1GGMA

Glycyl-trna synthetase from thermus thermophilus complexed with glycyl-adenylate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
442
structure length
442
Chain Sequence
b'AASSLDELVALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAWWRRNVYERDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNAKARYWTPPRYFNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNVLDATSRKLGFGIAQIGKAFRNEITPRNFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSRENLVPYQQPPESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVAVIPLVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKDGTTRLKDTVTVRDRDTMEQIRLHVDELEGFLRERLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine--tRNA ligase
publication title Glycyl-tRNA synthetase uses a negatively charged pit for specific recognition and activation of glycine.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ligase
total genus 115
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 1999-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1ggmA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 1ggmA02
2QHTA 5F5WA 4BWAA 4CS4A 4TQFA 1ASYA 3PCOB 4H2YA 3V7SA 3TUPA 4H2SA 11ASA 2C7IA 3HY0A 3UGTA 4P72A 4PHCA 1N9WA 2ZZGA 3REUA 4HWPA 2CJ9A 2E41A 2DTIA 2G4CA 1NYQA 4TVAA 1NJ1A 1SETA 3W3SA 2DU7A 2AKWA 4XU1A 1H4SA 3IKMB 3CMQA 4K88A 1X56A 2ALYB 2RHQB 3E9IA 4YRRA 4KR2A 1EVLA 1E24A 4H2TA 3I7FA 5KNNA 3IKLA 4CH4A 4EX5A 4OLFA 2DKGA 4YP0A 1ADYA 1EIYA 12ASA 1YFRA 2DZ9A 1X01A 4YYEA 1KMMA 3TEHB 4XU0A 4NCXA 3VBBA 1BBUA 1EVKA 3M4QA 1WNLA 4YRQA 2C8MA 2RHSB 3PCOA 2ZT8A 1J5WA 3RGLA 4YRMA 4XU2A 1WPYA 1V95A 4P3NA 1SRYA 2PMFA 3QO5A 3HXYA 3VQWA 4WJ3M 4RQFA 2DU5A 4PG3A 3V7RA 2CIMA 2J3MA 3VQXA 3HRKA 4HWRA 3QO8A 4H02A 3PZCA 3A7AA 3RIRA 4DQ2A 1H4TA 2ODRC 3WQZA 2ARTA 2DXUA 4HA8A 2DXTA 1GGMA 2I4NA 4XEOA 3RACA 2AMCB 2Q5HA 4H2UA 2ALYA 1SESA 4YCVA 4KR3A 1B7YB 2RHQA 4YRTA 4YCUA 2E10A 1W66A 4YRIA 4G85A 2DJZA 1VQZA 1BIBA 3DSQA 2ZGWA 2ZIOA 2ZR3A 4P3OA 3LSQA 3VQYA 1YGBA 2P5IA 4YREA 1HTTA 4HWOA 4UP7A 3RUXA 2Q7GA 3L4GB 3HRIA 3TEHA 1KOGA 1QF6A 3NELA 4P71A 4P75A 4YRLA 5ELOA 2IY5B 2ZIMA 4YRPA 4XTWA 4X5OA 3A74A 5E3IA 5K1XA 4HWTA 3EFRA 1E1OA 2DDZA 4H2XB 2DQ0A 2RHSA 4L87A 2E1HA 1H4VB 3E9HA 4YRKA 3REXA 4TVWA 4XEMA 4UP9A 1EQRA 3HXUA 1YB3A 2I4LA 1HC7A 3LC0A 2ZT6A 1PYSA 3P8YA 1H4QA 4XTUA 2Q7EA 3HFZB 1WYDA 4YDQA 1IL2A 1B8AA 3V7CA 4XU3A 4J15A 1ADJA 4KQEA 4P72C 4H2VA 2ZZFA 3A5YA 4BW9A 1NJ2A 4P75C 4P74A 2FYKA 2QHSA 3IG2A 2AMCA 4UPAA 4EO4A 1B7YA 4WF2A 2ZT7A 3RF1A 3A31A 3NENA 2EAYA 1ASZA 1C0AA 3KFUA 2ZINA 4YRCA 4G84A 2DZCA 3LSSA 3RKYA 4TQDA 2E64A 4TTVA 5ELNA 4YRSA 4P3PA 2LW7A 4YPFA 3NETA 4RMFA 3VQVA 1QE0A 3BFMA 1NJ8A 4YRGA 1B70B 3HXWA 3A32A 4UP8A 4XTVA 4K86A 2CJBA 4DPGA 3EFSA 3P8TA 4P74C 1E22A 4CH5A 2E65A 1X2HA 1NJ6A 4WJ4A 1EOVA 1WQ7A 2ARSA 3V8JA 3HY1A 3RKXA 3V8KA 2P0LA 3P8VA 3HFZA 2DVEA 3HXVA 1L0WA 2ARUA 4YCWA 4CS2A 1X54A 3HFVA 2DTOA 2EJGA 2CJAA 1USYA 3MF2A 4RQEA 4LNSA 3NEMA 4CH3A 1X2GA 4ZIBA 4CH6A 2XTIA 4YROA 2ZCEA 4YRNA 2XGTA 3BJUA 3L1AA 4RDXA 2EL9A 2I4MA 4HVCA 2QHUA 2E3CA 1Z7MA 1Z7NA 1BBWA 2ZZEA 2EWNA 1JJCB 1RIQA 4XTXA 1YFTA 2DTHA 4XTYA 2ZT5A 2Q7HA 4P73A 3TEGA 4CS3A 3QO7A 3MF1A 4O2DA 1WU7A 4AH6A 2EJ9A 3UH0A 1WLEA 1G5IA 3A7UA 1LYLA 3A7RA 1ATIA 1E1TA 5C53B 1B70A 2ZR2A 3G1ZA 1USYC 4P71C 4H2WA 4K87A 3ERRA 3RL6A 5C51B 3OD1A 2E5AA 2QHVA 2I4OA 2EJFA 2DQ3A 3V8LA 1NYRA 4TWAA 1G51A 1FYFA 1BIAA 4TVYA 5K1PA 3UGQA 1EFWA 3HTZA 4YRFA 2ZNIA 4TVAB 4ZTZB 3L4GA 3M4PA 4P73C 2AKWB 3L2ZA 2HNIA 2IY5A 2J3LA 2ZNJA 2PMEA 3QTCA 2CGHA 4E51A 1X55A 1YFSA 4H2XA 3IALA 4OP0A 2ZXFA 4HWSA 4ZTUB 1HXDA 1KMNA 1PYSB 1JJCA 3FJPA 3A5ZA 1NNHA 3RKWA 3QNEA 3ICAA 3UFGA 1NJ5A 2DEQA 1WQWA 1EIYB 3HXXA 5C52B 1G5HA 4Q6GA 4XTZA 3MEYA 2ODRD 4WI1A 1B76A 2ZTGA 2Q5IA 4YRJA 5HGQA 3HXZA 4Q15A 1SERA 3R07A
chains in the Genus database with same CATH superfamily
2R84A 3QFSA 4BEBA 1M1NA 2W6OA 5IAOA 3EXIA 3FPAA 2QLTA 2GDZA 1Z2NX 4CW7A 1WF6A 1C14A 5AKKA 1VCNA 1N4DA 3FFBA 2I2AA 2DF8A 4GBJA 3CEMA 3LS2A 2A0KA 5C1IA 2GDJA 3W8NA 4E5MA 1IBKB 2P5TB 3QG1A 3T5TA 4BU0A 1NW9B 1I2AA 2C7BA 4KQMA 4DHWA 4HJXA 4FCVA 4AB1A 2BKEA 3SC2B 1UFVA 1KVQA 2VJMA 3DAPA 5TJ9A 4CKWB 4F5WA 1DS6A 3K16A 2OYRA 3OVMA 1FDVA 1IJBA 3WRXA 1QHXA 4G0OA 4ALMA 1R4NA 2PZKA 4FE3A 1K9VF 1S3SA 1XCLA 4L9AA 4ZCPA 2NUAB 2GN8A 3FLAA 3ZLUA 1G64A 3HSYA 1QPBA 3QY0A 1Z4MA 2MYUA 1QRRA 1SETA 2IOYA 3IOBA 3OJOA 3W8RA 1JU3A 1BH2A 2UVQA 1BWPA 2P4QA 3VYWA 2DC1A 4QJ3A 2I9PA 4L8YA 2XVAA 4HYYA 3NHYA 2ZB2A 2J87A 4MUGA 4PLYA 1Q7TA 1IN4A 4D81A 2HMVA 4R7ZA 5CM8B 5K3SA 1EAMA 3WK6A 1OV4A 4NZ9A 3ZC3A 4BLSA 4CLDA 4EQZA 3MUEA 3RE1A 5K8VA 5ICFA 1L3CA 1CUWA 4FMDF 2X2PA 2R60A 3BERA 1IH8A 3KC2A 2FEKA 1XRSB 1Z33A 3KL4A 3RHTA 2GKSA 2IU0A 3IUSA 1W46A 1K5GA 1H22A 1VLLA 2CMGA 3KWFA 3MJRA 4RY0A 3PNYA 2QIPA 2OILA 5LDDC 4WW0A 3I6IA 4AD8A 3FVVA 3CW9A 3U81A 1AS2A 1WKBA 4QQKA 4YAOA 1X94A 4AZ0B 3NW9A 4U9IS 4CT0A 3H11A 2Q8QA 4CWAA 1NP3A 5I6DA 3PI6A 5DMXA 3I3OA 5TQ0A 2EHDA 1NBMD 2NXJA 4FNMA 1ONBA 3L1VA 3RDPA 5KBYA 4ZVNA 2DTEA 3RVMA 3WK8A 4ETWA 2ZWVA 5HJ5A 4QDUA 2JBAA 4Y9RA 2ATCA 3ZCXA 4B9EA 5AVVA 3M1IA 2XMSA 2ICAA 4PYRA 1VJRA 1V2GA 5DBGA 5E38A 3IBFA 2AEMA 1Y63A 3BH6A 3R7AA 2OG1A 5JDCA 1RYYA 3X2FA 1Z7YA 4Y6OA 1TQHA 4R1QA 3FZGA 4N5DA 2RH4A 1UBNA 4OAOA 4YJFB 4EHDA 4HXFB 2RONA 3QLUC 5DGIA 4DDKA 3ABRB 3HDTA 5EMHA 3QITA 1P80A 1R2QA 5CUQA 1JHMA 4IIBA 2C7RA 3QVGB 5EQTA 5F78A 4LZOA 2WUGA 3L6BA 3PVCA 4MV0A 1E3TA 1AO3A 1ZG3A 3JD0A 4OQZA 4C5AA 2FPIA 4OP3A 4PANA 3L8EA 1P1HA 1ESMA 3QHAA 2YOFA 1TPZA 3AOEA 4WJ3M 1ISRA 4KMOA 3QE4A 1PGNA 1ZD8A 2DLCX 2R6HA 1EJ0A 4E2ZA 3UK0A 1MTOA 3HB7A 2ECFA 2JFGA 4GBMA 4WUVA 4TKMA 3FOBA 4XW2A 5ED0A 5EZ5A 5IM5A 1HTBA 4DNXA 3FCCA 1ETUA 4A4DA 4RULA 3HJFA 3I58A 4LC1A 2B1GA 1I3KA 3ND5A 4PHTA 2Z3ZA 3KUXA 1NDQA 1YUNA 2P90A 3ZXSA 2GTIA 4G9GA 3DE3X 3EK2A 4G0VA 3KEFA 1KMQA 1G6Q1 5EJFA 1X7HA 4M0FA 3RIRA 1GN8A 5IM4A 1ECBA 1S5PA 3BZBA 4Q4HB 2PCLA 4KGDA 3RUPA 4D99A 4P98A 1LLQA 4JGBA 3Q9LA 1REQB 4O1IA 1MEOA 4BXOB 1L7XA 3DEAA 1LNSA 3UHAA 2DWOA 2I4NA 1GPH1 4I6GA 3IJPA 3PPVA 3WGZA 1MB3A 2OVBA 3QMPA 1Y89A 2DP4E 3S8YA 1ZCFA 2Q5HA 1BS2A 1YVEI 2BTQA 1JA1A 1SPBS 2IOFK 4FHEA 4K6OA 5A05A 4RWEA 1FPMA 1UFKA 3COVA 4ARUA 5JFGA 1OH5A 1QRDA 1XOIA 7AT1A 4H7KA 3BXPA 4ZYYA 5HILA 2X1LA 4YRIA 1MIOB 4G85A 3K72B 1NUAA 1Q0QA 1YDWA 3MRXA 3SDBA 5B1DA 3SWWA 5TLSA 4L3WA 4WFQA 1BIBA 8OHMA 1K89A 3BE6A 4QUBA 1VE5A 4H77A 2XF8A 4HEHA 3VQYA 3HVHA 4ZT3A 4NV3A 3WISA 3EIWA 2G9UA 3PENA 1JDPA 1M1UA 1OXUA 1XZDA 4K1LA 1Z68A 2MSKA 4H3KB 3W5VA 1DKPA 5KHAA 4A8JA 3K32A 4EJSA 4EUFA 5CB6A 3LOUA 4ZQCB 1YNSA 1AX9A 1WXWA 1P60A 2QENA 2VF5X 3PPYA 1KEWA 1B0AA 4OXNA 5CW2A 1JB9A 3UHOA 3JSAA 4D82A 5HKKA 3AR3A 4XVRA 3LYAA 4R3UC 1ECFA 2Q4RA 1QDEA 2XQJA 4FMDB 2RH9B 4JWKA 4Q93A 4B9AA 3WAJA 5GADl 1FQJA 4NHOA 2X2FA 1PT5A 4KO8A 1DMSA 1LSOA 3SN6A 4E4YA 1SXQA 1SVOA 2CSXA 3K0FB 3NIFB 1SGWA 2JZCA 2CJYA 1SC1A 3PHGA 2FW7A 2ODQA 3IESA 4CKZA 3LG2A 3RD5A 3IQHX 2H11A 4ZPJA 1MAWA 1PFUA 1IHXA 2YN2A 3Q15C 4Q18A 4QPDA 3G49A 1T5HX 3L8GA 3UC5A 5I9IA 5TY0A 1P8AA 1E99A 1E61A 5IN5A 5FPKA 2WWYA 3WRVA 2ZRFA 3D8NA 3PTAA 2XTZA 5EKSA 4URFA 4XEMA 2YYZA 4G65A 4CEJB 3E03A 5AKGA 5EEGA 4AZSA 4C0KA 2JIMA 5EJIA 1F5NA 5K9ZA 3JWEA 1EHYA 4FYVA 1YB3A 4XVHA 4QPJC 1EEHA 1CEEA 3PUZA 1EFTA 1IUOA 2EDCA 1IY0A 2ZULA 3CZRA 4HN4B 1W6UA 4TTRA 3WY9A 3UT0A 3ZKWB 4I4IA 3BJMA 3G8DA 4OVKA 3THYB 3QFHA 1N6RA 3FNRA 3RU9A 1TKRA 3CZAA 3D59A 3IQWA 1QHEA 1R88A 4QXAA 3ZG6A 1OYWA 2BGIA 3MRSA 3QVXA 1Z35A 1WSAA 1DJPA 4RELA 3IERA 2CBXA 2CDAA 2EC5A 3WV5A 1M0SA 2XTAA 1V5WA 2REOA 3PJFA 1NI4B 2ZZFA 2C0PA 4TTQA 1B3RA 5H4HA 3A5YA 3WLTA 4NYJQ 1L7EA 1F48A 1GUZA 1P1FA 2XJ9A 3O3NB 3IQXA 5I8PA 1E5QA 4HH1A 2OCKA 3QEMB 4G8JA 3UAOA 1RI5A 2DBRA 3OQHA 5C5CA 3FHJA 3BMNA 3V6LA 4GFDA 4NZZA 3GELA 5LQDA 1ZO8A 3IVGA 4LQ4A 2YWFA 4DUGD 3ABQB 1J8MF 4GWLA 1GZ7A 2RSLA 1EX6A 4HNVA 2OXRA 4KN8A 3KVYA 1AJEA 4MPTA 3WTCA 5FBRB 4CKYA 1PYDA 3ZZNA 4HAYA 1AG9A 2P4HX 1FX1A 4J7XA 1U28A 2OZEA 5FFNA 4C0XA 4Z4QA 1YRHA 2XNDA 1Y7PA 4GX2A 4NWIA 1KYQA 4P6VF 3JQRA 4X54A 5LC1A 1YONA 3OCYA 4AAYA 4NMHA 1G20E 2P2ZA 1O9GA 1Q6YA 4RLQA 4I4TF 4ENTA 4K28A 1ZRHA 3VR5D 1FFWA 3RKYA 1RCUA 1Q11A 3CIFA 3VR4D 5ER9A 2C3PA 3VHXA 1FDUA 1RQPA 3QGMA 1M6VA 1JA9A 1TD9A 3GT4A 2UXCB 1RJDA 3EGXB 3MQ4A 3PICA 4MOWA 3UK6A 2BGUA 2A59A 3FWKA 5A4DA 2JEOA 5CK4A 4RMFA 1PE0A 3OE1A 3HKBB 1YQ9A 4ZVQA 1C1YA 1T3ZA 4QJBA 4X41A 3OQMA 4JP8A 1N4AA 1BQ3A 1PQYA 1P5ZB 3EFEA 3WLLA 1ISIA 4K86A 2D8AA 2FN8A 4E33A 1KFKB 1LF0A 2VHXA 1W0KA 4OFZA 5C46F 2FSFA 3KB8A 1TTTA 1OAAA 1MB4A 5JBQA 1GUDA 4ZAWA 1BCRB 1R74A 3RYHA 3G0HA 1WXQA 4RQBA 2FN7A 1SU7A 1WMAA 3KNZA 3FH0A 3LFTA 4KH0A 1UT6A 4IRMA 5HE8A 3LP5A 1FUIA 1G8FA 3WI7A 3NONA 5K3OA 5KWVA 5EINA 1HFEL 4LY9A 3AGQA 3RSHA 3GLVA 1H6BA 1QK4A 2B4YA 3UAZA 2N1BA 1EWYA 1FRQA 2P2GA 2WT9A 4EUKA 5L9AA 1Y4DE 4QXMA 3HY1A 1DP4A 2YJTD 3O7MA 1WCV1 4XIJA 4RK7A 2PKXA 3SEQA 1M1YA 3R2JA 2P0LA 1U0FA 1KK3A 2CLOB 4GLJA 1GL3A 4JI3B 4LFCB 1G63A 4GOOD 3V48A 5HSGA 3DLHA 1XCMA 2XA9A 3HXVA 4OQ4A 1QIKA 3I73A 4W9NC 2VH1A 4LJAA 4WN9B 1W6RA 3CVUA 5B2EA 1NKTA 4Z86A 1E2LA 5ER6A 1E62A 1K5PA 3C3CA 5EC8A 3UXMA 4WADA 2DE0X 1VMEA 5IANA 3STHA 1XWWA 4N5LA 5JMPA 5M34A 3OBBA 4R68A 3V4VB 4ZU6X 1CFZA 1F8GA 1T0JB 5JD5A 4LS3A 4F4JA 2YNMA 4RLSA 1DAIA 3BFKA 4MUBA 3GUHA 5EY5B 2UYYA 3C5EA 4HNGA 2BGGA 4DR2B 1L5KA 4BX2A 1ECLA 2GSWA 3BTOA 3EIOA 3PCRB 5DTQA 2AVNA 5AHWA 2CY0A 2OCYC 4DDTA 2ZWPA 4G1CA 4HZUA 3KB2A 1Q1QA 1UKVY 4C7BA 2GHQA 2BEVB 3ESAA 2XVMA 1FNCA 1R37A 3ZLJA 2ZZEA 3L1KA 4BWYA 3E5RA 4N5MA 5FOSA 1ML4A 2BFEB 4BGEA 3C7AA 3CRZA 4OYLA 1VA5A 1O95C 3PC7A 3DLAA 3ROMA 3TVTA 1SKBA 2YQ5A 1DZIA 1ZGAA 3E7PA 3TDKA 4P33A 4EA9A 4KITB 1VBFA 1CS0A 1RFGE 3EPJA 2OXTA 2QM0A 3F6YA 1NP6A 1JFTA 1KH2A 2F90A 3VNRA 3UWSA 2WF8A 5A62A 1XEXA 3CWZA 4G0MA 2WABA 1XKXA 2XCOA 3GAMA 5BVHB 4MGYR 2ZYDA 2WYWA 1UWLA 3UEOA 3WP1B 3DFUA 1SBQA 3H5NA 4UZFA 2WWVD 2EQ5A 2EJ9A 5CD9A 1VKRA 1XTQA 1MB9A 1GXSA 4KN9S 3WYAA 3TZBA 2VPYA 2HSGA 3ORFA 3IODA 3QKWA 1U0OC 3WLRA 3ERCA 4IH9A 1ZOIA 4QXPA 4FOTA 2BIFA 3PBKA 1J70A 3ET5A 4TLMB 2P4UA 4ZOLA 5GVSA 3C8ZA 1SXJD 1WEKA 4E6EA 1C8LA 2X77A 1M1XB 2AMLA 4I4TB 4OHWA 4XB2A 4XH9B 1VOTA 3ICOA 2CLHB 1U02A 5IVHA 4XEHA 1T9GR 1TT5A 1T1SA 2ST1A 2A0FA 3LFHA 5CD1A 3MYYA 5EHGA 3DL7A 3GH1A 2IOHA 5FJIA 2R00C 2WU3A 3QVTA 2AMVA 2WG0A 3UH1A 4D9GA 3AVXA 2W6JD 1JVBA 3OF2A 3PE4A 1ZOLA 1Z2CA 4XR4A 4PG8A 2JHAA 2ZRQA 4O0LA 4EPWA 2DQ3A 1D9ZA 4BMNA 4B17A 4TWAA 5AWFC 4QEKA 2BHLA 3P71T 3K8YA 1BIAA 1ISSA 5BNIA 5B2ZA 3DMRA 1HDXA 3JQCA 5DI9A 4DIKA 2JFFA 2P9EA 1U0EA 4YXWD 3OG9A 4LDQA 2BFFA 4QECA 1SJ9A 2WICA 3DGFC 3IO5A 1L5GB 3B2EA 5K6TA 1SIBE 1XKQA 4Q9IA 4W5RA 3HABA 3V97A 5ALTA 1JEQB 4D41A 5KNLA 1GV1A 3LVRE 1U9CA 4V0KA 1L4UA 3NTXA 3UB2A 4JMPA 4ZCTA 1NMSA 1A5TA 4WT7A 3L2ZA 1O4WA 1SBZA 2CW5A 2X22A 3HYLA 1JLSA 3MOSA 5SY9A 4AROA 3U4MA 1G7CA 1ENZA 2TECE 3M6MD 1GQFA 3UV7A 1HKHA 1Z28A 2YIJA 5GMOA 4WNCA 5CURA 1C4WA 2AJCA 1NBOA 5B30A 1XDDA 2W90A 4JT4A 2C57A 1F6WA 2AXNA 3EH2A 3GVCA 2WIFA 5AVOA 4G0WA 4E94A 4XQ9A 2I62A 5HOEA 4XD7A 4LSMA 3HWRA 1O5OA 3OTIA 1HXDA 4R8RA 3QF7A 1KMNA 3C8HA 4EF5A 4UM9B 4NCBA 3E0QA 1QIDA 5HGXA 1MJHA 1F1JA 2JI6A 2ZRHA 3K92A 1P1CA 4M9ZA 2O8EB 4KZKA 1YU6A 3L01A 3OY7A 4OYRA 4XWYA 5DGTA 3WFJA 5IDWA 1X2BA 3ETLA 2C00A 2QY6A 3I6BA 2PUWA 4QXQA 3TJRA 5T4FA 5LIPA 1H5QA 1PCXA 3FR8A 3FXAA 3N2LA 3AM1A 4NBRA 4KJZA 5H16A 2FFBA 1FSGA 3FVWA 3KSMA 1TK2A 4FZ3A 3U4GA 5LJLA 4ER7A 3F8WA 4Y98A 2KW5A 4FOLA 5G02A 3SX0A 1FRNA 2Q0HA 1MB0A 1Z5UA 5E8RA 2GBLA 1CJMA 3N6VA 4MW5A 2L19A 3OWXA 4JLAA 4PO1A 4TL7A 4Z0PA 3O73A 2W58A 4BB0A 1HE8B 1GPDG 1N2IA 2Q5FA 5FULA 2QOEA 3NKVA 4Q7QA 4YNBA 3L92A 4EZEA 3MYRA 4RSRA 2R97A 5E7MA 4UNNA 4MP3A 4J0JA 1CUXA 1D4FA 3DEIA 3K1TA 1XTSA 4FM9A 3VPXA 3ZD8A 1K3TA 1V96A 2R8OA 1NUTA 1RFLA 3B60A 3RKUA 2VNAA 3SQWA 2C9ZA 4PVDA 1HFJA 3HR7A 4EW2A 1ULZA 1HE2A 2Y76A 1TMGE 1KO1A 1B15A 1DBRA 4OOFA 2TMDA 4Y2TA 1OZGA 3V3KA 4EMBA 4GMDA 1KJ8A 3FMOB 3OEYA 1W85A 4OSEA 4PHCA 4JNKA 1QGED 1HM5A 4OKSA 3DDWA 1RRKA 2BZ0A 4XYEA 1KJ9A 3ESZA 4IQ0A 5JCJA 1U98A 1FXWA 2MSCB 1GCGA 4E70A 2ZZGA 4NU8X 2GERA 4GOKA 4KUGA 1TKBA 5FOQA 4IQGA 2ATEA 1TVEA 5KINB 3VU8A 4I5EA 1H3FA 4GL4A 4HRXA 5JYEA 4CLRA 3GRPA 1H2RS 3VR6H 3A4LA 4RTJA 2BMFA 2QS9A 3AT1A 4PF1A 2PCJA 3JQAD 3R1IA 5IARA 5LR6A 3QOXA 3UJ6A 3HCNA 2JW5A 4ZCIA 1XA3A 2I4RA 3ZVMA 2CVHA 2MSEB 4NYMQ 4CM9A 3PYXA 4QSMA 2VDUE 3RSCA 2PEZA 4ZTBA 4W5NA 1J0DA 3CZQA 4Y2JA 3ZWQA 3I8OA 2WFLA 2G8NA 3AJEA 4RANA 4UAVA 1CYEA 2Y8EA 3ETEA 4IDBA 2PXAA 3G8YA 3TRIA 3SMQA 1A9TA 5ERYA 3ZEAA 1G9SA 4ZVLA 5BSKA 3E3MA 1IOLA 1U8EA 3VC2A 2CV0A 1M2OA 3OZIA 1I2ZA 1I4LD 1TZBA 2C2BA 1W5FA 2DJ5A 2A58A 2FWRA 4V3CA 4EG8A 4HWKA 3HEBA 3QEKA 1EPUA 3T3GA 1EWVA 2NTNA 4FGKA 2AKYA 4FX2A 3PWKA 1R6AA 2ZU6A 1VE3A 1QTRA 4KAAA 4J0DA 2QLBA 1XSEA 2ONYA 3A1WA 5JSYA 1ZH4A 3HLTA 3WNDA 4XSVA 3AI7A 1D03A 1Q84A 2XYVA 3H3FA 1LSJA 3SYTA 5J2UF 3Q4GA 2YVKA 4YP0A 1FQWA 1E1CA 1WPRA 1U7HA 2D74A 2HLDD 4JQZA 4C78A 6Q21A 4NL4H 4J90A 2FETA 4TWZA 3U7JA 1XTRA 3RYTC 3F9CA 3BZWA 1YRAA 2PZBA 3VSAA 1RQGA 2R751 1Z07A 3E23A 4IZIA 4DDWA 1Z88A 5T5QA 1FSZA 3FCOA 2KM1A 4EFLA 3BMQA 4EF4A 2J8ZA 4NBVA 3GB9A 2BGLA 3G88A 2VSYA 4Z9AA 5DM2A 4BLOA 1EESA 2FDXA 1YZHA 3L6EA 4H6VA 4QQFA 5CX1A 1GZHB 2BKVA 5E0OA 1H1LB 1AU9A 1RTKA 1HWYA 4OMDA 3GN1A 4D0RA 1UCFA 4DV1B 2FMIA 2JCBA 4C4XA 4KPGA 5TMPA 4XAQA 5JAQA 4IY1A 1ZD3A 3V8BA 1EZZA 1VKOA 4YRDA 4DLAA 4LOLA 1K68A 4M9QA 1HDYA 3KWMA 4G6ZA 4XU2A 2C1ZA 5KYVA 1A2OA 4IMJB 4NJEA 3T1QA 2V4MA 4NTZA 2BDUA 4NS1A 3WGTA 2WVGA 3F6SA 1SVUA 1W44A 4UVIA 1HTWA 3W9YA 4R2KA 4OUDA 2BSAA 1L4EA 3DOOA 4QJIA 2ZR8A 4H3HB 1JHDA 1GSAA 3EYWA 1U31A 3ONDA 3Q0IA 3LDHA 3ZNOA 1A9RA 1GO2A 4AJ2A 5LU8A 4I3GA 3LKDA 3KIPA 2WP8J 5A5VA 1QJ4A 3QO8A 2QRVB 5CLFA 4CF6A 2LZ0A 2YXDA 5I4BA 4LJ5A 3QYJA 1TJYA 3QH4A 1H4TA 2A7XA 6CHYA 6GPBA 3W6PA 4OQMA 4A3SA 1YR7A 4HAUA 2I2FA 4LUCA 2OWDA 4ZICA 4J16C 2KBFA 5J1SB 2J0SA 3DO8A 4CFZA 4A82A 3U56A 4PTLA 3BGSA 5AXDA 1J7JA 5B57C 2XR1A 5KQMA 2OQ2A 2ZI6A 3T38A 3VKWA 2PAAA 3R3XA 4WOJA 2QIOA 2PUCA 1C4XA 3AM5A 3J7TA 4KSYA 5C3MA 5JPDA 4UU1A 1JHUA 3EDOA 2PV0A 2R6JA 3KZMA 4RNDB 2J33A 3A0UA 3V5NA 3ZWMA 3E70C 5ITZA 1PK8A 1TVMA 1VI2A 3ZWOA 1XTTA 2HXGA 2PBRA 4HXYA 5U1PA 4D44A 3VNBA 2X8LA 1QORA 1QF7A 3RV4A 3AB7A 4J7AA 1PT6A 3PT5A 4GI7A 3B70A 5AI4A 4D9CA 2NU7B 2R7AA 5AM4A 4I1PA 1AQIA 1JS1X 1RI2A 4OHOA 3RS8A 3STXA 4UP7A 4F5EA 4NBLA 4FYMA 4PSUA 3D4LA 1FFEA 3HA3A 1X86B 1LW6E 3IKVA 4A5OA 4NMMA 4IIHA 3HJGA 1W35A 1LWOA 4A2CA 4Q3AA 5I7SA 1EFUA 2WT8A 1WM1A 1NU8A 4L85A 3I37X 3UWDA 3G68A 2GJAA 5LQUA 1L7AA 2W37A 1XHLA 4RK4A 4FJ1A 3B85A 2Q2VA 5JE8A 4F9GA 3O5AA 4HWTA 1KEEB 2B8JA 3AB8A 5DOZA 2PR2A 1IHOA 2ZBGA 1E1OA 3KAPA 1TK9A 4MO9A 1E9AA 1PLKA 1RBZA 4P8RA 2PQ0A 2ZBFA 4Z54A 5KOJA 1KI4A 5ALRA 4JJIA 3RFVA 1T5IA 5J2UB 1T2FA 1C7RA 1PHRA 5GPBA 3UMBA 4Z8YA 4C4PA 2N1MA 5CXUA 1H4VB 2GILA 5EXEA 1A69A 4IINA 3VZQA 3UMSA 1KKUA 2J3JA 2C8VA 1NNEA 2PK3A 2A86A 4FW9A 4UAGA 2F67A 3JALA 4ZVKA 2PSDA 2PKEA 1L5YA 2A57A 1ZGBA 2WTUA 1JG7A 2O3RA 5DI3A 3TOCA 2H1IA 1CJSA 1XR3A 3DBRA 2AQHA 1X9GA 2P3QA 1FYXA 3Q6NA 4LDAA 4PO9A 4RCZA 3NVKI 5DSTA 3LUJA 2B1RA 4EATA 1PR3A 1C7ZA 4TL8A 2NU8A 4BQPA 2OHOA 4H16A 3JASB 5E8JA 3RIHA 3THOA 5HHTA 1RIIA 1YMUA 1O6BA 4M0MA 5GV8A 1MF7A 4MXDA 3REQA 4KLRA 4YUAA 3R3ZA 4LDPA 1AC5A 1XPJA 4ZGGA 4P4SA 3D6HA 2V4ZA 2PGAA 3HNOA 1I7DA 1QWSA 1PL7A 4BFWA 3MJEA 3A6PC 4QYWA 4KB5A 1Q16A 2AG0A 4ER5A 5HNKA 5LMUB 2X3FA 2ZJYA 5DU2A 4WBNF 2VPPA 4E5NA 1QIFA 4PE5B 2JJQA 3IQIX 2WE7A 4J91A 2GASA 1XQWA 4A2WA 5JALA 1MHPA 1D6NA 2GARA 3RFCA 2GN0A 2ZAGA 5EMLA 5BR4A 2WUDA 1SIUA 1NV8A 4DSNA 3PC6A 1I4OA 2R1UA 4AQ7A 1KYWA 3HXMA 1B7YA 2B35A 1JSCA 4MUHA 2VL7A 4Q34A 5TMEA 1Z0IA 2CCKA 3OOHA 3ORRA 3VH4A 4ZDKA 3HN6A 2VQ6A 5KWJA 2R0QC 2OLKA 4REMA 5TIIA 1ONNA 1FXSA 5JSKA 4G9BA 1SA0A 3U0BA 1QOPB 3ANXA 4FHCA 4ZIRA 4DDMA 5MN6A 2LPMA 1J8QA 1PGJA 1T5TA 2WVHA 2QN7A 4QJ4A 3EXG1 4MV3A 5DM4A 3E7XA 1YC5A 1QGAA 3T3DA 5JQWA 1TZKA 3OZTA 1U8AA 5EHNA 1I5RA 2D4HA 3F67A 2IYQA 3K94A 3OZGA 4GBGA 3VOAA 2AI3A 2ZYTX 5CLHA 4EB6B 1T3LA 1B00A 3GL9A 2J7PA 3JYLA 3R5XA 4OYYA 1XXHB 3V8QA 4XA8A 2ZRNA 1NWCA 3IMKA 4IM7A 4X20A 1RC8A 2H9AA 4X1YB 5EXSA 2F8TA 5LIRA 4JT2A 1C1DB 4ECAA 3VQVA 4D8TA 1CY4A 1J24A 4QUAA 1TMYA 3ASUA 4LA4A 4OREX 4WOKA 5DM0A 4M0KA 5H9VA 4BQIA 3A32A 2AG1A 2NU9B 3RRXA 1ZCAA 4EP1A 2FN4A 1ARZA 2P62A 3CF4G 3MWKA 4MR7A 4PC6A 5GOZA 4LRUA 2Z1DA 2FA9A 4G4IA 3RNLA 4EY6A 5ESDA 2H8GA 1A72A 4DJFC 3HJHA 4GX5A 2FMHA 3S6JA 4PHGA 5INTA 5CB0A 3SIXA 2E65A 1QPGA 2AB0A 5LDGA 4B2YA 3OU7A 5AJYA 1CKEA 4F11A 3A10A 1W75A 2OB1A 3S28A 4W5TA 4E5UA 3NAQA 3V7YA 4Y2YA 2OVFA 2AJTA 1IN6A 3LXUX 4X7MA 1XV5A 5L7TA 4Q4LA 3GIWA 3UATA 2X41A 4ADSG 5F98A 5FUBA 4EKDA 1ZYUA 3B3JA 1XCPA 5GQSA 1VFNA 3KT0A 2VP6A 1AKEA 2Y67A 2TMYA 4AWXA 2B8EA 3WBBA 1PFYA 1GTVA 3R0IA 3AIIA 4NEGA 3V6MA 2HRCA 1HG1A 1SXIA 4MYCA 1OFVA 1WMBA 3LT2A 1U2TA 1EJBA 3FKSA 3VZDA 5KC8A 1G18A 1JDVA 3WKEA 1USYA 2NIPA 4RKRA 2VZLA 4IXNA 4O4LF 4EWLA 5LOVA 4H7EA 4Q9KA 1PQ4A 1UDCA 4OGWA 3QLVC 5KTMA 1PGQA 5FI5A 5HKBA 3CNQS 3SCZA 3HVKA 3CHYA 4Q82A 3RSSA 4CF3A 2GZHA 3C87A 2AF3C 3LZDA 1BFUA 1ZONA 5LD2B 2LE0A 3R09A 1J9GA 2CV1A 3K71B 1CUGA 3KEGA 4P4TA 1IDN1 1X9HA 3FNQA 3H6KA 3GLIE 1IY9A 1E20A 3GVIA 2Q1WA 3HFRA 3OIGA 3VZSA 3VZPA 1SB9A 4BO1A 1LV8A 4E12A 4RGVA 4FPXA 5JD3A 3T15A 2BFNA 2MINA 1RIQA 3SVTA 5HTKA 3WO1A 4RJ2A 3IRVA 1HMPA 1YQXA 4WBNB 3FSGA 3ICEA 5DEOA 3D0KA 1NI5A 3PUXA 4QC2A 4RJTA 1UWVA 3FF1A 3LUFA 3D6NB 3FGNA 3U4IA 4B2PA 2GD2A 1VJDA 2FPLA 3O03A 2VSFA 4Z9YA 5BV8A 5AESA 1JDJA 2VAPA 1AK2A 3V8NA 2P9QA 4UEQA 2H63A 3H2KA 3JATA 4PLVA 4UTXA 1E9EA 1YE8A 3D81A 3GN2A 4Y18A 3WWPA 3MELA 2BH9A 2X23A 2Z1NA 2ZSAA 3G0DA 4Q01A 4YT5A 5AKZA 4AH6A 2JVKA 1U7WA 2H7CA 3R7BA 3QWAA 3KSAC 4P7KA 3ZCSA 2ORYA 3G2JA 1IM2A 3L7YA 5FA6A 1QU2A 3C3DA 3V3TA 4F9FA 4PSVA 4DV7B 2HCFA 4ZN6A 1KL7A 4QBIA 1JFVA 2XIJA 2IXBA 5FPYA 2ZR2A 1T9AA 1E9FA 5FWDA 2IZOA 1V7ZA 2VH5R 3GMIA 2D3TA 4FFLA 4CODB 3PF9A 1SZCA 1N1EA 2GRUA 4FZVA 4K87A 4LRQA 4TKVA 3H9CA 1C7JA 5IVDA 1JALA 4J0QA 2HT6A 2UZ0A 4B34A 1I9CA 2GETA 4E31A 3LAWA 1KK2A 4M1WA 2HRRA 4MDYA 3ZV3A 1USKA 1U8XX 3EXEA 4UMEA 1TM4E 3DR5A 3WA7A 1J39A 1Q0RA 2B4QA 1CR2A 3F6CA 3S68A 1TT7A 1QO7A 5KAPA 1DUIA 1FFAA 2HAEA 4JUIA 4K6KA 4ALJA 3TR6A 4JI2B 1CHNA 1MEJA 4IBOA 4K46A 4I8IA 5FTNA 2RHBA 4I5FA 4D74A 1G51A 1II9A 4TSKA 2QSYA 1JAZA 4Y6PA 5IJZA 2DTXA 1P2DA 1EFWA 3UGQA 1RJGA 3X43A 1V16B 4OP2A 1P8JA 4ZI7A 1R8SA 2I34A 1QRUA 3C1OA 3AZQA 1P73A 1M6NA 1EWKA 2HO5A 3GRCA 3HUEA 1Y5RA 4HQ6A 4DCNA 3L7DA 3N2GA 5HOQA 5KIAA 3DFFA 4CIBA 4GVPA 1W2HA 4GR9A 3W6ZA 5TGDA 1JAHA 5REQA 2Q8NA 4FZ5A 1T8TA 1JIXA 1M3SA 4B2IA 4LRXA 1XL0A 2CVZA 5L3QB 3CLTC 4QUDA 2CXSA 2RGXA 3W2GA 2JLQA 2QP3A 3JYNA 2VHUA 2W6NA 5IKOA 3T9BA 4GQBA 2YV3A 3G59A 3GZJA 4KWTA 2PMEA 4LJYA 2G07A 2BBWA 1G20A 3NOVA 3P9XA 3F90A 1G7RA 1JEAA 1Y1KE 3QLEA 2CSUA 2XCRB 1H94A 1THZA 2OL4A 3IULA 4BZQA 2ZUVA 1O3YA 3CT6A 2NZVG 1VB3A 4P93A 4F3CA 2QZJA 4P4LA 5FI3A 5FEUA 1OBHA 3DZGA 3NDIA 1OVGA 1W4CA 3HSSA 4IJ5A 4MSUA 3A3OA 2RK6A 3NNDA 1YWGO 4G0XA 4GUAA 4DOMA 4RZXA 3JYPA 4YAEA 2OZVA 3E35A 3FCEA 3HO6A 3W5JA 2AYYA 4X8HA 5F9FA 2FFHA 3RC7A 4FXPA 4O4LB 5CJPA 3EHDA 3K7EA 2Y1LA 1WQWA 1TX4B 2PR7A 1LK7A 1E0JA 4DJ5X 2HF9A 3C3EA 3BWYA 4K9DA 4RF4A 1O7JA 2ZOSA 4FONA 1ADBA 2WWRA 2VXOA 4L0DA 4LV8B 2G4VA 4P38A 5DXAA 1PR4A 4D3DA 3GEMA 4H9GA 3A9VA 5ALIA 5TQVA 3LX4A 3K2BA 4LYFA 2DZDA 4HUJA 3PWZA 4EA6A 4RPLA 2KBEA 3ROXA 3VDQA 4BAGA 3N8GA 1J4AA 3BQMB 3IE0A 4CHGA 3QU5A 4EVRA 1AXGA 1Q12A 1GN9A 2R1VB 1G5PA 2IP1A 2VA9A 3UFXB 3RB8A 5D3QA 1XAGA 3CTMA 4C0JA 5C35A 1TEZA 3EUWA 3K09C 2YJ3A 3JSXA 1UPCA 3MGGA 4YV2A 4X6UA 4AXBA 3ZWNA 5JR3A 2Q4OA 3OKFA 4D4KA 2QXUA 3ESYA 4FEGA 3ZNPA 1M5UA 3AESB 3E2IA 1FS6A 2HSJA 2W6IA 2FPUA 4JEHA 3P2YA 4AUKA 11ASA 3EBLA 2QV0A 3WWEA 4E5VA 2ECPA 3MSXA 1DQZA 1A8HA 4X9XA 4B3MB 3ZW7A 2XZDA 1LJUA 1DFGA 4LZNA 1LLDA 1IN8A 2W48A 3B53X 3JY6A 1N9WA 4YJKA 1KVRA 3AUTA 4WN3A 2EBFX 2WV7A 4LKOA 5DNEA 4AW9A 2NXCA 3I39X 4AUNA 4QYTA 4F7DA 1YRBA 1P9OA 1FYEA 3NC4A 4G97A 1Y9JA 5G3YA 1XD2B 4YRAA 3T9DA 3OFJA 1X92A 2PRSA 4R0MA 4ZT2A 2C97A 1GZ3A 1JEOA 1IONA 4X7PA 4Z9FA 1XEAA 1A9XA 4TM7A 1GRVA 2GJ9A 1PBTA 4X97A 4U1RA 2PZAA 4MUIA 1E2DA 4J2OA 5AIAA 1UBSB 3TI7A 2Q3BA 4CM4B 3ZDBA 2P0YA 3ETDA 4I1IA 4DMCA 1SUPA 2PX2A 3IV7A 3KS9A 1SUWA 3ZGOA 1L5RA 4A8HA 1V5FA 4CV2A 3VC7A 4B4KA 4CTOA 3TQQA 3IKMB 3OWOA 4I50F 5C8VA 3CMQA 3UAYA 3UUEA 2BEUB 2RHQB 5KU7A 3T4PA 3MCTA 3OKPA 1IVYA 4LVOA 4WLUA 6PFKA 5FHQA 2JGNA 4C7MA 1CF9A 1GRRA 3H9JA 4IKEA 4ZRMA 5BUQA 1FFXB 2AFIE 5C31A 3TTWA 4L3OA 4UREA 3A26A 3HB1A 1DJLA 1SUIA 2ZRAA 2B5VA 5KNNA 2J0UB 2WILA 3OX3A 4LG1A 2JVJA 3GZTB 3PL5A 4Q37A 4ZCQA 5T8KA 1I6KA 1H6DA 3SHQA 3TBFA 5M04A 3J7AC 2CNKA 2O0KA 5DPMA 4QRDA 3D2LA 3EA0A 1G21B 1VG9B 1RZRA 2AK3A 1K0UA 2DMRA 3CIOA 3DMPA 1EIYA 1XUOA 3LWNA 4IUCS 3MWEB 1KAQA 2VCEA 1MH1A 1MHTA 1RXCA 4RU1A 1P6XA 3HA2A 4KO1S 1NM5A 1I80A 1T8PA 2OCIA 3IAM1 4NARA 3EEOA 2F55A 2WF9A 4I9UA 3S2SA 1UFRA 2BHNA 1YUBA 1TCBA 4AP9A 2WJAA 3GGPA 1NVFA 3VJRA 3AETB 2HDHA 4EHJA 3TQSA 1KEVA 3P9QA 2CVPA 3TW8A 5DISB 2OXEA 3FYSA 5A9SB 1ID8A 1DX6A 3EVCA 2DPGA 1N9GA 3ELYA 4WLOA 5COQA 3FOFC 3K0SA 1S01A 1FP7A 1FQKA 4L0MA 5HIMA 3L7OA 3EPHA 2QVCA 3QUTA 1E79D 1WUJS 3IVMA 2QI9F 3VAZA 3N59A 4UJ3A 3DAFA 4ZYUA 5ABPA 2NMVA 4ZOEA 5K99A 5D7NA 1A9ZA 3CLHA 3OTGA 4PONA 4XWKA 2AI1A 1YZYA 4DQKA 3VQWA 1KQPA 1UBHS 1W0JD 2IEZA 2ODTX 1F0KA 2CHEA 3CH4B 3VTFA 1CJUC 1ZUD1 2ZAYA 2IU6A 2JGLA 3LBNA 2QTAA 3LX6A 4DCSA 3V7RA 1ISMA 4CEHB 2CIMA 1ZVVA 4JFAA 4P5PA 2NTYC 3WWZA 1Q5PA 4DT1B 3D3NA 2LNDA 3EFOA 1FUKA 3EEYA 2NVUB 4W5WA 5ENVA 2H4XA 1HDOA 1FFSA 2QSUA 2XTJA 2Z0MA 4U7FA 4YP7A 3U49A 3U39A 1ZAYA 4KO4S 1J2YA 4CQMB 1MO2A 2JFBA 4C0AC 1XU7A 1YS9A 2FWJA 3FTDA 2ODRC 1U0JA 3P0HA 5I7EA 3MPOA 3UOGA 1EU1A 4BBPA 4D6YA 4C04A 1Z4IA 2FV8A 3H5RA 2IYZA 3EXG2 3AV0B 2H52A 5A3QA 4RZIA 2W2VA 5AH0A 4RJJA 3G8BA 1FTGA 2ETVA 3FPCA 5IBQA 3DZHA 5FPSA 4PLPA 4FFSA 4BCCA 1EE9A 1NVDA 3PVSA 1AMNA 2J5QA 1XVVA 4EG5A 2H51A 4BZZA 3B6IA 3C1UA 3HVIA 3AY6A 3MBKA 1CVLA 1QHHB 4LQDA 1BHQ1 4YJGA 1TAGA 1ZA1A 2Y1CA 3EZNA 3ZHUA 3BTVA 1YVRA 2BRUA 3LECA 4TQ9A 2VBCA 3FE2A 4W63A 5KNDD 4XEUA 3FVQA 2XT9A 1FX0A 4US0R 2YVLA 4DC0A 1L4LA 1HZJA 1NBAA 1Y48E 4P5EA 4F21A 3PQ7A 2PUFA 2NUBA 5HYVA 3PQ2A 3NXKA 1RYMA 1VJGA 1QFYA 4XWTA 1L4HA 2CXNA 4CN8A 3WSWA 2GFIA 2QX6A 2VEOA 1GT91 1JAYA 1VIMA 4ZVUA 5HF8A 1YQDA 5JAMA 4EHAA 3AJDA 2Q1XA 4IYJA 4LC9A 2Q7GA 1F8XA 1ZWKA 1Y33E 3HXLA 4I50B 2V6GA 3GAZA 3M5DA 2IUUA 4PC1A 3R9XB 1J56A 4JYCA 3WBFA 1SCQA 5DHAA 4B3HA 3O8NA 4EFMA 1WCIB 3G3EA 4UCXA 3ON5A 4R1MA 5BW5A 4UNIA 3QX3A 4TZ6A 4I46A 4AI6A 1DO8A 1U2QA 2JLWA 2VTBA 2JIZD 5DT9A 2Q45A 5C1OA 2ATIA 3TMYA 3F5MA 3D6VA 3RS0A 1ND6A 4HDSB 4P7BA 1FTQA 3T7KA 1P29A 2YV4A 1I4TD 5BV2P 1RI4A 2A9OA 4FGLA 3HCEA 5E9QA 2XE4A 2GZDA 3U1TA 2DUWA 3SICE 1KO4A 3UHJA 3GVHA 4C4ZA 2E1HA 3DBLA 3NRBA 4J76A 1SOUA 2FP3A 2C8KA 5BQXA 5BWMA 1F4PA 4LYAA 1VP3A 1K06A 2AC2A 4B85A 1Y8AA 1ZBQA 1QQBA 1JPVA 5K0CA 1UAYA 2ZJ7A 1XZBA 3ABZA 3K0BA 4WNIA 2PYDA 3KJIA 2GXAA 3DTVD 5FX2A 4W7SA 3T0GA 1IU9A 5B3JA 3E22B 1ORVA 4HB2A 3R9IA 4M9SA 4I99A 3AL2A 2GAAA 2J6BA 5FRDA 1WHTA 3HFZB 5GZ3A 4G3XA 2C5FA 5BUCA 5JMOA 2J5XA 2JJ8A 3H5IA 4ZMBA 1NG9A 4AO6A 2C42A 2NO4A 4FEAA 3FUCA 3IEMA 3K4PA 3Q7IA 1VKNA 4PS0A 2WF7A 1HE3A 1K6MA 1KERA 4YLEA 3JWIA 2FEWB 1KORA 5K0NA 5LUBA 2QLLA 1IJKA 1KAMA 3EZGA 5K0JA 5DCUA 1KYYA 2M1ZA 1XC7A 1WD5A 3B1JA 2QE7D 3DPUA 2EQAA 4OI2A 4V2UA 5GINE 1UZLA 2IXFA 4FKMA 2EBHX 2GK4A 2FFRA 1ZUNA 4XGQA 3JQPA 4HQOA 2GPNA 1Q6ZA 4X8MA 4JH0A 3D3WB 2ZT7A 1DBQA 1EP9A 3RSGA 5DLQC 4YJHA 4EY4A 2ZCJA 3BCUA 1M7BA 3ABSB 1RM5A 1SRRA 2QPAA 2XE6A 1J0AA 1XJCA 3GJRA 4R1UA 4X00A 4I2NA 4YBRA 5EGNA 1KSJA 3OZCA 1QZZA 4UKDA 4EYQA 5B1SA 1IDOA 2XDYA 4ZVOA 2BN4A 3IUYA 3A58B 1YBVA 4S1PA 3RF6A 4IIVA 3VKVA 3HV0A 4ZYTA 5KNBA 1ESZA 1CEYA 4C2UA 3WK9A 3VKGA 3K8ZA 4WVLA 1KZGB 4QWMA 2QR3A 2WHQA 4UOQA 5GGYA 1D2RA 3UYKA 4M54A 4QOJA 1RSZA 3HYCA 4HC4A 4WHMA 5THKA 1PQUA 1CZUA 1FP1D 3H18A 4OFXA 3MA0A 1YHYA 1Z0UA 3HMKA 4WZBB 5TQ2A 3V2UA 1YR2A 1OPRA 3HCPA 2H9IA 2ID7A 4EFDA 5JCZA 2IYXA 2QN1A 3T7EA 3E8XA 2IE0A 3GQBA 4INAA 3V42A 2WMDA 4J3NA 4F3KA 6REQA 1Y3CE 2QGNA 1OJLA 3WQQA 3IE1A 2C4UA 4CQNA 2CKMA 3QF4B 3JPYA 1H2HA 1SD1A 1Z3CA 1AT1A 3AHFA 3OLZA 3P9ZA 3HXWA 3FI9A 5KYWB 4YK7A 3WNVA 4BFVA 3RC2A 4RFVA 3S99A 4B4OA 4CG0A 2JH9A 2G09A 2XMBA 3DVAB 3OFSA 4OK3A 4ED9A 1PVVA 1KOFA 1IEWA 4MGKR 3UXHA 1CX9B 4DA7A 2ZM6B 3C16C 3PUIA 2OV1A 3ANMA 3EIEA 2ERCA 3EZFA 2IGBA 3DQPA 3GCGA 3NTVA 4F0JA 4PX5A 1Z6QA 1WNTA 2J6HA 2GN6A 1NG1A 2J6CA 4JSTA 1I33A 2DUJA 2J85A 3V8KA 1TA0A 3RKXA 1X77A 1BYIA 4KFRA 3W3ZB 3ZDRA 1LDEA 2ASVA 3BICA 4FHFA 4PSAA 1K6IA 2CWWA 5CIYA 5TPZA 3VO9A 1SD2A 1QRAA 1XP5A 3OM0A 4P31A 2EKZA 4LPSA 5JZOA 4AIIA 4FWTA 1W52X 1ZXBA 2Z2JA 3HB9A 3B6EA 2XUPA 5K0FA 1DC6A 4OHMA 1C0LA 2DPXA 4YUYA 1DEXA 5IC4A 5A4JA 5KYYB 5KS2A 4I1YA 3OZAA 2YWEA 1KETA 4HPJB 4ACAA 4ZEOA 2IS1A 1FYWA 1FP4B 1GFIA 1TM5E 1XRMA 3QTBA 4WXPA 5F33A 3KKZA 4F1WA 1GV0A 3NYWA 1VBMA 4L7VA 4YCDA 2CFIA 3EGDB 4HPXB 2VDVE 4KYUA 2QBYB 3L40A 3X1DA 1EA5A 1S3IA 2WHYA 3OTWA 4RC9A 4EUEA 1Y6ZA 1FU8A 1KTVA 1QP0A 5DT2A 1IG3A 1YULA 1VP9A 2IKSA 5LA6F 1TJPB 4AN4A 1O8CA 1T9DA 1PR0A 2X0RA 3EDQA 4HNSA 3MAJA 1KC3A 4KWCA 1ZLXA 4R16A 3RGWS 3STUA 5C1DA 4PFSA 2P65A 2RG7A 4M7OA 2YOHA 1Z7NA 2BEWA 2XYPA 4NBSA 2GCIA 5DNVA 2FMTA 1YSCA 2M9MA 4BN5A 4Q9LA 3QVOA 2R6DA 3RTCA 4KX3A 3AK4A 1D4OA 1D7OA 1I30A 1S2DA 1SVSA 2VPXA 3CUUA 3QU7A 4N6GA 4PXAA 5K51A 4AJIA 1MQ8B 1CLEA 2VUSA 4EI8A 2Z5GA 1NVWQ 4IIYA 3E4CA 2BFWA 2P2LA 1I13A 2PX5A 2UAGA 4R40A 2BFDB 1UWCA 1A27A 3AL3A 4XDGA 2BW0A 2ONZA 3RHSA 4ZMRA 5BNZA 1BSVA 1YRWA 3LOPA 4HWGA 4CR8A 3KZNA 5AVUA 2YS6A 3DKPA 2HRQA 1T4DA 2PBFA 1TCAA 5ALFA 5EWMA 1KNQA 3NTRA 3FPEA 1KYVA 2FHPA 4RD3A 2YICA 1G59A 5IZ4A 1TJ5A 3OMLA 4P08A 3SLGA 4Z3OA 1T24A 1Z6ZA 1Y3DE 1QLJA 3EUFA 5KVQA 3WLPA 4G63A 4BNVA 2VF2A 5JH7F 4K0KB 5CT9A 4FP9A 2H59A 3FHOA 1N5IA 4I36A 1BXZA 4JXJA 3CFYA 5EXXA 1P7YA 3NUGA 4QHYA 1Z39A 1I7QB 2YMMA 1I24A 3CTPA 4OM7A 4RJLA 2DLNA 1WMFA 1MLDA 3PXXA 3QNMA 4FHGA 3DZIA 3J81k 4P80A 1XVLA 4NBNA 3QA9A 2D2IA 5IASA 4IZHA 4BN0A 4BWFB 2OD7A 3H3JA 3EXHC 3ECAA 2GR9A 1NSFA 2FNAA 5AI0A 3VJMA 2HJHA 2ZRLA 4ES6A 3EZYA 3E9CA 3ZY6A 5BURA 1JSRA 2O7QA 3K0HA 4MPPA 4ZCMA 1I7SB 4R0VA 4YUWA 3OZVA 1ZVJA 2RB4A 5AI8A 5ARDA 5DBFA 4HDKB 4S04A 3NAZA 1ZUHA 4EABA 4YRFA 1C7FA 2PQ2A 3KTFA 3AYXB 1DIHA 5LUAA 2ZIAA 1KI7A 3JYOA 1EFRA 1Q1NA 4CLEA 4BASA 1RWMA 4ER6A 4YMLA 2ZI5A 1VHTA 3WADA 1DQYA 1F9AA 1IHYA 3ZE8A 1ZRNA 5EESA 3WIOA 4TMVA 3NWOA 4K1XA 3RVLA 1UC9A 1FFHA 3HNRA 1ZH2A 3IPYA 1UJ5A 3TTYA 5JEDA 2QTMA 2ZSEA 4D9FA 4N0MA 3EZ9A 2RHJA 3TWOA 2C9MA 2CWDA 3GJ3A 2ZXFA 2PDAA 3QRWA 4TRRA 3EBOA 3AR9A 3ZR4B 1J2JA 1CUZA 1TVKA 3CRQA 1U6IA 2M2IA 3E0XA 2VK4A 3H6HA 1BO6A 1GADO 3BD9A 3GBPA 4HDOB 3B9QA 3PHIA 4M1TA 4AS3A 3O21A 4JUDX 2YCLA 4LF9B 2RH5A 2Z8ZA 3FYTA 4JQCA 4ZAYA 4BQRA 2QYOA 4C0WA 2W4QA 3QW4B 1DC5A 1JILA 4CKCB 2JKYA 1E7MA 1T8RA 3DBOB 2I3DA 2W2TA 2N42A 3BB4A 3UMRA 4TT8A 2I3BA 5CAEA 3ZQJA 4G41A 1A97A 4MWEA 5LDHA 2H2HA 2PX8A 3T5CA 4C76A 1R10A 4E7PA 4QXRA 5LA6B 3M0EA 4MCIA 5F7XA 5JDIA 4D7AA 2A5LA 2QR2A 3OPXA 3M33A 4FYXA 4KXXA 3Q2KA 2OCAA 1CF4A 1UT5A 1OFGA 2N3ZA 2JFQA 3UHFA 1P45A 2CL5A 1DIAA 4MUMA 2IDMA 1K4KA 1V8PA 3QUSA 2G1PA 3L0PA 4IJWA 5ICGA 3A7EA 1X80B 3RBAA 5C8YA 1QCCA 3PCOB 2RH8A 4X91A 3N07A 2V7EA 4BRWA 3DT6A 1X7ZB 2HH9A 3RG8A 1TUBA 4KVZA 2QN8A 3CN7A 3UGTA 2VDWA 3KE9A 2GD0A 4KN5A 3TCNA 5IJWA 4OCZA 3ZDDA 1II8A 5KYUA 1CZOA 4EZBA 3KR2A 3OUTA 4BP1A 4ZHSA 2O54A 3IP6A 2EIXA 3EVEA 1IOZA 4RZ2A 2G4LA 3HBMA 1C30B 4IS3A 2QJTA 3ZNQA 3QXHA 3U3KA 4YIHA 5JH7B 1Q14A 2RK3A 1R0CA 1XMSA 2I3AA 3MJFA 2JJ1D 2E18A 3PDHA 3ZIDA 4EKYA 1LPSA 4B83A 4BNUA 2CHUA 2ZJ2A 3WGVA 4H1WA 4OOEA 4G23A 1NYQA 2JHPA 2PLAA 4LI0A 4M1QA 1JAIA 1RVDA 3PU6A 1M2NA 5KYXA 4H1TA 1KDRA 1IPHA 3VR2A 4I19A 1KMCA 3KYCB 1UKYA 1W2WB 2IS2A 4BTLA 2YUIA 3RCBA 4EYGA 1T3HA 2OAP1 2Q4EA 3DZBA 3E2PA 4HUQA 4XTCS 5TMBA 1LUAA 4UASA 4RDCA 4DCMA 2X1VA 3JWPA 2A1TR 3MT7A 2D0PB 1Z37A 1TGVA 4ZVPA 2AH5A 2WFMA 2WV9A 4QTYA 4BVEA 1Q7RA 3CR7A 5IKEA 5KNCD 3LZCA 2UUAB 2EBUA 3E9IA 1W73A 2CFCA 3BX1A 3SJBA 5BR1A 2IFTA 2R62A 3SJCA 4RA9A 4FFWA 3OEED 2KLBA 5H82A 2RC6A 4R54A 2ONJA 3KD2A 3IEXA 3W2EA 4KIFA 3OE7D 3TGWA 4JC8A 4MHTA 4ANFA 2ILVA 4QLBA 5BN3A 1JLHA 3DEKA 2QE6A 2GBGA 3HJAA 1Z5PA 1AUXA 1ZESA 4G4GA 1YKSA 1DPGA 4F3TA 1GGHA 4F56A 1J6UA 2DKGA 1IUKA 1T2AA 2PTHA 2B7LA 4B4VA 3FYUA 4XRGA 4DJEC 4QAJA 1V43A 3SOPA 3T6KA 1RRVA 1BE1A 2GVDC 1TA4A 1B8NA 4WY5A 4A0SA 3DOJA 3T5DA 4KXLA 4EMUA 2CL6X 2EKPA 3QWFA 2D1RA 3JTMA 1EE1A 3NYIA 1U9JA 4KQCA 2XCSB 5CIWA 2PZJA 2CGEA 2Y1GA 1MXHA 1W4AA 1Y8QA 3EG9B 4FUQA 4K6CA 1EVKA 2GA8A 2WHXA 4LVUA 4TT3A 5TF4A 5HDBB 4YAKA 4JI6B 3RJ5A 3WJ2A 3BJRA 4BO0A 4CL0A 4G8BA 5I7WA 4PGMA 2FPGA 3M5CA 5A4FS 4KDEA 5JS8A 2D6FA 1NV9A 2WWIA 1NA5A 2JLAA 2RHSB 1YDEA 4LQCA 4HG2A 5K4AA 2C5SA 1P17A 1ZRSA 1LZLA 1J5WA 3UWPA 2EDAA 5JZMA 1GAEO 2G28A 2DEUA 4UJ5A 4OGFA 3M1YA 4KW7A 1D6SA 3SC2A 1KY2A 4QUKA 2ZS9A 4HV4A 1GDTA 3QVUA 3BGVA 3O8OB 4CKWA 4LVJA 4UUMA 3THWA 1E96A 5MF6A 2G6TA 4ZU1X 1T1RA 1I10A 3IPXA 3KAKA 2WYUA 4YDSA 3LBAA 4R1OA 4I3HA 1QYRA 3KHKA 5T3UA 4QPCA 4WECA 5GJBA 2NUAA 1H3NA 4N5NA 2IYRA 3A27A 4U00A 1U2GA 1EZ4A 3HM2A 4BUZA 3AF4A 2XNHA 1JA0A 1T0BA 1M33A 2B36A 2VP0A 3CX4A 3N70A 2GYUA 3TQHA 3HRHA 1IVSA 2BVNA 3E9RA 2B6HA 4JA2A 2JKZA 4ARCA 4AWBA 4WFIA 1JZTA 1GPKA 4Z3DA 2XIQA 3GEBA 4X90A 5HBGA 1BWQA 2C3MA 2PPLA 2IZ1A 1ZR4A 2J4FA 4RGYA 4ZANA 1LVHA 4V1CA 2Y1KA 2ZAOA 2FU5C 4Q1FA 4URVR 3PGJA 4XEOA 3R24A 4OH7A 4J2TA 1EXVA 2G70A 1P0PA 2HT1A 1QC5B 3P5BA 5A6VA 3SF8B 4JXXA 1VJ5A 1X1EA 4RM3A 5I9LA 1D8TA 1Y4AE 2GNOA 1KA9H 4QUIA 4LYEA 4F2PA 2PFKA 2PU7A 5D3KA 2FVYA 3CF0A 1WUIS 4HBZA 4RTSA 3PRKE 2VSXA 1WSDA 1NJGA 1JJ7A 3O8RA 1RAIA 4ALKA 2NZJA 3DBVO 4PG4A 1QHGA 3LYHA 3KPVA 4JJ6A 5FBWB 5A3SA 4YT2A 1QB8A 3DCIA 4NMWA 2ZUTA 4HLCA 4UVGA 1LK5A 3P97A 5BQOA 5CFZA 5KTYA 4AY5A 4AZ0A 1A8SA 3CRMA 2Z83A 3D3QA 5CJJA 1ZLYA 3IEPA 3JYHA 1JDUA 1AS0A 1JG2A 3U09A 3O7WA 5EKUA 2C83A 1MORA 4IIJA 1KRHA 4YDRA 4IOKA 4LXQA 5KSYA 1PL6A 1I5OA 4QDXA 4U0KA 3KFLA 1KZ4A 1Z82A 2EKBA 4YJ3F 3WLMA 3HP7A 4ZD6A 4XDHA 4KTVE 4URZR 2PX0A 2RHWA 5JU6A 1YFKA 1P5RA 4P83A 3F96A 5PNTA 3QMMA 1H2XA 2Q28A 3FDJA 3OFNA 1WZUA 4DRXB 5J9FA 4PTYA 2X0FA 1H2EA 3F49S 4H7IA 1M75A 1GYQA 4IHAA 3RTGA 3ZXUB 1F14A 2WC1A 4LTNA 4YJFA 1TQ8A 3RRNA 4ZAGA 1TNDA 1V8FA 5JBIA 1XXHE 1X7YB 3PIRA 3TJMA 5D7BA 1D8AA 3NLLA 1JDSA 1FLDA 4NAHA 1G3IA 4LHVA 4MRPA 5AW1A 3WB1A 3C48A 3ETNA 4NP6A 2B82A 3TVDA 3U3DA 4OHFA 5EE9A 1TA9A 1PZNA 1Q7CA 4QVGA 4M8SA 1R64A 3L46A 4PZPA 4B45A 2UUBB 2BMJA 3HXUA 2NT3A 2WM9B 1Z17A 3OCZA 4Q1VA 2ZSKA 4TMKA 3HBAA 3VSEA 3WYNA 4UPEA 4JYZA 4HRVA 5ADHA 3QJ5A 4DCTA 1R27A 1V1MB 2VHCA 4TQGA 2D5AA 1VPDA 3BRWD 2QNRA 3KXIA 3HL0A 3ZXIA 4JY7A 4KK4A 3HUFA 4B7UA 4MMZB 2AX3A 1PJ8A 5FUVA 3DOHA 1V7QA 2BFCA 2VWHA 1KYTA 4O4HF 2SICE 4JXZA 1UOOA 4B3FX 4Y2SA 3GFBA 2ZXUA 3SEFA 1UPUA 3ZE7A 2QW0X 3PKIA 4Q4HA 1PFKA 5ULLA 2E6KA 5ADVA 5TB5A 5LPNA 4N6NA 3TXXA 4MKRA 1REQA 3EXIB 4N82A 2CXHA 3OBIA 2VNJA 4BXOA 1S1MA 2IOQA 2J3KA 2VT7A 3EF1A 2J32A 3GA0A 2AFIA 5BT9A 3RAPR 1PNVA 1WDKA 4O1HA 5DSXA 5FUYA 5CDTA 1MDFA 4YCBA 1MC4A 2CLDX 5SV2A 3ROTA 1Z4JA 4J4TA 2FRDA 1RRPA 4AMZA 1NJFA 1JHPA 3WJAA 1QVWA 5IC6A 1GZ6A 1YIOA 3I6QA 5D5QA 2I1QA 3NDPA 4BVAA 5J4KA 2EOAA 2I7VA 3EXHB 1PL0A 4B33A 4EB0A 1SURA 1ZD5A 1KYIA 3BTUA 4MA4A 1OGYA 3DFZA 4PNPA 3JXEA 1Y9ZA 2BBSA 3KWLA 3FIJA 4AZTA 4DZRA 3O6VA 3KOMA 2BUCA 1R4NB 2ZYRA 1IM8A 4FFRA 3T5BA 2P27A 4XGKA 2PEYA 3ENKA 3RIYA 4M99A 1Y5MA 2HF8A 4GGPA 4GD3Q 4Y0AA 2ZDQA 3W8EA 1POWA 4JUCA 4MA0A 2O1XA 421PA 3U6KA 4F5ZA 4CRWB 3KEOA 2AZTA 3C6ZA 1YBHA 4GG1A 1KU0A 4KKVA 3GDFA 2EP5A 1NX9A 5TGZA 5H3HA 4NCHA 5D85A 2G77B 3DMDA 4JVSB 1N1DA 2VZEA 2AE2A 4GKKB 1QE0A 2XD9A 3A1TA 3C2QA 1Z36A 4C1BA 1BROA 2OQIA 1DDOA 4V0QA 1AURA 5TEWA 3PUYA 4YACA 3K0CA 3ZVLA 1AKYA 5FWNA 3M6XA 4M8IA 3ZOZA 3OPMA 3PP8A 4CTNA 4QYMA 3RAEC 1LPBB 4PWYA 3B12A 3L9XA 1R1DA 4I66A 5IXSA 3RVQA 4E09A 1RCTE 4DR7B 1ONOA 1W59A 1Z73A 2I03A 4LK3A 3O8DA 5LQAA 3IV6A 1A8IA 1EP2B 5J4YA 1JWBB 4D97A 2HK7A 2Z6AA 4YJ3B 1MOQA 1H9BA 3LCRA 4PO3X 2GBFA 5BSUA 1A8QA 4CEJA 2GF2A 4N3BA 2I3ZA 3DF7A 2PSHA 3FKJA 3TPZA 3SIWA 4ALIA 1XK7A 3WE7A 1WQ7A 1H85A 3O3CA 2A4KA 4DPKA 4C7JA 4ND1A 2RAVA 3V1KA 2ZB3A 1MC5A 5LVAA 3V9AA 2O2JA 4WOCA 2EX4A 5GONA 3DDHA 1GSOA 5LKAA 3F5DA 3RUFA 2WYVA 2XSZA 3LPCA 3VAYA 4BVFA 1L0WA 1LSUA 1QS0B 4JLDA 4RESA 5J5CA 1VDMA 3WV4A 3F3SA 3EA4A 4O29A 5IW8A 3GLIB 2DFVA 4CS2A 4KU4A 1NI4A 2I8CA 1OYVA 3PWTA 4D6PA 2VP3A 4GXTA 2QL6A 2CXOA 2O2SA 2CJAA 4V02A 1QKIA 1ZMOA 1OTHA 4FE4A 5E9WA 3L0BA 1MW9X 4QGSA 5KPJA 2RKBA 2TS1A 3QEMA 5LU9A 1DT3A 1GCAA 4YCNA 3N28A 3RIXA 4YROA 4KYTA 2DFDA 3OCXA 1BJTA 2FPIB 3E18A 3LCMA 3LHDA 4J6EA 4K9PA 5EMNA 1Y37A 4F1JA 3P2OA 1DC4A 3I72A 4OF4A 3ZCTA 1C0KA 2VOEA 3HDJA 4P82A 4JHLA 1CRWG 2JD1A 2O7RA 1XDBA 3KQOA 2WTMA 2QHUA 1AUPA 1OHHA 3I92A 4IH1A 4O4HB 5LB4A 1JWLA 2NZYA 3IBGA 2ECQA 1E9CA 2AOTA 2VSOA 4NPCA 4Y0VA 4EO7A 3IIJA 3U1VA 3A2MA 4UDNA 1ONPA 4DXDA 3HHEA 1RLTA 5IKXA 1LW7A 2R2GA 3FM9A 2HQ1A 1LVUA 2ONKA 4M36A 4X94A 4DA8A 5I7OA 2ZT5A 2HMTA 3FUUA 1Q0PA 3A37A 3BYZA 3PD1A 2NZ2A 2RC5A 5EIWA 1PS0A 2FPRA 2H0RA 2Z6QA 2OCDA 3C3BA 1AQLA 3DEJA 1N1MA 2C96A 3FMGA 4MLCA 2CD9A 3C1TA 3N2YA 3R6TA 2DWQA 4IFBA 3EGXA 1SK9A 2EJBA 3N75A 3B52X 2AL7A 1SEVA 2Q9BA 2REQB 3ID6C 2PT7A 2ZCVA 4LMRA 3JTEA 5IK2A 1G5IA 3ENZA 1NN0A 3HKBA 1Z0FA 2DH5A 4J0GA 1LYLA 1SC9A 4D5GA 2DSTA 3I6ZA 1E5LA 4CKXA 4C21A 2JBHA 4WY2A 5H5JA 1Y42X 1P7VA 2QKYA 1NQAO 1RE1A 2C5EA 4MULA 2ACKA 2O2IA 4RVHA 2Q1TA 4XUEA 4P71C 2H8KA 3FFTA 1BCRA 3MCWA 4QNNA 3URKA 1RYHA 2W4IA 4PNEA 2WKWA 4C07A 4ZV4A 4DR4B 4KQWA 1WLYA 3RL6A 2TSYB 2PANA 4LBYA 2PXHA 1NVKA 3NH9A 3A6KA 4NJOA 3RLFA 3M82A 1S96A 3SK0A 2ERYA 1ZK4A 1DDGA 1T6BY 2GEFA 1H8HD 2RKOA 1GJRA 1WOMA 5TDHA 4A8JB 4EJSB 2UXDB 3S81A 4JROA 4L5IA 1G9TA 4K6FA 1OTXA 3OOEA 4QPNA 4RMNA 3IAS1 3RSQA 3TNJA 1VKZA 3UUGA 5BYKA 2YQ4A 3N0VA 3OLWA 4O59O 1NBIA 3CW2A 4O2BF 1R8QA 5AJXA 4ZT5A 4Z1MA 3INNA 3JAWB 1CNFA 5H70A 3E9YA 2RHOA 2JCVA 2ZNIA 2HIHA 1COWD 1DUVG 2OSVA 3DB2A 3L4GA 3VPGA 5A02A 5BN1A 4ZYXA 1L4NA 1P2GA 2FEXA 1Z0KA 3HBJA 2WJJA 2Z2YA 4EO9A 3KKLA 4P9NA 5F35A 1SVKA 3D54D 3BT7A 4O1MA 2V1UA 4ND5A 2BR4A 4BQQA 3QYPA 3RVJA 3IDFA 4IH4A 1O9BA 1AN9A 1US8A 1XF1A 1ZDMA 4NULA 5BV7A 1KKLA 2BSQA 3NORA 4DIEA 1XNGA 1RM4A 1IHDA 1T8YA 4M88A 1F7UA 2M6KA 2FQYA 2C3UA 2AW3A 3FNEA 1ZC3A 2FY8A 2HBRA 2OCGA 3W4IA 5KNBH 1SXHA 2OFWA 3K31A 2CL7X 4EFKA 3TRHA 4EFNA 2WWHA 4PZAA 4FMBB 4ZTUB 2IEBA 2BEVA 5M5BA 4PR3A 5B36A 4YS6A 1E3EA 5JWOA 4YMUA 5L4LA 1T5DX 3BDIA 1KRXA 2BFEA 1K9SA 2H18A 3ELUA 3OQ6A 3A5ZA 1E5DA 3CPSA 3OU6A 4R2XA 4UMVA 4YJ2F 1KDYA 5A3RA 2O7NA 3GJ6A 3RKWA 2FW8A 2H06A 5F52A 2IHJA 3DNFA 1V3TA 3IAFA 4W6QA 1V8DA 1L5OA 1YB2A 1N5OX 2PKQO 4D9IA 2H2AA 1XNQB 2HU8A 2OV3A 1B43A 2G0TA 3SZMA 1THGA 3KVRA 3P9IA 4AVYA 1ZMBA 2WPDD 4QGHA 2VDJA 1N7IA 1LH0A 1I0ZA 1K0FA 4Q6WA 9LDBA 4LJ9A 3NIDB 5MGNA 2Q0QA 3I0NA 1KAHA 4JZKA 5K1ZA 3SZOA 2QTGA 2V74B 1BEUB 3KO8A 2J9XB 4MAFA 4AM8A 4DG5A 1AK9A 2C7PA 4I4TA 1TK3A 1AHIA 1IRXA 1YI8A 4W1SA 2C4MA 4BWAA 3SS9X 3VRHA 4HZGA 3W6UA 3A4MA 3AEYA 4YDHB 4F6RA 3O2QB 1USGA 2XWJI 3IDOA 1ASYA 2I2DA 1IFXA 1HE5A 2QSJA 2A9QA 3ZJYA 1WVGA 3KJHA 2AD5A 5BN4A 5KKCA 1D2CA 2CLCX 4H08A 3WMEA 3KHSA 2ZBUA 3F98A 2RI1A 4CI9A 4EZIA 1GZ4A 1E2HA 1VJ1A 4P72A 2YASA 2YZ2A 3FNIA 4BYMA 2JGIA 3MD9A 2JZOA 1U7TA 3DMFA 4Y7CA 5DWVA 4L9RA 3LRXA 4H7JA 3ZJUA 2CE2X 3Q0EA 1G4AE 4IHQA 4JBLA 1NAIA 5A0VA 4MTCA 1Q83A 4IDHA 3WMGA 1M6VB 1OV6A 1SAYA 1XP8A 4FFBB 1VPEA 2VF8A 1NXQA 2A0YA 5T67A 4AG5A 5TT1A 3RWBA 3A7DA 3SBDA 1P4GA 2I54A 2GA9A 2OOKA 2FUG1 4LOHA 1NJ1A 1Y98A 2ZTSA 1JEQA 2F3UA 2BJWA 4MICA 1M0EA 4BLPA 2KWIA 3QLUA 4U9UA 4WJKB 4XU1A 2N46A 4EEXA 3O31A 1M2EA 1VG0B 2IH5A 4PSDA 1J9EA 2NNLD 4CM6A 5JJ5A 1XWFA 1HA3A 2NX2A 3KXLA 4RPHA 3Q0TA 4G5QA 3SFZA 3JX9A 2NN3C 1GSIA 1ZGHA 2B4RO 2X1MA 1AMOA 3FYHA 3A9SA 1A7KA 2BI8A 1NOKA 2YZGA 3I23A 4G0NA 4CPDA 1ISFA 4N48A 1P2SA 3DDCA 4HTFA 1VE1A 2DHDA 1GTSA 2AVDA 4Z1OA 1VPTA 4O2BB 5BO5A 5AQ1A 2C4VA 5FJJA 1BKYA 4PGGA 1PWYE 1A7AA 1TEVA 3HY6A 5E7JA 3V8EA 3JS5A 3MILA 1M1YB 4PYKA 1Q19A 4BP9A 5KJ1A 5HFAA 3N3AC 2QY9A 2FR8A 2ZRIA 4L15A 4HY3A 5F9MA 2R25B 4J03A 1NULA 2EW1A 1UDWA 5AQEA 3GBSA 2EV9A 1ST2A 4IV5A 4OQPA 3RUAA 3K9LA 2C03A 1QH8B 5ALVA 12ASA 5I5GA 5C0OE 3AVVA 3BILA 3S1LA 1QRTA 1V35A 4M7RA 4MW9A 1SULA 1OUMA 1XL1A 1XZMA 2HKIA 3LDFA 3TTUA 4DV3B 1TGYA 1P9RA 2ZG6A 4LSZA 3PQ8A 1TU4A 1C2YA 3CNHA 2OA0A 1E1QA 2QX8A 3MF4A 3T7RA 2QWXA 5THXA 1ECPA 2PNJA 3DBIA 1DJMA 1HDRA 3KBBA 4IF6A 4YCLA 2XI4A 2ZQ5A 2CNNA 4YJ2B 1ZJ4A 4C3VA 4E1AA 4GZ6A 4TZTA 4IHKA 3FD8A 4Q02A 1SM4A 2YV2A 4DLLA 4B5LA 4ERXA 4MVJD 3W77A 5EIXA 3NEAA 4MYDA 3WL5A 3HGTA 1LRLA 3W9UA 1KO8A 3WDSA 4AKGA 1N2EA 1L2TA 2IYEA 2QAGB 4OM8A 4YFVA 4YWJA 2AXQA 2GYWA 2F8SA 1I3OA 4H4CA 4YRZA 5IUNC 4AY3A 2CLFB 1ISPA 4MEBA 2R6ZA 4PCLA 3VDRA 4MVJI 3QIAA 4DREA 1DOZA 3AUUA 1ZJYA 2ZIFA 4KX5A 1AQJA 2VDMB 4F3RA 4YBZA 2BFAA 2GPYA 4HX2A 3SX4A 4RHXA 3SQOA 3PNBA 4EBBA 4KDRA 1PZGA 5KMGA 1ZH6A 2NLOA 3LT0A 2QD1A 1PJRA 3EZLA 3P9NA 4HB3A 3T1NA 1GPNA 5IBRA 2J07A 3USZA 3T3NA 5D3ZA 1W5BA 1ZCZA 2GAOA 2YWDA 3AB3A 3I4CA 2O0HA 3Q5EA 4MPRA 3WQZA 3UMJA 3MIIA 4NOKA 2H4JA 4YUXA 4B6EA 3IB3A 3W3AA 4RHCA 1J0CA 4RK6A 3VMFA 4ZAVA 5L4NA 4F5DA 5BW6B 1QG6A 3FCUB 5FT9A 1R0YA 3FPGA 2QT9A 2VA8A 1O2DA 4CMKA 3UV3A 5EJ9A 5SYNA 2RE8A 1Z6PA 3F3YA 3HYTA 5K45A 3BWVA 1QKJA 1TYAE 3FSRA 3K1AA 2COKA 2ZYIA 3H1PA 2BYTA 3F1KA 1U2SA 2DYKA 2DXIA 1D2AA 4GWKA 4GPIB 3N2KB 3O1LA 2J48A 3VO8A 3MTAA 3GPBA 2QX9A 2ZIXB 3B51X 1YO6A 3DSQA 5FO0A 3IHLA 4AKEA 2COUA 2BELA 2ZGWA 4B3BA 2D54A 3QMWA 1MMFB 3R7WB 5SZKB 1MPTA 1GTL1 1UJBA 1EUDB 3F9IA 4FS8A 2BFFB 4U6SA 4HGZA 1BYUA 4D56A 4B40A 1NX6A 2EYUA 1QV9A 1XDGA 1XLWA 1ZUIA 4UVEA 3DP7A 3TLEA 2XHZA 2ES4A 2Q1UA 3K9FC 5IXYA 4R41A 5DK4A 1NMEA 2JFHA 2IXDA 3H19A 1I4WA 3D43A 4JYMA 4RXMA 2E1RA 1Z6TA 4G67A 5E6SB 3DEHA 1I9GA 2ZCUA 3GWGA 3CVYA 1ZXXA 1C80A 2PJDA 5EE0A 1C1XB 3B7PA 4XTWA 5K1XA 4UE6A 3V9PA 4MUYA 1H1LA 4WZBE 2PUVA 1ILWA 4U2DA 2QZSA 2V45A 1S2MA 1YU9A 4YP9A 4OL0A 5HIAA 1HYQA 3LUHA 4IOMA 2Q9CA 1IUNA 2P9TA 3BL5A 3KPWA 2X9NA 1YS7A 2CMKA 5JFOA 3W2HA 3WGIA 3REXA 621PA 3FWZA 3W4JA 1OU4A 4BNHA 2X19A 3WBJA 4C4SA 3CVWA 1KI3A 2P1RA 1UUFA 3K9QO 1TRKA 4QEDA 3DPSA 3O75A 3Q8WA 1F2UB 2B1QA 1T3GA 2PFGA 1Z4PX 4Q5IA 5DTEA 3O8LA 3GJXC 5I9BA 1V2HE 4HQ0A 4N6OA 5I8ZA 3AF2A 4FYWA 1ZN9A 1V4VA 4HUTA 5FD8A 1E6LA 1X70A 1RYBA 3NHRA 4RIGA 2JGDA 4DLBA 3C7TA 1XZIA 2UUOA 1KQOA 3SQDA 1DARA 1RC1A 2D13A 2QRVA 1WSBA 4G2TA 2TMGA 4WBSA 2EQBA 3KTOA 4Y6RA 4CNBA 2ZYGA 1XXLA 2OT3B 1VLMA 3CA8A 3EJWA 2ACEA 5DNYB 1NXWA 3EZ2A 3GRYA 4LPKA 3G2PA 1SKYB 4TXJA 3UT6A 4CIXA 5CEEA 3NU1A 1RLIA 3OZXA 1VYTA 1IWOA 1NONA 3ZYZA 4CDMA 5IEBA 3UAGA 4FDAA 1E6CA 1NMXA 1Z8DA 1I1OA 2WIDA 4UNQA 3FOEC 4TVSA 2Q21A 4FUTA 3GCXA 4S2EA 3WLIA 3RT9A 3B48A 5JC1A 1KJNA 2E4YA 1IUPA 2EJTA 4K6GA 1GRNA 4NFHA 3TUJC 4NCIA 5JVDF 3GA7A 2VCHA 5CT4A 2ZRPA 3MLAA 1PJCA 4QSHA 4YT8A 5KVAA 4A36A 2E89A 3TD2A 2NAFA 4JI8B 5DHUA 1U3VA 4P7FA 5AK3A 4YCMA 2B34A 2X14A 1DCMA 1X6VA 2GYVA 3HSKA 4BPBA 1SIWA 1QQTA 2W71A 2H07A 1HEUA 1W4LA 4KJXA 4Q4JB 1CBUA 3ZXXA 3IBSA 2NU7A 3R75A 4CLRB 4YRCA 4G84A 2JAHA 3R3VA 1JW9B 3HCAA 4W9NA 4AJJA 2V8BA 2Y0EA 3I1YA 3DMTC 5ALUA 4XARA 2VG8A 3D4NA 4WXMA 1CQXA 3OCUA 3U26A 1S2OA 3PDUA 2WUWE 5F2EA 5FLXA 3JPWA 2OHJA 3C70A 4C6SA 4LE0A 4FS3A 2PH3A 4RFLA 3UJ3X 4OQYA 2GPJA 1YD7A 3TDNA 1BCSA 1Z5NA 4PV7A 5F2KA 3OX4A 4G5RA 4NY1A 5JZ9A 4IPTA 1KYXA 4U7GA 1HSOA 5D3MA 4CM3A 2D06A 5LJIA 1Z08A 1AQUA 1CNEA 2I66A 3O4GA 3GK3A 1KEEA 1TI7A 4F3YA 1EQ2A 1WCXA 3DFMA 4QATA 4XDYA 2B4KA 4XTVA 1G60A 1EVQA 3ACCA 4MJ7A 3T41A 4CQMD 4MWDA 5KJ6A 5J2UA 4FZJA 3KQNA 4MKXA 3ZU4A 4UHFA 4M0LA 2P9BA 2Y27A 1HNZB 3GUYA 2C61A 1EP1B 2QVLA 3P8TA 3ITEA 3PFNA 4IHJF 4TN1A 2C4TA 4EITA 1OXVA 4MHSA 1JGTA 4DLSA 4UTNA 3PFBA 4WNYA 4YT4A 1J23A 1O95A 3L0IB 4XZ3A 3RHFA 3R3UA 1ZCBA 5HQ3B 1WHSB 1BMFD 3MGAA 5HM6A 2D1YA 1TKCA 4LOKA 5FH9A 3KJNA 4JSYA 4B82A 3KR0A 4KI0A 3H0EA 1Y9EA 2O3JA 4IJVA 4MQUA 2GN4A 1ZD9A 1E94E 2WSMA 4YMWA 3OOYA 3JASA 5FKJA 1EK5A 1SKMA 4ARIA 1VSBA 1ECCA 1L6IA 5LZ7A 1M6YA 1FSFA 2DHCA 1S3GA 3OF5A 4B7AA 2KX7A 3BMQB 3HXTA 4B8WA 3H83A 2XMQA 3N53A 3C5HA 1FUYB 2HR1A 2OMEA 2V7BA 1PR9A 3O84A 1DIRA 3NTQA 1YQGA 2F3QA 3MWYW 1TJ3A 3ONVA 2EERA 4IMPA 2KHZA 4XLTA 3WZLA 1SG6A 2UYGA 3MF2A 1SQ5A 1WVMA 4OFBA 4ZYWA 5FFFA 2QG6A 3FR7A 1ZGJA 2VXYA 3ICCA 1RM0A 3Q7RA 4P84A 5EA2A 5SICE 2AOXA 3SDZA 4B35A 4YMGA 4CH6A 1EJ2A 4HN9A 4J0FA 4Y2QA 4AWAA 5CFLA 1EHCA 1ZD2P 4KQHA 1GUAA 3I0ZA 1DOAA 3V1TC 4DARA 2R00A 4NZNA 3MXTA 4JX8A 2OO7A 1Z3IX 1I1NA 1Y4UA 3MWLA 1P9NA 1DRVA 2CZQA 4ZMSA 4RPJA 4RTNA 2JFZA 2VYVD 2VZ8A 3NO4A 3NT2A 4UCQA 4ZWNA 1GCIA 1ZNZA 2FGKA 1I5EA 5A4KA 1BFKA 1CV2A 2WJHA 3H5TA 3JRWA 2DFNA 3OT4A 2Q50A 2O0MA 1XPUA 4GL2A 4XTXA 1YFTA 2ZSUA 1PTJA 2H92A 4A7PA 1JSZA 2JAPA 3W04A 1YB6A 2IE8A 2ORIA 3SGLA 2VKTA 3NBUA 2H85A 2O3TA 2OGSA 4MI6A 4J1NA 1OBVA 1AOXA 3ROFA 4X84A 1I2DA 5E4JA 4HEJA 5IEJA 5IBCA 2UU9B 4INOA 1KXZA 2OENG 4M89A 1CUYA 1BXRB 3MF1A 1HDCA 1XXHA 2A7QA 5JVDB 1Q0TA 1A7UA 3DQQA 4X1YA 1NE7A 4LNUB 2CXRA 2EG5A 2AFHB 5JSFA 1TC1A 1C1DA 3FX2A 4QOIA 4G25A 2LDBA 3NHFA 2AJBA 1O0SA 1I1HA 3AW9A 3E5NA 3GD7A 5GVRA 4KOAA 3BCRA 5FI1B 2NU9A 4GOMD 1PSWA 1BE8A 4ZQIA 2BT4A 4BEVA 1YS1X 4ZJUA 1YB1A 3FOCA 1D6MA 4EMSA 2LKCA 2JK0A 1Q1EA 3BRSA 4XDZA 2HU2A 5B12A 2PWYA 1Z6GA 3ERRA 3NGLA 1V0JA 5IAJA 1G3UA 3BHJA 2VJBA 3T12A 3TW0A 4I5DA 3GV0A 2PKRA 2ZJZA 1A7JA 1U99A 4D3FA 2B9VA 2PUTA 5DP2A