 3A3YA 4F4UA 2BZ0A 1VPTA 1EP2B 2V7UA 2NTJA 4Q3OA 3WIEA 4BJHB 1B6SA 3BMNA 2B69A 3OEEA 2OGWA 3GRUA 4PBSA 3EUWA 3ZJ5A 4OSEA 5E4JA 4IGEA 4D4HA 4CEJA 4UP9A 3TLGA 3FKSD 3VDNB 3MWEA 1EJ2A 1PLLA 4QOJA 4EYKA 4ZGGA 4NYMR 1JE1A 4BP9A 1U3GA 3IUNA 2P4HX 3GRYA 3ZDYB 1EG7A 1C30B 3MTQA 4N82A 2UYOA 3LC0A 1J0BA 5AKKA 4UMEA 1RXVA 1XKXA 4L7QA 4BMVA 1C3OA 2J9ZB 4I99A 4R41A 1AHPA 1FUYB 2QZZA 4YRBA 1JEEA 1KR5A 3EQ6A 5B4UA 3U7EB 1MVLA 3P7MA 1B14A 4IUBS 5EIAA 3I5YA 3PG5A 1YMQA 3RYFB 2OM6A 1OLUB 3JQ7A 2XCSB 4LF5B 2Y1LA 5JR3A 2C4WA 2O50A 1F5SA 2AMCA 2M6RA 2C58A 2FQYA 2PA0A 2WHRA 2WTXA 1ZH6A 3E2PA 5B37A 4A0SA 3TCKA 3LP8A 1QOPB 2O3JA 4IO1A 1BMQA 2DWCA 3E7DA 1SKBA 4QOEA 4UP8A 2EW1A 2K7FA 2R7MA 4P74C 1A2KC 1CUIA 1PGQA 2O8NA 2VC2B 2WC1A 3PK0A 5F73A 3GJTA 3HB4X 1FP4B 1XEAA 2P5TB 4RSGA 3DWFA 5B1IA 1EHIA 3PQDA 1E7WA 4DSZA 4JI2B 1QB8A 4UOQA 3DSRA 3R3SA 3ZTYA 3C41J 1F3OA 1JEAA 2E4AA 2INGX 2IU0A 5B7GA 1ADCA 3WV4A 2GA9A 3N5KA 2BKVA 3SS7X 1G5HA 2UZAA 3LYHA 3BCHA 4LHYA 1CZKA 1FRZA 4RF2A 5EUQB 4LHXA 5IDQA 3M4YA 1NI4A 3DMPA 3LPCA 1VCOA 1RZUA 4JLDA 4JJIA 4WY2A 4TXNA 4Y9UA 4H2VA 2O2YA 1ST2A 2VK4A 3T7RA 1KZ9A 1X1CA 4RHEA 1ZR4A 3DMTC 1DTWA 2GWRA 4FWIB 4NMWA 1GEEA 2VG8A 1XRJA 1GTZA 2AFIE 1C9MA 2I2BA 4CNQA 4L1KA 2YC2C 1TW3A 1M1NA 2HF7A 3R0IA 2ZRDA 1AB5A 2BV3A 5JECA 2QSJA 2R87A 1DAFA 1JAIA 3KU4A 2FFJA 4M9SA 4P82A 4GE0A 2ENWA 1R18A 2ZB3A 1ZCBA 5A3QA 5FBZA 2XUGA 1RWOA 2QIPA 2YS6A 4DR2B 1LWOA 1U0LA 4IWNA 3F71A 2RIPA 1BYIA 2A88A 1ZONA 3BAZA 4L85A 3TIGA 1EUZA 1IQRA 5AJVB 3UFBA 1SKMA 3L8CA 4R1UA 5CW1A 4P74A 1MAWA 2GBPA 3SR4A 4K88A 2G4VA 1PR2A 4H6WA 3L7MA 3MWDB 3QNEA 3F8SA 1E2DA 3FUCA 2VYCA 1RWPA 3IHTA 1H2ZA 3JVUA 1B2RA 3F5SA 3KM0A 4BZPA 1MB9A 4IJUA 1MIOB 4H27A 1OIVA 1K6MA 1MG0A 3GZ4A 1SUSA 3GEMA 4D9IA 3T5DA 4BMOB 2VZ9A 1GZHB 2GJSA 4MVYA 5HNKA 4MUFA 4O5AA 1NWHA 3P9IA 1DEKA 2ZATA 1E9FA 1NOJA 3P8ZA 3G0BA 5HDQA 2J8ZA 3GEHA 3GLKA 3V2HA 5CK4A 1JQ3A 3F7TA 4ZRDA 2Y0PA 1JBKA 1VPLA 1OV6A 4MO9A 1I1HA 2QF7A 2EOAA 5AXDA 2WJGA 5E6UA 1GTVA 3LHKA 1VHWA 1NT4A 4GI1A 3H1AA 4HLNA 2EX4A 3TM5A 4D0LB 3I6MA 1YGPA 2WWIA 1BW9B 4OQZA 3R0XA 2MINA 2QTRA 4P81A 4X24A 1S3GA 5DHTA 4CM8A 5BVHB 3LC2O 3OU7A 4JVSB 1PZEA 1X56A 4Y2QA 1DXYA 2B98A 1RD4A 2WPDD 4DQ2A 4V0QA 3SZUA 2ZZMA 4YREA 1DCKA 4NONA 2ZR2A 3R3XA 3WYFA 1XL1A 2Q4RA 3HYRA 4L50A 1A9SA 1NSYA 3CHYA 3OQJA 1VBKA 4FHDA 3CIOA 4ZXFA 4CM8B 1BYUA 2FSVC 4HDMA 1TIKA 2FI1A 3FLAA 5F1PA 5AVVA 5DF1A 5B6JA 4QOSA 1EA5A 3FCOA 4UM7A 1ZH8A 3HFJA 3B6JA 3UH0A 1N0IA 1M2JA 3N05A 3ZZ0A 4AJJA 1JSXA 4R9VA 2HN9A 2FPSA 3H97A 3OZGA 3RQSA 5KYKA 4AO6A 3URKA 1CJSA 3NWEA 4KWIA 1H6DA 1QE3A 1Z0JA 4N48A 4XWGA 4EMSA 1HEYA 4M8IA 2WYOA 1FU8A 1N7HA 5FUVA 4P5EA 5HK9A 4HB2A 3N2NA 1J2TA 4U9UA 4WY5A 5EKTA 5FNVA 1E1QA 3QKWA 1UP7A 4LOHA 2FF7A 4DJTA 2J5RA 3IVAA 4MP8A 2IX3A 3G79A 1SURA 1BQ4A 2I2XB 2WI8A 4X63A 4KHPB 3EPLA 3A26A 1KE2A 2AB0A 1L7OA 1JXQA 1XHLA 1D6JA 1WXWA 2B4YA 2YWDA 3ACDA 4I66A 3ZCUA 2DBVO 4YR9A 4EFMA 2XX3A 3T3NA 3JU3A 3ZVRA 5IT4A 2PUBA 4WUTA 3KJHA 3JQFC 5K8JB 2FFBA 2DUJA 1V11B 1X38A 2QJWA 1UPAA 4ZOQI 1EU1A 2CHFA 4H6PA 1BU8A 4O2AF 2C7QA 5FWYB 2GBIA 4QSMA 3DLBA 2NU9B 2PZJA 1B8OA 4LVCA 3R8CA 2O7RA 4F8YA 1AUQA 1YKSA 1SNYA 1JYEA 1M34B 5K0NA 1ULTA 3W1EA 4M9XA 2HA6A 5ESWA 4Z0TA 5KDDA 1RRMA 1VJRA 2VN8A 3PWZA 4LTMA 3WQRA 1DTWB 2G40A 1NC3A 2QGFA 1R3DA 3GR6A 3PNBA 1Z36A 4ZV9A 3WYEA 1MRSA 6YASA 5IJ0B 4Q4LA 1XKQA 2O1SA 1L7PA 1JAZA 4L6IA 4JJ4A 3U4MA 2GRJA 3C6QA 1B15A 4X6XA 3QI2A 2QXUA 5FORA 3JWIA 2DKFA 3GJZA 2ZTUA 4HEHA 3ETGA 2C4KA 1WXQA 3TQOA 4TUYF 3T38A 1DAOA 1GG5A 4GWGA 4YJGB 2XEDA 4KR9A 2ADMA 1T25A 5PNTA 5DE3A 4GKKB 1FP4A 2P0YA 5B58T 1MOSA 3O31A 1XCMA 2C5GA 4YYEA 1MQSA 2VDVE 3ENWA 2WIGA 1USKA 1LF5A 1PL7A 1QQTA 1T91A 4HTFA 4HDSA 1XA4A 3DAOA 1E6CA 5MGNA 1F8GA 3JRWA 4FYMA 1BKDR 1U28A 3DWGA 1U04A 2NWQA 4FFWA 4JHXA 1O5OA 4JK3A 4KQKA 4R1QA 4RHXA 1WVIA 4RKWA 4J16A 4LZWA 1GV1A 1YI0A 4TV8A 4MYCA 2Q4DA 1RXWA 3YASA 1NQAO 2DPMA 4BE9A 4POOA 5AVYA 4MK4A 4MDHA 4OXYA 3VNVA 5AUQA 1S2OA 4BQNA 1NP7A 2AT1A 2XEXA 4MV3A 2HRZA 3DBOB 3U39A 3RVSA 1SKYB 3HDJA 4P2BA 4E70A 4FN4A 4XWYA 4KE9A 4MGZR 2QR3A 4JXKA 4DSNA 1V45E 3DOJA 1H8ED 1ESDA 4XVQA 1ZYUA 3TK1A 1V0JA 2WM3A 2LBPA 5ENZA 3ZLTA 3K20A 4AMUA 3GP8A 3FHCB 3SBOA 2I4RA 1RZ3A 1D3AA 1HQCA 2C5BA 4RY2A 1JG3A 1K4KA 2IDKA 4N8SA 2HUNA 3UJHA 2KMLA 4E1BA 3DZDA 1IZ9A 3AC0A 2NOAA 1L4FA 2WU4A 2ZAGA 1OZHA 1ODLA 3ML1A 4NK4A 1GXSB 1QH1B 1V2HE 4Y6QA 4F84A 3M5PA 2RH8A 3U1VA 2OHHA 1O6FA 4ZEXA 3MGKA 2FZWA 1FTNA 3ENZA 1GPBA 4ZEMA 2O1WA 2ZRBA 4NBSA 4PYQA 3GYGA 3KD3A 4IXNA 1G55A 4M55A 1NXXA 5AD1A 1QJ4A 3IP9A 1QH0A 3MJ4A 2P9GA 1WUIS 2VNAA 2GFIA 3QLTA 4FFSA 4MZDA 4TWIA 2VHJA 3KEMA 1MT0A 2VPWA 5L3VA 3RJZA 2ONCA 3HV0A 2WU1A 3H6GA 3DNMA 4NDAA 5B2ZA 3V55A 1AF7A 4YMUA 2LE0A 2OVBA 4TQUS 4TX1A 3QH4A 5AM5A 3TZLA 3LRPA 4KVAA 3P4XA 4ZHSA 1DKQA 4EG1A 3IVXA 3COJA 2J0QA 2YRXA 3RD5A 5E0KB 2H0QA 2SCUA 3RFVA 1P1FA 1KRXA 4WASA 4LX8A 5FWAA 3P4UA 1R10A 2VRCA 3T1OA 1ORVA 1XZNA 3CR7A 2HRRA 1Z2OX 4N6NA 3ID6C 4CTNA 2CVZA 3K70D 1LLDA 3DDSA 1UOOA 1Y4SA 5B5SA 3ASZA 4RZSA 1O4VA 1W8IA 2VF8A 3IBSA 1E8NA 3HY4A 3QIAA 2I5PO 3QX7A 3OE5A 1Q7GA 2NNWB 2G0NA 5I7EA 4ZDJA 3O8CA 2RFLA 4J0QA 5DBOA 1XROA 1SBNE 1TT5B 2GETA 4FEGA 4WKNA 2J08A 4X20A 3DLAA 2VJCA 4U7GA 4BGDA 1E0JA 3DT8A 1O77A 4GSKA 4JNKA 2P9QA 2QV7A 4M9QA 2JLWA 1PQYA 1IWBB 3FI9A 5KJFA 1P1JA 421PA 2F1OA 3QXJA 4C87A 3BA6A 3DMFA 4JD5A 2RK6A 4OXRA 3RBXA 4EHKA 4CEHA 1FZQA 1QS0B 2GKSA 2W00A 3OLYA 4REQA 3MM4A 5FHRA 4FFBA 4D74A 2BM8A 1ZU5A 3NHZA 1W34A 1ZEMA 4RZXA 1P5FA 2GOYA 3QVKA 4GKVA 2GF2A 3RWMB 3TX2A 3KQQA 3OJWA 4MQEB 3V4ZA 1WHTB 1V39A 2NO5A 3H99A 2VXYA 1N3IA 2OD2A 1CR4A 2IV2X 5FRDA 3IAS1 2EIHA 5TARA 3FPLA 1C1XA 3CF4G 4JIGA 4J94A 4RYLA 1DADA 4U6QA 5A4KA 2H2HA 3H83A 4P36A 2DPYA 4ML3A 5JO9A 2NLOA 3JD1A 3KOMA 2R8BA 1E1OA 2JGJA 4YO8A 4B3RB 3MFYA 2E7ZA 2FZ5A 4MAMA 5EPEA 3WNQA 2Q0HA 2X3UA 3ZTWA 5K4HA 2XWJI 1OQAA 4R8RA 4I55B 3DKVA 5ALEA 4CMAA 1M3SA 3OH8A 5MFPA 3DBVO 3OJEA 4MA0A 3NVKI 2PX6A 2IUTA 1PVDA 4N5HX 5IJ0A 5F52A 3KQWA 3TZQA 5JCZA 4X60A 5C51B 2GCOA 4DUGA 2ARTA 1C8VB 4TYQA 3LUDA 4M1TA 5BT8A 1F2UA 2Y6VA 4M87A 2GZHA 4O2RA 4UDXX 3W2EA 1DKPA 3LSYA 3UAZA 1Q0HA 5DLPA 2O05A 4G0UA 3O47A 3FMGA 1Z7NA 1CZHA 1E1NA 4KK4A 3MSCA 4CCWA 1EUQA 4C7VA 2AKEA 2WIFA 3R1IA 1MQAA 4W5HA 3Q1KA 3A2NA 4CUJA 2CV2A 3COPA 2BUAA 2VPYA 4Q9DA 3J81A 4IDBA 4H02A 1ORDA 4FZVA 1TD9A 5TF4A 3TEJA 3VR3D 5CVVA 5BXQC 3E05A 3B89A 1DIAA 2J85A 3G7UA 3GROA 4GI2A 3WMEA 1A8PA 3OMXA 3UNXA 1ZK2A 2CUZA 4UAVA 1X1BA 3VX3A 4EKIA 2YYYA 2JJYA 3LC7O 2PZGA 1DMRA 2IODA 3C3PA 3NS7A 4LE1A 1WXHA 1H1LA 2R6FA 4JOSA 1GTRA 2JVJA 1OXBB 1HETA 1E18A 4EOGA 4MO2A 4PM4A 1ZLYA 4R7ZA 3HCPA 2JAXA 3ZD7A 3AK4A 3KJEA 4PAGA 4M1ZA 1M1ZA 3M3HA 4UXIA 2QAGA 4Y3UA 2D5CA 5DIFA 2OKCA 5TRTA 3W6ZA 4DG8A 2VJAA 4UBNA 4AKHA 1VJGA 5J5CA 2QUKA 2FX3A 3HH8A 3RDPA 4B82A 2JDIA 4IX1A 3UMBA 2R8ZA 2CVOA 4GHWA 1Z2NX 4DQ0A 4LZNA 4RPIA 3EPHA 3IAEA 1J2UA 3VGJA 2HW8A 1N92A 2VEDA 5T41A 1QH8A 2WBLC 2WMDA 1CY7A 5FUXA 2DR2A 2VVTA 1N5MA 2PBLA 4FGWA 1ISJA 2P2LA 3KKQA 4G8BA 4ZOEA 3ZPXA 3A6FA 4OVKA 2P4EA 3OZUA 3JS5A 4BVBA 1UBSB 2ZRLA 1WAMA 5LQJA 3GFGA 2E9SA 3E5MA 1JIUA 3BRCA 4WOJA 4YUAA 5JDIC 5K6RA 3ICEA 1XVUA 2JJ2A 2QE6A 5A1TA 4C20A 1YRYE 3MHPA 3KHSA 2OCYC 1GL9B 3CLTC 3A9TA 1HDYA 2A0UA 1SG6A 1N5KA 1NJSA 2R6CA 1KQPA 1WPGA 2HHCA 3TB4A 4A0HA 1X7WB 3WNZA 2GXQA 4D25A 1RLOA 3IT0A 3Q72A 1JS1X 1HE3A 5GONF 2FR0A 2Z2JA 2VYNA 4P34A 5KWIA 4R7TA 3P2YA 5TPZA 3QENA 3WNDA 5EC8A 2GK7A 2QVBA 2YMPA 3V8VA 3ANNA 1Y5LA 4B2IA 2J3KA 4MW4A 1JZQA 1NA5A 3BQMB 3PFNA 2ZUVA 3ADOA 4UCXA 3M1AA 4BN4A 5A71A 3I62A 5TT1A 5C1PA 1P4GA 2GAIA 4GC5A 4MSUA 1NQWA 2AE2A 3EBOA 1CNEA 3F3SA 4ZAGA 4PN7A 5BSUA 1B70A 3UA4A 3L4GB 1E9EA 1C8LA 4O2BA 1XK6A 1N6PA 1O95A 1E2MA 2YMLA 4N7JA 1A96A 4G0QA 3QK7A 1I7LA 1GKIA 1L5OA 3FPKA 1U99A 4LV8B 3RTEA 3CZAA 2Z5VA 4QEKA 1G64A 1RLIA 2XY4A 2A9RA 1N3LA 3HBJA 3ZXUB 5B3LA 3PT9A 2AW3A 3QIVA 5HGQA 1R6VA 4R3UC 4CM4B 4ESVA 2JDID 3UAVA 3H87A 1CY4A 2B1IA 2WT4A 3WNCA 2EGUA 1KOFA 1RJ9A 2XZTA 1ULUA 3PPXA 4UM9B 2F8TA 3GW8A 3LXRA 2WSBA 2VSXA 4QYWA 2X2FA 5AT1A 4PBTA 2OZKA 3W4KA 3WL3A 1WRBA 2GN9A 3DVSX 5ICMA 4LYGA 4RMNA 1PAUA 1Y48E 2WFLA 4FHEA 4LKRA 4Y2HA 2I76A 1O2DA 1SH7A 3QWIA 4ZDKA 4DV4B 1E2EA 4XAQA 5HA5A 4BTEA 3ZU5A 4QT4A 4WKCA 1XZ8A 3TZ6A 1XSEA 2UYCA 4GVXA 3MJDA 1RXEA 4GICA 5IDVA 2RGRA 1L7RA 1RM3A 3RE1A 3ZHCA 4BL5A 1PEYA 2OV4A 1D03A 5KSPA 1OREA 4YLGA 1DBRA 3NLLA 7AT1A 4L0CA 1XTTA 1RYMA 4TVWA 3D4LA 2C8JA 4NESA 3I64A 4UUOA 5M29A 2ZIUB 3RUPA 1AK1A 3OE4A 1TC1A 3A7DA 2YS7A 5IKXA 5B3JC 5J59A 3K15A 5FOSA 3ZD8A 2RMKA 4H6XA 4KQ6A 1X13A 2PZFA 4JDUA 4DJEC 1ZGAA 1E3SA 2FWRA 4N18A 5F5LA 2LKCA 2QM3A 4DGQA 3BUSA 4LGYA 1VIVA 4P4UA 4IGAA 1ZICA 5EJEA 2QPLA 1ZCAA 2IEAA 3WSVA 3AQ4A 3LZCA 3NT4A 4YJHA 4E2YA 2B2NA 1DS6A 2ID4A 3FRIA 1WDKA 4TSFA 4FK8A 2ZBDA 3OEYA 1MOQA 1U1FA 4JGIA 1C8KA 2F6RA 3NEPX 4RK7A 2NG1A 3WFJA 4BU1A 2G5CA 1BBUA 2IP1A 4TM8A 1VP9A 4IVQA 4BFUA 5E2BA 2CNWA 2R6AA 2D5BA 1TF7A 2WTNA 3K73O 4IDGA 4R0NA 3TCXB 3GDOA 1CFZA 4U6SA 4X45A 1ZJ5A 1E4EB 4ZRNA 2O4CA 1QVZA 3TAUA 1CUDA 2OTCA 2XZDA 1OYWA 1RQ2A 3Q7QA 4GH5A 4CQNA 3N1UA 2GPAA 2E4ZA 4LC1A 4TQFA 2BFEA 1PO7A 3VSEA 3ZZMA 2NAPA 3URMA 1DQPA 2VAPA 3OQIA 3A3NA 5IZCC 4P53A 1NBIA 3SQMA 2DZDA 4MCJA 4DA9A 4LJKA 4WK0B 5IT9A 1GPMA 4GSLA 1B70B 1F0PA 2GBGA 1FMTA 1IMOA 3TL3A 4ZWNA 1RMYA 1UANA 1AOXA 1KY3A 1LTKA 1SBYA 4FTWA 4UP7A 2PU5A 5REQA 3ETHA 1I7NA 4CKBA 4EPXA 3OQ1A 5LXTA 1R00A 2AX3A 2EKBA 3HUDA 2OPBA 4P33A 1M7HA 5E9QA 2E65A 2Z8ZA 2RH4A 4CIWA 5JPCA 3KB6A 2GBLA 2IYRA 1Q3HA 3K8YA 2VO1A 5FFFA 3OEHA 2BSAA 1E1MA 1X6VA 3SZ3A 3VC3A 5I5EA 1YULA 2QN3A 3AM3A 5HRCA 5K3EA 4U7PB 4JUCA 4NCNA 2AN5A 2CD7A 4FGUA 5KKAA 5K99A 5IT5A 3QUAA 5IFKA 1PBNA 1X7XB 2EJGA 4G0OA 1XYVA 5HKKD 4EEZA 1POWA 5COAA 5EZYF 3OT1A 5EHQA 1H42A 2UUAB 3O4RA 4MYSA 4B6GA 3C24A 2IQIA 3LFHA 1G3IA 3SQDA 1ZD5A 3K1AA 3M6LA 2ORED 4JKIA 3WBBA 5BVGB 5JS1A 1SIOA 1UXJA 3IP5A 5EIWA 1QFSA 2IXFA 3ZY4A 2B34A 4R9NA 4RCVA 1K66A 4BX3A 3RT7A 4JGGA 4MS1B 4MZXA 2I03A 1TECE 3WYGA 4NZ9A 1YQQA 1EK1A 1F4VA 2BSXA 3GA0A 3V5NA 3VHRA 4WRRA 2BHLA 1CUXA 4L0MA 5C1IA 5DCUA 1YU6A 4Y2RA 1W8DA 2G6TA 3VJKA 1W581 5KS2A 4DGSA 2ACKA 1NX6A 1GNTA 1B3BA 1M66A 1R4NA 1TVKA 1VBMA 3DNFA 5CP8A 5HILA 4CU5A 4KDCA 3U9LA 3K0FA 3CW9A 3U7FB 1LY1A 4RZUA 3SJUA 4HDOB 4NATA 1E96A 1KZGB 1U6KA 4PNEA 1PFKA 1CY0A 1YCGA 2PGJA 1W46A 3RIEA 2AUNA 1SKYE 4ICIA 2Y1OA 1RQLA 1FXSA 2HBQA 2VJMA 2DKNA 4UDNA 4I1UA 4B6PA 4OH7A 4KHZA 4XTCS 2J3LA 4BQFA 2VNSA 1LV8A 2FPMA 3JAKB 3SSOA 2FHPA 2QN7A 3NP9A 2HOQA 3EJWA 2G82A 1FA9A 1HG0A 2HDNB 3L0CA 4FFNA 1D6SA 4UBIA 13PKA 2YJGA 3HXUA 3E1SA 3GGSA 3MTGA 4YJ3A 1QM5A 4F6RA 1Q2UA 1W47A 4CKWA 1NZFA 4BKPA 2I8LA 3DAFA 3ZNQA 1IBKB 3M3DA 2XA1A 4GXRA 3PS9A 2ZM6B 4TTPA 2GBCA 5JHHB 5KJ1A 4Z3OA 3RJMA 4TSRA 1Q22A 5LBIA 1SMKA 3H3XA 2HTEA 2XNDA 1CZLA 2ZE5A 1QGUA 2VNKA 4LNUA 3U48A 1YZYA 4AJLA 1BC5A 2FQQA 3HCDA 4AJEA 2YNMC 4ETNA 2P5IA 2RGCA 4KFTA 4RU1A 5DRYA 4QJ3A 5IKEA 5KQMA 3M82A 2JGNA 5E4FA 1DZIA 1GPNA 1PS0A 1ZNYA 3O8DA 4AU1A 1Z2PX 3FX2A 4TUYA 2VWQA 1CUAA 5J4YA 4LWQA 1E7QA 1F2UB 3QVOA 3I39X 3I8XA 4S24A 3RS2A 4J6EA 1AVTA 4JB0A 4LXYA 5GINE 2N1BA 3H2ZA 1RC1A 3E8SA 1Z6TA 2CXHA 2A0WA 1CRLA 4B87A 2CLHB 1P44A 5D00A 1GZ4A 3NHJA 4I1VA 5DCYA 2PE5A 1YE8A 3HJBA 3NAQA 3JYNA 2A84A 2X5NA 4MLZA 2JW5A 1NAHA 3NEAA 3ZK7A 2D00A 4OO3A 1G8JA 1OHHD 4DWVA 5LZ4A 5LUBA 5DNAA 5IG2A 1OWLA 3SHTA 9LDTA 4NE7A 5FAKA 3MQFA 3UFGA 4EBFA 3H86A 3U2QA 3F5QA 1U8UA 1SVIA 3LCRA 4O4HB 4QULA 1M8PA 4F6LA 4CF7A 1FYXA 5ALTA 5L7YA 1AGNA 1O6CA 1J07A 4H2DA 2QEQA 4PHGA 1DIHA 4NZYA 1HYGA 3WK9A 3X2EA 2AOTA 3FPFA 3V42A 2Y27A 2YV5A 1TXGA 3O3CA 2FSPA 3PDJA 4ZYUA 4CEHB 2BFAA 3UXHA 3CISA 3KE8A 2Z8YM 1Z2EA 1FXWF 1UQRA 1ISFA 4CCSA 4O29A 4KMOA 5TMBA 1GNSA 1CQWA 3B1JA 4L4UA 3WFIA 2BZSA 2HGSA 2DWQA 5TQ0B 3SX4A 3W0LB 4AK9A 3RGGA 1W0CA 1EVLA 3EEBA 4EENA 3J80A 3BPSA 4F91B 4YONB 4RJLA 1XPJA 3JASB 4JP1A 4PIVA 3W6PA 4N0DA 4MYTA 2F00A 2FDXA 4G2TA 3GLIB 3HVUA 1RACA 1M5UA 1LDYA 3D81A 1ZM9A 4TVOA 3T99A 2DU5A 3KYCA 4DNQA 1PFVA 4M76B 3FYDA 5DEIA 4ME6A 3GLFA 4JV5B 2RHCA 3ITEA 1R7RA 5ICSA 3B7PA 4NAVA 4JUDX 3GDGA 1UEIA 1OLOA 1P9OA 1VFPA 4Q05A 3P8TA 3TDKA 5LB2A 3ZBQA 4K6CA 4M3NA 3V7RA 1U02A 4EMUA 5BSHA 4U7DA 4GXNA 1F1BA 1SK9A 2P2GA 3AL3A 4I19A 1CR2A 1K3FA 4X1IA 3NOOA 2AJLI 2ZNIA 2X0IA 2Y92A 3FZYA 3R6GA 1SC3A 1B1CA 3HB9A 5EJGA 5A06A 3TXXA 4ZK6A 1ZGHA 3HKCB 5JALA 2EJUA 3RG8A 2W43A 4BNVA 1QGED 3NPMA 1HDOA 4L7VA 4IOKA 2RHLA 4TQ9A 3DLHA 3E2IA 1Z4JA 1H1DA 3F98A 1W48A 2ZS9A 3KPUA 4HX5A 3CNNA 1Q74A 5K4AA 1ZN7A 1OKKD 1II9A 3T1TA 5ALZA 1JQKA 2Q5FA 3REOA 4KCGA 5LN1A 3O38A 2FOXA 4KITB 4OX9B 1L0BA 4LZZA 1OH5A 4HAZA 1ZNQO 1WMDA 3V46A 2C0QA 5I45A 1MXHA 2EL7A 2BT4A 2PJUA 3AERB 3UV7A 2X6RA 4J3FA 4NU5A 2MJLA 2OFPA 1K86A 5E6SB 3BTVA 2WKRA 1BXRB 4P6VF 4MARA 3EASA 4F8JA 1UT5A 2AK3A 3MWJA 1SU8A 2PVCA 3G9XA 2XVAA 4EF5A 1GU1A 1Z75A 1RXIA 4RNDB 3RUEA 5EWJB 3TL6A 1EX1A 1YS9A 2A4KA 4FJ0A 2JH8A 1GCOA 3GFTA 4FKBA 3G2NA 2EEPA 4MV7A 3RSZA 3SE0A 1V3QE 1N0UA 2ATIA 4C0XA 4UFPA 4EGAA 1NUUA 3H1BA 1E1QD 1QYIA 4Y30A 3A1VA 5NULA 4IPTA 2EV9A 3E0QA 3I72A 4IIYA 4NNPA 4XCQA 5ELXA 2YN2A 6LDHA 2GLUA 4NOJA 1N7GA 1BCSB 1N25A 2PEZA 3GN2A 3PUVA 1KMCA 2I65A 4JGBA 4R98A 3BK2A 3TSZA 2P5YA 3D2BA 3KOOA 2QP4A 4GAEA 4W5QA 1F7UA 3A2LA 2W2NA 2FEKA 4H17A 4UVIA 3QX3A 2FR8A 3WMXA 1Q7BA 2RHBA 2VZEA 4D9HA 1ZAYA 3N8DA 1SVKA 3KKMA 4JOBA 2BMAA 2LW7A 4MVJG 4UBMA 2R8RA 4IDQA 3R9IA 1X54A 3DXZA 5EXTA 4GGMX 2E3CA 4YRPA 3TWOA 1YFLA 3A11A 3F78A 4YUYA 4PQYA 5ADUS 1ORIA 4KQFA 3FGOA 2FPGA 5F4BA 5B1YA 1SESA 4OKSA 2AEFA 3FAZA 3LFUA 2CHGA 1C0IA 4KYUA 4LC9A 3LH5A 3GUCA 3GVXA 4L0DA 2G1PA 2PUEA 1WCWA 2EFYA 1DC7A 5CDTA 1BO6A 2QG9A 5LP6B 1YFRA 2Q99A 2AOUB 2ZRPA 5JY6A 2ZM5A 1J2RA 5CIYA 3MRXA 4YTEA 5FQNA 4ANFA 5EOVA 1BIFA 3EFBA 2B6NA 2RCNA 3QKRA 2A5FA 1SEVA 2B6HA 2Z5GA 2GEBA 3CNBA 2EFEB 4QXRA 3I9KA 4QU0A 1NR7A 2R68A 3F8TA 5FTWA 2IGBA 2PWAA 2JHGA 2H63A 4NNJA 5DDIP 3U60B 5EQFA 4OK3A 2NU9A 4BLWA 5KYUB 2NP6A 4F5DA 5F1OA 3L8YA 3UMVA 2XT6A 4IJWA 4DDMA 1QHNA 2H2FA 1EK0A 3CBGA 1WZCA 4QXMA 4L72A 3JWPA 3JYPA 3LLMA 3LD9A 4UTVA 1HPLA 5F64A 5F7OA 2I3DA 4PIMA 4R9UC 1NJ1A 2FSIA 1VYTA 1F2DA 4Q15A 4F2HA 4D56A 1KSFX 4ZICA 1F60A 3AU8A 3WO1A 2J32A 4PC6A 5LQRA 1OOEA 1V7CA 4HAWA 2PNFA 1CRQA 4F5YA 5C8ZA 1PSWA 5DM60 1NMSA 1GDDA 1IDN1 2WWVD 2QD4A 4PGGA 3SYLA 3DOFA 4I3FA 1Q21A 3WKEA 3NRCA 2J3IA 3KOWA 3PXCX 5E0OA 1SEPA 4NJOA 4E7OA 3GLGE 2OB2A 1RJ9B 1X42A 2V97A 2TMDA 1YOVB 3BGVA 4D9BA 5CDHA 3R5KA 1ZUNB 1GTJ1 1LBTA 4G0MA 3TOZA 4E08A 1YBAA 4GSYA 3F90A 2VDLB 3Q8WA 4TKZA 4EF6A 3FPJA 4UTPA 1DIGA 1KO5A 1VSTA 3HUFA 3CX3A 2R8XA 2RAPA 4AJKA 5F7XA 2QVLA 3DLCA 5EIHA 4BYGA 2AG0A 2IUUA 4YRNA 3PXBA 1PU2A 2I54A 3G8BA 1NNLA 2P2NA 2RKOA 3ABZA 3RJ5A 4B48A 4HH1A 4Q82A 4JY7A 4W1QA 3BE4A 2OO7A 3L01A 3PQ7A 2EIXA 3G5TA 3D6FA 2Q3LA 3EG9B 2QRKA 2CUKA 2FN8A 4G07A 5AK5A 4L5CA 3TB6A 2C3YA 1UBMS 4A6EA 3O93A 3BA1A 3UJ9A 5EXPA 2C99A 2DU7A 2M1ZA 1J0XO 1VYVA 2Q28A 2VRCD 1XF1A 4TTSA 5TNXA 4IHJA 4EY4A 2Y4NA 4OP1A 4C4RA 3KJQA 1MG5A 3DR3A 3CVYA 2A3NA 2WM2A 3JWHA 4KEAA 3S2IA 1ZBDA 4CWAA 5KYWB 1Q15A 1C9EA 1VIDA 1WD5A 2WSSA 5CPBA 2PLWA 3LT4A 4C4XA 1YJCA 3HXTA 5C9ZA 4BLSA 3D6VA 3GLIA 5TJHA 1CSEE 2LDBA 2FLVA 3IAM6 2HWWA 3TUJC 4HS4A 1W4AA 5LDGA 2WAOA 5HRAA 4D4GA 3R5HA 4YMLA 2QW8A 4ZMSA 1Y4UA 1XLTA 5JFTA 1DSSG 1P60A 1IPFA 2AOVA 3A9CA 5ALRA 3SY8A 3ZI4A 3CKLA 3TYXA 3ZHTA 5MN4A 2VP0A 1ZPDA 2B36A 5BRJA 1GAEO 1U7PA 3KQUA 4KBYA 3DMDA 4CQLB 3OHMA 3AJEA 4NIMA 4GF5A 2XGSA 5DSXA 2BEVB 4OI1A 1Y3AA 2PX4A 1KAHA 4IDFA 3L8EA 4D3SA 1XDUA 1ZSYA 1CUJA 3R0ZA 1VKHA 1R4MA 2YWFA 4G84A 2I6FA 1Y3BE 4O4JA 3SFTA 3OSUA 3GGGA 1YDWA 2EKDA 3NIFB 1K7XB 4Z9FA 4AN4A 1KAMA 4QNRA 3KWLA 4UPVA 4P3KA 5FA8A 4UZSA 4EB8A 1A2OA 1H65A 2VA9A 3JR7A 4PCVA 4JB2A 3CVUA 3VGPA 3U80A 3MMPA 4RADA 3ILVA 3ANSA 3P97A 2BGWA 5E7MA 1XMIA 2QIOA 2RBGA 5FAXA 2GX6A 4ZEOA 4AUEA 1L3CA 2FPKA 3IKVA 3IDQA 1ZXLA 2CLSA 4PLHA 4KO8A 3KQLA 3ZN2A 4ZGBA 3WI7A 2ZRMA 4F60A 3IODA 4LRXA 4BTVA 5AVSA 2JHFA 3HHPA 1I7DA 1BJRE 2G77B 1TM2A 1Z56C 2CNKA 2P5SA 3BTSA 4G1CA 4MJ7A 3R3ZA 1JIQA 4P7JA 3UPUA 3V8EA 3RK1A 2H2IA 2P4QA 1IN8A 2PRZA 3G9ZA 1Z07A 3IPCA 3BL8A 4J15A 1KH2A 1RHKA 2L42A 3FPSA 2FLWA 3GUZA 3KOXA 4IGIA 3WGHA 3ZE9A 2AMCB 3U7IA 1DQNA 2BR3A 3HVIA 3DDOA 3KKKA 1QPZA 2V7WA 5DSZA 4JIMA 5L45A 3EZ7A 4M2LA 1Q1AA 1XQ9A 4M7RA 4AVYA 1KK1A 1I7QB 4YALA 1MB4A 3U9TA 4C2UA 1T9HA 4HRYA 1P72A 3SMQA 1FTQA 3CH7A 1NUAA 3GLGA 1AQIA 4MP6A 4BLPA 4EO4A 3Q40A 3RC9A 1UCFA 3K70B 5JAPA 1HNNA 3W5UA 1R74A 4M0KA 1AO0A 2XZLA 1C1XB 3S5JA 2FFAA 2HLDD 4DNXA 1QTQA 3AHGA 3FH0A 3GJ8A 4Y6OA 2H4FA 5EMLA 5GOTA 1VHQA 2FSUA 4HNVA 5BW5A 2D59A 2ZJZA 1ULSA 3I28A 3TECE 2J3MA 3BWDD 3UHOA 4CIAA 4LGCA 4LJYA 3PDWA 4Q39A 4RY0A 1Q1QA 5EYPB 1LDNA 2M2IA 1WEHA 4W8GA 4CE6A 4JCOA 2Q5IA 2Z30A 3K5HA 3PZBA 1ZNXA 1L4BA 2AFIA 2IXAA 4HTAA 1C7QA 1LUAA 2JAUA 3FNGA 5EZ6B 3P0EA 2PVSA 3T4EA 5BSWA 3VPAA 4I0WB 3TJZA 1GQQA 2FSFA 5DW3A 2O0HA 2WUGA 3AKYA 4X20B 2ASVA 3VI4B 4F9GA 4MV9A 3KYBA 4BFVA 2Q3BA 2QM7A 3C3XA 1Z8HA 3F3YA 3GPDG 4RELA 5DX8A 1WO8A 1JR2A 1IHOA 1Z9BA 3KEGA 4LDQA 4M1QA 2YJTD 3SI7A 1E2KA 1PFQA 4PONA 2FY8A 4JZYA 1SC6A 1VXOA 1XMVA 1LNSA 1UFOA 1D1QA 1RKXA 2OBXA 3D4PA 3EQ7A 2C3OA 4GI3A 3N28A 1WXXA 3Q3JB 4JLBA 4N8DA 5EQDA 5FI5A 1M0EA 1UOQA 4EK9A 3KT6A 5KB3A 4GLJA 4U63A 3HLKA 1RW4A 3NHMA 3JZMA 2DGDA 4DMCA 1XVVA 3F6YA 5HCNA 1ZNZA 3P71T 4FSDA 1KGDA 1SIUA 1T8PA 1M67A 3LPAA 3INTA 1IAQA 3V6LA 1PW5A 3MGBA 3ZWCA 4F1KA 3VR1A 1AH2A 3OCXA 3PFBA 4J76A 3TW8A 2H8KA 3VYWA 4F5EA 1GYPA 4LAFA 4FDTA 4OUDB 4PSUA 4EGCB 1GCGA 2JZCA 4YJFB 1DJMA 3WLIA 1TCBA 1ZRMA 1WZUA 1QGOA 2J48A 4NU0A 2WG0A 1HKHA 3AFMA 1NL3A 3ZWVA 3ZWOA 3DC2A 4ZAFA 5C2JB 1JMVA 2NO7A 2OCLA 2GWHA 4REOA 5JMPA 3ZWWA 1Z5WA 3TPFA 1T8WA 2YZNA 3WRYC 4YAJA 3HFZA 1QKKA 2LCIA 3MWFA 2DHQA 4J1QA 4D42A 5LKRA 1G63A 3ONVA 1RPZA 1SAYA 2V6MA 4CTOA 4ED9A 1QO9A 2OCAA 1XPUA 4NH4A 3BGOS 4CIYA 3R77A 4M6WB 1P2GA 3PEYA 5E1MA 4UHEA 1YFSA 3IR6A 1M8GA 1C9KA 3ZU3A 2IXGA 5DBHX 3T12A 3M4ZA 1YR2A 3JQDA 1YJ5A 2E49A 5D85A 2O0KA 3WSWA 1QO0A 4XYEA 2C5EA 3HXWA 3MAJA 3KYCB 5SICE 3GQBA 3PWSA 1U7ZA 5CDFE 2HAEA 5AW6A 3WK5A 1CDOA 3NEJA 4JX9A 3OPMA 3ZGVA 1PNTA 4M36A 4MWEA 4C08A 4HT3B 3H2KA 4EL5A 3TGLA 1P7VA 3H4VA 2BF4A 3PRHA 4N39A 4BVFA 4AMVA 4TVAA 1GNLA 4Z2YA 3RVKA 4E1AA 3PLAE 3R7WA 1WB9A 3QG5A 3ZXIA 2P0LA 1M2GA 2R1VA 2ZTSA 4L22A 4ZTZB 4OGGA 3SYTA 3AHEA 3NDPA 5CITA 3VR0A 1VHDA 2GDZA 4K6MA 2YASA 3UUWA 2QB5A 2WMYA 1S7GA 2QSZA 4RGQA 2O1EA 4AF8A 4BJ6A 1M74A 4PPYA 2ZWIA 4WJKB 3VDXA 3ZJYA 4IIVA 5HQ3B 1OFHA 1WEKA 3I5MA 5BQ5A 2ZZNA 1KBOA 3KLOA 2GZRA 4FMDF 4Z9AA 4AJ4A 3DFZA 1J42A 4FMCB 3ECCA 3ME5A 4L9RA 1WCYA 1B2LA 3OZAA 4JELA 4EIWA 1Y4DE 4H1WA 3VU9B 3HJNA 5E9WA 4WBNA 4Q7JB 5HHTA 2QU7A 4ZQHA 1ELOA 3IKTA 3V8QA 2ZAYA 4LYJA 4ZV7A 3ZCRA 1XJCA 4HUQB 1GJRA 4PAWA 12ASA 2JFWA 1JKJB 2DUMA 5JRDS 2BTEA 3KYJB 1POXA 5AI6A 5SZHB 4DKJA 5DTJA 3MGGA 1L5LA 4TYNA 1HTWA 3VU0A 1QG0A 2V0GA 2VWPA 1YI8A 4HQ0A 1GU0A 5FD8A 1CEQA 3NVDA 2WJHA 4TLDA 5DM4A 2C98A 5LLSA 4JI3B 3UWMA 1Q14A 2PUHA 3QQPA 1FRFS 4LVOA 3DTNA 1IY2A 4WGFA 5H83A 2E87A 3BD8A 3LKZA 1QIGA 1T29A 1PZGA 2P9BA 2VKTA 4JDPA 5ECGC 3SIWA 3WHPA 4A2WA 4E32A 2NTYC 3L93A 4US1R 5B3JA 1WMSA 3ZXSA 2E1PA 3HXKA 3MWYW 4KQEA 3HEMA 2PYZA 3IDZA 2NU6A 4LSMA 4QLOA 1EI9A 1ATZA 1CP3A 1UKBA 5FLYA 4CCYB 5KTMA 1U63A 2AUTA 1RM4A 3GFQA 1MFZA 3IJ5A 5BSGA 4CH6A 3CTPA 1PYDA 1OBOA 3EXFB 1YUNA 2II6A 3AIOA 3IV7A 3PUZA 2X7XA 4JLUA 5JSUA 3DOUA 5HG0A 4UEOA 3ZW8A 1M0WA 1JQEA 2YQ4A 3GCZA 3MTDA 4DLAA 1KI3A 2NVOA 5FI1B 3PHLA 1EVJA 1PT5A 4FYYA 4J7UA 2QOEA 1RHUA 4WJZA 1M6NA 2HJHA 1O97C 1TU4A 4UAGA 4X8MA 2ZRCA 1HQKA 3EYAA 2KS6A 4G0XA 4UVHA 3HFRA 4M9UA 1K5PA 2XXAB 4DABA 3C2QA 3IGFA 3PFKA 1XVIA 5I7AA 5BUZA 1P2UA 2JAWA 5A4MS 1RQ7A 1YDEA 3JQEA 2ID9A 4WOKA 2FZVA 2P75A 5DNUA 2JIBA 3FUWA 3QVMA 4L2IA 4XPZA 5M7EA 1XTQA 2VJDA 4KX3A 5EWMA 4AZVA 1AGPA 2YVLA 4S2EA 1FUUA 1W96A 5F2EA 2DPLA 3G6KA 4L5AA 1UJ6A 2JJ2D 4IY1A 2VJPA 1M2FA 1NURA 5IXSA 5FOTA 5MN6A 4ZZ1A 3HFVA 2Z2IA 4L5IA 3ZGLA 5KMGA 3ZOZA 1E6KA 3MJTA 3LWDA 3U7QB 4JSYA 1U28C 5EXEA 2IUYA 3OFJA 3EF1A 4BWYA 1WG8A 2Q0QA 3BE5A 3DEIA 3JRXA 2RGYA 4WXPA 3LQ1A 4RTQA 4CS3A 1W75A 4GP6A 4A2CA 1BBWA 1OZFA 3M89A 4MQ4A 5JNUA 2G08A 1IRIA 1ZGBA 2NV0A 2DSNA 2OXCA 4LXIA 3NM4A 1GRQA 4ARUA 2HHHB 3GMSA 3KUUA 3U7QA 3JPWA 4C89A 2WIDA 3CRW1 4MDYA 4MTCA 4YCMA 4AKIA 1CUBA 2VUHB 4K46A 4PEVA 5DH9A 2ALYA 1R4ZA 3ZWMA 1TFRA 2XQFA 4CHGA 3PUWA 4ODIA 3U3RA 3FMFA 1EVKA 1C3EA 1UZUA 4K9KA 1HUQA 4G1FA 4RLSA 3JQBA 1GA4A 4PCLA 2JGKA 1YA4A 3K9GA 1EBUA 1SERA 1U0FA 4U2EA 3REQA 4FNOA 3O4FA 3R6WA 5IS2A 3LRXA 2Q5QA 3TFWA 3N2KB 4EHBA 1SQFA 1JXAA 3HJGA 3KR0A 5AICA 1WLEA 4NYMQ 1V3VA 5B36A 3DD1A 3GLHB 2FPOA 5FYDA 4X8HA 1LS6A 1U9JA 2AR7A 1R50A 1PZNA 2WF6A 5JWHA 1B00A 1GNRA 3V97A 5IXJA 2IYVA 1N8NA 3B9PA 3DOHA 3HO1A 4E15A 1I9CA 1UBJS 1TVEA 4WXRA 1CUUA 3S7TA 3BXZA 2E0IA 4OLAA 1V6CA 4JT9A 2QVGA 4DF3A 3W8DA 3LWBA 4HGOA 4FFLA 4X1YA 2WE8A 5ITSA 2EDCA 2G1KA 3TQFA 4LBWA 1W36D 1G8SA 2IZ7A 3H5AA 2BH9A 2WYIA 4MCIA 1L7EA 1PN3A 2AFHA 3OZEA 2GAJA 3MN1A 3EW7A 4US2R 1EA7A 3ADDA 3II6X 4D4JA 1SO8A 3IXQA 2BTQB 4X1KA 4LF7B 3T9FA 4HXFB 3TLEA 1RP7A 2N75A 2HR1A 2WIBA 1TCAA 2ZWAA 5L6LB 1UADA 2GS9A 2ZRAA 3MCWA 4XU0A 3L40A 3RBVA 1CF2O 3UJDA 4NEQA 3UXYA 3JD2A 3D5QA 3TKAA 1X86B 2X41A 3TEGA 2ZR8A 1KO4A 2C4VA 3VKWA 5KQSA 2BJVA 1TF2A 1UDRA 4PZLA 4JS0A 4P4SB 4WCVA 2FYTA 1NVVQ 4S1OA 3L43A 3DGEC 2N0SA 1XDWA 2NZXA 4LJ8A 2WOOA 1YZ3A 4ND1A 4XEHA 5IVPA 4GDFA 4F3RA 1YCDA 2OL4A 4MHOA 4RV4A 3U6BA 1JKJA 1QQ5A 1DLJA 2CGHA 2X14A 2CVQA 3DBIA 2HEIA 5B30A 1X1AA 1XWWA 4HPWA 5IH7A 3R9XB 1E20A 1P1CA 3PNVA 1OBCA 4BPBA 4H3HB 1E79D 1DO0A 1JMYA 1LC3A 2FP4A 4JJKA 3IFSA 4NAUA 3RHFA 3K35A 4HOYA 2V1XA 4JLOA 4ZOLB 1OI3A 3V7NA 3RLFA 5THQA 5ECDA 1E7MA 3Q9NA 4E21A 2FW7A 3NYRA 3NUZA 4NMXB 3RAEC 4BKRA 1BG6A 2H29A 4LQDA 5DB4A 3UMRA 4KGDA 5FV7A 3S2GA 1C7JA 4P1ZA 4Q47A 1CVLA 4MR9B 4YO7A 4Y9DA 2RGUA 2XVXA 3G49A 3P2IA 5FTKA 1G41A 4GPIB 4KR2A 2VSFA 4P7FA 4AKEA 2MSWA 3NMUF 5JASA 1WCV1 1LDGA 2JI6A 5KYNA 1PEAA 2A6PA 1KK2A 4IYJA 3E48A 4X7MA 2C5FA 5CYOA 2CY0A 1YF3A 2HCTA 2WFLB 3KKLA 5E3JA 3COZA 3VZCA 1Y8AA 2B83A 3G0DA 4Y6SA 1W44A 2C8MA 4UU7A 5L8VA 2Q3EA 1SZPA 3MWEB 2AN3A 3R5TA 5DYTA 3RRBA 1G21E 2V98A 1DWOA 2WK1A 4EBBA 2OO5A 2V3WA 3E1GA 1X7YB 2RHDA 2Z3VA 2OHIA 5AJHA 3ILXA 2GVDC 3GEBA 3O5AA 4I4CA 2DX7A 5SZIA 4C5CA 4Q6WA 1NN1A 3KSUA 2ZBPA 1G8GA 1OI7A 1KP9A 3HBLA 1UXKA 1BZYA 1L7AA 1JF8A 2PSDA 1F9EA 3BSSA 3H4TA 4C6HA 4AS1A 3PC4A 4KMRA 4O2BB 3DZJA 1QR6A 3I32A 2HK6A 1TQ4A 2HWXA 2FA9A 1C2YA 1PNQA 5AKHA 1YRAA 2CEKA 3U3MA 4PW0A 5LD2B 2UXCB 1HTBA 4K8RB 3IEUA 1HZZA 2Y9MB 3UWSA 2EP7A 4JC5A 2GM4A 2FEAA 1L5GB 3GFRA 1GN8A 4MV5A 4DBZA 1HYBA 1QK5A 2J46A 1N2HA 3AY7A 3OE7A 2RIRA 4Q24A 2Q0XA 3WLFA 2A14A 4BKQA 4ZYTA 3WIOA 2JH9A 4OAQA 4EG8A 4CH5A 2Z2ZA 1AT1A 1KDRA 1UC5B 3PXXA 3QXSA 4RL4A 1E3TA 1YQTA 5NLLA 3OLWA 3F6EX 7MDHA 4HQLA 2ZUUA 3PU6A 2H1HA 2KBFA 4IQ4A 3UAWA 5I9NA 2P69A 2FPPB 2A78A 4YR7A 1HL7A 4TMXA 3OSZA 3JALA 4YWHA 1S02A 1YCFA 3RCBA 1K75A 1M2KA 1D4OA 1MUUA 1R0CA 2BGIA 2OXEA 2PU7A 4PGMA 3RSGA 5KHLB 1YB5A 3HM2A 4TT3A 3LY9A 4YV2A 3SEZA 4F7DA 5FPYA 1QAMA 1JFVA 2JF0A 2GN8A 4JX8A 1C7RA 3D1VA 5AFSA 3KETA 2ZZGA 121PA 5I4BA 2HNKA 4E5PA 5KTKA 3G2KA 3JQCA 4R40A 1MAVA 4EUFA 4M8NE 4DV0B 1E6LA 3NORA 3TH5A 5IHXA 4MW1A 1OTXA 1YB3A 2H92A 2I4IA 3O8OA 3PTLA 1U5BA 4O4HF 4X94A 2IX9A 3WHKA 3PB3A 4EGJA 5CFZA 1NWCA 2R79A 3P26A 5KC9A 1L0WA 4Q19A 5KYVA 2O59A 3C3KA 2IW1A 1KYYA 2WWGA 4HTFB 4R2WA 3HR8A 4R2KA 2WD8A 2ZUCA 1DELA 4I1PA 5FL7A 2YKGA 3DAPA 1H8EA 5DYGA 3MMZA 1RWNA 4A2QA 2G7ZA 2VAWA 3R20A 4O4IB 4V02A 5D3KA 3F6PA 1UOEA 2IUFA 3HI6A 1Z62A 4HZUB 2B25A 4PO9A 1GFIA 3UK2A 4OMDA 3B1FA 4OH1A 3K9NA 4B6SA 4CIDA 5F21A 2GN2A 2OLEA 3CNOA 4DNOA 2G5PA 5EESA 2W42A 2I22A 3TSAA 3HCCA 3I0NA 3N2ZB 2PKEA 3UOAB 4LF6B 3VSAA 1Y34E 4OQ4A 2XBMA 3L0YA 5F2NA 3RRJA 1BCRA 2OFOA 4YX9A 1H9CA 1JT9A 1LPMA 2W2VA 3A0UA 1SWVA 2XT0A 3TR6A 3KPJA 3BFKA 2PTHA 3GIWA 4D79A 5JNVA 4UQOA 4MVWA 4S1NA 1B8VA 1QO7A 4Z0PA 1LJUA 1DZ3A 1TPYA 3ND7A 4RA9A 1W1UA 5LIRA 1NONA 4KUGA 3TN7A 1IBMB 1RRCA 3F3KA 3FSJX 1W4ZA 1OV4A 2DE0X 3FSGD 1WNLA 2NSDA 4PYJA 5HZGA 3FJOA 4FFDA 4LNUB 4GOJA 4PHHA 2BGGA 1BCRB 3GDHA 1HO3A 3PUXA 3EIXA 4G5OA 1WKBA 4Z4HA 5AM0A 5BUCA 5JXJA 2CF5A 1NT2A 1YC2A 3PNOA 1USYC 1ETHA 1V4VA 2Q9BA 3LCUA 4TS1A 4DG5A 1JALA 2J5KA 3E2MA 4OBWA 5FHQA 3T7CA 1RZRD 1C4OA 2H85A 3C4JA 1YR8A 4GG1A 4P9NA 3RACA 5JS8A 2OORC 3ERRA 3GL9A 5EKDA 1J4AA 1FP6A 1VZ3A 4JI6B 1C81A 3HXMA 3V4RA 5EXSA 1H0RA 2PZLA 5FWNA 7MHTA 1XTUA 2LTAA 2WAYA 2PSJA 1G0NA 2VQDA 4K6GA 3SLKA 1Z2CA 3TS1A 4UOEA 4Y6LA 3R7LA 4PSAA 3PX7A 1FQWA 1OU0A 2A67A 1JR3D 4NE2A 2CL0X 1SOUA 1PL0A 4DR3B 3TBFA 5AJTA 4H2YA 4HI0E 4IIFA 1EKXA 3HP7A 4CL3A 1FOEB 3LTEA 4NICA 2BN4A 1OLXA 2H9YA 2A35A 2ILVA 2IF0A 2B37A 2FX5A 2W6PA 2ZQZA 4LHEA 4BP3A 3D6TB 4HNTA 3CLHA 4PTYA 3E3LA 5IK2A 3BDVA 5EXXA 3TE7A 1IUPA 1TO1E 3QVXA 3J7AC 2QI9F 5DMXA 1E24A 1H4SA 1J9EA 1NG1A 4M1OA 5ALMA 1O7JA 2JJ1D 3KAQA 1UFKA 5A7GA 3A1TA 3QBDA 2WSSD 1QYVA 3PHIA 2H18A 2KBEA 4NVRA 4HEA6 4PIPA 3DBRA 4TYPA 4AYWA 1T2FA 1TZ2A 2VYVD 4AUNA 5C53B 4RE5A 1II8B 1V3UA 2AHRA 1VA5A 4QUKA 4BQQA 3ZDCA 2ARKA 4H7PA 5CLIA 3JAKA 2RCYA 5CVDA 4DL9A 2X77A 3ROGA 4E33A 4TKUB 3EPJA 3G9QA 2G07A 1N5IA 1UK6A 2GKOA 2WG2A 3DA8A 4TL7A 1CT9A 4UM9D 1E8MA 3STUA 1NDHA 2ZI9A 3FLMA 4D92A 2A5JA 3FSGA 4BOYA 4HDNA 4LE2A 5HS4A 2I71A 1U3FA 4E5UA 1ASYA 3DZHA 3O94A 4MUAA 4YB8A 4CLHA 2WYWA 4J91A 3S27A 3K2BA 2OYCA 3TTSA 4P75C 1JFLA 3GA7A 5E95A 1FL9A 1R4NB 2QBYA 3MCUA 5DYNA 3B5IA 3MSXA 1XZMA 2I80A 2XIQA 4WESB 5A03A 2G6BA 1MR3F 4ZVUA 5KWSA 3HJUA 2YQZA 3DZFA 1NKSA 1A9XB 5JHGB 3V9AA 1SXQA 1QVWA 1YK0A 4BLTA 1MQ8B 1MJ5A 2Q2OA 3B8HA 4HAIA 3LTNC 1PZXA 5BRNA 3EFHA 2NX2A 1XDBA 4MS1A 1AKVA 4MUJA 3N0RA 2NZYA 5AWFC 5JRJA 3U62A 2X6TA 4F1WA 2JCSA 1ONOA 2J41A 1O8CA 2WHXA 3B9RA 3QKIA 3P2OA 2VJBA 4JUBA 3NANA 3BKWA 3QKSA 4KLNA 1N3BA 1LPBB 2YY7A 1HLFA 5KMGB 1Z2AA 2QVYX 2A9OA 1GUZA 3F49S 3MB8A 1IN5A 1VOTA 3GI1A 4I08A 3MBOA 1RMTA 2ATVA 4DCTA 4NBTA 2QRLA 4A23A 1QX3A 4F92B 4E7PA 3JQ9C 1PJ4A 2QPOA 1TT7A 2Z3ZA 2A59A 4B83A 2YRWA 2FMXA 2O3RA 3V2GA 1FLVA 4ZYZA 4GMFA 1E9BA 4KW7A 1PNVA 1YQ9A 2P9TA 5K6TA 1ST3A 1T2UA 5TQVA 1X9IA 1T3GA 3TBKA 1N2XA 2QRZA 1XCPA 5A4AA 2P62A 1RHQA 2V4ZA 3KO8A 4JYMA 3A3PA 3EFEA 3D2CA 5ERXA 3BT7A 3LL4A 1I4TD 4BBJA 2DWOA 4GM1A 3DM5A 2JFQA 3D7SA 5KVAA 1H2RS 3RYCA 3LBNA 5HUJA 1SY7A 4K5QA 1NVVR 3N75A 5DW0A 1IM2A 3PV0A 4IKPA 4CLOB 2ONYA 5HP4A 4FWBA 1DXQA 3AETA 1ECPA 2ZYWX 3EGCA 1VJDA 1MJGM 4HEA1 4QRDA 2Q07A 1N1GA 4XU1A 3B6KA 4I50A 4O1MA 3BMCB 3U3DA 3UANA 3HU2A 3ESBA 1FXWA 4CODB 4HSEA 1E7SA 1Q83A 1WXEA 3JD3A 2Y6UA 4L51A 4RM2A 4Q9IA 3NBAA 4L9SA 1PV4A 2CLDX 1SUFA 2IYAA 4LQCA 3WVNA 4KXWA 3EAFA 1SD5A 2CLCX 1HM5A 5JROA 2PD4A 2HDOA 4ABTA 2FPLA 4YAFA 3H13A 4W4TA 1AA9A 3AV0B 4YC7A 3QLUC 4DMMA 5THKA 1YVUA 2V5AA 5IC6A 2CLMB 3ADBA 1ZLXA 2BONA 2COKA 2CKMA 2J7PD 4IRMA 4DARA 3S28A 3H1FA 4ZQEA 4BUZA 1H2BA 2OBMA 2JH3A 1PUIA 2JRLA 4GBMA 4CG2A 4ENTA 4RTLA 1ASZA 3PNPA 4HBGA 3O0TA 4MRMA 2ZCVA 3RVNA 1JJAA 1HEIA 1N2JA 4GVPA 3ED5A 2D3WA 3EUFA 4QGSA 2JL1A 5I51A 3Q5GA 3BXFA 4E5VA 1OBFO 3HACA 3GHHA 1YIAA 3N9IA 4CMIA 3LSSA 3QVLA 2GEFA 4UD6A 1EUDB 2FMHA 3QU7A 4FBLA 4YH1A 1G6OA 5DI3A 2ZYVX 3W79A 1KYVA 4MCHA 4MV0A 4DBVO 1ENOA 4KUEA 5I5GA 3E23A 1GGKA 3A4NA 3B1XA 3IIEA 3VR6H 3WZMA 4LF8B 2BLNA 2IEZA 3GVHA 5G1NA 1TA4A 1BS2A 1TM3E 1K27A 4UOZA 1DC6A 1VBFA 3P52A 1KP2A 3PCXA 5KNDH 1TA9A 1NW5A 1BMFD 2YWEA 1MTZA 1VB3A 4Q9NA 4EUEA 4PFSA 1N0HA 2FG5A 4CQMB 3FR8A 1FNCA 3RUDA 1C1HA 4OD0A 3UOGA 2OPHA 5D3MB 1ZM4A 3LPLA 2A7XA 5EPUA 5ER9A 4CVNA 1D6MA 1WKVA 1TKCA 3GNTA 3ONFA 2WKSA 3NCHA 1N7IA 2P8SA 4X3OA 1DUSA 4M8KA 1NVAA 2NZWA 2Y76A 3DFIA 4PVDA 5M5BA 3CJRA 3JYQA 5JVDB 3PX3A 4N49A 3E0XA 2JFNA 4KDFA 1P7PA 1T2VA 4KXLA 1VRVA 2O1XA 1LX6A 2F3UA 2GASA 1C0AA 4AJIA 4IJKA 3CN9A 3L1IA 4QO7A 2O8DB 2WQZA 2Z4TA 4LDNA 1FS4A 3B1VA 4Q16A 5F9MA 4GZ5A 4AMGA 3EZ9A 4WZBA 1YZGA 5JI2E 1EFAA 2VDRB 2C9ZA 1B41A 2QN8A 3V8LA 4KE8A 4YDRA 3JSXA 1YVEI 4DS3A 4X97A 3M34A 1U2TA 1CVRA 2XQVA 3I04A 1L5WA 1ZCFA 3LA8A 1GKYA 1RWMA 4I5IA 1KAOA 4INAA 4UJ5A 3U3KA 4YQFA 5LOVA 4OMCA 1NHGA 2WABA 5F3WB 1OMOA 2VTBA 1DUIA 4PR0A 3ZNNA 2BGKA 2PWPA 2QDKA 2IDJA 1PIWA 3T5GA 3U26A 4DJJA 3EMDA 3GRAA 1OILA 3KLNA 1YB2A 4HGRA 4DY4A 3IA7A 3KE9A 1XVAA 3ILHA 1N6LA 3L0ZA 4D6PA 4F7WA 3OG9A 4BB0A 1B0PA 1EDBA 3CEAA 3KZNA 5EJMA 1VE5A 1IHDA 1LU9A 2ISSD 1I01A 4I8DA 1PHRA 4MMXB 1NKTA 4Q7EA 3CJTA 3IV9A 4QDOA 1NX9A 5BWMA 4FUQA 3ZXYA 2X4GA 3Q8KA 2A5DA 1YJAA 2JCYA 4DY6A 2BHNA 3GFOA 4FI3F 2BHTA 2FZGA 4QELA 4QPNA 4BXOB 4QRIA 4HY3A 3IS3A 3NBMA 3ZIAA 4QUGA 4XOUA 4D8YA 4AI6A 2G8NA 4GDMA 1OT3A 2A86A 3U4GA 1O0BA 1GV0A 1PR4A 2RGXA 2QJRA 1IVSA 1E89A 2A8YA 1J9GA 3GJQA 1QF9A 4QHTA 1IN4A 2XXBA 4DSTA 2UVDA 1K7SN 1TJYA 2V3VA 3IMKA 5HFNA 4KLRA 2H3EA 3A6DA 1XUOA 3QE3A 3CX6A 1QYCA 2Q1UA 1QH8B 5CEFA 4Q1VA 1YRWA 3QKUA 3I01M 4JKOA 3X44A 3V8PA 1J00A 4QAJA 3N3BC 2A9JA 4XQGA 2PMBA 4G5RA 1IG3A 2RGBA 3VZDA 3UOWA 2Q8PA 1DBVO 1Y33E 4DM4A 1D04A 3U13A 4QG3A 3FHTA 1TQ8A 4LISA 3O9ZA 3DJYA 2Z98A 5B1DA 5BWNA 1E2LA 1T5DX 2ONKA 2AH5A 3O1JC 1ECJA