1GHFL

Anti-anti-idiotype gh1002 fab fragment
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
211
structure length
211
Chain Sequence
b'DIQMTQTTSSLSASLGDRVTISCRESQDISNSLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGTGTDYSLTISNLEQEDFATYFCQQGNTLPYTFGGGTKLEIKRADAAQTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-ANTI-IDIOTYPE GH1002 FAB FRAGMENT
molecule tags Antibody fab fragment
publication title Crystal structure of an anti-anti-idiotype shows it to be self-complementary.
pubmed doi rcsb
total genus 42
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 1995-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ghfL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ghfL01
1OTUD 2E7MA 4JCLA 4QRTB 3BXNB 1JHLL 3FMGL 5MEND 5MENA 4QRPE 4U1IB 1RZKC 4S2SB 2W0FA 4X6CF 3FL7A 4YPJA 2D4DA 5IK3A 1M6OA 1I75A 4JM2A 3MXVH 3WFCL 1XCQA 4OV6F 3WHXA 4L4VA 4OFKA 4KJQC 4UI2A 4YDVA 5B38G 3KLAA 4WGWB 2X1OA 1JNHB 2I5YH 4RBPK 4H8WH 4Y1AB 2Y23A 3K80A 1F2QA 3IYLW 3GO1L 5CP7A 5GJSH 4UU9A 5E5MA 3RNQA 5T3XL 5TFSH 3ABZA 4LOUC 1YMMD 3ECBB 4NJAL 4Z7UA 4ZNEA 1JHLH 2ITCA 3EYOA 2OL3H 4Z18A 5IK3B 3RDTD 2CKNA 3S37X 4KROD 1KEGH 4DKDC 3ZL4H 1E4WL 2CLZB 4S1QL 4YXLH 1P69B 2IBGA 1IT9L 1KIRA 1LDPL 5IVZA 5TDPA 1MI5E 4RMSA 4GG8A 3UZVB 4DEPC 5IW6B 3ZDZE 4YPGB 2Z31C 1CIDA 3F7YB 4XI5C 2FSEB 3JUYA 1MHPL 1RURH 1AFVH 2IF7A 2WUCL 4ZOAA 2BJML 1K4DB 4TRPH 1D5XB 1ZKAA 3OR6A 5CEZL 1XH3A 1ONQA 2DQIL 5BRZE 2VXQL 2FDBP 2XZCH 3HNVH 1UJ3B 5CD3B 1MFNA 2IAMD 1VB9A 2Y6SC 1FDLH 5FHAH 5I8EA 1JZ8A 5KVMC 4Z0XB 1J5OL 4DN4H 2B39A 2XA8H 43CAB 3P0VL 2P49B 5E2UH 4OZIF 4P48A 2P8LA 5D5ME 3SDCB 1QSEE 3VXUA 4N8PA 4O2EB 1GOGA 4HJ0C 3UYPA 3LQMA 1ZOXA 1U42A 1X5HA 2P44B 5C0FA 2EKSA 3OHXA 2PYFA 3GEWB 4RFOH 4U7SA 3VGHA 4I0PC 5INDA 3MLZL 3WFCH 1NH6A 3EYUH 5GZOC 4JFXA 2HJFB 1KSRA 4YHPB 4H1LA 3GFUA 4ZUSB 1JPSH 5HHPB 2ZCHH 2VE6B 2LU3A 3ARTA 4Z95L 2QJDA 4YZFE 1MHCB 4NKOB 3UTQA 2PW2B 3ILPB 1UM5L 5CKGA 5IMLA 3P4OB 1KFAH 4PGEB 4YHKL 5FGCE 4OZHA 2H1PL 5FYLD 1IEBA 3MV7A 3T0EB 2ZG2A 4PTUB 3QCUH 3QJFA 5CBEA 2X9YA 3PJSB 2ORBL 5E8NB 5CZVH 5I1HL 3IGAA 4IDLA 3ZKND 1I8IB 2WP3T 3ZE2E 1MI5B 3QIUB 1ES0A 2XNAA 4BFBD 1LK2B 3PHQA 4Y4FB 4IMKC 4J8RA 2X1PA 1HQ4B 1G9MH 1YY9C 4OCMC 2BFVL 1P7KA 2BY0A 2YK1H 1W0VA 3MLZH 3TYGH 4ZD3L 2J8HA 3EDFA 2AKRB 4ZDHA 3FOLB 1N59A 4U1SA 2HFGH 4JO3L 1EEUA 1A4JA 1FL5A 4JFQA 3SE8L 3U83A 1KTLB 2ITDB 1IAOB 3I3DA 4FQHA 3VRIB 5BO1H 4MD5B 1F02I 3QUXC 4ORGA 4I4WB 5F6IB 1WBYA 1AY1H 3QIWD 4APQC 2Y9RT 1QRNB 1W0VB 1MRDH 2OP4L 3JV6B 1W0WA 5JO5A 4PJEB 1RZ8A 4YC2B 4WW2F 1VGKB 3QFJA 4U6XB 3Q5YA 1N7MH 2OJEB 1HIML 3HE7D 4XHJD 4JN2A 4LCYB 4MNGA 2BVQA 4IM8A 3FO0L 3U36B 3TV3L 3MX0A 4P3CL 5DD6B 1H8OA 3SE8H 4D8PA 4QNPF 4Z9KB 3Q6FB 3QG6A 5ESVB 5C9JA 2YKLL 4F9PC 3LN5A 2OJZL 4K94L 2IANA 3QXTA 5EUKA 5T5FL 2EE9A 1JWUA 3PDOB 5IIEB 4ZUVA 2R23A 2AI0L 4AIZA 3OKYA 4P23C 4XP6H 3BZFB 3MRLA 1ZHLB 1OSZA 2GY7B 1K3ZA 4NZDA 3SGDH 1PEZA 1RZ7L 3TM6A 2EDDA 4PRBA 1Q9KA 1WT5C 1S9XA 2YC1A 1KTKE 3JVGA 2HA1A 1T3FA 2IBZX 2VZ1A 3GIZH 4TQEH 3QCUL 3RHWK 1AC6A 4GXUN 4L8BB 4HGMA 4P2RA 5J7CC 5TF0A 2HFTA 3DHMA 3T8XB 2CUMA 1ZVSA 2LE9A 3RGVC 3V0WH 1U3YA 3VJ6A 2DOCA 1U58A 4KJWC 4TTDD 5KSBA 4M7JL 4PJDA 2BHYA 4PRPD 3RWIA 3ARGB 4DGYH 2XWJB 3C60A 3V6ZA 5FA3A 1LE9B 5J13C 4WFHD 5K9KB 4Z6AT 5F8QC 3SCMB 3QQ9C 4LPCA 1RAMA 4M7ZB 4JM2C 4XNQB 1KPUA 4PJIA 1QLFA 1HYSD 4QF1A 3EYSH 3MLYL 1KB5B 2VXTL 2F53B 2DQCH 1O7VA 3ROOA 2F19H 2HLFD 3BE1L 1P5VA 3JWDL 4P5TB 4C54A 2WWMD 4JFEE 4LDLB 5EUOE 5GGRA 3DX7B 5C0GB 2APTA 3ARGC 4PJFF 4IIQC 1I7RB 1MHCA 4JRYB 1SEBB 3KPRB 2J5LC 4LP4A 4K3DH 1FORH 4CN4A 3BP6A 4GUPA 4JFDD 5IT2H 3OKDB 3G5VB 2XXMB 5C86A 3WFHB 4WTXA 1X5FA 2QADB 4DFIA 2B2XL 3UTTA 4QKXB 2BNRA 3ULUF 1MFDH 2PXYB 4N1EA 1ERNA 2VQUA 3TBVA 3PXJA 3VGBA 3IAPA 4RWYH 5IBUB 2R1YA 4JO2L 5CHNA 1G0YR 4URTB 2DTMH 3CDGA 2F15A 1KB5L 1NGXB 1Z9OA 3FQWA 2YUXA 4P46B 3LQAH 4JG1H 1WAAA 3D2UD 5KZCD 2W59A 3EOTH 3F7PC 3OGCA 2VWEC 4B7IA 1TETH 2DJUA 1YNTA 3RGVB 3BP6B 3TESA 3ARBD 2ITDA 4GKOA 1CXIA 2AJVL 5K9OA 1MY7A 2MFNA 4Y2OA 5FYKH 3VD4A 3BO8B 1YQ2A 1IC5H 3EZJB 1FORL 3MLWH 1F97A 1Q0XL 3T2NH 4BSVA 4F7MA 3CAFA 1MH5A 1OP3K 2G60H 4NPYB 2Q76A 4ODWA 5LAXA 3MRGB 2RCSL 2VIRB 2XFXB 1A3LL 1FZJA 5DJDB 5HHOA 5DRWB 3FO9A 3K4ZA 3ARBA 3CFKB 4DUVA 4DVBA 5CUSH 1JVKA 1QR1B 3FCTA 1EEYB 1D5ZB 3D87B 2VSDA 3HE7A 3O9WB 2WINB 3U4AA 4ONHA 5K9KA 4JKPL 3CVHA 4FFYL 4ODSL 2DM2A 4IRJC 4K3EL 4UNVA 1UGNA 1EHLL 5INCA 3S5LB 1M05A 1FZJB 2VDOH 2DQCL 5HGDA 4KRPD 3M8OH 2NY1D 1FYHB 2H6PA 1J8HB 5CJBA 5H37H 5DHYA 3C60D 4KKLD 2UZIH 1AKJD 4KVCH 3QFDA 4KTEL 5GS0H 4KI5C 3NH7H 4NZTL 2P5ED 3VD7A 1UWEL 3F5WB 3GBNH 3FZUC 5FKPB 4PJCF 1TXKA 4NZRL 2NNAA 5DEGA 3WSQH 1S9XB 3L3GB 1NEZA 2WLYA 2GJ6D 3QO1B 3DVNA 1RIHH 2C3GA 1XAUA 4ALAH 3MV7E 5ICYA 4L4TE 1MEXL 2EYRA 4FQQA 1AKJA 5DC4B 1ZGLB 4ODSH 1AGDA 1EO5A 3PDGA 4QY8A 4NIKB 3CVHL 1OP5K 2VDQH 1A3RH 4BA8A 4UB0H 1JL8A 1UB5B 3RAJL 1YEHH 3MODH 1VFAB 1FPTH 1ORQA 4U31A 3AAZA 3VFUB 4GAJL 3QWOB 1U8LB 4XPHL 4OGYH 4LCUB 5GS0L 3WIFA 3TN0A 2B20A 4OIIL 5T1DH 3WS6A 5IJKA 1DBML 5I6XB 3Q0HA 1P4IH 3DIFB 1FCGA 5IBTH 3W11D 4OV5A 1FFPB 1OWRM 4PRAB 1IMHC 2DQHH 1MEXH 5GS2D 4K8RL 4PGDA 5C6WH 4PJDE 1I8MB 5B39G 4Q0XL 5IF0A 2D9QB 1B0RA 4JPIA 5GRJL 5FCUH 3QO0B 3HR5A 1AD0A 3BKJL 1EFXD 5DJ2A 2VLRB 5FK9A 1D5ZA 4FFYH 4I3GA 4HK3J 4BQ8A 3C6SA 1FL6B 2QSTA 4FFZH 1YC8A 3QI9C 4F80A 1TVHB 4R96A 3BKYL 1FC2D 3RRQA 3STLB 3BGFB 3JWOL 4QCIB 2K7QA 4PJ9A 3M8OL 4JFZH 3PE9A 1P4IL 3TYFB 2A6KB 5I76A 4XCNA 5L2KB 4POYA 1LDSA 1GOFA 4MAYB 3OX8A 1BQHB 3E6FA 1L6XA 5I75B 3U7YL 5IMLB 1YNTB 3W11C 3I6LD 1OT2A 2RIKA 4ISVB 4LLDB 1F4AA 1YN7B 5ICXA 5C0CE 4P46A 4GXVL 3PWVB 1U95A 1GH7A 2KKQA 4K7PL 4P2QA 4OBRA 4YHIA 3QULB 4BQ9A 3IDGA 5DYOB 4PS4H 3D48R 5D6DC 1EXUA 1NCBH 3IFLH 1H5BC 2C3WA 5HJ3B 5C0AE 1FZOB 3SO3C 1P4BH 3EJYC 4PJHE 4JRYE 4P46D 5CSZB 3SDYL 3KYNB 5JIPA 3MUY1 5EU7C 4KK8C 1BQSA 1YEJH 3W9EB 4Y5XB 2FGWL 1G7QA 3L5XH 3S3PA 3D5OF 2F53E 1S7TA 1QR1A 1MRFH 4YIQA 1NLBL 4E9LA 4EZMA 4D0BA 4C56D 4O2FB 4MB4A 3MR9B 1MCKA 3O4LE 1U6AL 5I9QC 1B90A 4M93C 3LKNA 4DTGL 1UEMA 2HTKD 4FOMA 4F58H 3C5ZA 2R0WL 3WD5L 4GG8B 2AEWA 2R2CA 3DV6B 5SWZD 3VFNB 1VSCA 4OF7A 1IGJA 5EC2B 4OGZA 4JLRA 1MHEA 3NN8A 3O6FC 4HXBL 4JY6A 3DO3A 3C2SA 3BYYA 4BUHA 3U4BL 1MAKA 4GKSB 2E27L 5HI5C 1B4JL 1G6RA 2P5EB 4L4TA 4XNUL 1DVFB 5B39B 5GGQH 1TPXB 5JPMB 2FR4A 1CICA 4OFDA 3F7QA 3MA7A 4KMTH 4JLRB 4HG4K 1XGRB 3U9PL 1OPGL 5I1AB 1ZEAH 2YC1B 4F15C 4KRLB 4NNXB 1LEIA 3RWHA 2V9TA 5ESAA 3LB6C 4I3SL 5DWUL 3SY0A 1V7NL 3KLAB 2H9GB 3OKNA 2JJUA 4NQVA 3ARBC 2B1AL 4WO4C 2G5BB 3FT4A 3IXAB 4RA0C 2I60L 3ESVF 3SO3B 1CD8A 4NGHL 3KYOA 3MMEA 1MIEH 3IU4L 5IP4A 2ADGA 5EZJA 2I9TB 1LNUB 3SKMB 2QKIB 3OG6B 1T2XA 4H88H 1CQYA 2XACC 1FO0A 4OSUH 1JGUL 1LQSR 5TQ0H 2XY2A 4EQ2A 1MLBA 3FQUB 4CAGA 4ZOCA 1Z0MA 2YMXL 2VAJA 2ZCHL 2F58H 2R4SL 2BCKB 5I74B 3GZKA 3NPSB 4QTHB 1T6WA 4M93B 5DI8A 5CGYC 4P4KB 5I8EB 4YDJA 1BGXL 5I1IH 5KZCB 5C2UB 5DURD 4DZ8B 3I6GA 2H1PH 4V2BA 4PRPB 3DYPA 1P7KB 5DFWH 2MMXA 3VCLB 1AHWC 2JKXA 1YJDC 2X4OA 3BH8B 4ETYA 2PTUA 4J8RB 5IVXE 5JW4N 4JFYB 1JYWA 1VACA 2EDBA 5T1KA 5ICZB 5IM7B 5E2WH 1CL7H 5GGSY 15C8H 1QVOA 5TQ0L 3PHOA 4XVUC 4O9HH 4JFED 1JV5B 1ZT4A 2MPAL 4X6EA 4PV9B 2H8PA 2SEBB 3D18A 1ZS8B 3VWKC 3K4AA 3VWJA 4EBQL 5BO1L 4BH8A 5DZLA 4PJBB 1AHWB 2AABH 2A6IB 2XPGB 4WWKA 5ANME 2F53D 3FB5B 3MV8A 4C55A 1J8HD 5D70L 4HGWA 4Z95H 4U6YA 3O9WC 3X3FH 5JXED 2XTLA 4HS3A 4YHIB 3RPKA 3VA6A 1IAKB 4K7PY 4LHQB 1RK0A 4MD0A 4YHKH 1F3JB 3MUGA 1GXEA 4LCYA 4MNGB 3SGJC 4X4YA 3S35X 3WS3A 2V6HA 2J8UE 5CZVL 3BUYB 4OCXH 5F3HB 5F9OH 3BP7A 3MA9H 4PJIB 4R8WL 1Q94B 1JBJA 5L2JA 2CO7B 5T5NG 4PJIE 1ACYL 1T7YA 4U1GC 5GGVY 3H42L 1RD6A 2GQHA 4KK6D 4QRPD 5ACZB 3PUCA 1U3HA 4PREB 4RX4D 4FQIL 1QTYT 3VXMA 4D94A 3BGMB 2E6QA 2IFGA 2VDRL 5FB8A 1BEYH 3I6KB 3EJZC 4E5XA 4YDIL 4PRIE 3TN0D 4LSVH 2VO5A 4GRWF 4IDJL 4KJYB 5SX4I 1NCDL 2DYPB 2CSPA 1KT2B 5EH1A 1A7PH 1CCZA 4RCAA 1YPZB 4H8WC 4Z7QE 3BJLA 3ZTNH 3JV4A 1LO0L 5K9QG 4FABL 2XOTA 3ZMRA 3DVIA 5FOBB 5MENE 2OTPA 1CTOA 3QIWC 4APQD 3EOAA 1KJMB 2BY3A 5B38B 3L3GA 4NC0B 2PR4L 4XZUB 3ZDXE 5I8OL 3SY0B 1TQCC 4GKNB 4J3XA 4XH2A 2CIKA 4OLYL 1U8JB 2VH5H 2JJTA 5MEOA 1FFQA 43C9A 3OB0H 1MFCH 2ZZUT 4ORZC 2IFFL 4IDJH 4LSSH 4CN1A 1F4XH 1GGCH 1N64L 1IGYA 1YEIL 4HT1H 1UB5A 4FTVB 3OZ9H 1HEZB 3FQNA 1JPGA 3KGRA 2YHGA 5IROA 3ZKNC 5EIIA 2X4SA 5KTEL 3H0TA 1J1OL 3CFKA 1IL1A 3BQUB 3P9LB 4YGAB 1HQRB 2DQGL 1RZGB 4PRBB 4AIOA 1SY6L 3IAGC 3RTQA 3RVVC 2ICES 5I8OH 3MCKA 5DS8A 1A6WL 2CPCA 4NO5A 5CJQL 7FABL 4P5KB 5MERA 2LAAA 1A47A 2IAMB 2Q20A 3A0OA 4UUJA 2CKBA 4YXKL 1A7OL 1HHJA 3PWJA 4YDLB 5D7SH 1QLEL 1RJYA 4K7PX 1MCRA 4M7JH 3S8WA 4N0YH 4NHUB 4KZDH 3OR7A 5D7IB 2VC2L 1X5IA 5DRZA 4ONOA 2IQ9H 3VFMA 1CTNA 3BN9C 1HHGA 2AP2A 3DXAB 4G7VL 5TH2B 3S4SB 5F70A 4RSVA 3DX7A 4GRWB 3RDTA 1X44A 1EHNA 1TZIB 3QEGH 4R2GD 4LHUB 4DOHE 5HXMA 5C09A 2IAMC 2Y6SD 4DVBB 3BE1H 3S96B 4MWFB 4X6DB 2X2YA 1QEWA 1ZHKA 1RU9H 5HI3C 4AZ8A 5HYIA 3TIEB 3C87A 3VG9B 1WK0A 4WU7B 2HJKB 3RU8H 1RZFH 2XZAL 3CPLA 5IFAL 1Q9WB 5F7FA 1N0LA 4XI5D 5C08E 3QEQE 1NPUA 2B2XH 1UZ8B 2YEZB 4AENA 1NGZB 4FA8A 3DOSA 3EZ8A 2YR3A 3O4LB 2Q3AA 4EEEA 4N5ED 3OGCB 3IETB 3U48A 1PAMA 1CLZH 1ZSDA 1CBVH 4NO2A 4XBPA 4XWGL 2NY6B 1T03H 4Z0BH 1ADQL 3MV9E 3WE6B 5JOFB 2R0LH 1YEEL 3KPQB 4HD9A 3VG9C 5FKPA 3QUMA 2Z93B 4OF8A 4YDLC 3KHQA 4OLUL 3ULUH 1E4XL 3H9SA 5IJVA 2HN7A 3LKOB 5B22A 2JCCE 3B43A 4IMLA 4XPAH 4OQ1A 4TVPH 4CU7A 5J6HA 2DQDH 4XRCA 4PG2A 2WWKO 1P7HL 4XPGH 1TPXC 3FT3B 2IEPA 2FH8A 4OLZH 5IW1A 2PW1A 5BMFH 3LEVL 3CX5K 5CJ5A 4YHML 1YEGH 3SDXF 2IQ9L 2GJJA 3AREA 4LCUA 4JFDE 5KN5B 3GJEB 3ARWA 3RY4A 1TNMA 8CGTA 4AQOA 4LU5L 1S9WB 4JM4H 1S7RB 1PZ5A 1XIWA 4EVNA 5E6ID 4GKZA 5E6IA 5HHOE 5H35B 1U41A 2VUOA 3AB0C 5DRXA 4RMRA 4EN3A 4AK1A 3DSFH 3VFRB 1KLUB 1CU4H 3L3HA 1WIUA 3FN3A 4XPGL 2DBLL 3FB6A 1PG7W 3BD4A 4KROB 1MFBL 3LSOA 2NNAB 5DD3L 1D5IL 4F3FB 2J4WH 5JW3L 1KXVC 2EYTB 4L3AA 1MQKH 1I7UB 4FXKA 1DTUA 3AXLA 3LRSA 1F11B 5L2KA 1HILA 3VG0H 3W2DL 5LQBL 3LPWA 4KKCC 3TYFA 2ZUWA 4LU5H 3WXVL 3SJVB 5LGJA 2L7UA 5HHMB 1ZLSH 2ZUQB 3VFGH 3IF1A 5CIPH 4OM1H 3T3MF 5IOPA 4OIIH 3QIUC 2AJZA 5FYLH 4MAYD 4UT7H 5D7JB 2MHAB 4PTTB 2QSQA 3AY4C 4JPIB 4UNUA 4HJGB 5INCB 4LAQH 3WBDA 1IAII 1BJ1J 1GGUA 3S36H 3IDXL 5EU4A 1WGOA 3WLBA 3C08L 4G3YL 4PJEA 4PJAA 2FRGP 3MRQB 4HKJB 5HVWA 4HIEB 1BVZA 2NTFA 5J89A 1FFOB 1DEDA 2PW1B 4PRIA 3KXFB 3R8BB 3SDXA 4CBPA 4UAOB 5BZWA 2A0LC 4HIIB 3TBWB 2PO6D 1I8LA 5FOJA 3WXVH 3IF1B 3L6FA 1MFEL 1B6DA 3I2CH 4PJXE 4IRJD 4WDIB 3C5JB 3OAYK 1BVKB 5HHNB 4CN6A 2QR0A 2C1OA 2Z31B 4MQ7B 2DI7A 3D39D 4D0CA 2UWEF 4WTZA 4NN6C 4R3SA 4CMMA 4K8RD 3TCLB 2OMNA 4YAQA 2N7AA 2EDWA 2NMSA 5FGRA 4BKLA 3FOMA 3KPMA 1CICD 3E0GA 5ID1A 2GJ6E 3QAZC 2GAZB 5MEPB 3ALPA 4MNQE 5IKCA 5C08D 1QNZL 2CRIA 4X5LA 3GJFB 1G9MC 4J12A 4K2UH 2BERA 5F9WB 5L9DL 4KUCF 3D0VB 4X4YB 1CFQA 4Z8FH 2NY5L 5CJXA 2R0WH 3WD5H 3MJ7B 4S1DC 3VXPB 5EOQL 5C07E 3C5ZC 5IFJB 3Q6GH 3BGFC 2ESVA 2GT9A 1A14H 1FG2A 4HQQH 4O4YH 4ELKA 2NXYB 3IVKA 1UXWB 3DSNA 5ID0B 3WIIL 4ZUSA 1K5NB 5CD5D 3KPLB 5IF0B 5F8RC 3MV9A 1XGPA 4NKMA 1NCAL 2PTTA 2HWZL 5AZ2H 5CSBA 5A43C 2DQEH 4HC1H 1T83C 1E6OH 4KRNA 4RGOH 1XR8A 5TPWH 3U6RA 3UCRA 4ZMAT 1HHIB 3V4PH 4L8SB 4IOSD 4P3DB 1SYSA 1XF4B 1GGIH 2X4NB 4RMQA 3MACL 2OMBA 5C6TL 2A77H 4NP4L 4LSQH 5D96C 3OXRB 4ELKB 3BKCH 3T0BA 4XB8A 1MJUH 3MLSL 1GHFH 1YYMH 3EFFB 3JVGC 5DT1L 4NKQB 4Q2ZA 3H3BC 1N59B 4U1SB 4JZNB 4X98A 3WUWA 5AWNH 3SHSA 3PQYB 4I3RH 5SV3A 1J0KA 5LXGH 1CXKA 4PJ5B 4GG6E 4OFPA 4QGYA 4OD3L 5DJYA 1WZLA 4Y5VB 3UTPD 3IDNB 3MLTA 1HILB 3P9MA 2JJSC 1C5BL 2DN7A 2OL3A 2YMXH 4QHLB 3LH2L 1JRHL 1RULH 2C9AA 2F54A 4S1SL 3I6GB 2YZ1A 4YHNA 2J8UF 4AJ0A 8FABA 1CLYH 1ZLWH 3V6OE 4LPTA 5BCAA 1NC4D 3RGVD 1R24A 4R4BB 1JE6A 2XICA 1M71B 3CFDA 1MCDA 1ZEAL 4U6HB 1GCFA 1U8NB 4U33A 3RNQB 5H8DA 4OZHE 3P3YA 2A1WH 4PGBA 3SKOA 5ESVA 2AS5M 1BBJB 1QZ1A 4OZIA 3WMSA 2UZYB 2JB5H 2N7BA 1S7TB 4OZGA 2CDEA 2XPGA 1NJ9A 3MUHL 1A6AA 4LGSB 4O9HL 4F9LC 5JW4Q 2GUOA 4KQ3H 3RVWC 3IDUA 4Z7QF 3B6SA 5HHME 4OSUL 4NCDA 5I0DA 4X4ZA 2OLDA 1FIEA 4S2SA 3U0TB 3OKKA 1Z9SA 5CEZH 4OZIB 3W9DA 1HH6A 3CH1B 2Z35B 1U0QA 4KUZL 5IEHA 3SKOB 4LCIH 3VRLE 4ONFL 4U1KA 4OI9A 3EDJA 3WXWH 5BS0D 5HHXL 3O6ML 5ACLA 2FIKA 1OOAA 1SEQL 4QT5B 1BQLL 3FT2A 3QUKB 2MJWA 1ZVSB 5I16B 2H26A 3KLDA 1I7TB 5ID1B 3FTGB 4U0QB 2NLJB 3A6OA 2L4OA 5AWNL 1LVEA 4KQ3L 3VFSB 3SGKA 4ODHH 3ZT7A 3L3KA 2DBJA 4DAGL 2ZUUA 1F4YH 2A9NL 1U36A 4RAUA 1OP3H 2NCMA 2NXZB 3DGGA 3QHZL 1IQWH 1PVHA 2NXZD 1A6UL 3RIFK 5ITBH 3MXWL 3MJ6A 2YPLE 1PLGL 3LH2H 2DWEA 3E8UL 1G84A 4CL7A 3O2VH 4HS3B 1ZT1B 3NOIA 2NY2C 2E9IA 5JDJA 1N8ZA 1DBBH 4KHTH 2CIIA 3RA7L 1HOCA 1X9QA 4NKIL 2APWA 3KR3H 2HJLA 3CFBB 4KI1A 4ZPTB 5DJ2B 5ISZA 2BVEA 3DROB 3IXAA 4EOWH 1U8LA 4OD2A 4A6YL 4X7SL 3K0WA 4NQXA 3SQOL 3R06B 1AJ7H 4FQXD 2CK0L 5FAAA 5B8CC 1J0ZA 4BJLA 1LEKB 1B0GB 2BP3A 1GJIA 5GGUA 1MREL 2EKSB 3OHXB 5CEYA 4F2MB 4ZUTA 4PJAE 3MA9L 4R4ND 4MAYA 5E8DH 1YA5A 2X05A 1JZ2A 2EIEA 4GRWH 1R3JA 4P5MA 3QDGB 4JFEB 1PLGH 4JRXD 2V9RA 4ZO9A 4NFDA 4YO0B 4I0PD 4L3CA 1QLFB 5FO9A 3VRIA 3MJ9L 3IJHA 4GLRI 1IEAB 5KOMC 1RZGA 3MRPB 3CC5B 4LRNH 4M8VA 3RY6A 1O5DT 2Y06H 2FEDD 4AL8H 4LL9A 1IAMA 3ARUA 4RA3A 5K9OB 5GS1A 3R1GH 3ZO0A 2FX7L 1IAIH 5CWSB 5EO1A 1EUTA 2WK2A 2R8SH 2NY2D 5JLZA 1Q9OB 4I1NB 1T89A 4OZGF 3OAYH 4OZFA 2NXZC 2ED8A 3OAZH 4ZUVB 5EIQA 1WTGT 2YD1A 1DL7H 3FO2B 1J0HA 4U3HA 1J10A 2PXYA 4X8XA 5F88B 1VADA 4NO3B 1UEYA 4HKXB 3C5ZD 4KC3B 5IR1B 5F9JA 2QQLH 2AV7A 3Q2CA 5DR5H 4HAGA 3TJHD 3MXWH 4H0HB 4GRLA 1E28B 5GS3A 1X5LA 5BRZB 4PJIF 1NAMH 5MP6H 4XMLH 5MEOB 1F4XL 1GGCL 4U3CA 2VZSA 5C09B 3KPSE 1E4KA 4K3GA 2ZUYA 5IBLD 1S3KL 4BQ6A 3ZHKA 4HHAA 3D69B 1KN2L 4UAOC 3BH9A 4QXGL 2O5ZH 4HCRH 4XP5L 4JKWA 3JXAA 5JHDA 4EQ3A 3A67H 1BM3H 2I9LA 5F89B 4YXHL 2VIRA 2CGRL 4OKVB 1UWGL 2QQKL 3O3EB 3NCJH 3RVWD 1AD9A 1KN4L 4NC1E 4D9LH 3MRJB 1XCTB 5JW4R 5DXWA 1FRGL 3CX5J 1OP5H 3RL2B 4OQTL 4LFHG 3OSKA 4RWHA 4M6NH 3WE6A 2WUBL 3I6KA 5D2NE 3T2PA 3SOBL 1N5AB 1MCEA 3QAZB 1N6UA 2QV2A 1CLZL 4JRYA 4F7PB 4JO4L 4ODUA 3MROA 5JR1L 3HB3D 3MNWA 4Z0BL 2QSCL 5EOCH 4ZSOE 3V5DB 1A21A 2EEBA 1UM4L 4ZAKD 1KIQB 4Z7WB 3A67L 3SKNA 4JAMA 4UT6H 4HUVB 2O93L 1DQTA 2XQYG 3O45A 4P2OA 1NDMB 2R4RL 4A2LA 1SJVA 2XZZA 5HGHA 3S7GA 1GGBH 3EO0B 2IALA 3SCMA 2XTJE 3VDAA 1LEIB 1MCHA 4JDTH 2NX5B 3ES6A 2G9HB 5J1TC 3W5MA 1VFUA 1SJHB 3SDXE 4D9RE 4H0GA 1K4CA 3KDMA 4Y4HD 1BAFL 2QL1A 4XMKL 5F7KC 5GRWA 3T04D 4Q6IA 2WUCH 2X1QA 2F53A 4Y4HC 5ADPH 5LWYL 4WJ5B 3BWAA 4XXDA 3Q3GB 2DIBA 2P42B 1JJUA 1KACB 3RJDA 2DQIH 4HUMB 1OM3H 1OAQL 1KPUB 2YPKB 2JJWA 4LLVB 5FHAL 2EH8L 4U1IA 5I66A 5DVKA 3OR7B 4JDVB 2VLKD 4N8VB 5IM7A 2FB4H 4Y4KD 1ADQH 1A64A 4EIGB 1CFSA 4EI5A 1A7NL 5E6IC 4PG9A 1OHQA 3MBEC 4NHCH 5GGSB 1T0NB 2M1KA 2H2SD 5CZKA 5DRNA 5LCVH 4QHUA 4YHOL 4LAJH 4UT9L 5D5MB 1BX2B 3NCJL 3QNZB 4LIQE 2F5AH 1AP2B 1A2YB 2XQYK 2J8OA 1NKRA 1QO3B 2ATPB 4OQTH 5DJAA 5EB9A 5F7LB 2HH0H 3FFCE 3ZTJG 1B3JA 5DMGD 4PRID 3PNWB 4GLRH 2X4TB 1F3JA 3MUGB 2MSPA 1H5BB 2A6DB 3QCTL 3U2SB 1RZ8B 3MBEB 1YQVH 5EOCL 1AXTL 3VXSD 1INQA 1JGEB 4KK5D 5EU5B 4ETQB 5HPOA 1VFMA 4HIHB 5IB3A 2DICA 3BP5A 2E6JA 3NCBB 5DQJB 5IHZB 1YEFH 1JPTL 3NIDE 2DL2A 1BOGA 5KVDH 5DSCB 1TVBB 3I85A 4PJAB 4BH8B 3S5LG 4LQFH 3MV7D 4H1LH 2DLFH 2YA1A 1K2DB 2VOTA 4JQXA 1R24B 1BWMA 1YN6B 4KFZC 5FYKD 1GIGL 2GT9B 4BSVB 4F7MB 4Y4HB 4J4PA 1N3NB 1NUFA 1IGFL 4HWUA 5A2KH 3T0XA 2X4PA 4G9DA 4YH6A 3VFWA 2FWOA 2IPKB 3DXAD 5DVMA 2EDEA 3G04B 3VFNA 3SE9L 4PGCA 5DMGC 2HRPH 3TPUB 1UYWH 4RAHA 4F9LA 2AK1H 3QIBB 3VXRB 1RK1B 1TENA 3H3PH 1J8KA 3FFDB 3FOMB 3KPNA 3TWCL 4JGJA 1U93B 4GW5A 4IJ3C 3G5ZA 3B4NA 5EWIH 3LOWA 3FHQA 1U2HA 3G6DH 2BC4A 1UKSA 5K93A 3MO1B 5BVPH 2HG5B 1I3VA 2XZQH 3B9EA 1G7QB 2HLAB 5J11B 1OVZA 2H6PB 4WFGD 3DURB 2PETA 1C08B 4PBVC 3LY6A 2V17H 4ZFFA 3BAEH 5EU4B 5DDHB 4ODVH 4RGNB 1AGEA 4M61B 1ZHNA 4N8VG 4EXPX 1DQJA 2FEDC 5I9QB 4V1DB 2A2QT 4HF5H 5D7JA 4Z8FL 1IZKA 4P0DA 1F4WL 1UYWL 4YHZL 5J9PA 1ZTXH 5JHLL 3L7FA 3FMGH 3UBXA 1U3JA 4Z7VF 3QEHB 5KN5A 4I2XE 3QEQA 4OBSA 2PCPA 4IOFD 5J11C 3UJTL 5SWSD 4XNYL 4JO1L 2VN4A 4U1JB 3WNLA 2VXVL 4GFTB 1NGQH 4JR9H 3MOQA 3MV8D 4TNWF 1G9NH 4NCC1 4MJ5B 2HKHL 4MX7B 1BQHA 3VI3E 4EDXB 2CJUH 2EDNA 1T20B 4BH7B 4NDMA 4YX2H 3GDBA 4LQFL 4NNYB 2BDNH 1ZLUH 1CLOH 1FGVL 1KJ2A 4E41A 5F7UA 2BVOA 3KPOA 4NQDA 3DV4B 4F7EB 2R2BB 3BH8A 1OAKH 1HDMB 1UJTA 1UJ3C 2KZWA 3AXLB 1QFHA 3CDYA 2VITA 5GSRB 4ZXBB 3RHWF 1TJIH 5E8EB 3INUH 1RZKH 5FIEA 3MLXL 3VXNA 3KYMA 5GGUB 3BEVB 4WHTA 3ULVD 1T66D 3MLYH 1AQKH 1XGTB 4Z7UB 4QOKD 3OKKB 2XKNA 5HPMA 2WIIB 3W0WA 4JY4B 2LTQB 3EOBB 3RZCB 1ZHBA 5FF6A 2CDFA 3TH4T 3U9UA 3QDGA 4IIQA 3FQUA 4Y2DA 4HWZB 2VDKL 4BK5A 3LN5B 4OZFG 3BVNB 4DQOH 4NKDB 1HH9A 4HGKC 4H25A 3QNXB 1NFIB 2YOCA 2FO1A 1I85A 3BHBA 4HWBL 4WUUD 2Y07L 1HE7A 1T22A 1Z9MA 4NKMB 1WBYB 2CLVA 4W81A 3FONA 4Y19A 1II4E 2P8LB 3EJZD 2WIIA 3W0WB 4NQUA 3ME0A 1T7VA 3HTLX 4OZGB 1RUAH 4EUPG 1OCWH 4IHOB 2JELH 5BV7L 1FYTA 4Q74A 2Z4QA 4XCEA 1FBIL 1GHFL 1YYML 2X9WA 1XF2B 4HZLB 3G9AB 5KSBB 3RTQC 3MLTB 1G7JB 5FYKL 5M7QA 3WFBH 2ZCKH 4X7CC 4BM7A 4JR9L 2YD6A 3SKJL 2DQFB 4Y8AA 3TO4D 2Q8BL 3CH1A 1XT5A 2Y07H 3T0EA 4YE4H 2XRAL 3RI5F 4YX2L 4XVSH 4JFDB 3U7AA 3MRLB 3C9NB 5IG7A 1NBYA 3WKNA 4JANA 2AK4B 3K81A 4NFCA 4XBGA 4D0DA 1A22B 1OAKL 3MOAL 3RL1A 1PX3A 4M3KB 4X4XA 4HXAH 3DMMD 2DWDB 2C3VB 4LLYA 4P5MB 2JLLA 1RZKL 3NA4A 5D8JH 4J3OC 3L5IA 2A1WL 5ERWA 5CSGA 2ZKHH 1UB6B 3TJEH 3GSOA 3HFMH 2OJEA 2XQBH 1NCUA 2YZ8A 4G43B 1ZGLM 1F8TH 2W0PA 3DLQR 3FRUB 2UY6A 1IQWL 3LKQB 1MJ7L 5J6GA 1NUNB 2R0KL 5C1MB 1A6AB 2C26A 4NZRH 2YSSA 4MA3A 3O6KL 3QBTB 2FL5B 4CW1A 3QEUA 2X4QB 3LKRB 1KT2A 2R1XA 5AUMA 1VDGA 5T3XH 5TFSL 2XV6B 4HIXL 2EC9U 4HDIA 4A6YH 4GSDH 1WIPA 3MRCA 3T0VA 3DO7A 1F00I 5D7LE 3RTQB 1MCOL 1AQDA 3BDBA 2DD8H 4NHUA 5C08B 2XTJD 3T65A 4AIXA 1Q72L 2XYCA 1HHJB 1QD0A 3TV3H 3ZE0E 1OP9A 3P73B 5ETUA 4RAVA 3QPXL 1BQHG 4OCYL 1WBXB 5GRXG 2R0KH 2XNAB 4CKVX 2BOBB 1XGQB 1KBGL 5HDBE 1RURL 3HLAA 4LBEA 4CVUA 4JPVL 4YEEA 4M7KH 3V8CA 3TNNB 1JWUB 1QBBA 5J3HC 3CFBA 3T65B 3L3JB 3MNVB 5EO9A 1HN1A 2L0DA 3FB5A 3MV8B 4Y1AA 4B53A 2ZSWA 4HIXH 2NTFB 1A1NB 5D9SB 4LCWE 2LVCA 3GIZL 5IB5B 2YS4A 2XA8L 4R7NA 5H94A 3TIEA 4DKFL 1IAIL 2CK2A 1P5UA 3NMEA 1KXTB 4OFVA 1G1CA 4PB9L 4I13B 1J1XL 4I77L 5F6HI 3L1OH 2EYSA 4G5ZL 3TF7C 5JO5B 4O2EA 2E7CA 1DL7L 2GW5A 3N85H 2WBJA 5E00A 4DGYL 4ODUB 4XNMA 3TVMD 3VE0B 1CL7I 3O6FD 2DQUL 5DJDA 5HHOB 5B39A 1L7TH 3RWIB 1MPAL 2XWBB 4HK0B 1FN4B 3N1PC 5IWLA 3RQ3A 2H32A 5MEPA 1UCTA 4GBXB 5EZIL 5EUOF 1T5XA 4LLQB 2DI8A 1JYXA 5DHVH 3I9GL 4FXGA 5D7JC 3P77A 2W1NA 1LO3L 2N4IA 3QZWG 4LCWA 4AY0A 1WC7B 1G7HB 2O26U 4I2XA 1QKZH 4N0CC 5JDSB 4WUUB 1A6TB 4E0RB 3TA3B 4ZNEE 4ZTOH 4OCRH 4WV1C 1NCCH 5TE4L 3SDAA 4CJ1A 3VWKD 4MD0B 2QKIA 2WM0A 2AJXH 4X9HA 2QQQA 4P23B 1ZMYA 5ISZE 2I27N 3GHEL 3PWPD 2NZ9C 3X12B 3QT2A 3T4YA 1R5IB 4AENB 1HEZA 3MGTB 1FRGH 5BW7C 1INDH 1CXEA 3S3SA 1QRND 1HHHA 4XPBL 4MCZA 1XGYH 5DVOA 1AR2A 5JW5B 4MNHB 3OZ9L 4K94C 3SPVB 1OLLA 2O5YH 5KSUA 4HUUA 5D71L 4DN3L 4JO4H 3HC4H 2OS7A 2VDNH 1NANH 2ZJSH 1RHFA 4NM4L 3X12A 1Z3GH 2GHWB 5I30H 3WL9B 4MMXC 1IVLA 1JF5A 5GRUH 1IC7L 1GAFH 3QDME 2OSLA 1N7ML 3ARDD 1SJEA 5ADOL 3AS1A 1OGTA 3BPOC 1J5OH 4JRXE 1MVUB 1TZHB 3FO0H 4HCRL 4XP5H 1C16A 1T5WA 2E9JA 3B83A 2ZUXA 5DJYB 3RX7A 5F97E 3TIDA 3X17A 4EDWH 1HHKB 1K8DA 1CGUA 2NXYC 5C0ND 3F7VB 4YXHH 3PQYD 5T5FH 3LV3A 3QUML 1MIMH 1CD9B 4M7LL 5DD1L 32C2B 3ROLA 1FFNA 2VKWA 1TVDA 3WFDL 4F57H 5I17B 3BOVA 2FECI 2FZ3B 2H3NA 3PWUA 1MCCA 1TZHA 4G8GB 5C0EA 2VDNL 5K59F 3SOBH 1A4JB 5I71C 1LP9B 3ULUD 1FNHA 4N5UA 2YPLA 4YNYB 5CJXC 5L6YH 4JDVA 3WJLC 1AGDB 4HZAA 3HS0A 3LB6D 1S9WA 5I8KH 1ZANL 1E4JA 3GRWL 4MJ5A 4QRUB 4CVZB 4M6MH 4W68A 5BQ7A 1N3NA 1UM6H 4Z76A 3K74B 3R0NA 4JN1L 4BFIB 3D9AH 3KPPA 3O8XD 3DI2B 4JVPA 1E28A 4UT6L 4ODBD 3WSQL 4A6YB 1BBDH 5C8JB 2AJXL 4MXQD 2E9WA 4K8RC 3MV11 3AGVA 5IMKB 3B5GA 1RIHL 5IR1A 2HKFL 2EXWC 3ARED 5FEBA 1MWAL 2PNDA 4CJ0A 3KYAA 3TYGL 1CDCA 4KI5E 4HIEA 5CILH 2ZOLB 3P40A 4JDTL 3F12A 4L1DA 5I1CH 3QWRD 5EFIB 5FHBL 3STZA 5BS0E 3WN5B 2ZUVA 2O5YL 5E4IA 2VLME 1SMOA 5A2JH 1YEHL 1FVCB 3CD4A 5A16B 3JWDH 5C0JA 3EYVB 4NM4H 4FFWC 6FABH 1C5DA 5JA8B 1DVFD 2ZUSA 3FZUD 3HZMB 4PJDF 4XRCB 2NLJA 1JPTH 3BDXA 1HINH 3C6LC 4KI5D 5I2IA 5HHMD 1QA9A 2C1PA 5JZ7C 4HSQA 1BX2A 3RIAK 4UDTB 1RUMH 4KK8D 5BV7C 4HEPG 1NMBH 4GMTL 3GMRA 3MRKB 4MAYC 4NOFA 3QRFM 4KRPC 4S1QH 1T89C 4QXTB 3RL2A 1CFSB 4EI5B 3M17A 4LSTL 5FK9B 4NNPL 1JK8A 1K8DB 2MWCA 4CU8A 3CPLB 1GPOH 5E8PA 3H9YA 2JIXB 4KKCD 4OI8A 1F58H 4LHUD 4Q7DA 5D7KD 4F33A 3JTTA 1D6EA 4RQQB 3HMXA 3NIFE 3ZKMD 3H9HB 5E1AB 3SKMA 3O8XC 5TDNA 2ZPKH 3WFEL 5BV7B 1Q0XH 1WFUA 3M1BA 5I1EH 3ARQA 5E6IB 3DIFA 3GJFH 2ITCB 3EYOB 3P0VH 3DMMA 5EBWA 5AZEL 1T2QL 3ULVE 1BQUA 1F3RB 1K2DA 4Q9QL 5KVDL 4M9OA 3QWOA 3CXHJ 3BAEL 4OZ4B 4H1LB 4OF5A 4PGDB 1I7RA 3IDGB 5DYOA 2D7QA 1RIVL 3CSYA 5A2LH 2HTLD 1QSFB 1UXSB 2VLJE 3QDMB 3NFNB 3VG0L 3W2DH 1OAZH 4PD4K 3H7BA 4MYWB 3WEXB 5C2BL 3NCEB 5IW1B 1QQDB 5HTSA 4DCQA 1HHGB 4HPYH 2BSRB 4PLOB 4X8JA 2ZUTA 2VDMH 1KCRL 1FNEB 3S35L 1HKFA 4U1MA 3ARDC 1TQBC 4CVXB 2AEQL 5DMYA 1AO7D 2YSSB 4MA3B 5MERB 1EA9C 1FNSH 4MA7H 5DGQA 1MFAL 1G9ML 4L4VE 2QADD 3DV4A 4ZFZB 4NQTA 4ZAKB 1H3VA 3GKWL 5E1HB 3L6FB 4N1HB 5GIRA 3RWJB 4M6AA 4HIHA 5IB3B 3DX9B 3S36X 5FCSH 1TJIL 3QQ9D 3UTOA 3CMOL 4OB5L 5IQ9B 4MDIA 3TLRA 1FV1B 1BBJA 3RAJH 1CVSC 2UWEB 3ARBB 3QNYA 3BVNA 1ZHLA 2NYYD 4WCYL 4QRQA 3CU1A 3RWCA 1U91B 4GBXD 4N5EC 3UPAA 4ZAKA 4GW4A 4KK6C 2D2OA 1HCVA 5D7KE 2PYEE 3VFUA 3HNSH 3QG7L 3GI8H 4KJWD 4TTDC 3G9VA 4JJ5B 5DJ0B 4NJ9H 3C9NA 3TH3T 1NMCC 1JV5A 3MGAA 3O41A 4PJ9D 3V4VL 2GIYA 3LHPH 4HKXA 4X6CB 4X6FA 5C3LD 5JNYB 3QDJB 4LFHD 4N0CD 1D6VL 2JF1A 2F54B 1CFQB 3VRLF 3LCYA 1DQLL 1TTGA 3SBWC 4HH9B 4IRZL 1FGNL 4JM2B 3PGFH 3O3AB 4CMHC 3BN3B 1KCVL 1DCLA 3FB8B 1KG0A 2NY1C 1DJSA 2FBJH 3O9WD 4P23D 3BIKA 3CDFA 4NDMB 3O4LA 4NWUH 3VFSA 4GS7C 4N90D 4B7LA 4D2NA 4X7TA 4FQJL 1UQSB 3JWOC 5C2BH 3P4MB 4JZOB 3BN9D 3GMNB 4MA1B 3HUJE 1IJ9A 2VDML 3CMGA 1A9EB 3LPFA 1KC5H 1DDHA 3DRQB 2B0SL 3IKKA 1BZ9A 4XVUD 5IWLC 1X5GA 4XHJC 3HG1E 2DQEL 1A7QL 2XN9D 5ACZA 3ZE1E 4CMHB 4XPFH 2BOCA 3HUJB 4OF3A 2OTWA 1YYLL 4KTEH 3QHFL 1WVZA 3PGFL 5IVXF 2FJGB 1EAPA 1MFAH 2NY2B 3EDDA 3ARDA 5E1AA 3RU8L 1XIWD 4HWZA 2A77L 3UO1H 2NPLX 5C0BE 3T4AB 2D0FA 3AFLA 1UB6A 3BP4A 3H9SE 4U49A 4PTUA 2EEDA 5ERWB 1D7FA 3BYTA 2ZG1A 3UJIH 3RZCD 2ERJC 5DK3A 3VFPA 5KW9H 1GZPB 2ATKB 4RIRB 2IMMA 2LFGA 4KY1L 2XTJC 4P2OB 1NAMB 4PPTA 3RGVA 4WUKL 4BZ1L 2J5LB 1JNJA 3VXSA 1QG3A 3GSNB 2ENSA 4KDTC 3WYRA 1BJ1H 1SM3H 12E8L 4GAJH 2ESVB 1Z6JT 4JCMA 4YWGL 3V2AR 2ZG3A 3ZT5A 5I1GH 4JFDA 1DQMH 4ZPVB 3E6FB 3L95B 4TRPL 1KCUH 5HBBA 1NC2D 3J7HA 1JYNA 2X4RA 1BD2B 4P2RD 4A2MA 4NBYB 4NQDB 2DKUA 1KLGA 4ZOEA 1RY7B 3QRGL 5T3ZH 4WWKC 1I3RA 5CWSA 1T4KB 1S7QB 1NAMA 2WWKT 4OTXL 2H2PD 1RFDL 4WHCA 5I71B 1A0QL 4C56B 3VH8G 4PUBH 4JM2D 4YBLB 3TN0C 3MUZ1 1SQ2N 3F7VA 1SYVA 3O11A 4X5WA 2X5PA 4HJ0D 4ZYKB 4WU7A 2I26N 4X9IA 5J6GB 4JFHE 4YWGH 2IANE 4KQ4H 4G8FA 2F54E 3N06B 3EYUL 4YK4C 1GC1H 4WFEE 5FGBC 5DEFA 2V2XB 2P7TB 4XPFL 2DDQL 3BHBB 3D2UA 1U2CA 5IMMA 3B9KA 4Y5XA 2G60L 4LCIL 3ULVF 2GK0B 1J7VR 1X5AA 2Z8RA 3QJHA 2NY7L 3WXWL 5T3ZL 4L9LC 5C0DA 4UNTA 1XR9A 4X0KA 1UZ6F 3OQ3B 3UZEA 2DRUA 3KWWB 4CADA 1J1PH 5DD3H 3WN5C 2BNRD 5DF0A 1MQKL 1RSFA 4PJ9C 4PBXA 3SDDC 4BK4A 3PDDA 2X9XA 4KZEL 3G5ZB 4TNWK 4G5ZH 1CR9H 4PS4L 1ZVYA 1A5FH 4QLRA 4CGTA 4XT1C 3G5YA 2VH5L 1ZLSL 5DJXA 2ARWA 5SX5H 4Z78A 3NVQA 3SE4C 3UBXI 1C5CH 5E6YA 4FQ2L 3HE7C 2BSSA 2M26A 2GFBA 4JHAL 2F54D 1PYWA 4NBZB 4NKIH 3OB0K 1MLCA 2QLVB 4UMGA 1KCUL 2A83B 3EYVA 1BFOB 4JHBA 2BXYA 3O3BB 3U46A 2EICA 1EO7A 3U0TA 3UTQB 3FT2B 4PYGA 4U1HA 3L5WA 2VLRD 4ELMF 2VDLL 4OD2B 1IGIL 1Z2KA 3L7FB 4NRZA 3D3VB 5CCKL 1X4YA 5I2IB 5CEZD 1H3WM 1CF8H 2R1WA 1NFDF 5CGYD 1EHAA 3W0WD 3GGWA 1G7PA 4XH2B 5C0RL 4LVHB 3TBSB 3ISWA 2BVQB 1GYAA 3FRUA 5J6HB 5JOPD 3SDCA 5FFLA 5CLTA 1TITA 3RWFA 1YY9D 1XGYL 4LCCC 1DEEA 4QHNA 5L8JB 4QRUA 1TJHL 2HTLC 4XP9L 1HOCB 3UPRB 4HX1B 1WAAF 4JREB 4D9QE 3QUZC 1C7TA 4MDJA 1OARH 4JZJA 1JGDB 2AKRA 4ZDHB 5DUBA 1FIGL 2VDLH 1AO7A 4WW1A 2DWEB 4UINH 2V5TA 3WUWG 4UILH 5DJCA 4M9PA 3MLUL 3NFSH 4I3SH 4JFPB 5FCUL 1KF9B 1FSKC 4QCIA 4QRSA 3RKDD 1L0QA 4ZFOB 3ROLB 5F7DA 3L3IA 1FG9C 5C07D 3NTCL 5C07A 4GAFB 5GZOD 4PJHF 1UFUA 5IB1B 2DM4A 4R90H 4XBEL 4N1CA 3ZYOA 4XTRC 5E94A 1LP9A 1F5WA 3RBSA 3IDNA 5F7MC 2VDRH 1LK2A 1H15A 3IJHB 3KNBA 3V0VB 4N0RA 1EJOL 1JTOA 4LKXA 5GGTH 3T0ED 5KSAD 5HVHC 3BPNC 1NAML 4XMLL 4RRPG 1OARL 1E27B 2I5YL 4RGOL 3E6HB 1CBVL 4UZGA 4ESKA 3AVEA 5DQJA 5D9SA 3QA3B 4UILL 3EYQD 1P7QA 1FH5L 4LLWA 5C6TH 3LMJH 1QFPA 2ZP0T 3NGBC 4PJBA 3SPVA 4NP4H 5JTWA 1AH1A 5EU6D 2D9CA 1JHTB 1KEMH 1RI8A 3K2UH 4OZFH 3LEXB 2HVJB 4K3JL 4LLMA 4UTAH 4FQXA 3JUZA 5T33H 5IMOA 4D9LL 4FFWD 1NFDB 3CSBA 4LSPH 3K8KA 4I3RL 1NCNA 3C60C 4KKLC 4LHUA 1KPVB 3DBXB 1HK6A 4OD3H 1PEWA 4DKEH 2H45A 3MRJA 4M6NL 5C0EB 5EBLB 4UIKL 4KROC 4I0PA 2XFXA 1P84K 1Y6NR 1KB5H 4G6FD 5LBSL 2AK4A 1JMZA 4OI7A 3GIVB 4PREA 5KVGL 4LKCA 3F58H 4MHHI 1TETL 3EUUA 2Y5EA 1FDLL 4FXKB 5GGRY 3RBGA 4L29B 1X5JA 4DZBA 1NFDA 1SY6H 1TZGL 2VLKE 2FX8H 2VLLB 4DTGH 2NY0D 3MLWL 4XXCC 1IKNA 1UH2A 3FB6B 2Q7NA 1P1ZA 1PKQB 3MCG1 2P24A 1S7UA 4I5BA 5EBLA 3TFKC 1XR8B 4LVEA 1HWHB 3BPNB 4N0YL 4WUUE 4KZDL 4TUOB 4OFIA 2V5RA 4LSTH 5KSAB 4D9RD 1VA9A 3BKMH 1R3IH 3NPSC 4NNPH 3JSSA 1T1XA 4LSUH 5CINL 2BNRB 3EIFA 5TDNB 5DRWA 1MVFA 5JW3H 2BNUB 5IROC 2FD6H 3G5VA 1JWSA 3QI9D 5DJ8B 2H9GA 4NN5C 3THMH 3SGDI 3F58L 1U8OA 4G7VH 3V0VA 1NC2B 1JPSL 43C9B 3VXUD 2EIDA 4PGZA 1OF2B 4Y5XC 5E8OB 3GBLA 2EDQA 4X7EC 4KHXL 1NCDH 1OSPL 1S9VA 2B1HL 5FO8A 4Y4KC 1SJXA 2DS4A 1UZ6E 5JMRA 2YA0A 1RHHB 2PYEA 1WBZA 3ZTNL 3RWJA 5A2FA 2XTJB 3QDGE 3HI6L 3MCLH 4UT7L 4R2GB 4G8GA 3ARGD 2Y4SA 5HY9A 3VI4E 4G9FB 3GSUB 5DJCB 4D9QD 1YNLL 3BXNA 2JK5A 32C2A 1I7ZA 1QSEA 3KG5A 1R3HB 25C8L 4WHTB 1RJYB 2VRAA 4OZHF 4WY7L 1KPVA 1WIOA 3HAEH 5F9WC 3MV8E 5CIPB 1FNEA 1A6UH 5ITBL 3NIDF 2IH1B 4N68A 1BVLA 5FM5O 5L7XH 4LDEB 4WDIA 1YZZA 4HLZH 5IB4A 5BW7A 1KJ2H 4LSRL 5E7FA 2HMIC 4UB0L 3ZYZA 1CDIA 1WBZB 3BQUD 1RQ5A 3GNMH 3MREB 3UTTE 3QIWA 2Y7QA 4O5LL 3TCLA 1YEFL 4K3HA 4PRAA 3KYKH 4E42B 5CHNB 1T3FB 4NQEE 2B5IB 4W4NA 2IPTL 2GSIA 4HKZA 3DECA 3IDYB 1W72L 2YWZA 1FHGA 3LPGA 4TVPL 5DUMH 3HMWL 1CL7L 4QRPB 2DLEA 5DQ9B 3RI5K 3P2TA 2W91A 1KJVB 5BMFL 1FNAA 4HUKB 5F9JB 3IFNH 1AGBA 4P9HC 5GRJH 5FA3B 4FP8L 1ROWA 1HI6B 1TDQA 1RVFH 3OKOA 4JJ5A 2YKLH 4LSRH 2Y7QB 1C8PA 4LK4A 4XCYA 1M7DB 4FQQB 2X4TA 2X44D 4GW4B 4NYLA 4H20L 1Z9LA 3O2WL 4WI7A 1T2JA 3DVNB 3TVMC 5D70H 4ACPA 43CAA 4HH8A 1DLHA 1A6TA 1BD2D 5F1SA 3IJYB 4L8DB 3ILQD 3F62A 4P4KC 1EHXA 4JFZL 1FG2B 3JV6A 2VLMD 3NZHL 3MYJB 4OCLC 5CD3A 2BNRE 1CU4L 4JQXC 1MHHA 1CGVA 1D6VH 4JHZA 3EO9L 3RJQB 4IRZH 4L9LA 1KNOA 1RV6X 2DI9A 3V4PL 5HYSA 3DVGB 2IGFH 5IG7B 4ZO7A 4U1LB 4X0KB 1GZPA 3UBXB 5IEHB 2JJVA 5TGBB 5J3HD 4HMDA 1UQSA 3GKWH 3DWTA 3MYJA 3CXDL 1QFUL 2FEEL 1MAMH 5DC0A 5FV2A 5JQHC 1UC6A 4OZHB 4M62L 3I3BA 5IBUG 1Y18B 3KPTA 3NABL 2H32H 4MQTB 4AG4L 1NANI 4G43A 5EZOH 3BPCA 4QHMB 2HFEA 4OZ4A 1FVDB 3WIHH 2VMFA 1K5NA 3F6IA 1RK0B 5D2LF 2N56A 4RFEA 3KYKL 2D7MA 3SDYH 2WMPA 1IGTA 2YPVH 3JWDC 4Y5YB 5CJOL 3HNSL 8FABB 4HBQA 5JOEA 2GFBB 3GJEA 3V7AE 4WWID 4GW5B 2DKMA 4LPYA 5FXCH 4P2RE 2AGJL 5GRZA 4FQHB 3CXHK 2EIZB 3PQYE 1Y18A 3CXDH 4I9WE 1YECL 2NY3D 4J6RL 1U8KB 4MXWL 3MRBA 2FHCA 4ELMB 1UA6H 2LABA 4J2XA 2DQDL 2XXCB 3MLXH 4F58L 1BREA 4P99A 3GRWA 5I1DB 4LSSL 1DANU 2VR9A 2JJTC 4YR6B 5DTFA 1CN4A 2DYPA 1LWRA 3KS0H 1AGCA 4I4WA 4WI4A 4JY4A 5E6ZA 1NAKL 2F74A 3BX7C 1FSKB 3MCKB 1S7VA 3QUXA 4FQXC 4NOBA 5CBEB 2VAAA 4OGXL 1VFOA 3T09A 1B4JH 2D0HA 4HIJB 1NGPH 1J1OH 1IC5L 4BFEA 4DKAA 1IKFL 2EDJA 5I1DA 1NUDA 4K23H 4BZ2H 1YECH 4J6RH 1XF3A 4YXKH 5L9DH 5EORL 4YQXH 3V5HA 1QLEH 3MJGX 5HYFA 2VLJB 1I1AB 5FYJH 1EZVX 2FLBT 2VLRE 4AEHL 2B1AH 2MQ3A 1ITCA 2FYYA 3P4NA 4V2CB 3TO4C 1EX0A 1PG7L 3OJMB 4M48H 5GSVA 4IOIB 3VGGA 4PUBL 2V2XA 3G6AB 4TSAL 3X13B 3TZVB 5EU7E 1KJVA 1JZ7A 5FUZH 1U8NA 3WIHL 1BD2E 2AJ3A 1ZHKB 1CDBA 3K1DA 1QFWH 3NPZB 2XIDA 2HFEB 2Q8BH 4U6XA 4NO3A 1I3GH 3GSVA 5D2LB 1E6OL 2AXJA 3L95A 3RDTC 4M7LT 3WS6C 2Z91B 5C0FB 3LDBC 3TNNA 1RU9L 2FJHA 2KL6A 4HBCH 4M8QB 2IAMA 5FYLL 5I1GL 2Z31A 2NY7H 4UT9H 3C8DA 3TO4B 2XWTA 3G5XB 1G6RB 4HXAL 1ED3A 2Y5TA 3DNKA 4LAQL 1EFQA 2FIKB 2IADB 3KXFE 3LD8C 1OGAE 2FWOB 2IPKA 4GMSH 4F37F 5IIEA 5JUEH 3GMOB 4LDOB 4IRJB 5I1KL 4G3YH 4G6JL 3BW9B 4XWOD 2Z35A 4KJQD 1A4KA 4X9FA 5EN2B 3GM0A 5FECA 2HT3D 2X41A 4G80B 3QCVH 15C8L 5D72H 5KSVA 4JY5L 3VGAB 2D7OA 1AXTH 4DK6A 4QNPE 1KOAA 4XX1E 3U7WL 1OTUC 3VXOB 3O2DA 3EGSA 4YUEL 1BPVA 1AI1L 5E99H 2X7LB 3VWJD 4GQPH 2GITA 2C3XA 2EDOA 2FX9H 4KK9C 1ZHNB 3O0RH 1B2WL 5C9KA 4KKAD 2G5RA 1AHWA 4WWKB 3TP4A 4YQXL 3SBWA 2Z92B 2C4XA 4RMVA 3T3PE 5I1KH 2MQ0A 4Z77B 1H8SA 3RY6C 4UDUB 1YMMB 1L9NA 5GHWL 1IRAY 3SKNB 1JI1A 1VADB 1IC4H 3BO8A 1F45A 4JY5H 2GSGB 3E1F1 1FP5A 4WEBL 4K9EC 4U1MB 4IOFC 2V5SA 3MRIA 3HZVA 4PJFB 4P5KA 5ICZA 4QHUB 3Q48A 1R3LB 4R4FL 3SJVD 3AS0A 4JFYA 3ARRA 1HHHB 1QSFD 5DD5H 2Q3ZA 5LGHH 1CFVL 3V5KA 3NA9L 4QRTA 5GJTH 3DYOA 3IAQA 3FFCB 1OTTD 3CU7A 4UV7L 3G6JB 3HI1B 4PB0L 1WFNA 5B8CB 5HDQL 1URLA 4XGZA 4W4OA 3T08A 5HHXH 2WW8A 4JHAH 1A02N 5T1MA 4LVNC 3PABB 4AIZB 5DMKA 5HYJD 1KTRL 5FO9B 5GHWH 1BFSA 4UQ2A 4PJFA 1U91A 2APVA 1F4WH 4JE4B 1DFBH 1X4ZA 5CD5C 1CGWA 1VEPA 4X6DA 1YUHB 5CCKH 2VZ3A 3N85L 4RMTA 2CGRH 5EIIB 5AG9A 2BX5A 2EYSB 1PKQE 2W9DL 5F7EL 4PRHA 5CGMA 1NCTA 2VLJA 2JCCB 2Z31D 1MPAH 4FNLL 1AR1C 2XN9E 3T2QA 1PY4A 1M05B 1NEUA 2G2RB 3FQRB 2VXVH 4XVJL 3CUPB 4ZQKA 1LDPH 4MQXC 3U7WH 1OB1B 3OPZL 1TQBB 1Y6MR 3I9GH 5DVNA 1NJ9B 4LVNB 4YUEH 1MH5B 2R29H 5CP7B 2Z9TA 4LLWB 1JRHH 1RULL 4F37K 1QKZL 1N0XL 4GG6F 1Y0LB 2OYPA 1IBGL 1H3UA 3FAWA 2FYYB 2QQNH 4X7SH 3TC9A 1U8HA 4MB3A 3HNTL 3GMRB 1CG9A 4X99B 2UUDK 4XC3H 2CRZA 3KPPB 4DN4L 2CDGA 4I8DA 3IETA 1A6WH 3PWPB 4KK5C 1KIRB 3BD3A 1PYWB 5I66B 2ZCLL 2R56L 1YPZA 3O3EA 4Y19E 1NEZG 4F2MA 2A0LD 1DUZB 5B21A 1S5IH 4YLQT 2UV3A 2GTZB 2E27H 1UKTA 1LK3H 1I7TA 2WBWB 3RX8A 3BZFA 3ZZ1A 2VZVA 3L3DA 3PL6B 3H9ZA 4RGMC 1CDGA 3GMQB 3STZB 4PP1D 2EDXA 1N0XH 1M4KA 1SJHA 3UTSD 1SBBA 2YUVA 3WJJA 1G7HA 4I2XB 4TSCH 2Y06L 3ZDYF 3S96A 1XCTA 3SEPA 3OJ2C 3ZHDA 1S78D 4P4KA 1R5WB 1U8JA 3R1GL 1QNZH 4PV8A 3IKCB 3SQBA 3OXRA 5E9DD 3MRCB 3MBED 4UBDD 4ONFH 5ILTL 5TF1L 1D5BA 4NO0D 2ORBH 1EVUA 1BZ7A 4NQEA 1MIEL 3OGOE 2PYFB 2NW2B 4ZSOA 3TBSA 4NQSB 2LQRA 4WI9A 2W60B 1EAPB 3V5DA 3LRGA 4G8GD 5DFVC 3OV6A 1KIUA 4M43H 3KPSB 2BZDA 1AIFB 1NCAH 3C09B 1ZS8A 4LLDA 3PWUB 3PV6B 4WW2B 4NQCB 3QXVA 5E24E 1KGCD 3IDJA 3FOLA 4HMEA 1IBGH 2ED9A 3DX6A 4OJFH 2VLJD 5KVGH 4G9FA 2DAVA 2I25N 2AVGA 1RUKH 3JTSB 4PIRF 3LSOB 2C5DC 3EDKA 4KAQH 1P1ZB 3HC3L 1OAUH 3V4UH 5F7DB 2VZUA 5F1IB 2FX8L 3FQWB 5E8NA 3SQOH 2BY2A 1I8IA 2NY5C 1TVHA 3GSNL 2HKFH 4XPTH 1TVBA 4B50A 3GMPA 3HB3C 5BOPA 2YXMA 5E2WL 3DX6B 1S5IL 3P0GB 2BK8A 2F5BL 1EEZB 5ITFA 2P8PA 3BDYH 2KUTA 1CT8A 1DANT 4EJ1C 5CSZA 3WNOA 1U3HC 3CX2A 3MLVH 3STLA 2AABL 2AJYL 1T1XB 2ZSWB 4HIIA 3O4LD 3U0PB 4CU6A 2Z4QB 1XF2A 5CAYB 3Q6FA 1I1FA 3QG6B 5C9JB 4M1DL 3QQNA 1S7XB 4Z7OF 3WCYA 1QRNA 4QHKI 5SWQB 1MCOH 2XN9B 5E2JA 4MZ3A 2ARJA 4L8CA 3VMOA 1D5BB 3BZ4A 2BRRH 1VFBB 2XT1B 4OGAD 4BYHA 1C08A 3MGTA 4R8WH 2ZSVA 1QBML 5DLML 3M17B 2NZIA 1MWAA 1G7MB 2DIJA 3H42H 4YK4B 4LLQA 3VJ6B 3U0WL 1BEYL 3WNNA 1AY1L 4G42B 3DXAE 1NLDL 3OL2A 4WJ5A 1BOYA 1N5YL 2E9BA 5GISH 4NSKB 3CCHA 2RFXA 1A7PL 5HI3D 4PP2B 4OJFL 5HDLA 3NZHH 2V2TA 5EZJB 1JIBA 3IDJB 1Q9KB 4LPWA 3CSGA 1OAUL 3MRHA 2NX5E 1VGEL 1RIUH 4R2GC 4Y16C 2BXZA 4PJ9B 3VXQB 4YHOH 1W72H 3HZKA 2NR6D 1WV7T 4TNVF 1DQQB 3LIZH 3EYFA 1LE5A 3KVQA 1BM3L 2EE3A 4XPTL 1KYOK 1CLOL 1FGVH 2XA3A 3CDCA 4IRSC 1CGSL 1OAZL 1N4XH 4ZS7L 2Z8SA 3BDYL 3U0WH 4JG0L 5C0AA 3RL1B 4ZSOB 4L5FH 3MLVL 4POZD 1T1YB 4ISVA 4X80H 2JE8A 4XVTH 2HT2C 3MLRH 3MRHB 1KCRH 2EC8A 3CVHB 2ADJA 4Y16B 5D1QA 4LRIC 3RVVD 2Q8AH 4OV5B 2BNQB 3QNXA 4RGNC 4RZCB 2G75B 3VXME 4M7ZC 3GI9H 2CMRH 5C92A 5JA9A 1HSBB 5K33A 1UG9A 4JKLA 5FO7A 3DVGA 5HY9B 3K3QA 5IB4B 3BMWA 5GGSA 1MAJA 3DJ9A 2FSEA 1IEHA 5ESQB 1CFNA 5AG8A 1FNGB 3K4DA 1MHHB 5D7SL 1FE8H 5LJYH 1CDHA 2VITB 2VC2H 1J05A 1YMMA 5LG1A 2X4PB 2OL3B 1YPZE 2VKXA 5ICYB 2BNQA 2HRPL 3W9EA 1LO2L 4YDKL 3GSVB 4OCNC 3MLPA 1V3KA 2W9EL 3FQTA 3ORJA 3WS3B 3GSNA 5BJTA 1NAKH 1A1MB 1EO8L 2ADFL 5SX5K 4OZIE 1IKNC 2FATL 1P9MA 2XZQL 5DJ6B 1JPFB 3QEGL 2HWZH 4QEGA 5ISZD 5IGXL 2P5EE 5ALCH 3VFTB 1VKXB 1UWEH 3LQZA 3G6JF 1U95B 4G8EB 5IFHL 5LGJB 3FQTB 1DVFA 4CNIB 3VXQA 3FONB 4Y19B 2J8UB 5CZXC 1IM3A 3E3QE 2AGJH 4JRXB 4MDIB 2F5AL 4NBXB 4UOW1 2HVKA 1LEGB 1UA6L 1ZTXL 1YUHA 4M48L 1S8DB 4O2CB 2XKUA 4TSAH 2E8ZA 4XX1G 3KJ4B 2H26B 3O4OB 4AT6A 3IFPA 3GJFA 5SWZB 4GG6A 3CFEB 4TUJB 2D3VA 2E6PA 2FATH 3OF6D 5TE6H 4U6VH 4M1GL 4OLEA 5DTFB 1R3KB 5IGXH 4JFOB 5C08A 3LKRA 3RUGF 2EECA 1K4DA 5H35A 3QUYD 5D2NC 3UBXG 3KPNB 1MCJA 1KB9J 4H1LG 1BFVL 3L3OA 2EYRB 3LS5L 3OKMA 4GG6B 3DETD 2UWEE 4D3CL 2A6JA 4P2YA 1B4RA 4GO6B 3MRRA 4EXKA 3NFNA 3WJLA 3GGWB 5DQDH 3W39A 1ULVA 2C7UB 4ELME 3BRFA 2WUBH 4WU5B 1FFPA 2GJZB 3GSRA 3HCVA 4S0TD 3V6BR 1MCWM 5L2JB 1RZJL 3HC0A 4WUKH 4BZ1H 3EFDL 1KENL 4XC1L 3VH8B 4R9HA 1DEEB 2R0ZL 2K9UA 3TBTA 3FQXB 1EO8H 2VDKH 1A6PA 3I75B 2V7HA 4JQIH 3TZVA 1QFWL 5ENWA 1J87A 1HKLL 2A73A 1GZQB 4D8PB 5I19L 1HSAA 3ARZA 3HCVB 3KLHC 1HH9B 5TJWK 4XZUA 4QHLA 1FL3B 4J3VA 4Y7MA 4KUZH 1AGCB 4ZFOA 2C4FU 5I1LA 2VQ1A 1L7IL 3C2AH 2VABB 3SDAD 4OF6A 4KH2A 1OCWL 2FEEI 1SEQH 1FL6A 3UX9B 3T0DA 1ZA3B 1TIUA 1KENH 3O3UN 4XC1H 5D7IA 3VRJB 5SX4H 3RPIA 4LCWB 1D5IH 2J4WL 1IC4L 1INEH 2E5EA 5L2KD 5DI8B 3HR5B 5EPMB 4XPHH 1CD1A 2EH7H 5KVEH 5L8LB 4WFGE 2Y25A 4WV1B 2VAAB 1EFXB 2VQ1B 3QCVL 2VLKA 3QYCA 3VFOB 5DO2C 5L8KB 4WO4D 4WIQA 1VESA 3LKPB 1A7NH 1JZ6A 2DQHL 3E8UH 5HGAB 3MRMB 4C57C 3SN6N 1AGBB 3WHE0 4NUJB 1U9KA 4Y4HA 2NY4C 3FRPG 4QF1B 1CICC 1BIHA 3KYNA 1MRCH 5HHPA 3NCYS 3OAUH 2D7PA 1EPFA 3QIBC 3NZ8A 2I24N 5EG6C 3MRDB 5HI5D 3X13A 2GSIB 3JV5A 4HKZB 3V4UL 3WUZA 4O51B 5H2BA 3BUTA 4HWEH 3MGOA 4HPYL 3INUL 3VW3H 1T4KA 2EE6A 3VA2C 3QULA 4YEFA 2WSKA 3QHTC 3CGTA 3QI9A 2X89D 4JFFB 2OQJA 1U3ZA 3S35H 1GGYA 3U46B 5FUCC 5FOBA 1E6JL 1R5IA 3T1FB 1KTDB 2JIXD 1WZKA 2NQCA 2Z93A 2P8MA 3U4EA 1I9IL 1J8HE 2D0GA 4LPVA 4LQ1A 4S0SD 1AE6L 1BLNA 5DC9B 2VXSH 5E2VH 2VERN 2Q6WB 3GM8A 1IEAA 3KJ6H 1J8HA 1OPGH 2OQJB 3RIFF 2FZ3A 1MJ8L 4Y1AD 5DWUH 5GQBA 1D9KD 4HUXA 5TDOA 3HR6A 3WLWC 1PKOA 3E2HC 4WTZG 1A1OA 3HHRB 5C0DB 3EJYD 2K7PA 5J9PB 3ZDZF 2EXYD 2I60H 1FLTX 4QHKJ 2OZ4A 4HFUH 3CVIH 3V7AG 4RDQG 3QG7H 5HYJE 1MF2L 2UUDH 3IS1X 3BZDA 2QQLL 5AZ2L 1AE6H 1MHPH 4HEME 3QDMA 4HLZG 4PRHE 4XVJH 2I9TA 3IDMA 3JV4B 1LP9E 5E7BA 3P4OA 4PGEA 5IVNA 4ZXBC 3HAEG 1X5YA 3L3JA 4Q9BA 3ZHLA 1WICA 4EN3C 4GRMA 2V7HB 1QSFE 4JZJC 4OFYA 4RX4A 1OL0A 1JUFB 3B8YA 4R7NB 5H94B 1U8MA 3PV7A 4K7PH 1T7XA 5TE7H 4PBWD 4ZOBA 1OD9A 4Z7VA 3IJSB 3CSPA 3B9KD 1DUZA 3FFCA 4XC3L 2PO6B 3G6JA 3HI1A 4Z7WA 5HHOD 1NGYA 5IB1A 3S4SG 5TH2A 5C6PB 2YBRB 1QFWI 3PHSA 2RBLA 2OZ4H 2VISA 5FYLE 4M43L 1WCBB 1VACB 4L3EB 4F7TA 2NX5D 2Y72A 2IH1A 2CRMA 1E6JH 2XQBL 4JFFA 4JFFD 5CEXB 3N1FC 3P73A 3A6CL 3L3HB 3IS0X 1CD1B 2FGWH 3L5XL 2X4SB 5F1KC 4J1UB 4EBQH 5KAQG 3F5WA 2FJFA 2CLRB 3HN3A 4LRIA 3LV3B 2VXSL 5E2VL 5C09D 1CVRA 1EBAA 1U92A 2J6EA 2CKBB 4NZUL 5GGRB 5AAMA 1DQDH 1WZ1L 4AYFA 1JPST 5BRZA 4QTHA 3V8OA 5BRZD 5C7XL 1EMTH 3X11B 3H3KA 1HZHL 3WNMA 1UH4A 4ZQKB 3Q3GA 1YJDH 1HINL 3MQIA 1K9TA 2RQ8A 2MCG1 1VHPA 5T33L 4GAYB 2WBJC 3O3DB 4MJIB 3ARVA 4LSPL 3HZMA 1BOGB 5F6HJ 2W9LA 2WP3O 1ZT4B 3ARFA 1NMBL 4GMTH 4KY1H 1EAJA 1IAKA 4HWNA 1QUNA 1KJ3H 3FCTB 3MRNB 4OLVH 3U2SA 3HAEB 4MNQA 1F2XK 2FNBA 3IXTB 3SCMD 3BRDA 1QP1A 1F90H 1WUNT 5D1XB 5BZDA 3NCYP 3PP4H 2ZWLT 3OJDB 4ZNCD 1F58L 3T8XA 2H8PB 2SEBA 1NBVH 2UWEA 2AJYH 3O3BA 5F88A 5FA4A 3GMOA 2DMCA 5ECJE 4B5EA 4QRRD 2EH8H 1EERB 4ZXBA 2B5IC 3B2UD 4OM0H 3N1GC 4PLNC 1BQLH 5FYKE 4P4RA 1G7JA 2IG2H 4Y2DC 1IFHL 1QYGL 4LF3B 4PGCB 4PRNA 2JELL 2EKJA 5BV7H 1F6AB 4XXCA 3TZVC 3JTSA 1M7IB 1UXSA 4M8QA 2YD8A 3MV01 4H88L 4DAGH 4WI6A 2DL9A 3BP7B 4NSKA 3WFDH 4F57L 5BS0A 5D7LA 3C09C 3C5ZB 3TT3L 1DN2A 3UMTA 2AI0H 1CDJA 1CE6A 3S5LA 3QHZH 3I6LE 3FKUS 3MUJA 4XP6L 3IFPB 5C0AD 4JEGB 4LMQE 1N5YH 4HS6B 4NC2B 1B9ZA 2BNQE 2CIKB 3RA7H 2EDLA 4QYOA 5I1AA 2WINA 5GS2H 2YN3A 3LKSA 1H3TA 3VFVB 2IG2L 3VXMD 1JFQH 1OGTB 2CQVA 4X6BB 4P59H 3S88H 2OSLB 1GRWA 1BVLB 1E4XI 1HIMH 3NAAL 5F6IC 5ESAB 4O02H 5IOPB 3DRTA 4FQIH 4APQB 2AJZB 2HG5A 3D85B 1YNKH 3IRPX 1XGPB 4U0RB 5E2TL 1I8KB 4JG0H 1QBMH 5DLMH 4JGMA 2A74A 4JQVA 4BSWB 5I17A 5F1IA 3GNML 1KFAL 4WCYH 3V6OC 2Q7YB 1XF1A 1J0IA 4O5LH 1MWAB 4XP4H 1FFRA 1NBYB 5C0IA 2YD3A 3D25A 3REWB 5I8CB 3P9LA 5FO8B 1CXHA 1DP0A 3Q1SL 4Y5YC 4MJ4A 2XG5A 3BSZH 3MSPA 4S1RH 4UIMA 5ENWB 5GRUL 4JRXA 1OF2A 5FV1L 2OK0H 2WWMC 3EJJX 4K3DL 5JHDB 4FQ1L 4YFEA 2AK4D 1IE5A 4UDTA 5F7HA 4MS8D 4HS8L 4M1CD 1TJGL 4RRPA 1FVEB 2ADIB 2ZOKB 1MY5A 4ZFGH 5EU3B 3IU3B 1A7RL 2UZXB 4HF5L 3LQAC 3P4NB 1PY9A 5JHDE 1LE5B 2KQMA 3OKNB 5DD0L 2ICWJ 2RR3A 1A9BA 4R26H 5F93C 3TA3C 3WFEH 3F12B 2W0FB 4MVBC 5HHVL 1SYVB 3O11B 4X5WB 3MZTA 4PRHB 2AJVH 4IS6A 4AEEA 1WWAX 4LIQH 4FABH 2VB5A 3LKPA 4G8IA 1ZANH 1KN2H 4U6TA 3V6FA 3RIAF 4X9BA 1P2CA 4PJEF 3UC0H 3RZCA 1NDGA 4C4KO 2PR4H 3D9AL 3QUYA 1AXSB 1KNOB 2B8OT 2AAVA 3NAAH 5JXEC 3JV0A 4JY6B 3P11L 3QUMB 4AM0A 2AJSL 4K71C 3GUTB 3LD8B 5FM5M 1MFDL 3DV6A 4QY8B 5E2TH 4X7TB 4L4JA 3LEVH 5CILL 5F3BB 4TTGA 4JPWH 4TUJA 2CH8A 2CDGB 1NDGB 5I1CL 1KV3A 2DTML 1T7WA 1EGJH 2WBJD 4NQXB 2OM5A 1O7SA 3OF6A 4BSWA 4NCC2 3E2HB 1M7DA 5CJOH 3GSXB 1UM4H 4PY7B 3QWQB 3BSZL 4Z7NE 3JBG7 1KTDA 4JM4L 4JFFE 5HGBA 4K71B 2G5BA 1A1MA 3FT4B 4P57B 2GCYA 3DSFL 5B38A 1WCQA 4MXWH 2X10A 1RUML 3IVKB 4LSDA 3QUXD 4DKEL 2VUYA 3C8KA 1A7RH 2VNCA 5T3XE 2ADIA 2ZOKA 4XPBH 4MXVF 4HWBA 3HA0A 3EYSL 1RFDH 4PJ8A 4PJXF 3ULSA 2LU7A 2R1WB 5JIKA 1FBIH 2B4CH 3CH8A 3TO2B 4XP1H 1Q9OA 5ESQA 4RAUB 3Q5OA 1NL0H 4JFQB 5T1DL 1SVCP 4OF0A 5D1ZC 1AGFB 1JF1B 2W0KA 5B8CA 4R7DB 3VXNB 5T3XD 4KU1A 3UDWA 4KVCL 2DIAA 3QR2A 1CFNB 4TUKL 1HXMA 1RZIA 2EEAA 3BUYA 1DBKH 1HYRC 1CZ8L 3I02B 4Q0XH 1KLGB 2VL5A 1T80A 4UIMB 3UYOD 4NWUL 3ULSB 3VWKA 1YEGL 3AB0B 3RPIB 1IL1B 4EIZC 2VSCA 1HH6B 4PGJA 4S10A 1CGTA 1MUJA 4OAWA 1QSVA 4LASH 4MJ6A 1KYOJ 3KJ4C 1EEYA 5D2LA 1SBSL 4LLMB 1D5MA 2HAZA 1QFWM 3QH3B 3BWAB 2VDQL 3I75A 4TOYH 1K85A 4LLUB 4J3SA 4CNIA 1A7BA 1T03L 4Y4KA 3L5HA 5EOTA 3O81A 1EV2E 1JNLL 3DPBA 2IANB 5EUKB 3AROA 4XNMB 5HYJB 1EEZA 3OMZA 5L0QC 5BZWB 2HTKC 5F44A 4OLUH 1UENA 3N9GH 4MZ2A 4QRPA 3WLBB 5ALBH 1MFBH 2R9HC 4NC1C 1DE4B 1UCBL 5D1XC 3QUZB 4ODTL 4EI5D 4PY8J 4GKSA 2CXGA 4N0UE 5EO0B 4KPHL 2J88L 1KCSH 4GT7A 1I1CA 2GJ6B 4K3EH 1H3XA 1LGVA 3NCCB 2VDOL 4P46C 4FXGB 4NQCD 5DMIH 2AK4E 3BZ4B 4E5XB 1INEL 3GMQA 3Q6GL 3V6OA 3KWWA 2X1WL 1A9EA 2A9MH 4YPGA 5ANMA 5JXAH 1Q1JH 2EIBA 4ZODA 2Q6WA 1MCWW 2W38A 4BKLB 2RJMA 2GJ6A 1U8QA 1RUPL 3DHJA 3FB7A 3SGEH 1YDPB 3L7EB 4K7FB 1T1WA 4XB7A 1LO5B 5EO0A 2O61A 1J86A 2V17L 1F13A 3HMWH 3SDCC 1ED3B 1EZVY 2Y5TB 1DBKL 4TNVK 3QRGH 1U8KA 1H0DB 1QHOA 4PJFE 3J8F7 2EDTA 1FO0B 4ODVL 1DSFL 2FBJL 5AUMB 1MJJB 3ES6B 1GPOL 3ZDXF 4FQPA 4GXVH 1QOKA 4PB9H 3MODL 1JN6B 1MJUL 2BY1A 3WV0A 4XAWL 4DGIL 3N0PB 4N9GA 3L1OL 1IGYB 1S7UB 1Q1JL 5F7NC 3U4BH 3VW3L 1GC1L 3FRPA 4LMQI 1NGQL 4JAMB 5D1QD 1LD9A 4XNYH 3D1MC 4GW1B 5B4MC 3FO2A 1T2QH 4HFWA 3N9GL 4Q9QH 4ZPVA 4LHUG 3U9PH 4FTVD 3GJFK 4J3TA 3KLHD 2W65A 2LAGB 3UYRH 5JOPE 3GB7B 3LAFA 1DBAH 1KIPB 5KVFH 3X14B 4ODTH 1FLRH 2P5WA 3D3VE 3KJ6L 5E8PB 2D03L 3DUSB 2IBBA 2GSGA 1NGZA 1CE1H 1V3MA 5L88L 1N6QH 5FM4A 3SE3A 2UVFA 5DUBB 2DMKA 5E56A 5IQ7L 4HKBA 3QUXB 4MGXA 1EBPA 4X6CE 5T1LB 4L3EA 4HDIB 1F3DH 1OSZB 3OKDA 4Y4FA 2CR3A 1YMHA 2YRPA 4FZ8L 3U79A 1WWBX 1MF2H 5HJ3A 3CDGB 4OCSL 1MSPA 3VD5A 2APBA 1JGLH 2CDEB 3D2UB 4C83A 4U6YB 3U0PA 4NO0A 3ZKQD 1I1FB 2MKWA 4NZUH 5IMKA 1MCPH 3GO1H 4KXZH 5GJSL 2HJKA 4MA1C 4PJCE 1WT5A 3MJ9A 4XBGB 1QLRB 4D0DB 4PLJC 3PGDB 1OW0C 4ZPTA 5JPNB 2KQNA 3CIQA 2OI9B 4XNZB 2EDKA 3GMNA 3VXTB 4I18C 5HVHB 2X70A 1NMCB 3KYMB 4C83B 1MJJA 3TA3D 1A0QH 1E4WH 2DLIA 5D6CB 3B2VL 2AXFA 1NC4A 2WQRA 5DUPL 1DZBA 3OKLB 3MNWB 3MRKA 5JMOC 1KB5A 4PJAF 3DUUA 2MPAH 4U1LA 2F8OA 2DB8A 3QUKA 3U9UB 1EEQA 1FZMB 3HMXL 3LHPL 2RGSA 5EULV 1ZSDB 3OKMB 4XP9H 3WFBL 2ZCKL 4NQED 1V3JA 1C1EL 1HCFX 2CUIA 5C09E 4C59B 4Y0GA 4EN3B 1UACL 4GS7B 5C71A 1I1YA 1MHEB 3NN8B 4JZJB 4R0LC 5MHSE 4M6OL 4ZG1A 3MLUH 5TF1H 5KS9F 1IGML 1P4LB 4OKVA 2HFFA 4GBXA 4JFPA 4N0FA 3T1WA 3V6FB 5C7XH 4U1KB 2CD0A 4FFVC 1SJEB 4FQCL 5DUPH 1RHHA 4XBEH 4EKXA 3QZWB 1QBLL 3HAEA 4MNQB 4OUUB 1CLCA 3WL9A 2DMBA 3TJEL 2A73B 3FAXA 3MMEB 4HS6A 5MI0B 2V5MA 1FCCA 1J88A 4EUPH 1KJ3L 1MCQA 3R06A 5J1SC 4U1NB 2V9QA 3UAJC 1ZXQA 4J7RA 5FYKU 4OCSH 1JWSB 1MNUL 3KAAA 1F8TL 3DURA 4UOW0 3UROR 1WAAE 1A6ZA 1C5CL 3R4DA 4FQ2H 5E9DE 1ORSB 3D3VD 4PRHD 2IALB 3K8MA 3QNZA 5I1HH 4YBLC 3TN0B 2ESVD 4UQ2B 4NM8L 4MNHA 4PRNB 1RMFL 2IPTH 3H9SB 5IJVB 1BMGA 5DS8B 1XCQB 5HGBB 1JFQL 3WHXB 3MNZA 4M03A 4JZOA 2HT2D 2VQTA 1JI2A 2R69L 2DLTA 4DCQB 3SGEI 3W5NA 5KJRH 1RUQH 1A6VH 2HLFC 4NN5B 1JTPA 3PF2A 5D72L 1S9YB 3HPJB 3S3JA 3GMPB 4YAQB 2YK1L 4HG4J 2X70B 5C0IB 5JW4M 3D25B 4LF3A 3REWA 5I8CA 1CFTA 1BFTA 4P9MH 4Y89A 1HYSC 4L9LB 1BVKA 3UTTB 3DUUB 1JGVL 1AI1H 1BGXH 5I1IL 2BNQD 1CDUA 1KIPA 1T20A 2NW3A 4BH7A 2F9BT 5JIHA 3UTSA 4M1DH 1Y0LA 3TEUA 1UACH 1KPRA 4YR6A 1R3HA 2VLRA 2X4QA 2CLZA 5I73C 4RZCA 3EKCA 3Q1SH 3PV6A 1BJMA 4X6BA