1GGMA

Glycyl-trna synthetase from thermus thermophilus complexed with glycyl-adenylate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
442
structure length
442
Chain Sequence
AASSLDELVALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAWWRRNVYERDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNAKARYWTPPRYFNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNVLDATSRKLGFGIAQIGKAFRNEITPRNFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSRENLVPYQQPPESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVAVIPLVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKDGTTRLKDTVTVRDRDTMEQIRLHVDELEGFLRERLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Glycyl-tRNA synthetase uses a negatively charged pit for specific recognition and activation of glycine.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ligase
molecule keywords Glycine--tRNA ligase
total genus 115
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 1999-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1ggmA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 1ggmA02
4YYEA 1X2HA 4YRGA 2DXUA 3A5ZA 4HWPA 2ZXFA 4HVCA 4TVAB 2EJ9A 3UGTA 3FJPA 4TTVA 4P71A 2RHQA 1ADYA 4YROA 4H2UA 1B8AA 2EL9A 3HY1A 4DQ2A 4CS2A 2FYKA 5C52B 1KMNA 4WJ4A 4KQEA 2DZCA 4E51A 2Q7HA 2ALYA 2DEQA 2ZINA 3QNEA 1BIBA 2ZR2A 3OD1A 2DQ0A 1H4QA 3IKMB 3KFUA 1ATIA 1YFRA 2EWNA 4YRSA 5C51B 2CJBA 2P0LA 1WPYA 1KMMA 2ZGWA 4HWSA 1H4SA 2C8MA 4OLFA 3RKYA 3VQXA 3A7UA 2ZZGA 1HC7A 1EIYA 1EVLA 3MF1A 4TWAA 2ODRC 2DTIA 3NENA 3QO8A 3HRIA 1G5IA 1E24A 1H4TA 4YCUA 4UP9A 4WF2A 3VBBA 1X2GA 3RACA 3EFSA 2DZ9A 2J3MA 2HNIA 3ERRA 3RGLA 3REXA 1WQ7A 4H2SA 4UPAA 4P75A 3A5YA 2ZCEA 4DPGA 3TUPA 3V7RA 1FYFA 2DJZA 3QO5A 1V95A 1G5HA 1PYSA 4H02A 1N9WA 3PCOB 2QHSA 3V7SA 4XU0A 3VQWA 2Q5IA 2CJ9A 3HTZA 2ZNIA 1USYA 3HXXA 4XTVA 1EQRA 1JJCA 4RQFA 2ZZFA 4P71C 4Q15A 4YRMA 2AKWB 3WQZA 4YPFA 4XU3A 4BWAA 3I7FA 4Q6GA 3NEMA 4XEMA 4XTXA 4YP0A 2C7IA 3IKLA 2I4NA 1KOGA 4K87A 2IY5A 1ASYA 4TVAA 12ASA 1B70A 5ELOA 2RHSB 2ZT5A 1NJ8A 4P74C 1WLEA 1NYQA 3HY0A 3VQVA 1C0AA 4HA8A 2CGHA 4P72C 4HWOA 2RHSA 4H2VA 4XEOA 3HFZA 3RIRA 4XU2A 1Z7NA 1X01A 3NETA 3RF1A 2DDZA 2DU5A 3TEGA 3P8VA 2AMCB 1EIYB 2ZNJA 1B7YB 2DTHA 2CIMA 1EVKA 2I4LA 1IL2A 1QF6A 1WNLA 4YRNA 4OP0A 1BBWA 2ZIMA 2ZZEA 1Z7MA 3REUA 1YFTA 2CJAA 4AH6A 4CS3A 4H2XA 4H2WA 4UP8A 4TVYA 1B70B 2DTOA 2E65A 4PG3A 3HXZA 3G1ZA 3W3SA 1NJ6A 2PMEA 1SETA 4TQDA 2ARUA 4P3OA 4ZTZB 1H4VB 4P72A 4YRFA 4YRPA 4TQFA 3A7AA 4P75C 4P74A 3L2ZA 4G85A 2DQ3A 3BFMA 1B76A 1HXDA 3EFRA 4WJ3M 1VQZA 4ZIBA 2ODRD 2QHTA 2Q5HA 1SERA 3IALA 4G84A 1PYSB 3UGQA 1G51A 3BJUA 1EOVA 3LSQA 2LW7A 4CH4A 2E5AA 3A74A 4CH5A 1YGBA 1NYRA 4UP7A 3MEYA 5ELNA 4XTYA 11ASA 3HXVA 3VQYA 4CS4A 4YCWA 3E9IA 2DU7A 2Q7EA 2J3LA 2ZT6A 2ARTA 3HRKA 2E41A 1YFSA 4KR3A 1HTTA 3UH0A 4RQEA 3M4PA 3V7CA 2IY5B 2ZTGA 3HFVA 2E10A 3A7RA 4P73A 3RL6A 3PZCA 3E9HA 2ALYB 2ZT8A 4H2TA 4PHCA 1NJ1A 2EJFA 4LNSA 3RKXA 2ZR3A 3QTCA 4KR2A 3L4GA 2XTIA 2E3CA 4CH3A 4RMFA 4XTWA 4YRRA 3HFZB 4YRQA 4YRJA 2ZT7A 4L87A 3V8LA 4YRIA 3R07A 3HXWA 2Q7GA 3PCOA 5KNNA 1X55A 4XTZA 4BW9A 2AKWA 2XGTA 3MF2A 4YDQA 2EJGA 3HXUA 3NELA 3CMQA 1X56A 4HWTA 1E1TA 2ARSA 1E22A 5F5WA 2DKGA 1LYLA 1NJ2A 4YRKA 2P5IA 2I4OA 4RDXA 3LC0A 2DXTA 1L0WA 1E1OA 4XTUA 5K1PA 2I4MA 3UFGA 3P8TA 1BIAA 3V8KA 3M4QA 4XU1A 3V8JA 1WU7A 1ASZA 1SESA 3P8YA 4EX5A 1YB3A 4P73C 1SRYA 3L4GB 3RKWA 3QO7A 1USYC 1GGMA 5K1XA 2E1HA 4YCVA 1ADJA 2PMFA 1WYDA 2ZIOA 4NCXA 3ICAA 3A31A 4H2XB 1JJCB 3HXYA 2QHUA 1RIQA 1NJ5A 2E64A 4YRCA 1EFWA 1X54A 5C53B 1B7YA 1J5WA 4YRTA 2EAYA 1WQWA 4CH6A 4K88A 4TVWA 2G4CA 3TEHB 2RHQB 3LSSA 2AMCA 3IG2A 3L1AA 1W66A 4P3PA 3DSQA 4HWRA 4H2YA 4K86A 4X5OA 3TEHA 4ZTUB 5E3IA 1NNHA 3A32A 4YRLA 2DVEA 1BBUA 4P3NA 2QHVA 4WI1A 4YREA 4J15A 5HGQA 4O2DA 4EO4A 1QE0A 3RUXA
chains in the Genus database with same CATH superfamily
5KX5B 3PTZA 5JS8A 5GM2A 2XIQA 2Z98A 2J7KA 3SXPA 2WIDA 3QE9Y 1DJPA 4B0PA 4FE4A 1E5QA 5D84A 1XC7A 3KKEA 2H5EA 4X1KB 4R8LA 2GCOA 3TK1A 1DO8A 3QVTA 3N0TA 2C95A 1GUDA 2O14A 2CFTA 2W48A 1VP9A 3ODGA 3OZDA 4II2A 1U2TA 2XXBA 2ZR0A 4RJ2A 3OHSX 4CEJB 2CMHA 3OCUA 3UGTA 2WWFA 4C9BA 1VJ5A 4CCYA 2GFHA 3EQ9A 4JIGA 4DQVA 2P0AA 4LJSA 5DNAA 3THXB 1W1UA 5F33A 3AHJA 4BU1A 5BSWA 2OV2A 5DULA 3ZY3A 1Z83A 1IPFA 5BR1A 3C8UA 4A8HA 5ILOA 3AVVA 3JY6A 2VC2B 1KVQA 1AHHA 4UOQA 5TV2A 2JAUA 3QVKA 4HEQA 1LFAA 4L5BA 3ZWBA 1MC4A 1GILA 5KWEA 2Z9BA 4TWBA 4JC8A 5CW1A 5DYWA 3UT5A 2IBSA 1EGAA 5IVKA 4MQLA 4MR9B 1F4VA 3A6EA 5F5NA 2B82A 4OCZA 4KQEA 2QUBA 2B0CA 2DZCA 4KWEA 4BV8A 4ECEA 5ICCA 4FOLA 3PR1A 1YC2A 2J9ZB 2QNBA 2YMQA 1W93A 1P4JA 2Q7HA 4WDRA 1U2DA 5CCBA 3WJ2A 1R6UA 1K27A 3BIOA 3E23A 3Q7QA 4K2AA 1BMQA 2JI8A 3PG5A 4JHXA 1Z4IA 2DQ0A 2NZ8A 4RSHA 3AZPA 1L5ZA 3QGMA 2YFYA 2DECA 3CSDA 3UHFA 1P4AA 1IZYA 4UAJA 1XZDA 3EA5A 4GR5A 2BMDA 4OK3A 1MH9A 1NI5A 3FR8A 4XXHA 4EARA 1SU4A 2ZGWA 3AM4A 3OU7A 3FYTA 4KK3A 3EOBI 4EJMA 4HWSA 2IYRA 4GLFA 1PW5A 2XKJE 2ODEA 3O9VA 4FGZA 5IULC 5K20A 3DLPX 3KLPX 2AFIE 1FRNA 1RBYA 1WDTA 5BT9A 2IZ6A 4ACBA 4EG1A 1KRXA 2JBAB 5DISB 3DMFA 3WNZA 5F64A 3RS3A 2RCNA 2ZRLA 4AZSA 3JTEA 1LPAB 2MU1A 3RVNA 2GI4A 3FNIA 2F3RA 4CEHA 1FFEA 2IOFK 4EMUA 4G56A 1DGQA 1NR1A 1BQ3A 2FMFA 1QC5B 3C5HA 4ZOBA 3IQDB 2ZJ5A 3RU3A 4OGFA 4M6WB 1H6AA 2CKDA 3W5SA 4CTNA 1OLXB 3V34A 2ID4A 4B32A 1H4TA 2R8PA 5AVOA 4HZUB 1V1MB 4D8VA 1G8JA 3ODPA 1HXHA 3JYNA 3T12A 2DZ9A 1T0IA 3QQPA 2IGBA 2JLBA 1D3AA 4YCMA 1LV8A 1S3GA 4C4SA 4XJTA 3PRJA 2UZ3A 4X65B 3JYLA 3IURA 3EEQA 3TDMA 4I14A 5GIPE 3MOSA 1I1HA 1SNYA 4J7AA 4ZO7A 2VHWA 1I6KA 1R4NB 2AGVA 1CDDA 5EJMA 1NF9A 3WRVA 4YMHA 1T0BA 5A9SB 4HMOA 3OQOA 2E6KA 1XTPA 4J4HA 2ZYUX 1G5HA 5LC1A 1PYSA 5F35A 1N4AA 4Q4CA 5C8XA 4H7IA 2JJ1A 1QLJA 2AS0A 3D6HA 2JD1A 3KV1A 2BEWB 1WULS 3I62A 1SQ5A 4JLAA 1GKKA 3LW7A 4H16A 1FDVA 2X7HA 4XSHA 3S1SA 1TVEA 4O08A 4OX9Y 4LVLA 1FCJA 1UWCA 2C7BA 2IDKA 2IX9A 2ZE8A 3AJDA 5EWMB 3RG8A 2X19A 3K0BA 4AI6A 2R97A 4PLTA 3EDRA 3RVMA 1USYA 3EZYA 3E18A 3TI9A 4WACA 1QHFA 2VDVE 2UZAA 3LQFA 4LYDA 3P19A 5HRCA 2PL3A 4M0LA 3A25A 1F2VA 2H9YA 2QI9F 2VOJA 3RS2A 1Q15A 1R8JA 5DBOA 4DV1B 4C7MA 4YPFA 2QRLA 4F91B 3E9NA 2WQ6A 3WJ7A 1EAMA 3GGJA 1I3KA 2Y0DA 3GROA 1AZSC 1D4FA 2C83A 4RPJA 2QRJA 2DFVA 2DTXA 3AM3A 1NW9B 3RVBA 2AQIA 2NX2A 1KEPA 1DTEA 1L7RA 1R6TA 3U3XA 1UJMA 3AR6A 3CN9A 1NN1A 3ELBA 3KB1A 1FZQA 1K8ZB 1NVXQ 3BTVA 2N0SA 3DHVA 1VJ0A 4MKHA 5BUCA 3K70B 1KKLA 1CJBA 1PGJA 4GI5A 5DK4A 4MIYA 4M21A 2R65A 5JQGB 2GJAA 4YJHB 1G4AE 2GBPA 3M6WA 4MVCA 4A0FA 4US2R 2GARA 3U6BA 1JFVA 3IBSA 3QXJA 2LZ0A 5IM5A 3FPKA 1CUBA 3R7AA 1H0RA 1YBVA 1JQLB 2WE8A 4B8YA 1X1TA 4Q24A 1IBSA 3IV6A 2HJVA 3WIEA 5B6IA 9ABPA 2AG8A 2P4SA 3L8YA 3V1TC 3DAYA 4JU8A 4TQ9A 4NYMQ 1Q0TA 2IUFA 4J76A 1EZZA 4QQFA 1G2OA 3KPUA 4YQZA 2DWPA 3LOPA 3Q7RA 1PX2A 2NO4A 3PJDA 2VHUA 2X8JA 1LRJA 4LJKA 4C7OB 3TEFA 1PYDA 2X5OA 3T1QA 3LGAA 5BR7A 2JRCA 5FA5A 3SK0A 2I7TA 1Q2UA 3LWZA 3HB1A 4GPBA 4P80A 3PJGA 3PXBA 4YWJA 1OH5A 2QROA 5L7WA 2Q1TA 1JDBB 5D01A 3PTLA 4IMRA 4R9RA 3BMNA 5DMHA 4A1OA 2JLXA 2XXJA 4C7OA 2AHOA 2O8FB 1EUDA 3TEGA 2O7RA 3CJTA 4OQLA 5HW0A 1T9AA 2XQJA 1U28C 3P9RA 4TMKA 5JCXA 5KYKA 1Z22A 4GOJA 4F96A 2DTHA 1PNQA 2HIHA 3DE7X 3R3UA 4X8MA 4AS1A 3A3PA 5B3KA 2CIMA 1JHOA 2O8VA 2SHKA 3H2KA 3I61A 4G67A 4ER0A 3IVMA 2FR0A 2GCOB 3JQBA 1A9YA 4MAAA 4YJ2F 1IRIA 1UCFA 1FMFA 4EAAA 1OWLA 4OA8A 2ZIMA 3AOEC 3KOOA 3PFHA 2V45A 2ZJ1A 4AH6A 1BH6A 1G3RA 2UZ1B 4L3VA 1Y3BE 1FFHA 5LOVB 2KJQA 1X7XA 3QELA 4H2WA 3JQ7B 3RAJA 2Z2IA 2IPLA 3W2EA 2IPAB 1ZD3A 5I3CA 1RCUA 5ALEA 1ZH4A 4ZYLA 1A9QA 1E32A 1BHJA 3HXTA 3SIPA 4E7OA 2Q9AA 3G5MA 3OY7A 1YSCA 2P65A 4B5LA 3PHGA 3R23A 1QLWA 3UATA 5DHRA 2XVAA 2H0AA 3DL4A 1HYGA 2EHDA 4B3FX 2F00A 1YK0A 1FU8A 3DZKA 2I03A 5A6VA 4M1QA 2ZRMA 4TKVA 2V03A 4YDHB 2O3JA 4FOPA 4E5YA 4HNTA 4ZZ0A 3ZKWA 4CIDA 1OV6A 4A0SA 4BP8A 5IM4F 1E9AA 4KHZA 2G9QA 1MRZA 3EPPA 5ARDA 1Y1RA 2YVLA 1BMFA 3DEKA 5T8KC 3WMWA 3GRPA 2OGZA 1JW9B 3D02A 1FJHA 1PNOA 2IHJA 3ZHVA 4DAEA 2ZRDA 1NF2A 1SKUA 1NC3A 4J4BA 4OYLA 3BWBA 4OREX 3RH0A 4HAOA 1A3CA 1PD1A 3EVBA 4I5FA 3UV6A 1NXWA 5HKBA 3HY4A 4G84A 1PR6A 5LQCA 3DYBA 1QU3A 4RTOA 1MZVA 3F6CA 4GX1A 5ES3A 1U8AA 5SZIA 4O4JA 1TXGA 1ML3A 1RW4A 4ER7A 1B6RA 1E7SA 2ACEA 3HCPA 3E15A 1GPKA 2MT9A 3KUDA 4QBGB 4ZI7F 2Q2NA 2FE4A 1BCSB 5DNUA 3C5WP 1OX5A 2BVNA 4PSCA 5FBRB 2BMWA 2QIPA 4UHCA 5SV2A 3SC4A 5HJ7A 4F4JA 2OZEA 1MOSA 1ZMOA 3QELB 1DCFA 2P8SA 2C59A 3CVJA 3D7MA 1CZHA 4B85A 3SJZA 1IQUA 1Z8HA 2OV6A 3HYNA 1OH6A 1JFFB 1V1MA 2IW3A 1Z5NA 2HLHA 1GG5A 2X86A 5BP7A 2BMVA 1ZBDA 3MEYA 4NESA 2F9MA 1AA9A 3GW8A 4GZ6A 3KKLA 1Z4NA 1OLUB 2VNIA 3AL3A 4XGRA 3TWOA 3EIOA 5HIMA 5KJCA 1T1SA 1SXGA 1PD0A 1V11B 2IPNA 2WG2A 2XRFA 1FTSA 3I6BA 2VDRB 3TL3A 4BGVA 5FWYB 3S8YA 4Z4QA 1D1QA 3R3HA 3UA3A 3AJEA 3BXOA 1TK3A 4CKZA 3Q3CA 3OURA 5ALVA 3I58A 3ROZA 1KYZA 2BEUB 4F4UA 1K0FA 2OC4A 3WZ2A 3HZHA 4R1MA 2LVBA 3UAGA 5K0SA 3I5YA 4A7PA 1O6BA 1PZXA 2O2CA 3TZBA 3ZQ4A 4QLBA 3C8MA 3EXFB 5F76A 1L7BA 1TT5A 5JJCA 5IAJA 3EVNA 1PZFA 2XB4A 1LW6E 2KQUA 3F4LA 2NUTA 2WOJA 2C4KA 5JAPA 5KHLB 1PEYA 2P62A 5JXIA 1XA0A 3MTIA 1OYWA 3H0KA 1AZLA 5I7FA 4ZEOA 1GADO 2NO9A 1GT91 2PYDA 1JEOA 4K0KB 3IQWA 4MMXB 4XI9A 5K6TA 4TSRA 2YVQA 4HDQB 4CQNA 1JQ3A 2HMWA 2HQRA 1G5PA 5SY4A 3PZCA 4DFDA 4LVJA 5CR9A 3N0XA 2ZT8A 1P0MA 1TCBA 2J59A 2WJ3A 2EBHX 3DAGA 5FBZA 3O8QB 3S55A 4BNIA 3K15A 3TQTA 1PNTA 3GG9A 3T5PA 3RK0A 4G5XA 1DO0A 4UXHA 2DRIA 3OU6A 4J7XA 3EUWA 3IOMA 3LBAA 3KR1A 4JUCA 5C31A 3L4GA 4NEHB 3RDPA 1GU1A 4KQ6A 4KIWA 4WEQA 1LVGA 4EATA 1V6AA 1CV2A 3M2TA 4PPQA 4D3ZA 4YRIA 5LIPA 2REQA 3FA2A 2R68A 4HDCA 2A9KA 3A9WA 4O33A 1LBTA 3C6KA 5J4LA 5HG0A 1OFUX 5AW8A 2GKGA 1LQUA 2VQ3A 4LF5B 4NDZA 3GLHE 5JZMA 3RRBA 1FRFS 2WSSA 2Y0PA 4WOPA 3EIQA 4F7WA 1E1TA 1NOIA 3SHFA 1XMIA 5KTKA 1E22A 1PK9A 2I9PA 3RFVA 1ITZA 5KDDA 2DKGA 1M8JA 2JCGA 1RS0A 2XT0A 2IYFA 2OCAA 4FDTA 4ON9A 4DBLE 2FQQA 2PR7A 3BTSA 1EMDA 4NK4A 2JA1A 1E4VA 3PNPA 3UWMA 5JD5A 2B35A 2BGNA 4HEHA 4JLKA 4FFMA 1ECGA 2QPOA 4M9RA 1QFXA 3AWDA 1VI5A 4TSFA 2QD5A 4D74A 2IS2A 1W9MA 2HHLA 3IIEA 1X7WB 3IT1A 2OMKA 2HRZA 3M8KA 1XQ1A 2C4MA 1JQKA 4E4TA 1U11A 2HY7A 3BIJA 3QW4B 5KNDA 2JIMA 1JS1X 3KBOA 4CL3A 2RK6A 2IHZA 5KVSA 3ZOZA 5CBPA 2C3UA 2O8NA 1TVCA 4PU0A 1X7YA 4JUIA 1WU7A 3P2KA 2CL6X 3CPEA 1I3LA 1KI7A 2HU5A 3B1FA 1M2WA 2YH2A 4MV0A 3VO1A 5D51S 3ZHUA 4D92A 3LC1O 4EWLA 4U7DA 3RUCA 4UVEA 4DEXA 4R8RA 4BUZA 2WUFA 1YJ8A 2ETXA 5ELLA 3DDOA 2DWQA 4ANFA 4AXXA 3B48A 5AI4A 4DSOA 3GELA 4D8TA 2NPOA 5FTNA 4DQKA 3ESBA 4HX5A 4WWHA 4FX2A 4CKBB 1C0IA 1UFVA 5DT2A 1UOPA 4AP6A 1XRJA 4LOHA 4I50F 1TX4B 4F7DA 3C3BA 2Q3BA 1T9BA 3UJBA 1NVBA 4FMBB 2GN8A 3ILSA 2NZYA 1YE5A 3HCOA 4ER5A 4JLMA 1RIQA 4L3OA 3D3WA 4RX1A 2J48A 4YRDA 5G1OA 5M2QA 5EZYA 4DNPA 4WAUA 3DVRX 4WZAA 5EJ2A 4CG0A 2GAOA 2FMXA 3ZJ5A 3A1CA 4OSOA 1UIRA 3CLSC 2ROQA 1HMPA 2XE7A 3DGEC 3PFBA 5D7NA 4YAIA 2Q4TA 3ER9A 1NE2A 4K40A 3ZGYA 4O4JF 4P92A 1X1CA 2EOAA 4MUAA 4NQZA 3BJEA 3GX1A 3QFFA 5JR3A 2IF2A 3KQYA 3PLNA 1HEUA 2QX7A 4HI0E 5FO1A 5AVTA 3R7DA 4WH0A 5IKEA 3L04A 4TVWA 3QG1A 4CU5A 5L3VA 4Z4IA 4C3OB 4OPMA 1DADA 1Z9BA 1LI7A 5F1PA 3PEVA 2WYIA 1T2VA 4H1UA 2HQ1A 1ZA1A 4X63A 1ENYA 1Z7WA 2Q6VA 2JK0A 4OI4A 5IZCC 1W25A 2BF7A 4L7VA 2R5FA 3JZMA 2PL5A 1XVUA 3R0QA 2ZRKA 4EM6A 5EKSA 1PP4A 1EFRD 4CWAA 2PIDA 2WPNA 1OC2A 3AESA 3WISA 4C29A 4KQMA 1T2CA 3EWAA 2J6BA 3E48A 4WK6A 1IMJA 1RZ3A 2OGUA 3RYHB 1GR1A 1JKFA 1YAHA 2C0CA 1M72A 4O02B 3OEHD 3ZXIA 3WIUA 2DVEA 1B14A 4LBVA 1Y3AA 4TV9F 2O0LA 3NBZC 3CX8A 3UK0A 3W3ZB 1J20A 4D0NA 1XKLA 5CH5A 1UKVY 3TCNA 1IBKB 3I09A 4EO4A 2V7XA 1N5KA 4OI2A 4Y2TA 1MB4A 3GNSA 4HDKA 4QXPA 4RF3A 3N6XA 4KNYA 3K0AA 1SCUB 3VGPA 4I6GA 1E3EA 4UVGA 2J0QA 2W11A 4OL9A 5DRYA 2XXAA 4CUKA 4A03A 4PG8A 3QNWA 2DXUA 5CLFA 2EZTA 4XJXA 4RNDB 2EW8A 3LQKA 4OA5A 3F6RA 1TOAA 4REOA 2VLIA 2YMPA 4LDRA 3PENA 2PHZA 1AY0A 2CXSA 3TX6A 3QXGA 1XLWA 2ZR9A 4FNMA 1BKSB 5WRFA 3O8OB 1SKMA 5BSKA 3U61B 1YCFA 3PUJA 4EO9A 2EGUA 2V55B 2WHPA 3GJ7A 4DZZA 4Z4CA 1YRLA 1VJRA 3KJXA 3Q9SA 1OH7A 2DPXA 2YNMA 4BV2A 1NA5A 4QQKA 3I0MA 1XCPA 4E2ZA 4WSOA 1BD3A 1H8EA 4D3FA 3TLZA 2XMBA 4NBNA 4WL0A 4ZVNA 4CS2A 5AXBA 3VUEA 1ZH0A 3X2SA 4PBTA 4GSYA 3B6JA 1SELA 1T2AA 3X43A 4CDRA 1F12A 1CIJA 2P5YA 1S4QA 1B2RA 2WR8A 4G01B 3D4BA 2C8KA 1E3TA 3RKRA 1BIBA 5T57A 4JR0A 1H4QA 3RF6A 1YO6A 1FXUA 1JXAA 2NG1A 3A6DA 1JEJA 2H2HA 3AEKA 3K9NA 4J1TA 5B5SA 3I6QA 4UUOA 3TR6A 1UK8A 3QU4A 3KO8A 3U56A 1DRVA 4QXAA 1PS9A 1MHTA 1D2MA 4N03A 2F1OA 4PLGA 4Q6WA 4CKEB 3DV2A 1AKRA 1RMYA 1D2EA 3Q9UA 1GHTA 4CDGA 4J0DA 3V7YA 5C4IA 1A5TA 2VWHA 1T34A 3ABIA 4E2WA 1FTNA 1IZZA 1ADGA 3LTNC 3LE8A 3H8WA 3HJNA 1V45E 3C6BA 5KQRA 2O8DA 2G0AA 1E3LA 3B3JA 3G17A 2OCLA 1YF3A 2C0QA 2EAUA 4KZPA 2DPMA 1TC1A 2RJ3A 2QBYB 5BN4A 4AT1A 2WZBA 4Q4JA 1REQB 4WHMA 4C87A 5D5PA 3LRXA 2DWOA 3AWIA 3NENA 3NHBA 1A5BB 1K88A 2H1SA 2ZROA 3JWIA 4RVGA 3TL6A 2EXXA 3D8RA 1V8DA 3B7WA 1AQIA 3K7EA 2CJYA 4I6JA 2O8CA 3B7GA 4HGOA 3HZOA 2KE5A 1V5EA 1NSYA 2IZ0A 4IQFA 1OV4A 4LY3A 2IYEA 4RZQA 4ETNA 1CIPA 5IWCA 4DPGA 3EVAA 3I64A 4KC0A 5LVAA 2VTBB 4DSAA 1I80A 5AKYA 3ZDQA 3WGLA 4BEBA 4PZCA 4QXOA 1IVSA 2BGUA 4GYJA 1FX0A 2PRSA 3GT7A 2F3UA 3IMKA 3PFWO 4H3HB 5I8ZA 2XNCA 3ZWDA 3V4OA 1FFWA 4YRBA 4S1WA 1Z6XA 5DK6A 1VE3A 1C9MA 2EIXA 2NZXA 3ABOB 3D0RA 3KXPA 3O2QB 3CVWA 2G9RA 2W83A 1Q0ZA 1J8MF 4G1EB 1I2MA 1TKCA 4NI5A 5F73A 4HAZA 2QHSA 1ZYUA 4J3FA 4RHYA 2A5JA 2IE8A 1G9XA 3A0UA 1JZSA 3VR4D 3YASA 1VHDA 2JNWA 3KJGA 2VJPA 5K51A 2F1KA 3I2JA 1FNCA 3AGPA 1CZUA 3FUWA 3F7MA 2BI7A 3L8MA 1GL9B 2G1JA 1IQPA 1VB3A 1M73E 5AIBA 3EZ6A 1FVXA 4P5EA 1TI7A 1NVKA 3MGAA 5A3VA 3LBIA 5BMOA 3TUZC 5IN5A 5BOSA 1ZY2A 2AKWB 1NKVA 4LJ6A 4EABA 2GOYA 3N3BC 3CH7A 3A9TA 1AF7A 2WT4A 2HTEA 3F96A 4ZOQI 3LPMA 3HBLA 4UZSA 3HS3A 4DLTA 3L4KA 4RMGA 1C0LA 1CYDA 2XADA 3JQ9C 2BONA 3Q3EA 1W6UA 1QXSA 3HDGA 3VHLB 2HW8A 4KGDA 4M0CA 1LC3A 3R5JA 1OAOA 4QVKA 3WKCA 2ZR8A 4QEKA 3HB9A 5JAZA 4RZSA 2FUG6 5E0OA 4XE5A 2IYXA 3PFFA 1Z37A 4OP3A 5FCDA 5CGZA 2DCUA 1M75A 1Q14A 3M6MD 5LQMA 3UG6A 5HGJA 1IEXA 3VC3A 3KSZO 2YXLA 5FORA 1EFCA 1OA1A 3QV1A 1EK0A 1J97A 1R5NA 4X7PA 4B71A 2VH2A 4D42A 4L15A 2XBMA 3HKBA 1N1MA 1M2HA 2JLZA 3EXEB 2B8WA 3SYLA 4F9TA 5DIFA 2IYNA 3KWFA 1HORA 4CGZA 4Q0MA 1DIOB 3PVZA 2C7RA 4G5SA 1QRTA 1E1RA 4QODA 3QBVA 4BMSA 5IVDA 4NCAA 4MWGA 3TJRA 5TY0A 5DHTA 3T7TA 1Z7NA 2GZ1A 3V7UA 4D0SA 2VP6A 3KTAB 5LBIA 3RJTA 2Q0QA 2A5LA 4PTZA 1RXYA 2P4QA 3BC1A 4L5CA 3TJZA 3ONEA 5E9QA 3EWIA 3N07A 1NP7A 3L1KA 4UC0A 4KSBA 5ER9A 1UZUA 2BFMA 2DDZA 2DU5A 2PJUA 2Y9PB 4XRRA 3QEJA 3SU8A 1I0IA 3Q2OA 4FDLA 2ZRIA 1YHNA 1E1MA 3GZNA 1RMQA 5JYCA 1YRBA 221PA 2PXAA 5I5GA 2WU8A 1SOWA 3N0VA 2CLFB 5KZMB 3CRW1 2D2EA 3W9SA 4TUYA 4W9NA 4K9DA 3A36A 4ZCMA 1OIXA 1NBMD 2Q4RA 2Q8QA 3A1TA 3F67A 3AQIA 1CR6A 3HVUA 5L4NA 4HUTA 3SWWA 4A8JB 2ZZEA 4CODB 4G1FA 4ND4A 3V48A 2ZCVA 3P96A 3OWOA 2NTEA 2RI6A 5SICE 3F6YA 3SQNA 5LR6A 3AY7A 2GJKA 4NMXB 5J2UB 4DJEC 1FU4A 5CU7A 1DINA 2AMVA 1H3FA 1P80A 1U3TA 1WQ4A 1W96A 1J33A 1G7TA 2H52A 2OTCA 2QM3A 2QQFA 3B13B 3G79A 4Q4LA 3SNKA 5AVVA 4MDFA 1PQ4A 3QXSA 1G8KA 1XZPA 3DMNA 3G1ZA 3E6AA 2H3HA 3GLRA 4ZGGA 2PMEA 3AY6A 4XGKA 2C82A 1SXQA 2PLWA 4GR4A 1JLLA 1ABEA 4Z8YA 3S3TA 3QZUA 5DB4A 2GRAA 4H6VA 2VNAA 4EZEA 2FG7C 4DIMA 4DJAA 1OU0A 1QQ6A 5TQ2A 1KEEB 1KH2A 1T9DA 3IDOA 1MRNA 2VP4A 2X58A 4Y9SA 1JHZA 2UVPB 4WE3A 5AJUA 1WXQA 1P4RA 1HBJA 5GJBA 3GIDA 2XDWA 2X41A 3IBFA 3QQ5A 2ZSJA 5HFAA 3TTVA 4Q01A 1T1RA 1SBCA 2AJ8A 2GN4A 4WVFA 5I3ZA 3Q8MA 1H0KA 1QRUA 4DCMA 1QIHA 2CJPA 2NUAA 2HYIC 4K03A 1NASA 1F0KA 4ZAXA 2H65A 3R3WA 1EZ1A 2HCRA 4RZ3A 2GO1A 3A9VA 3ETJA 3IA7A 2DU8A 1UQUA 4IQ8A 2OA0A 2OFWA 1LRLA 4HL6A 4QULA 4DNQA 3O75A 4EECA 5IT9A 1KRHA 4O1HA 4O4LF 1M8FA 1TUEA 2CHUA 1YZVA 4PLPA 2YQZA 5LYJF 3G9TA 1MDBA 3CF2A 1IFXA 3L7AA 1KJ8A 3DE2X 3R4VA 4NEGA 3ZIAA 3B9PA 2YJTD 5AK6A 2BDEA 5GPBA 1PKXA 1T25A 2XWJI 3HLTA 1KP3A 3P9SA 4JSRA 1TMYA 2HZBA 4Y2HA 3VSDA 4BJ6A 3LWDA 4LVOA 2AOVA 3I53A 2X7XA 3QXCA 3WL8A 1T8PA 1F06A 3F5MA 3F9IA 4ARZA 3LT4A 4ZZIA 4HLUA 2GXAA 2LP4Y 2OT3B 4GX2A 2CVHA 1C8BA 3DBRA 4URUR 3VZBA 1DQZA 1H5UA 1LPNA 1CQJB 2ODAA 4IKOA 3P0HA 3NLLA 4A0RA 5T6MA 5KVVA 4LF4B 2I3DA 3MCTA 3T1YB 1WPXA 3BHIA 2Z1MA 1DWUA 1CR1A 2IYAA 4BASA 3IUBA 3N05A 3F98A 2A58A 4M9XA 1JJBA 2C00A 4LZJA 1Q11A 2YRXA 1U2SA 4R81A 4FD3A 4OB7A 3BTOA 2AZXA 2FAXA 2TMDA 3GCWA 4K05A 5TQVA 4IXNA 2ARTA 2V6MA 4HFJA 4F46A 2NTVA 1GZ6A 4FMCB 2I8CA 3JQAD 4EJ2A 5KQGA 4TPKA 2EZ8A 3A4MA 3PZBA 1IB6A 3NJRA 2PGLA 3ZK7A 1TEZA 1BXKA 1EWTA 4RL6A 1E20A 1KO7A 4G81A 3KC2A 2E10A 3A7RA 3DMPA 4WADA 5AFSA 1FRVA 4RNCA 3T99A 3ZE8A 4WLFA 3BM5A 1VIVA 1X1AA 2F2TA 4UQPA 5CFMA 3E9HA 1KJWA 1WIWA 1Y7TA 1Z7BA 1W30A 1XCOA 2C2WA 3FPLA 3LU1A 1U8TA 1A88A 1FS5A 4XQGA 2HF8A 3U48A 2R85A 3FFAA 5FYDA 3N70A 2ZM5A 1Q91A 3L5OA 3T5GA 4AMGA 4UNQA 5AJTA 1BGWA 2AQKA 3Q7EA 3QTCA 1TA4A 1M83A 4BN0A 1C2YA 1U7UA 1WXIA 1NN3A 2BIFA 4Z0PA 2WHPB 5AVQA 2JIZD 3O4RA 4R41A 1BCSA 1T4MA 2GPAA 4B8ZA 2O6HA 5LZ2A 1GDHA 4ECAA 3CC8A 2CXUA 2VPTA 3N2GA 5KYUA 4IYRA 1PWXA 1R0KA 1RLUA 4I99A 5G3YA 4XTZA 5ITWA 4PFSA 3TQIA 1AKMA 2C2KA 1U0JA 1PI3A 5AKGA 4AK9A 1G21E 1CQJA 1SGWA 1PZHA 1KPHA 2PT7A 2YCLA 3T9AA 3KQUA 1CKEA 1W59A 2NUPB 1XQVA 2PFGA 2RH9B 4UM9D 5DYTA 3VGJA 1NPYA 4MLDA 4NVRA 3R09A 1Q16A 4XYBA 4RJLA 1JWLA 3F7NA 1W46A 4TLDA 2XXAB 3ETEA 3MA0A 1AKUA 4HZUA 2GNPA 1TVKB 1IHPA 1XGKA 2YBEA 5IBCA 1WZEA 3FWPA 2YOGA 3QPAA 2MTBA 3DZGA 5F21A 1V7PC 1AGRA 5FLXA 1YZ3A 4RSMA 2AMJA 2JJMA 2OP0A 4I4TB 4N8DA 3KL4A 2PUHA 2WJPA 3OWHA 4W99A 3RFFA 4X0EA 2ADFA 4C0QC 1WBDA 3AHDA 3AZOA 4ZVRA 4Q02A 1T9GS 4BPRA 2FHPA 2OXIA 2H3EA 1N1DA 2RARA 4WJLA 5JH7B 1XVLA 2OCPA 1WB5A 3DVSX 3U9LA 4B48A 1S2OA 5EE1A 5L3SA 4DIKA 4EPYA 3PKIA 3T3NA 1SK8A 4NXMB 2HJ9A 1ENZA 5CXSA 3MIZA 3CRZA 4IX1A 3VKGA 4I8DA 3DNPA 2INGX 3BQMB 4DTIA 2AT1A 3LDHA 1O94D 4PYOA 3DOUA 3I2HA 4BTEA 3KJZA 3WLPA 1WY7A 1GGMA 4KPYA 2BGRA 1GOTA 3B1VA 1GGKA 1M74A 1RYNA 1ZINA 2XTNA 4HSEA 4XEUA 3TNJA 1QUFA 3JYQA 3UAYA 4EY4A 4D6XA 3IQFA 4QEZA 1IWBB 1NXSA 1X3LA 2AEEA 4JWKA 4RIFA 4OJYA 1T5IA 5FUQA 1C50A 1ZD5A 1HA3A 4XW2A 1MC8A 2H92A 3ESYA 3EY9A 5K3AA 3JZIA 1Y9JA 1W94A 2VBCA 1ONPA 2VQDA 4YR7A 2NT3A 2YASA 1CY4A 3TRIA 4K2HA 2XCSB 1V96A 2FQWA 3IEXA 1KZ4A 2HI0A 3A6FA 1J09A 1CJMA 1R00A 1LTKA 4JBNA 4EMSA 3LZDA 2CMDA 1UMKA 1U1CA 3EAFA 1BXZA 1RYYA 3NFRA 1U7PA 2R7MA 1O0CA 5FFMA 1JR4A 2RGXA 4B6JA 3G2QA 4C4PA 3TUIC 4G9BA 2ZQYA 2SECE 4LGMA 4I1SA 3K4QA 1FW6A 4P6VF 2KMLA 1K5HA 4FGKA 1XCJA 1VL1A 4OFXA 1Z6TA 4BNUA 1ZIXA 5E6SA 1RPAA 2F4NA 1L8OA 2QXTA 2Y1LA 4O29A 3ACCA 3CF6R 5FHRA 3L7KA 3QENA 4NMMA 1QYWA 1X7HA 3LSSA 1TK9A 1TNDA 3FCCA 1JR3D 1U0EA 3OE1A 4B45A 4BO0A 3K4PA 1PZNA 1P91A 4Y9TA 3RABA 3VRHA 1II8B 4AKGA 4L3WA 3RGGA 2H0QA 3KQHA 3NUGA 3ESXA 1FSSA 3EFOA 2O8BA 1MD9A 3F4BA 3HLYA 1PLJA 1OZAA 1KXJA 1U4SA 5ALFA 1E62A 5KOHB 3HADA 5ERYA 1JIVA 4X5OA 3BJIC 2MSDB 3E7WA 2P2CA 5DCWA 1GN9A 3UK6A 5JMWA 4EFNA 4QC2A 3WYNA 3DNFA 5SY6A 1I51A 2BTQA 2ZE5A 5KKCA 2VS1A 4CN8A 1E2FA 5CVDA 4OYRA 1C3JA 2PUFA 1HFEL 4J15A 2QZZA 2W58A 3HKCB 1W9HA 5AXCA 1KEKA 3PGXA 3W79A 2H17A 1OILA 2PSSA 1JVSA 4YCNA 2CLLB 1A2KC 3AZQA 3NRCA 3ZHSA 4A16A 1P19A 3HWWA 3DAOA 2B4TO 3RSOA 4ACAA 3RUXA 2ZUUA 1N92A 4RZUA 2VR1A 4TL8A 4UAGA 5CDFA 1T1JA 5CDFE 2JJYA 2PT9A 3O82A 3C5CA 2EC5A 5BR4A 5IEBA 4Z4EA 3A5ZA 1A77A 2B8EA 2RBKA 4X20B 5U4XA 4D3DA 1KQFA 3MINB 5AH0A 4I8XA 1WZIA 2IEYA 5LMUB 1QHHB 5DH9A 5JJKA 5ADVA 3D54D 2C7GA 1SEPA 1SY7A 1U02A 2E4ZA 2F90A 1S2GA 4DCUA 3B2QA 3HXPA 4DCPA 3BJRA 3FJPA 4FC6A 1JG1A 3A1UA 4M76B 4LWQA 1L1EA 1QVAA 1UKYA 4WZ6A 1A96A 4EHIA 1XQXA 5CDTA 4O2BA 1BVRA 2W4QA 1IZ9A 1XELA 2Y27A 1LPPA 4QTUB 4G97A 1TJNA 3G13A 3SFTA 2PXHA 4H2UA 2NYUA 3KFLA 1DC5A 1U2RA 2B9VA 4J0JA 1RXSA 2GA9A 3MGCA 4CW7A 1C7JA 3LHSA 1AF4A 1V0JA 4AKTA 4CMCA 1AXRA 1X0VA 1SKYB 2PJZA 5AVRA 2FYKA 1GPMA 3BMXA 2IZ7A 3BSSA 2XBUA 3PRHA 1D04A 3KQLA 4EUEA 2H00A 4N39A 1UOOA 2GJ4A 5IVIA 3SVTA 3O47A 3S2GA 2AZ4A 3SYRA 2P2LA 1CEXA 2DG2A 2EP5A 4HTFB 4TL6A 5DGDA 1V1RA 1ZRNA 5AQ1A 2JLVA 2TRSB 1UR5A 2XE4A 5HS4A 2I2WA 4PLWA 2VYFA 1YS2X 2HZ7A 2QVLA 4LZOA 3RTCA 4JJ7A 2ZR2A 1W0JD 3PIRA 1THZA 2C94A 5HOEA 1T8SA 3W5JA 3DLIA 1T4CB 4MYHA 4DMHA 4B35A 2FZEA 4QXRA 1KAHA 1RZVA 1WPYA 4HJXA 3GT3A 1I0ZA 2I80A 1JB1A 3GRCA 2WSLA 2IXBA 4JP5A 4KDEA 4TVOA 3SS8A 3HA3A 3W2GA 5JROA 2FQYA 4IMJB 2Y92A 2ZYTX 4YPVA 3UJCA 2FW8A 4JQYA 3UJNA 1HK7A 3LH5A 3A6LA 3I4CA 3OETA 2ADOA 3REGA 4GYYA 3OIWA 3K9LA 4TYMA 2IHUA 2WG0A 1KAEA 4QFMA 4AB1A 4LG1A 2NVBA 4N6OA 2WWWA 3VQXA 4DN6A 1F48A 3OKAA 1SZPA 3OIUA 1EIYA 1KY4A 2I71A 1QZZA 3NCTA 4UMEA 4EHJA 2ODRC 5IWAB 5A0VA 1QHNA 2GVZC 2XMQA 3E9QA 1KL7A 2FSPA 5FBLB 3G2NA 4HLDA 4ER3A 4GQIA 1BGXT 3BZUA 5KOIA 4MQ5A 2H07A 3HXLA 3SQMA 3ZVKA 1DRKA 4CG2A 2GTHA 4MLCA 2IOQA 4HYTA 4DSZA 4H2SA 2RDMA 3LLSA 2D7JA 3E9EA 3QTLA 1MVOA 4IBOA 4YT4A 1ESDA 5BUZA 5F2NA 1ETHA 5JMTA 4A4DA 4PWZA 2A3RA 2DBYA 3C7CB 4GAEA 5JFOA 2WEKA 4P93A 4A6DA 3TB6A 2ZPUA 5ESWA 1ZD9A 3QJYA 3UCXA 1FJGB 2DJZA 3ANMA 2ZK7A 3C74A 3EIUA 3OECA 1GCUA 4ASUA 2PZFA 5AVUA 3C3KA 1GXSB 3ES9A 3MYYA 5K3FA 3IRUA 1XVTA 1JVBA 2VATA 4JT9A 1WP9A 1T0UA 1XDWA 3LSTA 3RUPA 4CCYB 4PANA 1KI6A 2JFPA 5BO5A 1ZI6A 4IDPA 3PCOB 1TADA 4GVLA 3TIIA 3WGHA 4XDHA 4B82A 3RRJA 1EFAA 1SBQA 2XBLA 2Z04A 3QHPA 4YJ3F 1EWRA 3VPGA 1E18A 3GUVA 4PQYA 4BOYA 1XEAA 3H7AA 3HTZA 1B43A 1X8JA 3PT5A 1ZJWA 2FCAA 4Y2JA 5IC6A 3VH4A 3HXXA 1XTUA 5E8RA 3L77A 1JL3A 1JIXA 1KI4A 5F2OA 5L3QB 1I33A 2ZTUA 3C3JA 3DL2A 3GBPA 3GRFA 5LQSA 5IASA 3CZPA 4NFSA 1M2VB 1USIA 1NJSA 2A8YA 3PUVA 4EJ6A 3QTBA 1D7AA 3LPNA 4Q3CA 5F1YA 2F3SA 4R2LA 2QTBA 3NYRA 3P0FA 2WK1A 3NOVA 3T3GA 3E2IA 3KB2A 4DLNA 9MHTA 2QRUA 3H6KA 1U5AA 3CINA 1AV6A 2E82A 3IR7A 4N49A 4XTXA 5K3EA 3CEPB 4B81A 3BICA 2FWRA 3DP9A 3TPCA 3PNLA 3QPUA 4H2DA 1YRQA 3OLZA 2WKWA 3U7EB 4WCDA 4RQBA 1DCTA 3ENNA 2WHEA 4IVRA 5F5LA 2WPDA 1IYZA 1L9XA 2JGJA 2OV8A 3PC3A 1ND5A 3P0JA 4UBJA 4ZVKA 4DG8A 2HWUA 2IPOA 2OR3A 3NHKA 4AWAA 2Z95A 4TTAA 1PWYE 4H9GA 4OB6A 3I23A 3A14A 5KS2A 1F20A 1D9ZA 1GUFA 3IRVA 2YHIB 4RMNA 1ILEA 4HB3A 2P9CA 1RRFA 1KOJA 5JASA 2HKIA 2PX3A 4IG4A 4EKEA 4O0LA 1UH5A 3FZGA 2V4UA 2HLDD 3LKBA 2P7HA 1C9NA 1YZUA 1MF7A 2Q5CA 2QTAA 1Z7GA 3D0OA 3NHMA 2PUVA 1E2LA 3FGOA 3AESB 1WWKA 5JCZA 3KD2A 2Q9CA 3ZEIA 3N0RA 4LECA 3U4QA 1SCDA 3E22A 3IQEA 4MCHA 3NJ8A 5EYPB 3KT6A 2G25A 3IXQA 3KVNA 2IEAA 5JRZA 3GGOA 3ZEAA 3LQ1A 2ZAMA 4DA0A 5BSEA 2PN1A 1G64A 1NUUA 3MAGA 1PBNA 2CCKA 4GRDA 1EIYB 2XF8A 5TT1A 4ZO9A 2F9FA 3GLSA 3DEFA 3BD7A 1OTHA 3LDUA 3HU1A 4PCVA 4YAUA 5JSZB 5K2OA 5EQJB 2PX4A 2VNHA 3KQOA 4YJGA 5BPFA 1OC4A 2ZE7A 1PJCA 1N2SA 1UJ2A 1QWSA 3QE3A 2WNHA 4MWSA 1J99A 2H1VA 2YQ4A 4PLYA 4R2WA 4D9GA 1AQYA 2PUWA 5TDHA 2E4XA 2VFAA 4FSDA 3E35A 4LNUB 4F6RA 4H4CA 3HDQA 4D81A 3DBVO 1UPCA 4XDYA 3NEJA 2FPKA 4CLRB 2JDIA 4XARA 1WPRA 3FF4A 3BB1A 4OL0A 4X92A 3EZ9A 5HIKA 1FNBA 2ZSHA 4AKHA 1K63A 3WYGA 4C6TA 2WT8A 3H99A 4KKXB 2OSVA 3JQQA 2PKXA 3L46A 1CE8B 2DFDA 4EB0A 5AK0A 3U3OA 3WYAA 4D9JA 5ALNA 5MN6A 4I50A 2BFEB 3QE4A 2ZUFA 1NFFA 3A28A 4MVJA 5F1OA 1GO2A 4QGHA 3I6YA 1CFJA 2XCUA 3DTYA 3U4IA 1KEZA 1ZN9A 1OYVA 2NU6B 2CL0X 2W0MA 3C5EA 2ODPA 3PYLA 4FJ2A 2XDYA 3NW9A 4Y6SA 4BFUA 2OFFA 2JLAA 3AEYA 4Q93A 3WBJA 5I4KA 4G85A 2KWIA 1JSLA 4Y2YA 4WKCA 3WWOA 1EK1A 3EFRA 2YCBA 1OKKA 1PT5A 1FMJA 4KYTA 3P9CA 1GPWB 2WUGA 3LMKA 2O59A 3IYLW 1U8ZA 2BM0A 4J49A 4OLJA 2IVFA 4TYWA 2XYGA 4CIVA 4LSWA 4PONA 3FCEA 2Y3IA 3IDQA 1MBZA 5BV7A 3T9DA 2JLYA 2GAAA 1XYVA 2QU7A 4YJDA 5JZSA 2APJA 1DMRA 2AEMA 2HX1A 3A7EA 3OPYA 4MR8B 4M1SA 3S5UA 5BYBA 4ESHA 3QMPA 3FDIA 1VRCA 1OT3A 3D5QA 2HLNA 4K28A 4R5MA 4HC4A 3A37A 5D00A 4ED9A 3IBGA 3GCZA 2RK4A 3JQRA 3NM5A 1GQQA 4CT5A 2I7DA 4W9NC 2PY6A 4MQUA 5C5CA 2P9QA 3KLNA 1K86A 1H5QA 3MTQA 2FI1A 1ZJ5A 2NWQA 2XLCA 1VJCA 3LOQA 3NV7A 3V1LA 4DUPA 4CF7A 3OTOB 3A2MA 4GICA 2ZTHA 4XTYA 4TLMB 3UMCA 2RK3A 1RQRA 5CMLA 4GZ5A 3QK7A 4MGIR 5FDFA 4EP1A 3DCYA 3IULA 3HYLA 4YCDA 2VAXA 1HKHA 3H1TA 1SXJE 2Z5GA 4MEJA 3GLGA 4DV5B 4DCCA 4ZVVA 1CQIA 1HLDA 3HWRA 2K7ZA 3E9IA 3IERA 1I6WA 1ZCBA 1YS9A 2AWOA 2VVTA 3WSWA 1W47A 4TL9A 1N2CB 4NNPA 4MKZA 3R74A 3ZQJA 4O8CA 2CNDA 1PHRA 3WLSA 5JSQA 4QUKA 3VI3B 3EEIA 2ZG6A 4BNXA 3NAZA 3KEGA 4P82A 1L4YA 3KZ1E 4YIHA 3CR7A 2B9EA 3AOEA 4N8EA 3GXBA 5I9TA 1ZITA 2JJ2A 2P2NA 3M4PA 4IDGA 3PDUA 1VPVA 4RY0A 4D45A 3EGCA 4AJLA 3AV0B 1GARA 3RL6A 5ITSA 5AD1A 4G0XA 3GT0A 1OBVA 1QS0B 4DARA 1PKEA 2OQIA 4PC3A 2P6RA 2KSQA 1V8BA 3NC0C 4C05A 1J8YF 4KO4S 5KI6A 1RRCA 2XGGA 2Q6OA 4GKJB 4RA9B 2BCEA 4Q9JA 4X6YA 2E7ZA 2YUIA 2UYHA 4FYHA 3IO5A 3MTAA 4XTWA 1Z34A 2I65A 5JW6A 2X5JO 2ZT7A 1M1XB 1PJTA 3V8LA 3ISJA 3PQ5A 1SMKA 2EQAA 1VIDA 1OE0A 3HL4A 3PQ6A 3WLLA 3IQXA 2ZWVA 5KNNA 1T2DA 2PRJA 2XYPA 4IGEA 2IJGX 3ZDEA 3HDTA 3S2UA 2J0VA 4ENSA 2PSHA 3OZXA 1CB0A 1SUPA 1VG0B 5FAKA 1E89A 1DBRA 3K71B 4LVMA 1HYHA 2CWDA 4FE7A 4IW3B 1CJSA 3W8EA 1H05A 4JYAB 2O07A 3L7JA 1NTOA 4I4TF 2H2WA 3I9JA 2XUHA 2CFSA 2OQ2A 1J00A 2XKKA 1NQWA 5F5WA 3C4QA 3I9OA 4GL4A 1M6HA 3TAHA 1GAXA 2B8JA 3L18A 1IG3A 4TWZA 1N4DA 3ZVRA 1MVLA 2RAVA 4YFVA 3MQZA 5HF5A 2AEJA 1HQYE 1ZJJA 5TPWB 4O4IB 5EJ6A 3OHPA 4E11A 1JHXA 3IP3A 3TTXA 5KQMA 4NCKA 4XTUA 1Z8FA 2J3JA 4DZRA 5KDOA 1Q44A 3G1UA 4OU5A 1BIAA 1JU4A 4R7GA 4Q7EA 4QA9A 1TD9A 4D98A 3COZA 3GA5A 1SPBS 1X9HA 1J90A 3V8JA 4N5DA 3TZHA 4F92B 5D1NA 1R1DA 1Y98A 2D0DA 1J2RA 4TVBA 1V6CA 2OZVA 4C0SA 1NLYA 1N6KA 2O2DA 4YJKA 1BN7A 1UPBA 1Y4AE 2JHFA 2RH4A 3PWTA 3KSMA 3TCKA 4DJFC 1SQ6A 5BMVB 1L8LA 2BSAA 5F7ZA 1W75A 1ZMRA 5CHEA 3V2GA 2FPRA 3ZHQA 3I6IA 3RR2A 4MI3A 4NJMB 1RABA 4GMGA 3CWZA 4NZPA 1O94A 4RK6A 3NNDA 1L8AA 4TTRA 2I5PO 4ZOEA 5DASA 3VR6H 4YN3A 4G24A 3SX2A 1YU9A 1A5SB 3TO5A 1N8SA 4Y9RA 1U98A 1DJOA 2W5UA 3AFGA 2QN3A 1AQJA 1DJMA 3CUTA 2YV3A 3HB0A 5EP3A 3KB6A 1DLJA 2RSLA 5CVVA 3U0BA 3BILA 4MV1A 4MP3A 2AXPA 1KC3A 1S6YA 4JLPA 3MN1A 4FMDF 1NJ5A 4TMWA 1A9XB 5HF8A 1QTNA 1NBMA 2P3LA 4D0GA 4YUWA 3C3CA 2V0GA 2A84A 4C06A 3I34X 3M33A 4AJ2A 1WHSB 3UYLA 4Q16A 1WKBA 3RROA 1G7CA 4G26A 4LF8B 3OCZA 4R0NA 2G82A 2NU6A 2PFSA 2QM0A 3M6IA 4JBGA 1U4NA 3EGWA 5J23A 1CUCA 1JVNA 3UC5A 3UXMA 3CIFA 4R9NA 4XTRA 3EDCA 4A23A 3OKPA 1UXHA 4CH6A 5CM2Z 2QW1A 4Y2SA 1XTBA 3LLCA 4GYKA 1NW4A 5EUQB 5IUNC 3VJRA 5DHPA 1DUSA 1NUHA 2AOTB 5AOAA 1O0BA 3KQQA 1FVHA 1O7JA 3Q3GE 2VJBA 4FYYA 4AWXA 1QP0A 1ABBA 3D9QX 4L0MA 2QGNA 1RR6A 3HLKA 4AZ3A 4M9SA 1E2PA 1BU5A 3QUSA 4AO6A 5JRJA 2DCMA 1NIJA 2C9YA 3O03A 3ULKA 4DCGA 2G0TA 2YZGA 1ZUHA 3OICA 4LKOA 2DLDA 2R7AA 1DVRA 3DDUA 4R7TA 4LISA 3A3KA 4FLMA 4Q9IA 2OQRA 3D8NA 4LMBA 1LSOA 5FP0A 4CM9D 4HH4A 3JQAB 4EW1A 3OZRA 4H3KB 3OE4A 5K99A 2AI3A 4P32A 2VP5A 1VBKA 1I24A 5FOVA 2DY0A 1NNHA 1P61B 3CW9A 3FB4A 2IX3A 1WXFA 3ANXA 4P3NA 5JEDA 5LOVF 3HCCA 4CFZA 4B0OA 3VAYA 5JI2E 3NJ4A 4IVNA 5L40A 1F2TA 4LNHA 2J3KA 2PGOA 2FSIA 5AHRA 2BFDB 2HJWA 3VPSA 3ZWPA 4DHWA 3EPHA 4CMBA 4M87A 5BN5B 4NZOA 2I66A 4JOBA 1F0PA 3HGMA 4HDAA 1APBA 1HFKA 3DLCA 1V35A 4P4SA 4UZEA 1Y8AA 4ZRMA 1ZLYA 5IF3A 3L7OA 3H5VA 3VA7A 3T7IA 4RVFA 1PX0A 1YBHA 1CQIB 5DYYA 3X1WA 3RVSA 4BE9A 1KJJA 1Q0RA 2QUKA 3LSYA 2EJUA 5D86A 1IHXA 1KO1A 1P0IA 1XA3A 3GRZA 4NENB 1GZDA 3DKRA 4P71A 1V2HE 1YR7A 1QHHA 4BWFB 1IN5A 3ADCA 2PE5A 3QLVC 2H4XA 1Y33E 4NBVA 1U0NA 1RZRD 1AJEA 4X20A 1C3VA 2H4FA 2Y8EA 4YROA 1XE3A 4BJ1A 2FFAA 2ZEJA 1B8AA 2P5TB 2Y66A 4L0DA 4F3YA 4TS3A 3P4YA 4PAQA 3HI4A 4RCYA 4D9EA 2CV0A 2DBQA 1U81A 3THSA 2FDCA 2WYVA 3QSGA 3ZU5A 2DBVO 1H93A 1V37A 2UVQA 4HN2A 4I1YA 4Z0HO 1K3TA 2WQ7A 1BEUB 3A1SA 4RE5A 2FF7A 3VQTA 3WYFA 1KMNA 3EASA 3A6PC 3VR5D 4D79A 4YMGA 3ORQA 2CXOA 3UENA 4DREA 1J8DA 3TM5A 1XUOA 1LUAA 2RHJA 4LSGA 5DE3A 4G1VA 2J1LA 3ZZTA 5CDUA 5D2CA 1E2HA 1OFUA 3OD1A 2HRBA 3IVXA 5CLQA 3TW4A 2VDWB 3VYVA 1SCNE 4ID3A 4EZBA 2G8LA 5BSUA 3PNOA 5JISA 1CUSA 2D0OB 4RHTA 2G5GX 1Q77A 2VZ0A 5L4LA 2I6QA 2V58A 1IE3A 3GR6A 1LWNA 1JT2A 3EFHA 2OM2A 1TYAE 2PA0A 5BYAA 1P2VA 4ND5A 5DX1A 3ZCQA 3RQIA 5FNZA 4ZFNA 3OPMA 5JXGA 2Q5FA 2R1VA 1Y80A 3R0IA 2JBHA 1EK5A 4FPXA 1PYOA 1I2CA 4IVPA 2R6CA 3UXEA 4D97A 1Z75A 1W44A 1P4HA 2YY6A 4C4RA 4ZOLB 4EF6A 2B30A 2NUBA 3C6YA 3IV9A 1ZXLA 3QVOA 3I1JA 3IGFA 4UAVA 4AULA 2QE7D 2PGAA 3HVIA 4LGYA 1L4KA 4DIBA 1R50A 3MG9A 5EESA 3MF1A 1IUPA 4JASB 1HWYA 4NF2A 5KU1A 4ZCRA 2ZP1A 2BZ0A 3KE8A 4IM7A 1BXRB 3NB0A 4L8WB 4UP9A 1W35A 2LDBA 4I55B 4BCBA 1X2GA 3IA2A 3H9JA 4X8HA 4EJ0A 3A6ZA 4UPAA 3TBKA 3S2FA 4B40A 2Z4SA 5IJZA 1HUQA 1RWBA 2YWGA 5H9VA 4AECA 2PV7A 2EARA 3IJ5A 3LXUX 4KN6A 2ESRA 3JQDA 3G7SA 2Q3LA 4EYOA 5BSFA 1E5LA 2JGIA 1RQ2A 4FWTA 3C4VA 2J45A 5F2EA 1ZOLA 3K0CA 2BKVA 3WADA 4MLPA 3D8UA 1M1YB 2HMTA 1V95A 4P98A 2JK1A 1I7QB 1Z63A 1FFDA 4NBUA 3KLMX 3K0KA 2J0UA 5TSDA 3P94A 1P74A 1USGA 1G2QA 4BV3A 1RJGA 4TYNA 2AUMA 1JQJC 1G5FA 1ZIDA 4BCDA 2HA3A 2J9FB 1K6MA 1V3QE 2Q1WA 3MRTA 3L0SA 1WZUA 2VUIB 3F6SA 1CJKC 1CG6A 3NNSA 1R0BA 2ZS7A 3OC6A 1P7CA 2PRZA 1G3UA 2ZJ3A 5K3OA 2CJXA 5C7LO 4RVSA 5DLPA 2WSYB 4ZYXA 3HCAA 2GZDA 3ROPA 4PZYA 2ZI4A 4BNNA 3PIIA 4Z7JA 4H1VA 2BTEA 2GZAA 2HIAA 1EFTA 4MMYB 3T4EA 5FKJA 5ARCA 3KETA 5C7IO 4HNSA 1ZD2P 2QQEA 3V8NA 2D1FA 2Q3JA 4XYEA 1L7EA 1T2EA 2EFGA 2H2GA 4HYQA 3L0IB 5AESA 1GVHA 4WOKA 2YWEA 4G0MA 4QOEA 3PDCA 5AKIA 1E3DA 1CDOA 1YQQA 1QG6A 3V1MA 3W4JA 1SQSA 3EFBA 2PTGA 3FPSA 6PFKA 3I7FA 1XJWA 2W70A 3NEMA 4DA8A 2VHQA 4LYFA 4LZAA 1RRKA 1E60A 4JGGA 1RLOA 4QDUA 3SDBA 4ZDIA 1SVNA 3AT1A 2FNAA 3GEBA 4IFTA 3H1GA 2VWQA 4L27A 3CVOA 3AC0A 4UHDA 4C43A 1EWKA 2G67A 4AJIA 4K6KA 4P7KA 2ZU0C 3DEJA 1KZHA 3FDJA 1MV5A 3GLFE 1PFGA 4K87A 4K9QA 3WB9A 5JDCC 3L0DA 2RG7A 1JH9A 1VKOA 5LB2A 5ELOA 1FXWA 2RHSB 2G06A 2R8XA 2X5NA 2OUIA 3O3NB 2ZVJA 4ZV9A 5KNBD 3EGVA 3BFKA 1P7VA 4NH0A 4RTJA 1MW9X 1QFSA 5A71A 3GDOA 2JFQA 3BEDA 3DB2A 3LY5A 4IFEA 5LDGA 4RQAA 4F38A 3HSYA 1K6JA 3GGPA 2OBMA 3ORHA 3DA8A 4EHBA 4YLEA 1R8XA 2EW1A 2AN1A 2P0EA 4MZDA 2A3NA 4ALKA 4G8JA 2XQFA 3THRA 2OHIA 4KMRA 1TCAA 5IUJC 3BB3A 4GI3A 4JX9A 5H9WA 3EPKA 3WA6A 3R5FA 4M55A 1GFWA 2Y1GA 3OOWA 1WETA 2NSHA 1VG8A 1KMQA 1KI6B 1VLVA 2JPDA 4NCIA 5K45A 5CLLA 4BY9E 4FVTA 4IIJF 4L5YA 3NH6A 5FYQA 2D5AA 3WMRA 5FNVA 3EZGA 1SIWA 1MIHA 3PXXA 4Q1EA 1ZO8A 2O2HA 3HKCA 2Q5QA 1DBIA 1ULHA 3BH7A 5CT5A 2Y1CA 4B3RB 5DBIA 3DF7A 3FRJA 1TQ4A 4I9UA 4ND8A 4DJJA 4CM4A 4KGVA 1NW6A 2NAFA 1IL2A 2Y0BA 4AS3A 1F7VA 3QFRA 4BMOB 1M2JA 2G1PA 3P2IA 1FUUA 2CKMA 3I6ZA 4HO1X 3RYCB 2GN1A 4C4AA 4POOA 4DEVA 3PFGA 2HLDA 4C4OA 2H1WA 2OORC 2VJAA 1Z7MA 1F38A 3A1VA 3K20A 4WLVA 1YFTA 2IQ5A 5BSRA 3T15A 3X44A 1SCJA 2ATIA 3RT1A 4UPEA 4WK0B 4LCBA 3AV3A 3P71T 3VKWA 2RGCA 4NE2A 3FSJX 5B36A 1JN0A 3P97A 3IQHX 5BW5A 2G9UA 3JAWB 2COUA 1JKIA 2QMYA 4YCBA 5ERXA 5C3UA 2W6JA 2JDID 4PPNA 1XZ8A 5A03A 1EUZA 1ISSA 3N8HA 4IGAA 1TO1E 2Z83A 3EA0A 3KHUA 2OXFA 4DWJA 3O1IC 4P72A 1G19A 3A3YA 2ZYRA 4MWOA 4A10A 4DDUA 1KETA 3EVGA 4N76A 1ATZA 2GBLA 3IDZA 2A86A 1TZJA 5AUPB 1BDMA 4J43A 4TQFA 5IX8A 2GK7A 2WKSA 4U6NA 2Z9DA 1OFHA 4Y2XA 1NXQA 1FDIA 3V3TA 4DIEA 2WVHA 5K03A 2OM6A 5KNDH 1DIAA 3LUPA 1QMPA 4FYPA 3VHXA 4V1CA 4QDXA 4KYVA 1VHLA 5K8TA 4WJ3M 3CX6A 5H8WA 1PRYA 4W5HA 1N2XA 2J6CA 4CLDA 1AKVA 4BC0A 3I12A 5IBRA 4D9CA 1R0ZA 4MV4A 1TZMA 4EGCB 4TQUS 1II9A 3H97A 5LZ9A 1JIQA 1Z0IA 1RAEA 2EJCA 2DKOA 2H85A 1UPUA 4MWDA 5DIZA 4DNFA 3HWX1 1M6NA 2PUGA 5ADWA 4MQEB 1BROA 2LWIA 3DOJA 4KBYA 4I4LA 4OAQA 4O2LA 5JWHA 1SXHA 5JCJA 2YWRA 3LSQA 1WXEA 3GPDG 2VA8A 3AIOA 3UMJA 1Q6ZA 3IMCA 4UFNA 5SY9A 3T9BA 4N3AA 1QH1B 1RAAA 1SC6A 2C4NA 2JGKA 2OECA 3LDGA 1KQ3A 5F52A 3VR5H 2QM8A 3C4JA 5DLEA 3RUDA 3H5OA 2B3DA 2IH5A 1UT5A 2J08A 2C5FA 1LDMA 2NAPA 4RO0A 2GILA 2PT6A 1Z4QA 2PAAA 3IBYA 2XDQB 4PM4A 3TUJC 3ZHXA 5B7GA 1UAAA 4NOKA 1GQ2A 4OHUA 4BUJA 3MWEA 4LOAA 3L6DA 3NI2A 1G8PA 3U3DA 3ZHBA 3I5MA 2PS3A 3QPCA 4IDAA 5JS6A 3U4AA 3SZ3A 2ZGVA 2X9NA 3KEMA 4Q9AA 3T0GA 1VCHA 2PBRA 3I32A 4EKNB 1R27A 3QEMA 3MAJA 1Q3HA 3OCYA 1A7AA 1N2BA 4XD7D 4X66B 1KZ6A 2PV0A 3KR2A 5KO2A 4P86A 2DPYA 5DTEA 2JJ8A 3B6EA 3OWXA 5ALJA 1JUDA 1NFRA 4MW5A 3VR2A 5CURA 2QRNA 3V2IA 2WJVA 2Z1DA 3AQ4A 1EIZA 4TUYF 2NZJA 1Y1LA 2C4WA 4Q66C 2IITA 3W5CA 1TLLA 3K16A 1HDZA 2D1TA 4PLCA 1C0EA 3OT5A 1KQPA 3ZVMA 2JBAA 3GH1A 3GHHA 3K9BA 2A67A 2ZJ4A 4HQNA 4MUNA 1FRQA 1O95D 2PL9A 2W8ZA 1NVGA 1Q0UA 2D0IA 3VO9A 4X60A 5FUWA 1E2EA 3CNEA 3LAWA 4E31A 1C2TA 2FW0A 2BKUA 4X3OA 4MULA 1XOIA 4OH7A 5HSGA 3O21A 3T3OA 1KSGA 2QHXA 5JMOA 3UHJA 1TQDA 3IVAA 4H2TA 4FUTA 4INPA 4KR9A 3BQNB 3PGLA 4PX2A 3D2BA 1TL7C 2VH5R 4JI2B 4QTZA 1NU6A 3E9YA 5DSXA 1FQJA 1P5ZB 2GFIA 2I99A 2VNSA 3OI7A 3QVSA 4WN9A 4H4EA 4RHCA 4B2PA 3WVNA 1N34B 4DPMA 3G5TA 4INAA 3SHQA 3IE2A 5AVZA 1PFUA 4AYTA 4RHEA 5I48A 1UWLA 1VFNA 2DM6A 2DFTA 4TYQA 2J30A 4JB8A 2JANA 3Q3JB 3U3KA 4MITA 4MCAA 5FUXA 4Q47A 3R07A 2K4MA 4R1OA 3HXWA 1P18A 4OOFA 1X55A 4E1VA 4NH4A 3EPLA 2QSJA 1R6VA 3KDSE 2UAGA 3I2GA 3K6RA 3OQIB 5LL6P 1N3LA 1YS6A 1ZIPA 3N7UA 1Y5NA 3WGNA 4QLOA 2VKQA 5EZYB 3FPCA 3AI2A 2C2MA 2QTNA 4HP8A 2EL7A 1R6BX 1YASA 2VZLA 5CW2A 2C3PA 3I1FA 1NNLA 3H9QA 5DYGA 1Z5WA 5BRNA 3VNUA 1BDJA 2IYZA 5ALMA 2WWYA 3D8BA 1XZLA 1TFRA 1UUFA 4KNVA 1CUHA 3QNMA 1KAGA 2O52A 3F7OA 4MGKR 2FN4A 3BL5A 3WLJA 4MW2A 2QAJA 4UM5A 4S1PA 4H3SA 4R1UA 3RTBA 3C45A 2BRUA 1U3FA 1HDIA 2DFPA 2P91A 2AYXA 2CFCA 3ZE0B 1QX3A 4BECA 4N6NA 2AG1A 1U7TA 2VYND 1AG9A 2MIIA 3N5CA 4P9NA 3DZHA 4RK1A 4RXMA 5JPDA 2ZJZA 3IJRA 1YFJA 3ISTA 1CDEA 2NU7A 3PHHA 1SVMA 4ZQEA 1H2ZA 5DEOA 2R6DA 4PCAA 2XITA 2L19A 1W0JA 2YWHA 4WKOA 4XX0A 2IU6A 4FK8A 5FR2A 3PLAE 2D3TA 3R3VA 5IVHA 1KYYA 1UXKA 2FG6C 4DT1A 3RVRA 2DH6A 3T3HA 1LPOA 4U0KA 4JITA 2PKRA 1M1UA 2LKCA 2WYHA 2ZTSA 1I7LA 3ML1A 2DR3A 4U6SA 5B1YA 4EJSB 3ROTA 1L7VC 5ALRA 3BPSA 3EZFA 4LV5B 4H7JA 1CX9B 3G0GA 5JH7A 5LP6F 2GEDA 3IX7A 3E3AA 1OXUA 1U1DA 4PLZA 3FOCA 4H2XB 4PYQA 4JEIA 2WAAA 4DYHA 3DC7A 2D7CA 4IZIA 4D8UA 1XSEA 3CLVA 1GQRA 3D6UA 3HNRA 5IS2A 4MI6A 3ILXA 1RCTE 4KCGA 3D3QA 3RPEA 4ZCIA 5K0CA 3OF5A 1H5NA 2ERCA 3M89A 3PF9A 3NT5A 3NTQA 5DTJA 2C31A 1N33B 1ZNZA 3OQNA 1EAYA 3G8YA 4PSVA 1MO6A 1A7KA 3TLGB 2HF2A 3X1MA 2D5LA 2YQ5A 3DG9A 1EFWA 1KK3A 3NIGB 4GI7A 4RH3A 3ZBQA 5C53B 4NNJA 4C2AA 1KOFA 3D43A 1RI2A 1TJ5A 3T1HB 4X9XA 5AJXA 5DEIA 1LV7A 3TLEA 3O0TA 1SULA 4WPGA 3VR3A 2R84A 1KDPA 1ARZA 1KKMA 3Q3IA 4CEIA 2QE7A 2W6ID 3TEHB 1W36C 1NBOA 4DNOA 4EI2A 3H9UA 4XVHA 1E4OA 4DLAA 4AY4A 1JMVA 2EP7A 3I76A 3UICA 4MS3A 2OHHA 5IKMA 3GGCA 5EKXA 4MI1A 1WV0A 3CLSD 1C14A 3R6DA 3S1AB 1W4AA 1RM4A 3AOGA 4OXRA 2PZMA 3HJFA 2GDJA 1ULBA 2V7VA 4ND8B 4L78A 3LC2O 3DMYA 4Y18A 5G53C 1C1XB 5CT4A 5FTLA 1DS6A 2QY6A 3CLUC 2DFKB 3CLHA 3P2EA 4XSVA 3QP9A 4IDBA 3EUFA 3SZGA 4BEWA 1VIYA 3ZE7A 4UU1A 3OX3A 3OF2A 1Z0ZA 3NDIA 4LJ8A 4K7JA 4RHUA 4L72A 3V8MA 3C8DA 4RPCA 1OSNA 1RPNA 1JIUA 1GITA 1TT5B 2GF9A 4OJKA 3T0FA 3T7SA 3KK0A 1LX6A 1QG0A 4MVJG 4LHZA 4ZT3A 2FGJA 2OXEA 2AEFA 4E6PA 1C7FA 4FI3C 6LDHA 3CGGA 5KTNA 4JQZA 1UAGA 2GAIA 1QQ7A 3D7NA 4I7EA 4G89A 4U7PB 1NYLA 1VPEA 1WPGA 3P0RA 4BFCA 1FP4B 2Q1YA 4JFRA 4MUJA 4A0GA 1N57A 1X86B 2BTQB 1W29A 2QLJA 3WICA 4PXAA 3ZCPA 3EB9A 4UPVA 3GARA 4ZU3A 2OZPA 2ZYGA 2OG2A 4D4HA 2IPXA 2YFKA 3PHJA 5CVCA 1MO3A 3C16C 4JXJA 5EJAA 2WMNB 1NWCA 4ZI2A 3N2EA 5IAKA 2EJ9A 1O6FA 4HGYA 1XI2A 1A4UA 3DAFA 3AFIA 3Q2KA 2BBTA 3WLNA 4OTZA 3IT0A 1NIPA 3D3JA 1EUCB 5KJ6A 1PVOA 4YI5A 3Q15C 3QM1A 1RKQA 2WF5A 3EBLA 1W4CA 4CE6A 2RAPA 1C29B 2FKAA 3L05A 2RHQA 4FFSA 4LGCA 4N0DA 3O2NA 1XDZA 1M1NB 1W5TA 1PV4A 3QEBZ 5AOCA 5DFAA 1BS1A 4P83A 4QWWA 1YFLA 1B74A 1XD2B 2R8ZA 3LF2A 2JGMA 1DWQA 4V0SA 4FFBA 1CUAA 4WJKB 4EI8A 5A4JA 5J47A 2WZCA 3LXMA 3MWJA 5BUSA 1KWKA 3RFUA 4MI9A 3W34A 4BFZA 3TG8A 3QU9A 4AY5A 1LX7A 1SWVA 3K9WA 3B1YA 3L84A 2HPHA 3WV5A 5JDIA 3OH8A 4OBXA 2IL1A 1QM5A 2RFLA 4GLJA 5EMKA 4D9KA 2RG1A 4NECA 3NHYA 1AKWA 2O2SA 2EFJA 2RGWA 4RESA 1XQWA 1KEUA 1ML4A 3KU1A 3ZR4B 2GN9A 1U1GA 3DS8A 2VDUE 4QTTB 4BFYA 2O2ZA 3E5RA 3LT1A 3LL4A 5CH8A 4ZALA 2EWNA 3BQ9A 2IXFA 3PR3A 1QG2A 2VTKA 2W6QA 3H84A 2OGWA 5PGMA 2VQSA 2P0LA 4DUGD 1XZMA 1QIIA 2CBGA 2HWXA 3GYBA 4R1PA 4F9GA 5EWJB 1P2FA 3GLHA 3HCEA 3ZU3A 3NCHA 1Z8DA 4QWMA 4URWR 3A2LA 2FUKA 5A05A 1UOEA 3L7NA 3PE6A 4URYR 1DAHA 4G5QA 2FSHA 1U99A 2O2JA 4CQMB 4OJQA 1JDTA 3RJ9A 5LZ7A 5H83A 3NZEA 2Y4OA 3DUWA 3KOYA 4AD8A 1WY5A 2B36A 4ZPXA 3UY4A 1FJXA 4L50A 5JZOA 2GLTA 5TEVA 4GZMA 3W5AA 4XYMA 3FPGA 3R7WB 4KLNA 5BNIA 5MF6A 4BLRA 5L7TA 4X71A 4TKLA 4TQGA 4M0EA 2JEOA 5ITVA 5DNYB 1E77A 1TC2A 1VDMA 2R5WA 3MXOA 3NQ41 4E1BA 5JATA 4FFOA 2VEOA 3VBBA 1I2BA 2RKOA 3IPCA 1T5HX 3F3KA 4Q7MB 4ZQGA 3PQDA 4BFWA 2HO5A 2HNIA 4J16C 1X70A 3WNCA 2OOKA 2Y68A 3H04A 4UEKA 4EHKA 1SIUA 3DT9A 4LW8A 3T94A 3P45A 2QD4A 4BKRA 4Z4FA 5E7IA 4QATA 2SKEA 3NBQA 1S0UA 4GE0A 2EKLA 1ZUWA 2ZWIA 5LBTA 4A0QA 1T2UA 4HD8A 1XRSB 5EJ4A 3WIBA 1W2HA 1Z38A 2QN7A 2VDNB 4F12A 5C3MA 1XN4A 5C8DA 1EFUA 1H6DA 3TFQA 2QUZA 4KMSA 1ZU5A 1UBCA 5GM1A 3B52X 1E66A 1E61A 3N3AC 1HRDA 4QOHA 1V9LA 4W7IA 2NV6A 2HBQA 1XDUA 4EEKA 3VAZA 3QFSA 2E1RA 3AHGA 1DDGA 4PFJA 5FOSA 4ZTBA 5IEJA 2CJFA 3Q1LA 5JPIA 4RTNA 3I73A 4XU0A 3Q2IA 2W00A 4HRYA 4LJLA 4Z7OB 1CJUC 2F48A 2WICA 1WB6A 2GUWA 5FPSA 2R11A 2GXUA 3GJ8A 5GMOA 5ED4A 3LZ6A 1N0WA 4ZVMA 3HVKA 3OAAA 4MUBA 4X45A 1LVUA 2I6GA 3GMIA 4IFIA 4NU5A 5FBWB 3JZAA 2WM3A 1GNQA 3Q0IA 3HEMA 3WGVA 5E4FA 4C6SA 5CCXA 1U63A 2OXCA 3ZZ0A 2XA1A 2X8LA 3A1FA 5J1TB 2O9JA 4ABTA 4M6WA 3TEMA 3ER8A 1FMCA 5HOQA 1XP5A 1QDUA 3CIOA 2VWPA 3DUFA 2IHKA 4R2MA 4R5HA 5KCMA 3TQQA 4E21A 4BXOA 5KYTA 2LCFA 3SHWA 1JQ5A 2VLBA 2XOKA 4GGMX 3BRCA 2F8MA 3TZKA 4YP0A 5H3HA 3DEAA 3L06A 1AQNA 1Z12A 4DWVA 2DJ5A 1NG9A 4G9EA 4QYIB 4Z49A 2WYOA 2QTLA 5IYZF 5AW1A 3R9WA 5CB4A 1ZW6A 3VMMA 4CMEC 3DZJA 1QZUA 1ZNQO 2XCIA 3OZCA 3WQHA 4U00A 3NBXX 4FOSA 3RIGA 4EYQA 3F7TA 1PL7A 1TIKA 4LJ4A 4EA6A 3TG2A 2ZT5A 3MWEB 3TTWA 2GXSA 4E30A 5JOQA 1DWOA 4MJ3A 1Z26A 4O1MA 3DHEA 4J0HA 3KXKA 4GF5A 3I5AA 1NBEA 3VQVA 3IOBA 1C3LA 3KXDA 3ONDA 4Q12A 5REQA 2CGHA 3RRMA 4D02A 3FD8A 1RTTA 3DT8A 1FUYB 4G09A 3VC1A 1S9HA 1IEWA 1IXRC 1M10A 3AKZA 2BFOA 1RZRA 1DV1A 1F2TB 1N0UA 3INTA 4WESA 1CY1A 3RBZA 4ARSA 5AHOA 1SKQA 2FEOA 1U7WA 3TLGA 2XPCA 4LY0A 5JVDA 2J7PD 2JIRA 2AJBA 3JQGA 3SS9X 4KHPB 2CEAA 4DMGA 1ONOA 4JLJA 4CZ2A 4FFNA 4AJ9A 1J70A 4JLOA 5CLJA 1OHHA 1SJ9A 1YB1A 5B1SA 5A9TA 2IK8A 3ZS8A 1K89A 3MCZA 1AVTA 3A2NA 4KQCA 2QD2A 4GDMA 2C9BA 4AU1A 1DAFA 4C0JA 4B3SB 3SLGA 4LXQA 2XMGA 2D5BA 1BWQA 3VO8A 4CN9A 6ABPA 3HVRA 3G9QA 1D2CA 3H05A 4J4TA 1JHYA 1X42A 3W2FA 2Y9MB 4HFMA 2NZWA 3ZU2A 1NC1A 1SVWA 4WNAB 4EL5A 2FB9A 2Z30A 1N78A 3M4YA 4GBMA 2DB3A 3QYAA 4TV8A 2VF7A 2JRLA 2ZUEA 2BLNA 5EWLB 2EFHB 1T2FA 4GC5A 1TYBE 1P33A 4GI1A 4XD2A 3VYSB 3AVTA 2R8EA 3DP7A 1ZNXA 4JQCA 3BWDD 4RY8A 3LGSA 5DJ5A 4C0AC 1X80A 1NPTO 3I39X 4YJGB 1ZK2A 4LVKA 3UWDA 1MTOA 4RYLA 1FMLA 2C1ZA 1L7DA 1I9CA 4RDHA 2QM7A 5EXDA 1E4EB 2WWIA 7ADHA 3TGPA 1NJ6A 2R8BA 4IFBA 3GGSA 4L74A 1MB3A 4XM1A 3L6UA 4ZAWA 3T0IA 5KB3A 3LUAA 4PSUA 1E2UA 4OI0A 2R47A 4WASA 2VPIA 1PSWA 5C8ZA 1ZN7A 2A9JA 3ESDA 3FETA 1Z0SA 3C3DA 4P74A 4RF4A 1JZTA 2L42A 3LHKA 5LDDC 4CUZA 2YIMA 4UKDA 2WM8A 1QH0A 2WU1A 4V02A 5CVTA 1SG6A 3RFCA 2R4TA 2I2AA 3BFMA 4HBGA 3U5TA 1ODIA 4S3MA 1B76A 2WF6A 5F5XA 3WGYA 3THWB 4GWGA 4E07A 1KO8A 2E49A 2RJOA 4GQBA 2EF1A 2CHQA 4L4SA 2L82A 2DVMA 3RUFA 2BY4A 2CB0A 5LKRA 1OWOA 2P6UA 4HEA1 3MLAA 3AFNA 2W22A 4IH1A 5JQWA 4JI0B 1AKQA 3RSQA 3NWJA 3VPBA 1MPTA 1G51A 2UV8A 4NBTA 2DE0X 3F0TA 3ADPA 4KU4A 1N2JA 3PCXA 1JAYA 1K9SA 1KJYA 4TLBA 4ZARA 1EJ2A 3MT9A 2GXQA 1WEKA 2V7WA 3FPFA 4NE7A 2GLUA 4PRZA 3DR3A 4G07A 1G8GA 4RLSA 1A8HA 1KZ1A 4QAJA 4YUZA 5JCJD 5KKAA 3SCZA 1W87A 3SX4A 5HILA 2VRWA 4RBNA 1Q1BA 1I7PA 5E4YA 2ZJBA 3VKUA 3WFIA 3ZH9B 2IW1A 2ZSAA 3NDBB 5CP8A 1RPTA 4XTCS 2GYWA 3TPFA 1EDBA 1MXHA 5E38A 4MQFA 3GP5A 4KR7A 1M7BA 3C98A 3MLEA 5J59A 1D1PA 4Q4HB 4CETA 3AGQA 4KX5A 4L5IA 4TXNA 1RFGE 5LOVA 3S4YA 5EHGA 2O2IA 2H63A 3BXEA 2J7PA 1IMOA 3HP7A 2BSQA 4OM7A 5HDQA 2HF7A 4JS0A 4H7DA 1YI1A 4N0PA 2G40A 2RHOA 3GLHB 1SEVA 1RWQA 2WUDA 4K6CA 3SC3A 4WZBE 4HNHA 4CLOA 3B2EA 5LD2B 4U2FA 1VIMA 1XAHA 3ZQ6A 5JEEA 2F7SA 1PJBA 2IKSA 4IIGA 1ZR4A 1T6BY 3PXUA 3HRKA 4AJHA 4XWWA 1XJCA 2E41A 3FYUC 5CX1A 2O8EB 3B9RA 1F9AA 1QU2A 1DTSA 3EVEA 4ML3A 1BFKA 5EXTA 2R00A 3UKOA 5K05A 3U6KA 4H35A 1Z5VA 1L5MA 1K5GA 2IA5A 1CZKA 2YWDA 4FBLA 4MRSA 4XH9B 5C7OO 5EIXA 3P8ZA 1SCIA 2C5SA 2CNNA 4Y7DA 4C30A 5IJWA 5LQUA 4RTKA 1XZIA 2QGFA 2B98A 1HT0A 4Q9HA 5BMVF 2FZ4A 3GFQA 3ICWA 3ILHA 2RGBA 2X7JA 3M1AA 4V03A 3ZS9A 4XGQA 2O2EA 1Q6YA 1J25A 1T3SA 2A33A 3U3RA 5IXJA 1SZDA 1BWPA 2GKSA 1OFVA 2YXNA 3PXDA 2XJ4A 4BRSA 2WB2A 1LZLA 5EERA 3KBBA 1J0CA 4TVKA 1NVMB 1OREA 3RKXA 3GFRA 4PRLA 1ESZA 2EERA 2PIAA 3DMDA 1G4UR 5DGIA 3ZBTA 1X8XA 2V8OA 1GGFA 2ORVA 3HFZB 2WY2D 5I7SA 3R7BA 2ZRQA 4J94A 3TTYA 1JF8A 3DOIA 2CW5A 2V4MA 3CY6A 1P4SA 3NHUA 3T7JA 1VPTA 1KORA 4RV5A 1NYTA 4IWNA 4NV3A 1F3LA 4JUFA 3WRYA 5LP1A 4BLQA 2WJZB 4C0LA 4C89A 3TLYA 3NH9A 4KMMA 5CIYA 2XGTA 5JDIC 1IEQA 3DLAA 4QARA 5KYWA 4KWHA 4FB4A 2BFWA 3LX5A 4JGIA 4IIHA 3CMQA 1XU7A 4YMIA 1X56A 1N2IA 2FFRA 2QRKA 4FINA 5C4GB 3IAXA 5DM4A 1YAJA 2BZGA 1QVWA 1YDMA 3NPMA 5JJLA 4Y1EA 2RD2A 1JG2A 2PXXA 3QVGB 1DCKA 5FXMA 1VMAA 1K5DA 1PV1A 1P1RA 1UBOS 3QYJA 3W78A 4F6RB 3ZDBA 2IYWA 2CMGA 3GJ6A 4M1YA 1JTVA 4BVEA 2GWRA 3SHVA 3ZBUA 3ZUGA 4GMKA 4RD1A 3UFGA 4DMLA 3GFSA 4R69A 1S2MA 4BNHA 4E0BA 1K75A 5PNTA 1NL3A 2Y1XA 2XEDA 3MERA 4HAXA 5L4SA 2FPIA 2GESA 4QOSA 4RF5A 1YV9A 4HNGA 2XVXA 1MNQA 2BAGA 4WEOA 4J0IA 4AQDA 2CT8A 3PJRA 4P0PB 1PW7A 2MSLA 1ULUA 1SESA 5HS6A 3WLOA 3WZLA 4HEA6 2GM4A 2DQ4A 2Q3EA 4P5PA 4X7RA 1RJEA 3QKIA 4I5IA 2E4AA 3WP1B 1MO2A 2ACVA 4RJTA 3RKWA 1XTSA 1GL7A 1P44A 4ARIA 2W71A 1OGYA 3P4XA 2E1HA 1J1IA 3ERCA 2HNKA 1TUBB 3FVVA 1U9YA 1IG0A 2FX5A 2PMFA 1CPYA 2OHGA 1XEXA 1GG9A 2VDPB 3A4NA 4HQLA 3SBDA 4GSLA 4FZ3A 4CBVA 2E21A 1QH8A 2O7NA 2M98A 4KYUA 3RC3A 3FDXA 3KEOA 2AWNA 5M34A 1A9ZA 1YQXA 1XTJA 2OYSA 1UXGA 2HJHA 1AHPA 1G3IA 3S99A 3F8SA 4DBVO 1JJCB 3KJIA 5ALPA 2QHUA 1DTWA 4PAGA 1AV7A 4S12A 3M4ZA 1CUVA 4LEIA 3GLIA 4C0