1GGMA

Glycyl-trna synthetase from thermus thermophilus complexed with glycyl-adenylate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
442
structure length
442
Chain Sequence
AASSLDELVALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAWWRRNVYERDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNAKARYWTPPRYFNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNVLDATSRKLGFGIAQIGKAFRNEITPRNFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSRENLVPYQQPPESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVAVIPLVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKDGTTRLKDTVTVRDRDTMEQIRLHVDELEGFLRERLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine--tRNA ligase
publication title Glycyl-tRNA synthetase uses a negatively charged pit for specific recognition and activation of glycine.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ligase
total genus 115
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 1999-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1ggmA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 1ggmA02
3HY0A 1X55A 4EO4A 4TTVA 3EFSA 4G84A 1W66A 4DPGA 1USYC 2E65A 5E3IA 2EJFA 3HRIA 4P74C 4YCWA 4YRRA 3A7UA 1SRYA 3FJPA 3RKWA 2I4LA 1BBUA 1Z7MA 4Q15A 4CH6A 4H2XB 4TQDA 4H2UA 4CS4A 3VBBA 1NJ5A 4BWAA 2XTIA 3RIRA 5HGQA 2CJBA 5C53B 2ZT5A 3MF2A 2C7IA 1ADJA 4WJ3M 4RQFA 3L2ZA 4RMFA 3HXYA 3PCOB 2PMEA 3IALA 2EWNA 3R07A 1YFTA 5ELNA 2ODRC 2EAYA 1NNHA 1KMNA 4UP7A 4P3PA 1WYDA 2QHUA 4OP0A 2DQ3A 3HXVA 3PCOA 3A5ZA 4P3OA 4HWOA 4BW9A 2DU5A 1E24A 3UFGA 4P71A 4YRJA 1NYRA 4DQ2A 2ALYB 1J5WA 2E10A 4YRQA 4XU3A 4P75A 3E9IA 5C51B 2Q7HA 3IKMB 3V7CA 3A32A 2ZT7A 4H2SA 4YP0A 3ICAA 1NYQA 2ARTA 2ALYA 4XTWA 4XTZA 4K87A 2DXUA 4YRNA 2ZIOA 1WLEA 3G1ZA 1C0AA 4H02A 3L4GA 3RL6A 3QO8A 1EOVA 5C52B 2ZZEA 4L87A 4XTXA 3VQVA 4HVCA 4UP8A 3A7RA 3V7RA 2EL9A 2AMCA 3RKXA 2XGTA 5K1XA 2I4OA 3QTCA 1RIQA 3KFUA 1X01A 2ZT8A 3TUPA 3CMQA 2DKGA 2HNIA 2RHQB 1JJCB 3TEHB 2G4CA 3EFRA 1FYFA 4XEMA 1WQ7A 1YGBA 3UGQA 4ZTZB 1YFSA 1B8AA 2QHSA 3BFMA 3ERRA 2P5IA 1BIAA 4YDQA 2RHQA 1BBWA 1EVLA 3V7SA 4CH3A 1JJCA 3QO5A 4YRFA 3TEHA 3HTZA 4H2VA 2ZXFA 2ZGWA 4AH6A 12ASA 2LW7A 4RDXA 3RUXA 3P8YA 4P71C 4CH4A 1X2HA 3RACA 4PHCA 2Q7EA 1SETA 3I7FA 1LYLA 1HC7A 4HWPA 2CIMA 2DTOA 3NEMA 1QF6A 1WU7A 1ASYA 1KOGA 3VQWA 1EFWA 4UP9A 3WQZA 4H2XA 1E1TA 2J3MA 3HXUA 2J3LA 3L1AA 2E1HA 2Q5IA 4G85A 3V8KA 2DJZA 1WQWA 2DU7A 4CS3A 2C8MA 1EIYB 3HFZB 4YREA 4YRLA 4YRPA 2I4MA 1KMMA 3E9HA 4NCXA 1H4TA 3UH0A 2ARUA 2CJ9A 1ASZA 2DVEA 1N9WA 1NJ8A 1EIYA 4WJ4A 2DZCA 3MEYA 4YRCA 2AKWB 3NELA 3RKYA 1E1OA 2CGHA 1L0WA 2E64A 4YCVA 3A31A 1BIBA 2ZINA 1VQZA 1WNLA 1YFRA 4UPAA 3LSSA 2P0LA 2ARSA 2E3CA 4X5OA 4CS2A 2DEQA 2DDZA 2E41A 3LC0A 3V8LA 4TVWA 3PZCA 1B70B 4YRSA 3TEGA 4XTUA 3QNEA 2ZIMA 4TVYA 4WI1A 2DXTA 2Q5HA 4LNSA 3HXXA 4P72A 4HA8A 5ELOA 1EVKA 4YPFA 4XU2A 1B70A 2ZZFA 4YROA 1NJ6A 1H4SA 2ZTGA 3P8TA 2QHVA 3V8JA 1G5HA 4OLFA 4O2DA 1E22A 3A74A 3NENA 3IKLA 1B7YB 4RQEA 2FYKA 4P73A 2ZZGA 5F5WA 3VQYA 2EJ9A 4WF2A 1EQRA 4H2YA 3M4QA 2RHSB 2I4NA 1B7YA 4P75C 1PYSB 4ZTUB 4CH5A 4XEOA 1H4QA 1IL2A 3HRKA 4TWAA 3HXWA 4YRTA 4KR2A 4YRGA 2PMFA 1NJ2A 1QE0A 3UGTA 1SERA 5K1PA 1SESA 3REUA 2RHSA 1HTTA 2DQ0A 4PG3A 2ZCEA 3QO7A 1X2GA 4K86A 1PYSA 4XU0A 4EX5A 3DSQA 3HY1A 4ZIBA 2ZNIA 4H2WA 1X54A 4H2TA 2ZNJA 4XU1A 4HWTA 4HWSA 2ZR3A 4KQEA 1ADYA 4P72C 4P3NA 3RGLA 4YYEA 1USYA 4KR3A 1H4VB 3HFZA 3HFVA 2CJAA 4TVAB 4E51A 4HWRA 1WPYA 4P74A 3NETA 3IG2A 3P8VA 4J15A 2QHTA 4YRIA 2ZR2A 3A7AA 1V95A 2Q7GA 11ASA 1GGMA 2EJGA 4XTVA 4TQFA 2IY5B 4TVAA 1NJ1A 3MF1A 4K88A 4P73C 1YB3A 3M4PA 1G51A 2ODRD 2AKWA 2DTHA 3HXZA 3OD1A 3RF1A 3L4GB 2IY5A 2E5AA 3VQXA 2DZ9A 2ZT6A 3REXA 2AMCB 1ATIA 3LSQA 1Z7NA 2DTIA 3A5YA 5KNNA 4XTYA 1B76A 1X56A 3W3SA 1G5IA 4Q6GA 4YRMA 3BJUA 1HXDA 4YRKA 4YCUA
chains in the Genus database with same CATH superfamily
4I3GA 1TQ6A 4KQMA 2VQ6A 2C95A 4AZ3A 5ERGB 1DDIA 2XUKA 4XLTA 3CC8A 5IVPA 1O03A 1KAGA 4Q3OA 1NXSA 5TVGA 3L0CA 4K9MA 1QYXA 4PRKA 4EGJA 1Z36A 2FZGA 3ETDA 5FRDA 1OVMA 1UWVA 2AF3C 2C2ZA 1E9CA 2EGHA 2JFXA 3KYDA 4XZ3A 2NTVA 4C0WA 1I80A 3OX2A 4IW3B 2HHCA 3ZI7A 1M3SA 4I8IA 2V6FA 5CNKA 1YB2A 3RTDA 5JDIC 3PCTA 1HE3A 3L0BA 3WRXA 2VWGA 3K0AB 4EHAA 5C3MA 1KS9A 4ZAFA 1PZMA 5LXTB 4E5YA 5JMPA 4KP7A 1DEHA 2Y05A 3SBDA 3LKDA 1G1AA 1OZAA 1XRQA 3NONA 4KO2S 2D4HA 4L7QA 1E5XA 4QBHA 5TQ2A 3TWOA 3HEMA 1GA6A 3UA3A 1BXRB 5D3QA 5B12A 1KERA 2PWPA 3WYGA 4A10A 3GRVA 2VCYA 2PUTA 4AZTA 1A88A 2RC6A 1VSBA 3H16A 2CNBA 2EX4A 2WF6A 4ZOLA 5LYJF 4IDCA 1E0SA 3UJCA 1NR5A 5JZ9A 4MTCA 2VNHA 3EXHB 1PGOA 2JL1A 5JQWA 2YRFA 1AKNA 3OTGA 1ECLA 1JT9A 4CLEA 1Q20A 2KJQA 2YYZA 3OLWA 3GFOA 1BBUA 1ZCJA 1OTHA 5AH0A 4YHBA 4DYDA 3K9NA 3UMFA 3X1KA 3P2IA 4ZOEA 3DE6X 4JLWA 1W5TA 4H2UA 3VTKA 2PRJA 1N9GB 2CJWA 3U3ZA 1QIIA 1TMOA 2EKQA 1ORVA 1N34B 3GBSA 4LDNA 1S4MA 2YVQA 1KQPA 1RI2A 4R2HA 2PUVA 3PGA1 3T94A 4X90A 1S2OA 2PXAA 3TQIA 2V7XA 3PNKA 1D2MA 1YOBA 2OQRA 1TIKA 3I73A 2P62A 1FP1D 1AF4A 1PNVA 2V5VA 1JDVA 5AI6A 1WUYA 2FPPA 3TCNA 2B4YA 4DTIA 5C18A 3VU3A 5CT4A 1S89A 4ZAYA 2GUWA 1P0MA 2DBYA 1U2GC 3A9RA 2QRHA 4FD3A 1V8DA 4BP1A 4RMFA 3R77A 3BM5A 2K7ZA 1Z82A 1JE0A 1Y9EA 2HSEA 4WKOA 2B78A 3KNZA 2GTHA 4YAEA 2OYRA 2O8FA 3FSGA 1EFTA 1VDMA 1Y1TA 1TMGE 2WSYB 3OQ1A 1R5JA 2YMQA 4DIUA 1KP2A 2QK4A 1MT3A 1VIVA 2ZQZA 1NNHA 3O47A 5KNDA 1KMNA 2ZUEA 4AP5A 2V7GA 4MVYA 5CCBA 1XL0A 4B46A 4PYIA 2PTGA 4I2NA 2XZTA 1HNWB 3EEFA 4NMWA 1TB4A 1MAUA 3ZTTA 1Y7PA 2GBLC 4G0UA 3IBYA 4K0RA 4BJ1A 3FTQA 3Q6MA 4BNFA 1TMYA 2J7PD 1C1XB 2CK3A 4M60A 1XLTC 3WNBA 1W0KA 3UW1A 4CV1A 4P3OA 3WIVA 2YHUA 1EQAA 1W1IA 1JKXA 4UBNA 3EXIA 4U7FA 1NC1A 1G55A 2G8LA 4KRYA 5T6BA 1JTEA 4OHWA 1XZ8A 3OIYA 2BM1A 4OGKA 2HMSA 2CYAA 4L5BA 3EEQA 3OU7A 3B53X 1KAMA 1V1RA 2ZSEA 4LJ6A 3S0JA 3VXKA 3DDOA 1XD2A 3OHSX 4HAIA 3LUAA 3I2IA 4RC9A 5JMTA 4UC0A 4JLAA 1KYVA 4D80A 5HOEA 1U2ZA 3E7PA 1QHIA 2GARA 3KVOA 4XX0A 1GGVA 3H9BA 4YC7A 3OX3A 5J63A 2BF4A 4PCUA 3ZGVA 1YA6A 2DERA 1RRPA 1UFRA 5EIBD 4HJRA 1JILA 4RHTA 1J97A 1KPGA 2F4VB 3VTFA 2X8LA 4DYHA 3BMOB 3F9RA 3RB8A 4NRDA 3DFMA 1BKDR 3HU5A 3NHAA 4ZYYA 2ALYA 1BHJA 3C8UA 4WXPA 3RRJA 1Q0RA 4I1YA 4NEHB 3WLRA 4FXPA 5CH3A 3X2SA 4HAUA 3PC7A 1JMKC 4ND7A 3MCAA 3P20A 3AGPA 2Z8ZA 2YYAA 3SFVA 3DNFA 3H6GA 2P0AA 3W04A 1U0JA 5D01A 2QTTA 1SKUA 2MHCA 3E22A 2VFAA 1W88B 4M83A 3RYFB 2VJYA 1EFRD 4K7JA 4BFLA 4FEYA 5AM5A 4A8JA 1M0WA 4RL4A 2ZJ7A 2EQAA 1OLUA 3LBAA 3COYA 1BU8A 4X61A 5IVIA 4N12A 2A0KA 2GF2A 5AKXA 5GOTA 4QDOA 3K0CC 1K63A 3WP0A 4FZJA 4HTFB 5EJ8A 1DFIA 1NXWA 4KSYA 1CJCA 4FYWA 5AJZA 4IUDS 5LXTF 4TPKA 2LPMA 1U8TA 1XZFA 4NCHA 1VE7A 1T0JB 4KPUB 1MO5A 1ZIYA 2IBMA 5JLAA 3ZWYA 5AKJA 3T9FA 4CM4A 2HCJB 4DFDA 1C7RA 1Q11A 2YNMD 3RTEA 5WRFA 3MXOA 3RRZA 3S44A 4PM4A 1OT5A 3PCRB 4RTLA 1A2KC 1K5GA 2BFWA 2ZI5A 3A36A 3N0VA 4IOMA 1T4CB 4BTLA 3DDSA 1E79A 4G41A 4ODIA 2OILA 1U11A 3L8DA 3T34A 1XYYA 4D4HA 1MAVA 1O94D 5JRZA 4PXYA 2E55A 4BKRA 1I6LA 5JZBA 2L42A 1ODSA 2G7MC 3EWSA 1Z0IA 2FDRA 3GFSA 4OSPA 4C20A 1GTVA 5BSEA 3H13A 3BSYA 4ZCSA 4FQ8A 5LZ4A 1RRVA 1I7PA 2WG0A 2CLLB 4D57A 1SKAA 1IK4A 4W9RA 4CODB 2UUCB 3CW2A 3HTZA 3OI7A 4DR5B 4RADA 3TBFA 3HGMA 3N2LA 1PEDA 1P0CA 3A9SA 1X7GA 2EGGA 2WMDA 4L78A 2A9RA 2BGJA 3JW8A 4FE7A 3IAS6 1RAGA 4NZOA 3ZCVA 2B4TO 2ZJ1A 3Q6IA 4UFPA 4CH4A 1GA1A 1U98A 2VPXA 5F4ZA 4F9GA 2QQEA 5L53A 1Q15A 3D3NA 3RG2A 1VMKA 3VTZA 1IN5A 3MJVA 3SFTA 2B4RO 3LYHA 4OHOA 3HFSA 4DA7A 1YOVA 1KXZA 1QNFA 4UUOA 1YZGA 3REGA 4B3BA 3T7KA 1XDWA 1SVUA 4L4SA 1OYVA 1XQXA 2C2WA 1IHUA 2PZJA 3H1EA 1FS6A 1YMUA 3ENWA 3I2GA 3ROKA 4RGQA 4TMFA 3SS7X 3MRXA 1PJSA 3KPUA 4UTOA 3N70A 4HDQB 5DBIA 2ZJ0A 2ZTMA 2CLSA 3C5HA 4X6LA 4ZHQB 4AG3A 1AGRA 4IL5A 1P0IA 1XKQA 4URFA 5F1PA 1DXYA 3KC2A 3KB8A 1CZNA 3VR1A 1IMJA 3OPVA 4G85A 1AF7A 1TU3A 2A84A 3IYLW 1WXFA 2XD9A 1WQWA 5KYKA 2Q6VA 2Z83A 3QKRB 4ZK2A 1LWOA 1NY5A 4PZUA 1RAIA 1VGQA 4ZZIA 3THXB 5BR7A 3VZPA 1OFVA 1E9DA 3VNRA 2HA2A 3ZLUA 1A77A 3HFZB 4UOZA 4CU5A 4YREA 4KVGA 4MW0A 3V2HA 2A5DA 1QTIA 4P08A 2WT8A 4IQFA 4ZRNA 1GLGA 2DWQA 4MI9A 2MSLA 3OCUA 4WKGA 2QE7D 1ULTA 5EQTA 5FHRA 3NVMB 2C8LA 4B0OA 1KOFA 2ZI6A 3PXUA 3IDZA 2W6MA 4Q1DA 1X0VA 3A9WA 3PP8A 4BLQA 1B0ZA 2FFJA 3GFPA 4FB4A 3UT6A 2BFDB 3UWOA 1KEEA 1VG8A 3C6QA 1CUJA 3A2NA 2KHZA 3DH0A 3QSYA 3KSAC 4UVHA 5BW8A 3UB4A 2HLPA 1HOXA 2V9CA 3HKEA 3WI7A 1WDWB 4W5JA 4BC1A 2OXIA 1G8YA 3HUEA 1QFJA 2OTCA 3OSUA 2X8WA 4JT4A 4N5NA 2V9PA 3RC3A 5L45A 1XTIA 1Y7HA 3G0CA 1RYFA 1B2LA 1KI4A 1WZIA 1ZSYA 1DT5A 1TT5A 1YZNA 2AOVA 2DR3A 1KE1A 3MQ4A 1R6UA 3FRJA 1A9OA 3H2JA 3H86A 1E6UA 3HS3A 4LI0A 2RB5A 1GM5A 3HCWA 1I5RA 2GWRA 5CFZA 3E4DA 2D7DA 4NZYA 4YH1A 2OR3A 1J9ZA 1WG8A 2CNKA 5T4HA 3N86A 2DFDA 1GYRA 3ZCXA 3LTEA 4Q1BA 1IL0A 3A14A 3CNNA 2P11A 5HCUA 4DLVA 3P4XA 3C70A 1FJHA 3T4XA 5K9ZA 4MS3B 2LIVA 1B70B 1RCFA 3BCRA 5E6RA 2ZPUA 1EWRA 3CVXA 2I3DA 3CNHA 3K1ZA 3CX3A 3IR6A 4KKVA 1JLHA 2BGRA 2DJ5A 3IEUA 4NQZA 4Q3KA 4WCVA 3RUAA 3P8ZA 4WE3A 4YONB 4N48A 3IQWA 1J56A 4LJ5A 2QYHA 1T3GA 2GZRA 1RXEA 2PWYA 4FW9A 5AK0A 5ALRA 1JLSA 2Z4SA 1L5FA 1P7WA 2VZEA 1C0PA 4P72A 3GPCA 2EKLA 4Z86A 2JIMA 4HA8A 4RK1A 4BXOB 3LKBA 2FJUA 5TB5A 5HQ3A 2GNAA 1HQDA 1SOAA 4QFDA 1H5UA 1K7FB 1YDGA 3AWIA 3QRWA 3F6BX 1BGVA 2W4QA 2YHIB 1P6UA 3WA6A 1IN4A 4OLBA 4MW6A 2WD9A 2ZRNA 1RWWA 4Q4LA 3EXAA 5EKDA 3VU9B 1IM2A 4F5ZA 2C7QA 3AHHA 3D3KA 3WA7A 1H2RS 3LUKA 5E1MA 2H0QA 1JB9A 3FSJX 2EZ9A 5ICGA 5BQFA 3ZCTA 2WYOA 3DEAA 1N77A 5AI5A 4Q6WA 2OZPA 3KAQA 1Q22A 1Y81A 2E4VA 1AKYA 2VHEA 2FUG1 3G3EA 3IOMA 1E1QD 1AOXA 4GD3Q 4GL2A 4EARA 3PDHA 5IC6A 5A02A 1RJEA 1YH3A 2XV1A 1JR3D 2P5TB 3DZBA 4HR7A 1NY6A 2VYVA 1IDN1 4BNXA 2ZZGA 4OCZA 1R4MA 4KDCA 2X8JA 4BMNA 4CLOA 2JFHA 1ZITA 4YWJA 3VDRA 1UZUA 3D6MA 5T57A 1EQRA 4H2YA 2GXUA 2ZFUA 4ZHQF 1WBJB 4GI5A 3OF5A 1C80A 4XJSA 1ODLA 1WF6A 3KSMA 3KPVA 1U3TA 4X91A 4ZEMA 5BWCA 2X0FA 1Q3KA 4R2JA 1VTKA 1VJ0A 2WUFA 4J3FA 2CLCX 3MCTA 1XTKA 3ZE2B 3BILA 4M1EA 1L7EA 2EFEB 2VUTA 3K05A 3GGDA 1KI3A 1X74A 3CNBA 4OQPA 3X2FA 2W71A 3OMXA 1C3OA 4AZSA 4E4TA 5CW1A 4GZ5A 1U0BB 1J39A 2H7YA 5K1PA 4LVIA 3L0SA 3REUA 2ZW9A 5FLEX 1HTTA 3KIPA 4V38A 5DBEX 5ERYA 1NMSA 3DZDA 4LDQA 2J41A 4ZYUA 2VDOB 4Q7EA 5FPSA 2I6QA 3VSCA 5J4KA 3A6PC 1XZCA 2XTZA 1JIIA 1NI4B 1P3JA 3K4QA 2G9NA 4B34A 5AOBA 4QOEA 5HBRA 2QB5A 5TGDA 1X1QA 1XTJA 3DONA 4DLWA 3KKLA 4G0VA 3PXEA 4Y3UA 5K3DA 3UVEA 4Y1RB 1BKYA 1DAGA 3F6CA 4MB6A 3IMCA 3ZEIA 2NO0A 5DLEA 1DL5A 4R1NA 1P9LA 1O9GA 5JBQA 1DDOA 1QH8B 1MVNA 5DLDA 821PA 3INRA 3R7DA 3MJEA 2X9QA 3FE2A 4TZKA 2FPKA 3IIIA 4HYQA 5HKKD 2QXUA 2WLTA 5F78A 1V7ZA 1XPUA 4LDZA 3CRRA 5JDIA 4FZRA 3QUSA 2VUIB 2R2GA 3CLTC 3DLCA 4B8ZA 3PWSA 3HYLA 4BNGA 4NXNB 2V74B 1ZIXA 3CXUA 4P0TA 1JMVA 4O5AA 1IONA 1G2PA 1K9SA 1V6AA 4QPPA 1E61A 1WZNA 3DV9A 2Z3ZA 4NCNA 2RH8A 1B6SA 1JS1X 1PNOA 1BYUA 1UT5A 4LQ4A 4DUGD 3NV9A 1E6MA 4EA7A 2IU0A 1X19A 3T9EA 1HDXA 1KJWA 1GGMA 5EJAA 4POAA 3KUKA 3KQHA 3RSFA 4BRUA 4XR9A 2JAHA 4YECA 2NTEA 3GFGA 4P73C 1S2GA 2WJWA 1A9QA 3C7AA 3G0BA 3TLKA 5JQGA 4ZOQI 2JH8A 5IW8A 5TEWA 3QLJA 4IKPA 5B2FA 3I0ZA 4B7UA 2H1FA 1Q21A 2BEUB 3FCXA 5DHUA 4RLFA 3W79A 2IH5A 2CHEA 1LPBB 3EVAA 4BBPA 2QTFA 1BU5A 1F2UA 3U49A 1R50A 4IGAA 2RGWA 3F47A 4L4RA 4NAHA 4C4RA 4LTNA 3GRAA 3SK0A 4ZVPA 4TT3D 1KR2A 5IBQA 2J31A 4RJIA 4Y2PA 1H2WA 4B17A 4US2R 2NW6A 2R5FA 3DC7A 4IAOA 2C7OA 2J3JA 3DYIA 3OJCA 4DILA 4FWTA 1P6XA 4ER5A 5AW8A 2I3GA 1NBMA 3F6SA 1U1GA 1U2GA 3L4KA 4L0QA 2J4DA 2WIAA 4CU2A 3GEEA 4LQCA 4YB8A 5F2EA 4ZVTA 2P9QA 4EABA 1B1CA 4ZCLA 2BISA 5EJIA 3KPWA 2FFHA 1S3GA 1VE9A 2YWDA 4OXYA 3G13A 4G1FA 4XGQA 4FYMA 2WWWA 4F4IA 5IN4A 1L8XA 1O4VA 3U16A 1NPDA 4XWGA 2WILA 1FFCA 3Q9LA 2X5KO 4JEUA 3KB1A 3ZK8A 1PFQA 1AGPA 2VZLA 5JDCC 1IN1A 2G83A 2ZS8A 3AH8A 3EIHA 3NLLA 5D6OA 3IVCA 5AMXA 5EE3A 1R4ZA 4HYYA 5IXYA 5GJCA 4TTVA 3LGAA 3EEOA 1XLTA 4BDSA 4JVMA 4OQZA 4D3YA 1ZOSA 4G84A 2QPOA 5BN5B 3AM5A 3TQQA 3DHEA 1TJYA 2B8EA 4KH0A 4DPGA 5P8WA 5IEJA 1AA6A 2UUOA 2PUBA 5E3IA 4IOKA 3TIIA 1PT5A 2IUTA 1E4EA 2BEVB 3ACCA 3HRIA 3RKUA 4M6WB 2R6ZA 3EVFA 5AKHA 5FF9A 4BL5A 1GQSA 4XM0A 3C2QA 5LBUA 3LO5A 1M72A 4EF5A 1NLZA 1XAJA 3DDUA 3HR8A 4QOGA 5CB4A 3RGGA 4JI6B 1HQKA 2Z9BA 1XFAA 1B42A 4PZDA 3DMTC 1U7XA 4OJQA 4Y30A 5F1YA 5AXBA 4B6GA 4D8VA 1G2OA 2QRGA 3G9UA 1Q6YA 3TJZA 3SKYA 4OLHA 1AK1A 2PO5A 3BE8A 1BE0A 2W48A 1Y1SA 1ZAKA 1KGDA 3BE4A 1H2FA 3T41A 1Z7MA 1ZGAA 4V0KA 1EE1A 4BZPA 3IOCA 2WM8A 1XKXA 3WYEA 4NMHA 1PO7A 4IGFA 2XA9A 2ZTHA 3MWYW 5CX4A 1NQOA 2NO1A 4MQFA 3AI7A 1TM5E 4MCIA 1FBTA 1Q17A 2XVZA 4NENA 4E3WA 1FMLA 2HDOA 3SAJA 4U63A 2GKOA 2FCRA 3MHTA 2AFIA 3K0CA 4CL2A 4P53A 1OAKA 3LA8A 3FCOA 1PTKA 1YHYA 4ARVA 4DWOA 3GEGA 3CZCA 1VYVA 4F9EA 3IVXA 2FZVA 3M6FA 4K3VA 1G8GA 2PD4A 2J9XB 2OXTA 3CIFA 3UFXA 1RWPA 2J5XA 4CKEB 3ZU6A 1K7SN 2I1VB 4G56A 4YNBA 4CF7A 4Y2TA 4NJEB 3ORHA 1IEWA 1ULSA 2IYNA 3U48A 1Z37A 1I3NA 2GEJA 4R7TA 4XEUA 1OZ0A 3TLEA 1JX6A 1OREA 4YUYA 1SC6A 2YHBA 3QYFA 2AN9A 2WJ3A 2DGDA 1V1MA 2J4FA 1ZHHA 1TO6A 1SBYA 3AI1A 5DF1A 3IP1A 1F2DA 4R01A 5FNVB 3KM0A 1LSJA 1MB3A 1NN0A 4TTIA 1RE1A 3VC1A 4LK2A 2VL7A 2EHDA 4HO1X 1WHTB 2FSVA 3BJZA 3G9XA 4M1TA 4Z1MA 1KO5A 3W1WA 2Q3LA 1IEXA 2IXAA 4Z9XA 3G2NA 2J7KA 3SQDA 2YY7A 3QITA 4MGZR 4MW1A 3L8GA 2BKVA 3V33A 4YCMA 2IXBA 2WWFA 2XA1A 4OA8A 5KUTA 1QCZA 5HDQA 3UGKA 5CDFE 3AUAA 2D1QA 1EUDB 3G6KA 4QREA 3PC8C 1P1JA 1KA9H 2XW6A 3DF7A 3EMDA 4HZUB 4MJ3A 3BBPA 1G2QA 5I51A 5LQAA 5ALFA 1RZRD 1M5RA 2AWNA 3COPA 5C7OO 1CP2A 1L1QA 1V37A 5AM1A 2O7SA 1H66A 1JIKA 1FDRA 2QYOA 4PYMA 3FA2A 1XKLA 4DR2B 1WVGA 4FYIA 3T5PA 2J7PA 5AWFC 4BGVA 3UCXA 4JZYA 5J47A 1EFVA 2H1SA 2I8CA 2P2YA 2HBQA 4G5FA 4CVNA 3IIKA 3K2QA 4FDVA 1OXMA 2WHEA 1X0XA 4I9HA 5JNUA 1WO8A 3I9KA 3EWNA 4L5CA 4B8YA 4BX8A 4XLLA 4A0HA 5CYFA 1XWWA 1DC6A 2IP1A 4P98A 2HHJA 4HCJA 4RVFA 4FMCB 3LI2A 5JMOA 3CJTA 1KRXA 2VPYA 4LBVA 5C52B 3OTWA 3FUTA 3K5PA 1N36B 3K7EA 4E5SA 1I5EA 2CBGA 2HJRA 2H2GA 2JJ8A 3GJTA 1ID1A 3L0PA 4UM9B 1QTQA 2EL9A 3KQVA 5JTTA 2DPLA 4JU9A 3QLEA 1QWOA 1XP8A 1BO6A 1UKAA 2PGOA 1RIQA 1ZONA 2A0YA 2K2QB 3A9VA 3L77A 4XSVA 4A5SA 3ZHVA 1G66A 1ECFA 1NYLA 2DT5A 3VV2A 3OFJA 4P4LA 3F8WA 5EXPA 1UT6A 2FHPA 4ROSA 2RHQB 3JZIA 1D5CA 1UMCA 1T3TA 2P9GA 4FKBA 3AP3A 3GDOA 4AI6A 3M6UA 3QK7A 3VMFA 3KFVA 4L4XA 4V24A 2W2MA 3JRWA 4ID9A 5LCXA 4EJ6A 3FWNA 1H2BA 2H4FA 4GI7A 4QYIB 3E5RA 3D6NB 4E5KA 3UT5A 2CMKA 3IAHA 2BUAA 4EM6A 3ZJ5A 2Q2QA 4ZICA 3TGLA 2M6RA 4R8VA 1EFRA 4GQIA 2X4GA 3N7UA 4IWNA 4MVWA 2HEIA 3WB0A 1P7PA 1RBQA 5JY1A 1GUBA 4EQ6A 1D9XA 1JHQA 2VRWA 1VMIA 3M4NA 1K66A 2VK4A 2UZ1A 3ORSA 4TLEA 4ZPJA 3T5AA 3PENA 4B3SB 5ALNA 4KXXA 3A11A 4IFEA 1JJCA 4YRFA 4P4NA 3TEHA 5E4TA 2G4VA 3SSOA 4TOIA 4Z7NB 4X97A 2ZR0A 3DXYA 4TX1A 3ESDA 3L06A 3UBMA 1ZGHA 4HDAA 2E6UX 2QMEA 3ENZA 3G79A 3N2GB 2YNMA 5F76A 1GDDA 2BGTA 2QRJA 1WXXA 1N4AA 4DSTA 1Q91A 2WHYA 1PBTA 3TZHA 2AFRA 2Q6TA 1UC5B 1W52X 2DTXA 3DPUA 1QV6A 3OQNA 2AJBA 1L9KA 1EAYA 3HZRA 3QFFA 4ZYXA 5JAIA 1JG4A 1WM1A 1L3BA 1O94A 1IHDA 2V3WA 4QU9A 4JL8A 1YL7A 2C1EA 4NJOA 4UCFA 1FEZA 4X71A 4M9UA 7ABPA 1U1IA 2CIMA 1IN7A 1GADO 4LRYA 4N0EA 2GO7A 3AW9A 4R0VA 1Y1QA 3BEOA 5FUBA 3UAOA 1SELA 3IUEA 4KACA 4BECA 1KOGA 3WSVA 1QVRA 4Z53A 2YCBA 2AH5A 5A4IS 2GJKA 5A4MS 1XRNA 2RJOA 3D7RA 1FLAA 1UL1X 2BELA 2P3LA 1N57A 3N87A 3NTRA 3TR5A 4LX0A 5KCZA 4QSMA 4GDFA 4HDKB 5NLLA 2DWOA 4RSRA 4G23A 1AN0A 3H2IA 3JQGA 1DADA 4W1QA 1YGPA 2VDQB 1JF8A 3GUHA 2CZQA 5EERA 3V1MA 3OJWA 2VLIA 3A6EA 4RULA 4U2CA 3RS7A 3ABSB 4GQAA 4PVCA 1FP6A 5FNVF 3I30X 5M34A 2DBQA 4KLZA 4DSOA 2H5JA 2H52A 1DHRA 3UN1A 5JH7A 3GELA 4TGLA 1NMQA 4J1TC 1ABFA 4Y2YA 3D3QA 5IM5A 1Y8QA 1DMRA 3ZBTA 4I4LA 2ZI3A 4YLGA 3DBLB 4MKRA 4DDHA 4YYZA 2VXCA 3GQBA 3OJ0A 1NBHA 1T2UA 4FFBA 1K6JA 2NV0A 3PXXA 4TMKA 4QLOA 1QDLB 1UPCA 1EWYA 1TC1A 4QOIA 1W96A 3LMKA 3HB4X 4ND8A 3VJMA 1L7BA 3U39A 4LHVA 1Y80A 3J7TA 3P5BA 1T1JA 2G67A 3TOSA 4XVUA 2FX2A 1RC8A 2Q8PA 4BU1A 5F4BA 3ETLA 5LBIA 2OV6A 4Y8VA 2PYZA 2ZJFA 5AUNB 3Q8LA 3RKYA 2JIOA 3O1HB 3MWGA 2O20A 1ZD9A 4HZIA 4PS0A 5DZSA 5AKLA 3MWEB 5BUZA 1R8SA 4HEQA 3WLMA 2QE7A 1RI5A 3QVTA 4B3HA 4BUJA 4GPD1 1QK3A 4GVPA 4DQVA 4GR5A 1L9XA 1RC0A 3MERA 1TUBA 3ICOA 3OIFA 4FMCF 4MTLA 2ISCA 1GU7A 3PHJA 2FSPA 2QTRA 5I48A 4I1UA 2W2KB 1CCWA 5DNEA 3N8HA 4HN2A 1RKBA 2G82A 5A06A 5K0EA 3Q11A 4PNEA 3KT8A 1H2XA 1J0XO 1L6IA 2V0CA 2WM9B 2YVAA 3QE0A 5BQOA 4EHLA 4KVFA 4ER7A 1E2HA 2F4NA 2BE7A 2PRSA 2WHXA 3FPEA 4YP1A 4JLMA 3SHFA 2DR2A 4HDMB 4YCDA 2DRIA 2QDKA 1CWUA 1HDOA 1W19A 2NQTA 4LZNA 2R84A 4CLDA 3O7WA 2NZWA 3H8JA 2V45A 3TUIC 4C4ZA 3HWSA 1FZQA 1D03A 2X15A 4JLKA 4C08A 2JAWA 3NH9A 4PSCA 4LOAA 4RVNA 3SDSA 4C7OB 3FB4A 1GPWB 2QG6A 4KK4A 3MWDB 5TDHA 3UMJA 1BWQA 2IX3A 2W70A 3R0XA 4RD3A 4K28A 2RK6A 3ZVRA 2OWDA 3W4JA 4CETA 4WNAB 2QZPA 4HT3B 1PV1A 4NU8X 4AZ0B 3SR3A 4ZDJA 2G9ZA 2EF1A 3FF4A 3W5SA 1Z7BA 1X3LA 4R54A 1LLQA 4G09A 4ZQCB 1O2DA 1MZVA 3S2YA 1K4MA 5EHGA 3HU1A 4OQ4A 4EG0A 1V0JA 2C9YA 4NECA 5BWBA 121PA 3EGCA 3GGJA 3IESA 3K15A 5FI3A 3UXHA 1YB5A 2H85A 4YDRA 4CMKA 2ZSUA 4XPZA 4FBMA 4LXIA 5A9SA 4KMMA 3T1HB 3PZRA 1YONA 1FX1A 1RQNA 2KSQA 4G5XA 4KSCA 4WA7A 1ZD2P 3QF4A 4TV9A 1Q0HA 1JJIA 2HMUA 1E22A 3NENA 1C7FA 2FN3A 3IKLA 3L46A 3MPOA 4RQEA 4N5IX 4Q0MA 1YHZA 5DM2A 2EATA 2GZSA 5TXGA 1TM2A 2VCEA 4HWKA 3QMPA 4WFQA 2FGKA 3JQAD 4P73A 4GICA 1YFJA 2UKDA 2O8DB 5KYUB 4PLYA 3GMIA 1FNBA 4IDDA 3TPZA 2BFMA 3DMNA 4Q1AA 1SU6A 3JQ9C 3EDMA 2V7QD 3IIMA 4CDNA 2RHSB 5ITVA 3CUUA 4LVLA 3I58A 2HA7A 2M1XA 1ZJWA 1H9AA 1QIGA 4RH3A 4FOLA 1XP5A 3KU1A 4IM7A 5F21A 1E3MA 1R0CA 3K0EA 5BOSA 4R1MA 5LLSA 3KSZO 3HCOA 2G5GX 4XOUA 5JNLA 3PSHA 4GO1A 3AJ8A 1E1QA 1ISFA 1SNYA 3AF1A 1NLYA 1QPGA 3GZJA 1SERA 1E2IA 1JR3A 3IT1A 1T34A 5DTQA 1IY9A 1P62B 2NXNA 2W2QA 2BFBA 1G21A 3HJGA 4XU0A 1G42A 3G0GA 3GLHE 1N6KA 2C96A 4AY4A 5IASA 3DSQA 2Q5OA 2QTBA 3HN2A 5B53A 3AIIA 2XQJA 3FTEA 5AVVA 4RPLA 3NNSA 2P35A 1TU4A 3L6UA 3LX6A 4DJFC 4F7DA 3NHSA 2GHRA 2IW1A 3I9NA 2VXYA 1H22A 1MC4A 5A7HA 3JQRA 4AECA 5TRTA 2Q5EA 4H2TA 2IXGA 2P5SA 4QTXA 3N2KA 4NARA 2QMUA 4QOJA 2QW1A 4G8CA 4NOKA 5DSZA 3TSOA 2R7MA 2XADA 2PGJA 3W77A 2W0SA 1VJGA 4UM5A 2XXAA 1QO0D 3C8ZA 5EIEA 2BMJA 2F1OA 4KQGA 3AIKA 1IBMB 2FPMA 4XGKA 4XA8A 1RQPA 2GF0A 2V9ZA 2NSHA 3HDTA 1F9EA 3BD7A 3E35A 1NVFA 1C7JA 1EFAA 2HDWA 1GDHA 3DBRA 4PGAA 4RK5A 2TMGA 3WIBA 4H31A 2J9FB 1VLJA 2QN3A 4IRUB 4PICA 4QEZA 1CHDA 3DMFA 1H05A 2EARA 4MO2A 1U8AA 3FM9A 3P97A 1XZAA 2QHTA 1GPBA 1ML3A 1YBFA 3CCBA 3BK2A 2O8VA 3EIXA 2AFHB 2LVBA 2X2EA 2OV4A 2PR7A 4UMEA 3VR5D 1EK0A 4FLMA 3DVAB 5DI3A 3ZDZB 4LWPA 5CCEA 3VDQA 5IC4A 4WZAE 2PUDA 3DMTA 3HRHA 1B3RA 2QYSA 1S01A 4GGPA 4RD2A 2CNWD 3KEQA 5F98A 2I03A 4JKIA 5SY6A 1K5PA 4BNVA 3AEKA 2Z95A 5ILGA 5HKKA 3UA4A 3NAQA 1XRRA 4KFSA 4RMNA 3D8SA 4GYWA 4IX1A 1JMYA 5FWYB 2FK7A 3IVAA 3OZGA 1XQVA 5AI8A 4P82A 5SYNA 2ODRD 5JAOA 2SECE 2YZGA 4XASA 3PQ6A 5CT8A 5H3CA 5H3LA 4B7AA 3O0DA 3W0LB 3OD1A 2EVWX 1U99A 4C76A 1EP9A 1OZFA 4DNPA 2CE2X 2J45A 2ZRPA 1DJLA 2EJBA 5A4AA 1CYDA 4OB8A 3WTCA 1U90A 3VI4B 1CR2A 5JCJD 4EJ0A 1OXKB 1PGJA 1JBQA 4Z7QB 2D0OB 4KVAA 3VQXA 5BVGA 2PV0A 1U63A 1ZOOA 1YASA 4GR4A 3UK1A 4AW9A 1UZLA 1XAHA 1XLVA 2AWOA 4AD8A 2JASA 1HH4A 1PJAA 4I55F 4QDKA 4RBNA 4CIAA 2FR0A 3A04A 1Z26A 3DUFA 1DTWA 4BMOB 2DPYA 2P9BA 4R68A 4AJ1A 4MI3A 2VJDA 3P0HA 3PRJA 5CVVA 3MRVA 1N1DA 4EEZA 4ENUA 1M76A 3KK0A 2V6BA 4HH1A 2DQYA 3CH5A 3D64A 4RCYA 5B6IA 2AZXA 4WN9B 4TT3A 4OH1A 5KTRA 4DG5A 3VNUA 3H4MA 2PU7A 2X14A 4O3FA 1GQRA 3JD0A 4F56A 1T6NA 1K98A 1YZTA 1E1YA 3HY0A 1XUOA 1P9OA 2QP4A 3PQDA 3K9HA 3DSRA 3LBHA 4PLGA 3CGWA 5ITZB 1PV4A 4LZOA 3H2KA 1HETA 3AUUA 3H05A 2GAOA 1P3DA 1JEDA 1TGYA 2WU0A 5JJ5A 1BXGA 2P3QA 3NBMA 3RC7A 1TPYA 3FNHA 4X1IA 3VKWA 2UYOA 3PNVA 3ZDRA 4PZEA 1H1LA 1LBEA 5A1JA 2GM5A 3MBKA 1N0VC 3RIEA 5INTA 2HMTA 4LXHA 4LTDA 1XD9A 3PITA 1ZU5A 5DBGA 3PC8A 4L95C 4PLPA 4DQXA 2J3DA 1T2DA 4BLTA 1IVNA 3U4GA 1YJXA 2VQFB 5JASA 4RQUA 8MHTA 4FFOA 4BVKA 1W47A 2EQ5A 5ALZA 1J4AA 1MX9A 3QIAA 3OP4A 2HT6A 1KMQA 3TLAA 1JDBB 1S2DA 3GPBA 3L04A 3LHFA 4ZI2A 2BHSA 4QTYA 5KTKA 3TG8A 1FC0A 3AEYA 1ZIDA 2J6HA 4WOKA 4AMZA 5ALOA 2QORA 2WNIA 4PAGA 4IJ5A 1RTKA 1ISMA 2QKYA 5GJWC 5I9NA 3WQBA 4A73A 4OJMX 4CM6A 5SZIA 3SBEA 3IILA 1B6RA 2A7XA 2AC2A 3G9TA 3QU7A 1TCAA 3BN3A 4QT4A 4MGKR 5JFGA 3KKPA 3WGQA 1UBFA 3BIXA 5LOVA 2ZRGA 3GFRA 4K6OA 4TM8A 2GWHA 3IQFA 5BUQA 4HSGA 9ATCA 1JVBA 2EBFX 1BFDA 1DZ3A 2OGWA 2QJOA 4KYTA 1N6NA 5A6SA 3JRNA 4KLCA 3EAGA 2PV7A 4E2WA 2HCFA 1PQ4A 3AF3A 2DSNA 2XUHA 1QH9A 4XIGS 1R10A 4UUAA 4OKSA 4FOTA 3KKMA 3RTBA 5JD4A 1R5BA 2OO5C 4ITRC 3PCOB 4CM9D 4TMVA 3BTVA 5FOWA 2GCIA 4YUVA 3K8YA 5ELNA 1ZUHA 4PO1A 1N2EA 3NQ41 2MOKA 2ODRC 2QJFA 4PBRA 3QTBA 2X7HA 1KDPA 5EZ6B 5GY7A 4EG7A 1LTHR 1RYBA 4CHTA 3KEOA 1KRHA 1GXSB 2FPIA 2LRHA 2X22A 3FDFA 4IIEA 1EYZA 4WNIA 3S5JA 3DEZA 2PBLA 2RBKA 4AO6A 1E2DA 4MUIA 3NEYA 1JFVA 2WF8A 3AY0A 3GRPA 3LQ4A 3UAYA 3MAGA 2XCTB 2FQYA 4J3JA 3IMGA 2R7NA 5BNFA 4C29A 3JASB 3KR2A 5FUMA 1HE8B 3TLXA 3TLBA 3RBZA 5JANA 4H7EA 3CUWA 1P2BA 3ORRA 1XZNA 3R9XA 2QRLA 5BV8A 3I72A 1QGDA 1P91A 1K7XB 1NYRA 4O2BA 5LPNA 3BWYA 4QRDA 2WIJA 1V16A 1WEKA 5CYPA 3ZDYB 4YMVA 2ZE8A 1KJZA 3KB6A 1NPTO 3F5QA 2J3HA 1B23P 4UEQA 2EFYA 4CM7A 1QCCA 2FPXA 4C2BA 4EATA 1D8TA 4G4IA 3PUHA 3E9IA 1ODIA 3U56A 5J2UB 1FQKA 1JP7A 5L3QA 4E7PA 1IE3A 1HORA 2HREA 4XIJA 4REMA 1WKBA 4O1HA 4HX2A 1JBKA 3A32A 2B94A 5CAEA 1S02A 1IDOA 3W2TA 4OMDA 3RSQA 2QMQA 3CUYA 1CY8A 1XQ1A 1QMGA 4RFSB 2HAEA 5DXAA 2PUHA 2JLZA 1OZGA 4XTWA 4YEDA 1NULA 2PRZA 3HL4A 3MXTA 3HI4A 2AKAB 5LIPA 4W8OA 3C5EA 1VE1A 3AEXA 1JKJA 3KKQA 3DNMA 2QPTA 4L76A 4LRSB 4ZO4A 3V4VB 1XQ9A 5DGXA 4U7PB 1E2PA 5C8XA 5J2TB 2P77A 3D4BA 2WJZB 1O95C 1AUVA 1Z35A 3H9EO 4JJ7A 1LWNA 4RS4A 2FJ0A 2Q50A 3ETJA 3JVUA 3ASZA 2R7LA 2ZWAA 4Q19A 4EEXA 4UP8A 1RZRA 5ADWA 2WSSD 4J16C 1J49A 2GN4A 3KL4A 1ZJYA 4J1TA 5K8VA 3GFFA 2XGTA 5CPBA 3W9UA 5TVKA 4QLBA 1X15A 1Y4DE 2D6FA 1WZ2A 1V3TA 5E2IA 1EX1A 1N9KA 3TEFA 1ZIPA 1EUCB 1DTEA 4GPEA 5ED0A 2DM6A 3K20A 3M6VA 5U1PA 1NZJA 3NW9A 2B2NA 3QE2A 4BKMA 4BZXA 5E1BA 5DBFA 4NLLA 2NU9A 1X7XA 4N49A 1SXPA 3R0JA 4XEMA 3KJHA 3IDQA 3LY9A 4TRRA 5H4GA 2PUEA 1CUDA 5ILOA 4R3WA 4W5HA 1NXXA 1E0DA 1VL2A 4G24A 2AT1A 3GGPA 3PPVA 3DL2A 5D3KA 3ELYA 4JLOA 4K5QA 1TMKA 2Q4TA 3HCNA 3ZLBA 5K8TA 5KU7A 4EA8A 2AA3A 2H6EA 3RSZA 1AX9A 3PPWA 3K2IA 1AQNA 2NTYC 2ENWA 4YDQA 2G7ZA 4TXMA 1H1TA 4PYNA 1DXQA 4Y6RA 4AJHA 5KYXA 4ESVA 4CIWA 3N28A 2GYYA 4O5OA 2F64A 2BI8A 3BKXA 2ZTLA 4MP8A 3A6DA 3VR6H 5KINB 5KMGA 1GSIA 4YJFB 3U5TA 3RTGA 3TW8B 1K8RA 4TKUB 2HF8A 2YZNA 1A8QA 4FS3A 4Y2RA 5I8PA 4OHZA 5JXIA 3W2FA 5BR8B 2Q1YA 5IXSA 2RD2A 1ONSA 4QLAA 1H69A 1BVUA 5AKKA 4E14A 1K86A 3M9XA 4LJAA 5CM9C 2XGGA 1XWFA 3TGPA 1M5UA 1G8SA 4HQRA 2BGWA 5MDHA 1ORWA 3FVWA 4PEVA 5E1OA 4DVGA 1K2VN 2XF2A 5KQMA 4RYDA 5HDBB 3QVJA 1ZKMA 3QKSA 5GM2A 4BTVA 1NM5C 2QVYX 3FUCA 2PZFA 1I3MA 3BE6A 1NDQA 1CEQA 2AHOA 1XVUA 3WSTA 1N2JA 2R751 1D9ZA 3PA8A 2OCPA 2MR5A 4AZWA 4XARA 3U9LA 2OSBA 5LQSA 2Y66A 4H2XA 2H2HA 3DFFA 4LPSA 2Q6IA 1W59A 3UMYA 4DCSA 3IE1A 2I3BA 3TDNA 1HOTA 3E53A 4K6KA 5HM6A 2TMKA 4ZN6A 5FBHA 1D5WA 2WK1A 2DU7A 1M2KA 1UBOS 4RMHA 2WYWA 3R40A 4H3VA 1E2NA 1J00A 3MGAA 2RMKA 4OUKX 3K0KA 5COBA 2JVJA 4GSYA 1F06A 1G8HA 4CLXA 3LPDA 3OIGA 4B2LA 2WNHA 4FMDB 4RESA 4EITA 4IUYA 5T4EA 4UNNA 1DLIA 4XUEA 4ZGGA 1D04A 1OMOA 1P80A 2OP1A 2B36A 3B1VA 3OQIB 3PFBA 4HJXA 5AKEA 3RBVA 4KXQA 3C6YA 3IBFA 4GVXA 1LB1B 4Q7QA 1YCDA 4WBNB 1ZOPA 2P2ZA 3DBHB 3P9YA 5HFAA 5B55A 1WBBA 2DVEA 3KQOA 1TT7A 1TVKA 1J20A 2FN4A 1ZISA 4H1TA 3ZDXB 5IKEA 1EHIA 1T8SA 1EG2A 1EAMA 3L0IB 3BD8A 3USZA 1EIYA 3OT1A 5A2GA 2R1VB 5KOYA 5J2UF 4EGSA 3JPWA 4LJ7A 1B2RA 1YJQA 5C7LO 5EN4A 2ZROA 3WGLA 10MHA 2DY0A 3EZXA 3A37A 4Y1GA 3JQ9A 1RJGA 1UADA 2Z2JA 2WZQA 1CS0B 2G6TA 2Q4RA 3I1IA 1E7RA 1TFUA 4G1UC 3RC9A 5BQ3A 1A4UA 1NE2A 2RJNA 3A58B 3AIMA 3IUYA 3PE3A 3FKJA 1W2GA 4G5SA 4Q3DA 3VKFA 5JY6A 3AC0A 1E59A 4UDOA 4WD3A 1BFKA 1JHXA 1CUZA 3MJFA 1TLFA 2X7JA 5JECA 3C3PA 3L7LA 5LZ2A 5J2TF 3W4KA 4F71A 1NG9A 5H70A 3WK7A 1W9HA 4ZV9A 1BFUA 4HNQA 4EZEA 4ZCRA 5CDSA 1DZIA 1UXHA 4LHEA 3ZGZA 4RM2A 4CCWA 2D13A 1OT3A 2IYXA 5L4SA 2HRDA 3C3KA 5L40A 3LT1A 2JGFA 1E0AA 2R11A 4DM3A 2H07A 3ACDA 4JA2A 2HQSA 3V8LA 1JZSA 3AUXA 3HE3A 4RKEA 5DM0A 2QZSA 3QUTA 4UPEA 1XJ0A 4LBZA 4CMCA 2BFEB 5FAXA 1U7TA 3FNBA 1OE0A 3KHUA 4NAUA 4WXHA 3RRNA 3ZTYA 2Y2VA 3HKDA 4AY5A 5LMCA 5IAEA 2IZZA 4FC7A 3SIXA 4QT0A 3EXG1 2YY6A 5DU2A 5BV2P 1J8VA 7MDHA 1U2DA 3SYKA 1ZK3A 1YO6A 5DOVA 5L3SA 4JBNA 4L8LA 1KMHB 2WFLA 4KMRA 1Z25A 5D8DA 2QM3A 1ZFNA 2IXDA 4RQTA 1K8QA 1GTG1 1EP2B 1YA8A 3MT9A 1YV9A 2FFBA 4CLRA 4DSAA 4JP3A 3WMEA 3AFMA 1UBGA 3RE1A 4HVTA 3PYLA 3LY8A 3ZIAD 1RPJA 4CRWB 1QLWA 1VHLA 3NIDB 2ZDGA 4M0LA 3Q9NA 3FI0A 3D3WB 3M3PA 4HQNA 4EHIA 4ETIA 4EY7A 2G08A 2PLWA 1A4XA 1VC2A 1TM7E 1XYVA 4HLDA 5GOZA 2G9RA 3ANXA 1KVUA 3O4GA 3J81k 1E96A 1Q0PA 3L7YA 2PUJA 4KOAA 4N7JA 3C4VA 2PSEA 5IM4A 2QG9A 3WTBA 2XLBA 1JLKA 1KFCB 1RRCA 1CUCA 1PU2A 3U7QB 1YE8A 1D6SA 2GFIA 4JJGA 5FFMA 6ADHA 1N5KA 1QPZA 3HCEA 3AKEA 2BFCB 1QG2A 2VXBA 3LWDA 3WYDA 4CMIA 4I6GA 1O1YA 3QQ5A 5AI9A 2H1WA 2YXEA 2NZ8A 4C6RA 4ARIA 1TF5A 1OWNA 4NEGA 1ZLYA 4N7RA 3D4OA 3T35A 3EGWA 4LKOA 3DR5A 2Q3JA 3D7MA 3AONB 1X80B 3PRKE 5DMXA 5DW0A 3RUFA 3WRYA 4F21A 2FQ1A 2WJ6A 1X70A 4GRAA 1RAAA 1J09A 1U6IA 4Q4AB 4HVLA 3ADOA 3D7LA 1MENA 2B98A 2EIHA 1JJ7A 1EIZA 3F2VA 3V32A 1PVVA 1X94A 3JQAA 4CIDA 6NULA 4WLUA 3R0IA 3E1KA 4PG3A 1VHTA 5BY2A 5KNDH 2ZCEA 1G4UR 4MV6A 1HM5A 3A10A 4K86A 3S2ZA 3N0XA 1S1CA 4OD0A 4WBNF 2V7QA 3PR1A 1T8UA 1W49A 3HYTA 4PSVA 5E4JA 1ABBA 3O83A 1VJTA 3JQQA 1TYAE 2NU8B 3SC3A 5FB3A 3F6YA 4H2WA 4R8MA 1XMVA 3BRQA 1HG1A 4OI4A 5C1DA 8ATCA 1ZI6A 4DBLE 2OHOA 4DCCA 1TM3E 1MG0A 4OU5A 5HZMA 1JHMA 3PSAA 1WDTA 1F7VA 4IJ6A 3SJAA 5IF9A 2ZVPX 5I7OA 3F6PA 3DAGA 4XJTA 4J8PA 1GHTA 4G5GA 1IBSA 2BAGA 2FU5C 2WKPA 4IZOA 3EZ9A 5DXJA 4AVYA 2ZWPA 5TEVA 3TX6A 5JLJA 3W90A 3LAWA 4LBYA 4PZYA 1H4VB 2ZRJA 4MVJE 1JHYA 3T5TA 4GMKA 3MJSA 3HFVA 4IIJB 1GSOA 4TVAB 5E9JA 5A0VA 5JBIA 3HYNA 5CHYA 3OFVA 1VJ5A 2LIPA 3GGCA 3RKSA 5FDFA 2OKCA 2MT9A 1NBEA 5KHOC 3P9PA 2E4ZA 2BW0A 3L1JA 3A1VA 3IUQA 4TTRA 4WOCA 2YWCA 2FA9A 2BHNA 2WY2D 4BWFB 5FPKA 5IYZA 4XAQA 3QE9Y 2B7BA 1M2HA 4H7KA 2F8TA 2L0XA 1GNQA 1WLYA 4WGGA 2VS1A 3TO5A 3GZNA 4UD2A 1ZD3A 2V7TA 3VZQA 4AS2A 1UKBA 4R2KA 4TQFA 4GZ6A 1ULZA 4HUTA 1JSZA 1QO0A 3FNGA 3KYCB 4OBWA 3ZCRA 4L1KA 1UAYA 2CVOA 2M1ZA 3EGXB 2AKEA 1FP2A 1GTL1 3JU3A 4UBIA 3ZHOA 4CFZA 3K6SB 2ATVA 4C7MA 3AR4A 5EVCA 1ZRNA 2EZTA 3VRHA 1DAKA 2BFOA 2PQMA 2FWMX 4UUMA 5DO9A 2HGZA 5H02A 3ZUGA 3W7AA 1EJ6A 1QQ7A 1JSCA 3OE4A 5AM0A 1N5JA 4H6VA 3RQSA 1S2NA 3R7LA 3TD9A 3PGXA 3SXJA 2AFVA 4G37A 4EB3A 4MDFA 2J0EA 4BO6A 5EXXA 3WMFA 4JOBA 4MV3A 4HEHA 3VR5A 1I0ZA 5H1YA 4ZZ0A 5BVHB 4QG3A 1ZK2A 2IYLD 5LNK1 2ZSKA 1YJ8A 2XWSA 2YFKA 1IM5A 1CIVA 1F38A 3LPNA 4W9NC 2NLOA 4XFKA 3HJHA 4MJXA 3RK4A 4AZ3B 3W8FA 3A5YA 1IEVA 3D2AA 1RM0A 2X9NA 1NFQA 1YK1A 1KVSA 2OO5A 2AV6A 4JVSB 2Y1OA 4AG6A 2XBUA 4IHKA 4LAFA 4BMSA 3KYDB 3LQYA 1G9SA 2NO5A 5HG0A 1QP7A 3L7BA 3DTNA 1GRCA 1BA2A 1K97A 3IMFA 3RVPA 1VCNA 1TKAA 5PGMA 1TPZA 3X1YA 2RGGA 2YDYA 3S1SA 1CUIA 1OGIA 2VAVA 3QPCA 3CG0A 4A8PA 2XGSA 1QX4A 5KX5A 3BWEA 4LHYA 4RPHA 1WQ3A 3PFWO 4FLEA 1CUWA 1I1HA 2X9GA 4EHBA 1AO3A 1QV9A 1U4SA 3HR4A 3O7MA 1EDOA 3FPSA 5REQA 2WE7A 3SYLA 1Z2AA 1C8BA 4H1HA 4C0AC 5BMOA 3H8SA 3WOVA 4CEIA 1UJMA 5AVYA 5IAJA 1RQ7A 1JAXA 4ZOLB 3ZKAA 4K6CA 5TMEA 2Q2VA 4KZPA 1J2YA 1PLKA 4LF4B 1W5AA 4HL6A 4F96A 1R0XA 2FG5A 5G0TA 1OXXK 5ULLA 2E65A 2KQUA 1DXHA 1VLMA 3G2PA 1VLQA 1WSDA 2JHPA 3ANSA 1TA9A 3EXEB 4PVDA 5MN5A 3PEFA 1HY3A 2QENA 1GAWA 2CVHA 2I4IA 3E05A 4JP2A 4OK6A 4J2HA 4TYPA 2X0DA 1DINA 1VHJA 2ZE7A 5PNTA 1W4RA 3A05A 4Z54A 2R9VA 3QVOA 1CJVC 2X3YA 2ACEA 3A1SA 3AXSA 3RVNA 3UTCA 3UFBA 3VOBA 1SQ5A 1C2YA 2CJWB 2Q8NA 2VJOA 4K8OA 2FMTA 1Y4SA 2IRWA 3QVMA 3PTLA 1LVHA 1UMBA 3FPCA 3B3QA 1SOUA 4H27A 4LVNA 1KEWA 3SM3A 2ZYTX 5AUPB 3A7UA 4K40A 1GZ7A 2C9OA 4AKGA 1NW6A 2R6GA 3D1JA 4UBLA 1GPNA 2RH5A 2DQKA 4GPIB 3KUCA 3I9V1 2Q7DA 4LV6A 2I2WA 5BW5A 3Q7PA 4A5OA 2PX2A 2FPPB 4KAJA 2E21A 2FOIA 1QRDA 2WT9A 4ZQBA 4EPRA 4KYUA 4L75A 3AILA 4MUGA 4BWGA 5J4VA 5K3OA 4XYBA 1E8DA 3VBBA 2GUGA 3WIDA 3A0RB 1DBIA 3WGGA 5JRJA 2YWHA 1O95A 3CVWA 2FN9A 1UWCA 1ORTA 3NP7A 2KBEA 2O8FB 3VC7A 1D09A 2GCOA 4LW8A 4ML3A 2PZ8A 3D4NA 2ZJ3A 4J16A 2IHTA 3LFHA 4HNRA 2W6QA 3P9KA 2IGBA 2PZAA 4JKOA 3BB4A 4KIWA 2QIOA 1R2QA 3SZLA 4JP1A 4YP5A 3RIYA 3SLRA 3JQ6A 1HLGA 4IIJF 4QDUA 4RENA 2C7IA 1UKZA 5CNJA 4XD2A 4PTLA 7ADHA 3WKBA 4LGMA 1BMDA 3W6UA 3K70B 4M9SA 1KJNA 1TLTA 1Y6ZA 2OCBA 4ADSG 3HXYA 5K0SA 3SFZA 4B3GA 5KJFA 1N6HA 2J6BA 4AO7A 1TZ2A 4MGYR 4ACBA 5BSTA 2E48A 2JHFA 3R07A 4L5YA 3SGLA 3AVPA 2C0PA 1O7JA 4WESB 4MV9A 1II8B 2P8SA 5FFFA 4H4EA 5FEMA 3CR3C 3GD7A 1CJTC 4L6IA 4P5PA 3P52A 3H5VA 1P4HA 3FCCA 3RLFA 1QH1B 1LH0A 1SC4A 3DL4A 1V1RB 1UQTA 1XTBA 4PG6A 2EBWA 4V0LA 2G63A 3KJEA 1X8LA 5HW0A 1XD2B 1XEWX 2E4UA 2QHUA 4G0MA 4RY8A 2O8BA 2LKDA 4J94A 2DQ3A 1IN6A 3EWIA 3MTEA 1DE0A 4QXAA 1YVDA 3CLRD 1MBZA 4I1IA 4WV3A 4XX0B 1KOJA 1LLUA 2ASVA 4BJ6A 1A9ZA 2NUAA 4ID3A 4J9UE 4J1SA 3V3KA 3BZBA 5KTMA 1U0NA 1WMAA 4TTPA 3DHYA 3FB1A 3IELA 3HCDA 4BB6A 1K0UA 4CM9A 4CW7A 5AQ1A 1OJLA 3BC1A 4YRJA 1RWVA 4FGWA 4C43A 4XH9B 3Q7IA 2ALYB 2VJKA 2BL4A 4K6HA 5CYGA 3R7SA 1CEEA 4Z51A 4MKFA 2PH5A 2WTAA 2YHAA 2CUZA 2RG1A 3CUVA 4V2IA 3RSGA 2QN8A 4P75A 1NATA 5K2OA 4ALIA 4UCQA 1I6KA 1QAMA 2FFRA 1VE5A 2BFFA 1NM5A 4D56A 4AY2A 4MEBA 4WXRA 5TMDA 1Y6RA 1M6YA 3E7WA 3EDYA 1OLUB 2C77A 3OURA 4IDGA 5U4QA 4DAEA 3LF1A 3WBKA 3OH8A 1SG6A 1BW9B 4XTZA 3OU2A 2XB8A 3ROZA 3S8MA 2IIPA 4B5KA 1E3WA 3JCZA 2HADA 1C0AA 1BJKA 1YR6A 2UVDA 3B6KA 3NWJA 4N39A 1KQ3A 4L3OA 1KH1A 4ARAA 4Q7LA 3CRMA 4RXMA 2CCGA 3G0OA 3HU2A 2LZ0A 3DOCA 3LQKA 1PZGA 4H1UA 4NDZA 4FDTA 2DKOA 4EI7A 4BGDA 1Q0QA 4ZOLF 5TF4A 3HJTA 2YWGA 4A03A 2CLFB 4FE4A 1D4OA 2PVCA 4EG3A 1NQTA 1ENOA 4WUVA 1PVOA 1Y3DE 4FYXA 4GOLD 3RYCB 3TUPA 1RVDA 3JWHA 2JLUA 3OVMA 3ETNA 1LU9A 3BXPA 4BX3A 3OKAA 5JALA 3B7PA 1RWKA 2AMLA 4DLYA 5LUAA 2GKGA 4PAQA 1EXVA 2XMPA 4K3UA 3VO9A 3D4PA 3UMSA 5F7OA 5L7WA 4K6MA 2MJLA 5C80A 1YGBA 3A2LA 3OLXA 5CLIA 2G1KA 3HFJA 1PEYA 4JUDX 4UBOA 4D43A 2QAIA 5MN4A 1ZA2A 1QGAA 2HQ1A 4BKPA 4URHA 2VJBA 2SNIE 3ENKA 5AVJA 1KY3A 3IPRA 1RHMA 2VRNA 1MB2A 4A1OA 2NYAA 1YOVB 4K6FA 3FETA 2WEKA 3R7BA 1Q7GA 1OFUA 1JLMA 1QF9A 5CNIA 4NI5A 5F12A 3FFTA 2C3PA 4AH6A 1TEVA 3VYTB 1J21A 5L3RA 2GMWA 3I04A 4FI3C 2WHPB 4GR9A 3SZOA 2OD7A 3TNYA 3ZE6A 3ZZMA 4NYIR 4WN3A 5KTSA 2OBMA 3NV7A 5EMNA 4GM0A 5AVSA 3CLSD 4FBLA 3OKCA 5K3FA 5DSTA 5JS7A 1X2HA 2V54A 1Z2OX 3E81A 3PQCA 3UWPA 3UW3A 5I7WA 1OWMA 3V4RA 3HP4A 4B3TB 4N3BA 4QXOA 1HC7A 1SQGA 1TZCA 4RKFA 3O1JC 1G5QA 1PZXA 1URPA 1MRNA 3S40A 3LSYA 3RC1A 3NEMA 1WXDA 4EF4A 2AOTA 1ASYA 4YCBA 4DMLA 1E2QA 1TDJA 1SVLA 1KVQA 4LQLA 1WZEA 2C5GA 3TB4A 3NFYA 1IZ9A 4A4DA 1E6WA 1RCTE 3CLRC 4Z4HA 3JAMA 3L8HA 4H77A 1Q7RA 4IIFA 4CQMB 5AUOB 4EFKA 1GGJA 1ZI9A 2W6ID 1GL3A 3MCVA 4TRJA 2O2EA 3GJ7A 5G0SA 2ZRDA 4EMSA 1P4RA 2EJVA 3L8CA 4AWBA 3KR9A 3GB9A 1OLXA 1YTLA 3RVMA 4ZCTA 1AMNA 1I2BA 2P0YA 3BWDD 1L0BA 1OFHA 5EYPA 1D8AA 1KEEB 2Q5LA 4WK6A 4L9WA 1E2LA 3HDHA 3WGNA 4NC9A 5JPCA 3VX3A 2AD1A 4GYYA 1Z4IA 4D81A 3A7DA 3DJFA 3GVPA 4FQ5A 3EDQA 5LFAA 2GHIA 1DQRA 3KOXA 2V58A 1W85B 3I01A 3E15A 2X40A 4FINA 1NF3A 2O7NA 2E7ZA 4K9KA 1WVIA 3DEIA 3ZI4A 2FX5A 1PF7E 5CDFA 1TF2A 3BORA 1W87A 2ZIXA 1TT5B 1KHHA 3RUPA 3LDAA 4RD1A 3GA5A 4ZCPA 2ICAA 1NBAA 2ANCA 3LQRA 4UATA 1U7DA 3PQEA 3SIWA 4I6EA 3UB3A 3P0FA 1PWYE 1X13A 3F5DA 4GECA 2BVNA 2GEBA 4NVRA 1OBHA 1Y1RA 3TTWA 1EBFA 3UXYA 1CR1A 1DB3A 5IK2A 5IZCC 1IOVA 1QKIA 3P0RA 4FYKA 1F4VA 3PT5A 1WPRA 4OKNA 2XDWA 1N1EA 1MX1A 1Z2PX 3DZ8A 3JVVA 4JHLA 2I8AA 1XMSA 5EGNA 4N5MA 2GERA 4P36A 4OHCA 4XW2A 1SHLA 4F2PA 3C7CB 1HNZB 4L5JA 2ZIWB 4LDAA 1SOWA 4PSDA 1SPXA 2C4KA 4M7PA 3RC2A 3WGVA 4KPEC 3TTVA 1KVTA 3DVLA 3WIUA 5HS4A 1YRHA 3T5DA 4IQGA 4O25A 4G86A 2F3UA 5BXQC 2J5QA 5DYTA 3ZJ4A 3EGOA 1YVUA 2DFLA 3R1IA 2Z4TA 1CQWA 3NS7A 4L72A 4US0R 4OQFA 3TNLA 4QL3A 2E89A 3DOOA 1OB5A 3FVVA 5C35A 5CFMA 4V3CA 4JN6B 5HQ3B 7GPBA 2KMLA 1LTKA 3EQ2A 1I2CA 4LV8B 4NCJA 2KM1A 3L4BC 3LBNA 1IY2A 1NN3A 2A2ZA 1Z0AA 5AK6A 1N5LA 2OFPA 3DP7A 1E3TA 1BN6A 4N9QA 2WIFA 1P61B 4RHYA 1IHYA 3FYSA 5GONB 5GV7A 1RXWA 1VECA 5IC5A 3ZD6A 3BWBA 3MWJA 5EQFA 2C2MA 2FB9A 3SX4A 1QKJA 2A7QA 5FIUA 3J7AC 1Q2UA 3KVYA 4TTTS 3AR9A 3SDBA 1J2UA 2R79A 1PT8A 3TVYA 4F8JA 1N32B 5ELOA 4MDHA 3ETHA 3A8TA 4DXDA 1FDVA 1W36B 3TMKA 4NE9A 4D3SA 1UKCA 3CMMA 4EYKA 1EP1B 3S1AB 1YR7A 2D1SA 3IPLA 4EKNB 1ZQ1A 4A0FA 1R4MB 2X8JB 4RXUA 5H68A 4D0RA 1XK7A 4CLOB 2O0JA 1JHOA 1Z6AA 4DW8A 1S6YA 1E64A 1O89A 4Y0NA 4XDHA 3NJRA 1OHHD 2VAXA 2F90A 2X5JO 3W8EA 3W5DA 4G63A 1QC5A 5HEKA 1U28A 1WUTA 2I6UA 1R0SA 2FPOA 2HJ9A 1N0HA 2I4RA 2ORED 2RGEA 3QOXA 1U1DA 3BXZA 1GPKA 3DEHA 4Q1FA 5C1PA 4KWHA 1Z8NA 4BE9A 2AUTA 1PR6A 1U81A 2VZ0A 3WB1A 3AY7A 2PX0A 1X6VA 5G3YA 2XHZA 1SK9A 1GAEO 1YL5A 4C89A 4EKDA 4B09A 1JHDA 4TLBA 1C3OB 2H29A 3Q1LA 2O57A 3OJEA 3PBKA 5EZYF 2BMAA 2XEDA 4GBJA 1KPIA 2ZDHA 4DA0A 1C9EA 3ZIAA 1W0JD 4ECEA 4CKWA 2FMXA 2PMCA 2C78A 4D99A 3IQHX 3MYYA 4D9MA 2QP3A 2YJZA 3D2BA 2WPDD 3LWZA 3N58A 2GCEA 4AJIA 2ZB3A 4CG1A 2NO6A 2V4MA 4FHDA 2P6MA 1SCAA 1AKTA 4KR2A 1SUPA 4W9NA 5FBZA 3RRBA 4WLOA 3RTAA 5AESA 1EGMB 3EK2A 3D1LA 3MTBA 2A5FA 4M99A 2QHXA 1K4YA 4GL4A 5FO1A 5ADUS 1JDUA 4QELA 4M0EA 1SESA 1S8NA 1OTXA 2G8NA 1Z2DA 1XCOA 2DPMA 1P2VA 1MOZA 4L6AA 4PWZA 5I3ZA 1X9GA 2QAGC 1MGOA 1C0LA 4B40A 1QCDA 4HNGA 5JCXA 3OU6A 3WSWA 1HG0A 1QZXA 1U9ZA 3O8QB 3M4YA 1YR9A 4O4LB 5K0NA 5CDYA 1X54A 2VT6A 4U8HA 1PV2A 5IH3A 3JARA 1P1CA 3VR3D 2J6CA 2QI9C 3AUSA 2C9ZA 1NX6A 3QPBA 4ER0A 5CCXA 1IUPA 2F1HA 2IY9A 3H5RA 4QGFA 2I6SA 1NW5A 1VSVA 3A06A 3M89A 1RHRA 4OAOA 1WV0A 1NOJA 1WPQA 5ED4A 3GUCA 4L16A 4GLLA 5A4JA 3X1DA 2VP0A 3LE8A 5JAMA 4P4GA 3NWBA 2IIVA 3RFUA 3AETB 3VSEA 4BNNA 2RHGB 2PJDA 3HYCA 3GV0A 4A6PA 3LT2A 4Q7MB 1CQJA 3EYAA 3VHXA 3NETA 1Y9JA 3PLRA 1VMEA 1EJBA 3D6TB 3MT8A 3NC1C 1F0KA 1I32A 3RV3A 5IANA 3WZLA 1DIBA 1AH2A 4QBFA 1F2UB 2ZSBA 2NPIA 3OLZA 2EYQA 3UAZA 5F2KA 4KL8S 2O8CA 2UYHA 3FFBA 2ZVJA 3QHAA 4DIMA 2E4AA 4QQKA 3EQ7A 1WLSA 4G5RA 4LCJA 4TTJA 2FMFA 1FNCA 1NF2A 1S2LA 2EKDA 3G23A 4I81A 3BJMA 3REOA 3RHFA 1FYDA 5KKCA 1G6Q1 2RKWA 2O07A 2G1AA 4EY3A 1FP7A 2BFNA 5C3UA 4C7XA 5J23A 1G8FA 3MSXA 4YLEA 5GONF 1A5ZA 2VK2A 1XMJA 1IG0A 3LBYA 3REQA 2BMVA 4EQZA 3I61A 1ND5A 1P44A 1SMKA 3H2YA 3DWGA 2GSWA 1VMDA 1MJFA 2Q9UA 1DGQA 1NBWB 2B6HA 1M34E 4NJMB 2V4ZA 3AL0C 3WYCA 1V8OA 5AHKA 4AN4A 4BMXA 3O90A 1NW3A 4LZJA 2X42A 2VF4X 5B7PA 4QGSA 1PZFA 1BEZA 2QSZA 4ISBA 1Q7EA 3G8AA 2XDQA 3EGVA 4TXNA 4YDSA 3ICWA 3SJ7A 4CCSA 2A1TR 5IKPA 5CEEA 1Q95A 1ITZA 1DBVO 2H1OA 1OFUX 1TIPA 3E4CA 1MIOB 1PDWA 3TB6A 5I5EA 1LPPA 1H0SA 3EQ8A 1P31A 4URZR 3VZSA 4B3XA 2EGUA 1XE3A 1XVAA 4LE1A 1E3EA 2ZSFA 2XCSB 2H4XA 3LTNC 1CQIB 1QQ6A 3C39A 3P0EA 4Q48A 2BR5A 3E7FA 1E4EB 1XGKA 2H8GA 2EHJA 3IA7A 3RAJA 4PX3A 1BX3A 1QUFA 2QTGA 4XQGA 3QZUA 3Q41A 2GCNA 1KAEA 1CS4C 3EMBA 1YR8A 5D00A 4IIYA 1U3DA 5CB4B 1TFRA 5DVZA 2ZSDA 1FY2A 3DT9A 2GAJA 2JFYA 3K94A 4GNRA 4EL0A 1RPAA 2XUDA 5LA6B 2PS1A 4FCWA 3MGKA 2ZE5A 1Y9DA 2WTUA 4F3TA 3PXGA 1B14A 2EKZA 2EJWA 1DO2A 3T7SA 1KYZA 2AEMA 2QJTA 3U4HA 2EU8A 2VUHB 4N41A 1QYIA 4HNSA 5AOVA 3SHVA 1OTYA 2I6FA 4QVGA 4YCNA 3SX0A 4B9AA 4ALNA 1TKRA 4P3KA 5GWXA 2CFTA 4B3RB 3LFUA 4GSLA 4MQFB 2R65A 3FYUC 4A2PA 2YC4C 4FK8A 1U5CA 3WDMA 1DJMA 1YDFA 2QTNA 3LW8A 3NOQA 4MVJD 4NENB 2B8JA 2HIGA 5HZHA 3AKZA 3BWMA 5DJ5A 3UT0A 3GJXC 1P2TA 1QRRA 3GLHA 5ABPA 4RELA 4PZ9A 1MGPA 1Z0DA 2ZQYA 4ON9A 1JDZA 2ODPA 5KJCA 4QE3A 3L6RA 1SCIA 5LP6C 3TPCA 4CIXA 3FHTA 4O4LF 1I2MA 1PUXA 1ARZA 1IBCA 4EHJA 2A9VA 4NSNA 4ZMBA 5CDTA 5AW7A 4OMCA 5IRCD 4KMSA 3MS2A 4FNGA 3UK7A 5K2MA 1ZUNB 2Q8QA 1QZTA 3HMKA 3K9CA 3PE6A 3PL5A 3LC1O 1M7GA 1NJ5A 3EOAI 1XTRA 1JAZA 3UJ3X 3PJFA 4XGIA 4D3ZA 1RD4A 4L8YA 4U2KA 3RIRA 4WJKB 4Z2AA 5D85A 3ZGLA 5I7UA 4UJ3A 3ZDFA 4Z4GA 5K4AA 1QANA 2ZPAA 1U1CA 1XZIA 2IUYA 1A8IA 1FS4A 4B4KA 5J43A 1OZHA 2YJ4A 3MAAC 5DLQC 5EWMA 1C3XA 1LNQA 2ZZKA 3QKTA 2FWBA 3BMXA 4EG6A 3TLZA 1CHNA 2FAXA 1OLOA 3E9YA 5EAIA 4Z9YA 1MC5A 1RFGE 1L5RA 2PMWB 5HMMA 5TSDA 1WX1A 4B4WA 1QWSA 3EDOA 1N0IA 5CA1F 5CFPA 4RTQA 1E18A 3C5VA 3D0RA 4LY9A 4RXTA 4WZAA 3U1TA 3W8NA 1WL8A 2V98A 3ND8A 4FWBA 5ALTA 4BFTA 4HNVA 5I6DA 3Q8KA 4TKVA 4V0OA 1M1UA 3H2BA 3T3PB 3ZG6A 1L8QA 3DV0A 3NUQA 3UM9A 5KAPA 4ZKEA 1YGYA 2ZKLA 3ZCPA 4JUBA 3PX3A 5MFPA 1S9DA 3HZOA 1SM4A 1Z0JA 4NCKA 3VU0A 4C6SA 1FTSA 2RI1A 1V71A 1W75A 1R66A 3PGVA 2YJ6A 5EMMA 4ZQFA 1SJ9A 2ZJ2A 3VSBA 16PKA 1JIXA 3NBFA 1XXHB 2FE1A 1BRTA 4B2YA 3HHPA 4EB8A 1XTQA 3C8DA 3R6LA 4MRRA 5DKFA 1BX1A 3WHIA 5KNCD 3X43A 2ZR7A 1C4KA 1LDGA 2Z09A 1NI3A 3AU9A 3II6X 3LXRA 5AO9A 2ZITA 1USIA 1VL6A 2BR4A 5CB8A 1JSLA 1OGYA 3OZVA 2XUPA 4FZVA 4WK4B 5EJ4A 3RUEA 1ODFA 4FOOA 2A5JA 3QEAZ 3E48A 3HNOA 3AEQA 1JV2B 5G40A 3EA0A 2ZUFA 1L1EA 3ADKA 3AR3A 5D51S 5ALLA 1YZFA 4BQPA 1TAQA 4IVNA 3RS5A 4HX5A 1UDAA 1DUSA 3EMVA 3M9LA 5CYOA 3DM5A 1F8UA 1R1DA 1SEPA 4TXHA 3ICAA 3EY9A 3GBPA 2IYSA 1XCPA 2PJUA 4UVEA 1MH1A 5CVJA 1C1HA 1E9AA 1G20E 1XTTA 4FD2A 5C34B 2F3PA 1JQLB 3AIOA 3KQMA 1UBMS 4LY6A 1DKQA 2YZKA 3F7MA 3GDHA 1GZ6A 4JQZA 4L9RA 3T4PA 4H7FA 3DVSX 3ZXYA 3GF4A 3TQOA 1UBHS 3N59A 3L4GA 4XQ0A 4F86A 3QJYA 4FGUA 5CB4F 1XA3A 1JG7A 1OXUA 2IHVA 4QHSA 3ZDEA 3FFXA 4R6XA 4R1UA 1YR3A 5LA6F 1E1LA 2G5TA 3L6CA 3PPXA 4J7CA 3UT5B 4B79A 4EY8A 3QOWA 3OE7D 4G1MB 5FV4A 5AJUA 1T5DX 1ZRHA 4MS4A 2I6TA 1VXOA 3BYZA 4W8GA 4RLSA 1EX7A 2C5LA 3WWEA 2W98A 1AUOA 4K1LA 4LTMA 3T3HA 4KTVE 1JJCB 1CQPA 3TEHB 1SVOA 1KFKB 1UPTA 2G4CA 1KAQA 3CF2A 3HB0A 4OOFA 1JQ5A 1XEXA 3FNIA 4QNNA 5THXA 3TTYA 3IEPA 2JAQA 3RPEA 2FRXA 3AINA 3DE2X 2PMKA 1F60A 1BIFA 2A78A 2LGJA 2JEOA 5IZCA 3QWAA 3TQRA 1IAVA 4JYBA 2F1KA 4JOCA 2EOAA 5BW4A 5KSOA 2RCYA 3OWOA 4DLTA 4MMZB 2FQXA 2I29A 3ND9A 3OIVA 4JXZA 4U7JA 3RK1A 4HQFA 3LHSA 4UTRA 1YS1X 1ZC3A 1C0EA 3ZEAA 3V7SA 1DC3A 3BG5A 4OQLA 3W8RA 3JATA 4AROA 2JEZA 5GIPE 4F84A 2WDZA 1E5LA 4MO9A 4L0MA 1ZN7A 2DSTA 3BS4A 2REBA 4D9JA 3FIUA 4Y7DA 4CKCA 4WLFA 3ZH2A 3ER6A 1JLLA 4RA9A 3DKKA 5J5VA 1TIBA 4FVTA 1GFSA 4DSZA 1CEYA 2UZ4A 4R1TA 3SLGA 3PVZA 3T38A 1YT5A 1P39A 1W6UA 4P7BA 4BOYA 4EDHA 2V7UA 4I1PA 2PPVA 4LC9A 3JQGB 3M0EA 2G28A 4H2DA 4QFMA 3W06A 2XDYA 1D2NA 1WA5A 3FAZA 3NM6B 2YFHA 1U0LA 2WVJA 4BPRA 1VE6A 3W5BA 2VPTA 4FE3A 4US1R 3VPGA 1MR3F 3ZR4B 6REQA 1SC3A 3M5CA 2IVZA 1TE2A 3L4BA 5CXUA 3VYWA 4DQKA 3DLHA 3D8NA 3C6XA 1U3CA 1NUSA 3BMNA 2IU6A 3PUZA 4DDWA 1E6CA 5C37A 4J6FA 4Q18A 3TSYA 3A0UA 4MR8B 1G38A 1JKMA 1Q19A 1UFKA 3L1AA 4ALMA 3CEAA 2E1HA 2QLLA 2OZLA 9ABPA 5LJLA 2JJ1D 3WAGA 2Q5IA 2WUWE 3G1TA 4CNBA 3LU1A 1HEYA 1N2SA 3KETA 1Q2XA 1ZYUA 3CCFA 1XXLA 3GQBB 3JQDA 3L7NA 4PZ0A 4IEFB 2H2DA 2FY8A 2JJ2D 5KNBH 1WHSA 3WLEA 1EVZA 2UVPA 4E08A 1U0GA 3DEFA 5ER6A 3E9EA 5DP1A 1CQZA 5EEHA 1BCSA 2VCHA 1OBVA 1PHRA 2COUA 4YIKA 4OHYA 2VH1A 2XYQA 3HVKA 1BDIA 2A0XA 5CLLA 3D2LA 3W7BA 4X60A 4M1ZA 3X1JA 4BO2A 1ZOLA 2JIPA 3EUWA 3O74A 3U3KA 3WJ1A 1A5SB 4HB4A 3THYA 5LDGA 1JIJA 4NG4A 4QA9A 1DPFA 2QRVA 1EHCA 3NHRA 1OC4A 4QRHA 3WYBA 3HM9A 2GRUA 1PG5A 2W6IA 3AEZA 4GX5A 2YFQA 4AMUA 3CINA 3ZWNA 2JFBA 1TUBB 4RM3A 1PLLA 2KYRA 1QOPB 1P7YA 2HOQA 2JGEA 2FNAA 3KEGA 3R5XA 4E1VA 1P7ZA 3ILSA 5HK8A 4HXEB 4KBFA 3OMLA 3QYJA 4GWKA 1XEFA 3O75A 4BX9A 5B57C 3GMTA 3P0JA 3N1UA 2R6AA 4EG1A 2AN3A 3HBMA 2IKSA 2IPMA 5TJHA 1T2AA 1JJVA 1S0UA 3UV3A 4JSRA 4ZXFA 2W6ZA 3WMGA 2WMNB 3U3JA 1N3YA 2OXEA 3U3OA 1U0FA 2WIKA 2Q5FA 2E64A 3K6RA 3UC5A 4HLQB 3ED5A 2J46A 1U9JA 1EMDA 3G5TA 1A7AA 1R9NA 3RU7A 4BEBA 4DMCA 2ZINA 4XYMA 5AW9A 4F9FA 2PT6A 1AHHA 3U7EB 1UPBA 1WIWA 1ZNYA 3H04A 4RX1A 1DCMA 3BL6A 1C9JA 3L82B 3I6BA 3OPMA 4I14A 4Z9FA 5IJ9A 2QSJA 2DEQA 8ADHA 2NQ8A 1KJYA 1CERA 1COWD 3BB3A 3A4YA 2O6LA 4NMXB 2OGZA 3SZRA 5LIRA 3OA0A 3GA7A 3N6RA 4XIIA 4Z6KA 1KC3A 2F9LA 1G6KA 1W94A 2TMYA 4KV7A 5HUHA 4YK7A 5CG2A 4V0SA 5KYNA 1UM9A 2RIPA 4QU0A 2L18A 2EQBA 3AM3A 4RETA 1QR2A 3QKWA 4XTUA 1QGUA 4YJDA 4B0PA 1F1JA 5E38A 2BPOA 2VKQA 1QHHA 1Z07A 2GM4A 2H2FA 2OECA 2RGNC 2QV7A 4M9XA 2P5YA 3AFHA 3GCGA 4MPJA 5D5QA 3CNLA 3QF4B 3B52X 4TV9B 2GQ0A 4KYVA 5ENDA 5JSHA 1U9IC 1X7WA 1BD4A 2BHTA 2VNSA 3INGA 1A27A 3KXDA 3NBAA 1KO8A 1CFJA 3IAM6 4JXKA 1M54A 3E0QA 2YRXA 3O31A 2Y0PA 1YS9A 4TN5A 3HZHA 1M1NA 3RYIA 1NJSA 3S2EA 5K20A 4NOJA 3GMSA 2PL5A 2Q1TA 3KLPX 2A35A 3BGIA 1XRPA 3ONWA 4LSMA 1GFWA 4GKAA 1T5LA 3ZY6A 4YMLA 5HYVA 1EJ2A 1U6KA 2WD7A 2HK7A 4MUFA 2C3MA 2XX3A 1F2TA 2W9XA 3H9QA 4GUAA 4I66A 2XDAA 3ESXA 4UBMA 4UNPA 4FT4A 3ABZA 4ZRMA 2GNPA 2MSKA 3H0KA 2ZOSA 3IAUA 4KB5A 4KRGA 3D6FA 3UCFA 2OEPA 3VPXA 5LQDA 2Q45A 4M88A 3A4MA 2N1MA 2HR1A 5C8VA 2ARKA 4DLSA 3HN6A 1NTRA 4R1OA 5DXFA 1F48A 4W5RA 3WNCA 1QGED 2FFQA 2B4AA 3O2JA 7REQA 3KUUA 4URYR 1RXYA 1TUEA 5JT1A 5F23A 2GA8A 4G2NA 1A8SA 3SQLA 3TM5A 2LTAA 4E94A 3CYFA 4HAYA 4AKTA 2GD6A 1QIDA 2IHNA 4LZLA 2XB4A 2JEYA 2RDMA 4UU0A 3S2SA 3H99A 4NF2A 4XE5A 1KFEB 2FRVA 1DP4A 3C3BA 4CH5A 4UULA 1OHHA 4TZTA 4XFJA 2W22A 1DJNA 2CJPA 3KXIA 3Q2KA 2I1WA 4QZVA 3GG9A 1HLPA 5JI3E 4I1VA 3A4NA 5JJLA 4EPWA 1AQUA 1OX6A 4KYIB 1GPLA 1MAHA 4KO3S 3M3DA 1NQXA 5KYWB 3C5CA 1FZTA 2Q3HA 3HO6A 3RAPR 1EGQA 1D6NA 1S1MA 1ZXXA 2DQ0A 3AZOA 2XXAB 3Q9SA 3GT4A 2WBLC 3IAS1 1MKYA 3OM9A 5CR9A 1J2JA 4C7VA 4DS3A 1T29A 1B93A 1EK1A 4JYZA 4REOA 5TPWA 2OBYA 3NC4A 4M1KA 3ZCUA 1EFHA 2IPXA 4C01A 3T1TA 2ZRBA 4ZZ2A 3LK7A 3AVVA 5I01A 1ESZA 1W0JA 2O1XA 4G0ZA 2YWRA 3SQOA 2JIBA 3QWIA 4FGJA 5AJTA 3I9FA 2VJPA 3DBRB 3M6WA 2HK9A 2WDPA 3OOYA 4DLKA 1V96A 4LXQA 4P83A 4CG3A 3ITEA 4HFJA 2WPDA 4QQRA 4RJ2A 5BV1A 3ZJYA 3Q8MA 2VAWA 3KHSA 4DQ0A 3KFLA 2WHQA 2GF9A 2FWIA 4NBRA 4TRMA 4KPYA 4UQLA 3GLIB 2X9LA 2EYUA 4EUFA 5G41A 5DI3B 2GPBA 4S2EA 3TR0A 1B26A 1LBIA 2FN7A 3DWEX 5LL6P 4BO8A 1JVSA 1MQAA 3IODA 4C1BA 2G9VA 4NX2A 4C1NA 1W48A 1AQLA 1CZLA 3DWIA 4CL8A 2ZI7A