1GHIA

Structure of beta-lactamase glu166asp:asn170gln mutant
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
257
structure length
257
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYDIELQYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Structures of the acyl-enzyme complexes of the Staphylococcus aureus beta-lactamase mutant Glu166Asp:Asn170Gln with benzylpenicillin and cephaloridine.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 89
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ghiA00
4NETA 4R3BA 3V5MA 1FSWA 1XP4A 1CEFA 2WGWB 3C7UA 3C5AA 3PBNA 5FAOA 2FFYA 5CGWA 1SDNA 1GHIA 2XFSA 3CMZA 3EQVA 3UDXA 4QY5A 3DWZA 4Z9QA 2J9PA 2PBYA 2EX6A 5CECA 4E3LA 5L2FA 3MKEA 4B4XA 3BM6A 1IYOA 2EX8A 4KZBA 1L0GA 3BFEA 1KVLA 4XUZA 3NDEA 5EVLA 5EVIA 2A49A 5EECA 3DTMA 4OOLA 2HDQA 4EBLA 4R1GA 2Y2KA 4Y0OA 2VGJA 4E6XA 3G2YA 3ZNYA 3E2LA 4B4ZA 4WEKA 5FDHA 3HBRA 4KZ4A 4R4RA 2Y2MA 2EX9A 4LCLA 4OPZA 4P85A 2OSUA 4JBFA 4OQ0A 2IWBA 1CI9A 4KG6A 5HX9A 4IVIA 4QJGA 3AGFA 3G31A 3IH8A 2ZLYA 4E6WA 2XLNA 2HDRA 3M6BA 3V50A 4BD0A 1VQQA 3IF6C 5GLBA 3Q81A 3QHYA 4X53A 2HPBA 1FR1A 1H8YA 1KGGA 4S2NC 5FI2A 1L0EA 2HP9A 1FQGA 4Y0TA 1YMXA 2IWCA 4GZBA 3SS3A 3TOIA 3UO9A 4JF4A 3BECA 1K4EA 3MXRA 3ZGAB 5GLCA 1HVBA 1RP5A 3B3XA 2Y2NA 1W8QA 2XD5A 2H0YA 2E8IA 4M3KA 4MBHA 3ISGA 3PAEA 4R0QA 3ZVWA 1GHMA 2WUQA 1JVJA 5M1AA 1U60A 3Q7ZA 4S2IA 4FSFA 3VOYA 3IXDA 4GDNA 3NBLA 4DDYA 2WGIA 4C3QA 1PWCA 3VP3A 4OQHA 3HREA 3FWLA 4JLFA 2XK1A 4N1HA 4S2JA 5JYOA 3WS2A 2J7VA 2XDMA 1XA7A 2ZQDA 4X55A 2Q9MA 3G30A 1KE3A 2V20A 2XD1A 1K55A 4IVKA 3IXBA 3SH9A 3OPRA 5FA7A 1JTDA 3IXHA 1L0FA 5DF8A 4ID4A 3SH8A 1ZG6A 1ONHA 3N8LA 3ZG8B 1BLPA 1RGZA 3VSLA 3ZVTA 4N92A 4GOGA 1NZOA 4OONA 3IH9A 1MKIA 2X01A 3PBOA 2J8YA 1MWTA 3CJMA 5IHVA 4JXGA 4RYEA 1K55C 4GD8A 4QD4A 4JF5A 3UN7A 1IELA 1K57A 1VM1A 2X02A 3GTCA 5FASA 1KGEA 2ZC5B 4ZJ2A 3HVFA 4MBFA 5HL1A 2XEPA 3GQZA 1RGYA 1H5XA 2WK0A 3VFHA 3W4PA 4LV2A 1CEGA 4WEJA 3VMAA 5HAQA 2G2WA 1E4DA 4EBPA 1G68A 4CJNA 2BLSA 1O07A 3IHBA 5E2HA 4Y7PA 4FH4A 5FAQA 2H10A 5GHXA 1W8YA 2A3UA 2ZD8A 1YQSA 3HLFA 2Y2HA 1Z6FA 3LCEA 1JTGA 2EXBA 2ZQAA 2XFTA 1S6RA 3O88A 3UE1A 1ALQA 1RCJA 4IEDA 5M18A 2Y2JA 1NY0A 3JYIA 4RA7A 5CERA 4WBGA 2WGWA 1K56A 4OKPA 2XH9A 1L2SA 4GD6A 1BLHA 1XPBA 1EWZA 3A3FA 5EOEA 3W8KA 3BFGA 1XA1A 3RJUA 5HAPA 1IYSA 1BTLA 3W4QA 3SOIA 1JWZA 4LENA 4JPMA 4WM9A 3G2ZA 4KZ7A 2PU2A 3NIAA 3P09A 4ZDXA 5F83A 5CGSA 3UNWA 3ZFZA 4RX2A 1TDGA 3VP1A 5KSHA 5J8XA 3CG5A 4PMAA 3BLSA 1BULA 4R23A 4N9LA 3VP0A 5HW3A 1QMEA 4KZAA 5AQ9A 1FSYA 4PM7A 4DXBA 2EFXA 3IXGA 1NYMA 1SKFA 2WAFA 3IHAA 3MZEA 2VGKA 3Q07A 1QMFA 4OLGA 1H8ZA 3MZDA 3N4IA 4JXWA 5DVAA 5DTSA 4S2OA 5CTMA 4KQRA 3GSGA 3IF6A 4U3TA 3ITBA 3V3RA 4E3JA 4S2NA 4JXVA 4P6BA 1CI8A 3OPLA 4DDSA 5EVID 1KDSA 4EBNA 2WYXA 4U0TA 3QNBA 2ZC7A 3A3JA 1XGJA 4P87A 5GLAA 4KQQA 3UDFA 3ZG9B 2XR0A 5FQ9A 1ZG4A 4GKUA 4FCFA 3V3SA 5GL9A 1JWVA 1GHPA 3HLEA 2C5WB 2Y91A 1PI5A 4KG5A 1WYBA 1NZUA 1XXMA 2P9VB 3Q82A 2R9WA 4OP8A 3SS4A 3M2KA 3WS1A 2ZM2A 3Q7VB 3G35A 4KZ9A 4KZ6A 1EROA 4KZ8A 4K0XA 3HUMA 1J9MA 5FATA 4JF6A 1NXYA 4OQIA 3IWOA 1YLZA 1KDWA 5EVIB 5HFOA 4S2LA 3P98A 4ZJ1A 1ZKJA 1I2SA 1S0WA 5HARA 1SHVA 3NDGA 1ES4A 2QMIA 1YT4A 1AXBA 3PBRA 3LY4A 5F82A 4DKIA 1ES5A 4DE2A 1DJAA 2G2UA 4ZTKA 4EV4A 1W79A 5KMWA 3FKVA 1O7EA 1PWDA 3BRMA 4GB7A 3UE3A 5FQJA 3UPNA 3UY6A 4MBKA 3S1YA 2V2FF 1E3UA 2WGVA 2XGNA 4HBUA 1K6RA 3ZNTA 4CPKA 5CEDA 1ESUA 3HLDA 4KZ5A 4LV1A 2B5RA 4KG2A 5DTKA 1ESIA 4OQGA 3UE0A 5CEBA 5EOOA 2ZMAA 4X68A 1G6AA 1LI9A 4E3NA 2ZM0A 3IQAA 4QHCA 2JCHA 3S4XA 1I5QA 1MBLA 2Y2IA 1N4OA 4B88A 2IWDA 3FKWA 3GV9A 5CGXA 3LY3A 2Y2QA 4WZ5C 2P74A 4KQOA 2ZQCA 2Z2MB 1MWUA 1FR6A 1KVMA 1DJBA 2WZZA 4PM8A 1TDLA 1WE4A 3C4OA 4R4SA 2X71A 5F1FA 4MEZA 1LL9A 3PBQA 4S2KA 1N9BA 1IYPA 5GLDA 1K25A 3M2JA 1BZAA 4BJPA 4N1XA 4E3MA 1SCWA 2BG1A 1LHYA 1M40A 3OC2A 4ZJ3A 3O3VA 3WRZA 2HDUA 4KENB 3GRJA 2ZC3B 3E2KA 1LI0A 1Q2PA 4N9KA 5A90A 2WKEA 1HD8A 2DNSA 3EQUA 4DE3A 3HL9A 5E2GA 4BD1A 3FV7A 4XUXA 5AQBA 1GA0A 4WMCA 1BLSA 3OCLA 2ZC6B 3OPHA 3PTEA 3WS5A 4YFMA 5FQIA 4BQMA 1KGFA 1MXOA 3ITAA 3QNCA 4RX3A 4UA7A 1LLBA 3BYDA 1M6KA 4PM6A 5EE8A 4DF6A 3D4FA 3DW0A 3ZHHA 3TSGA 2PU4A 4HESA 4R3JA 5TGFA 2H5SA 4OPRA 2GDNA 1XGIA 2JE5A 4HEFA 3GMWA 5FQKA 4GN2A 3WWXA 2J9OA 3HLBA 2EXAA 4DE1A 1K56D 2DRWA 4BL2A 1PIOA 3MBZA 1YLTA 3I7JA 4UA9A 4ZBEA 3GR2A 1BSGA 1YLJA 5EUAA 3ZG0A 3BEBA 1FCOA 1ZC2A 1YLPA 3V39A 4UAAA 4OH0A 4IBRA 2ZM8A 4ZAMA 5FAPA 4E3IA 2WADA 3C7VA 1W7FA 3PBTA 5G18A 3VSKA 3FZCA 1IKIA 1Y54A 1OMEA 1PW8A 3PBSA 4WZ4A 5EPHA 4BENA 4BLMA 3G32A 5FQQA 4OPQA 5CHUA 3FYZA 3HUOA 5DF9A 5I94A 1BUEA 2QZ6A 1FCMA 5A93A 4L0LA 4FH2A 1PW1A 4EWFA 2ZC4B 1EI5A 2P9VA 3Q1FA 2OLVA 2I72A 2JBFA 3CZDA 3Q7VA 1LL5A 4H8RA 5HAIA 4C75A 5DTTA 3NC8A 2JC7A 2RL3A 5FSRA 3LO7A 5DF7A 2ZQ9A 4WYYA 3WS4A 5GHZA 5A91A 4S2PA 4X6TA 5KSCA 4LV0A 5FI6A 5JYPA 1KE0A 3IWIA 2WAEA 1ES3A 1MPLA 3UDIA 2RCXA 3PAGA 4OP5A 1IYQA 4E3OA 4U0XA 3IF6B 3RXWA 5TFQA 5CHJA 4F94A 3C4PA 1PWGA 1L0DA 1XX2A 2V1ZA 1MWRA 5EVIC 3W4OA 3ZDJA 1K54A 3VP2A 4P0MA 4RVAA 2EX2A 4OLDA 4DXCA 1K4FA 2OLUA 3VOZA 1C3BA 5D3OA 1W5DA 4KZ3A 3WS0A 3VFFA 3BFCA 2HDSA 2Y4AA 3G34A 4WZ5A 1ERQA 1TVFA 5A92A 1HTZA 3DWKA 5CHMA 3MKFA 1SDEA 3HLGA 3HLCA 2XF3A 1E3UD 1K54C 3G4PA 4S2MA 4LCMA 1PI4A 3A3EA 4O7DA 1KE4A 4MNRA 4EUZA 2WKHA 2Y2GA 3IWQA 3SH7A 4UA6A 4HBTA 2FFFB 3A3IA 1DY6A 2DCFA 3WRTA 1FCNA 5E2EA 1GCEA 4JKTA 4JXSA 4XXRA 4D2OA 4Y0UA 5F1GA 4NK3A 1CK3A 1YLYA 2ZQ8A 2HP6A 3IT9A 3O86A 4OOMA 3ZG7B 3SS5A 4Q8IA 3ZCZA 4OVDA 5AQAA 1ONGA 3N6IA 4OPYA 1E25A 1IEMA 4X56A 2Y2LA 1BT5A 2Y2OA 3GVBA 2ZQ7A 1PYYA 4A5RA 2UWXA 1BLCA 4QY6A 4QB8A 4X69A 1MWSA 3LEZA 5FQMA 2ZJ9A 3N7WA 1IKGA 1K6SA 1PZPA 1WYCA 2Q9NA 2Y59A 3OZHA 4GNUA 3OCNA 5KZHA 1DJCA 3UPPA 1NYYA 2CC1A 4BL3A 4PM5A 1HZOA 3HLWA 3IF5A 3BFDA 4WMCD 4E3KA 4YINA 2QPNA 3MFDA 3N8RA 1JWPA 5E2FA 1YMSA 4C6YA 3N8SA 1ERMA 2WZXA 5TR7A 5AQ7A 1PZOA 3RXXA 2Y55A 2C6WB 4UHUA 4EQIA 2HP5A 3BLMA 3HUNA 1FOFA 3M6HA 4WELA 4QU3A 1I2WA 5M19A 1XKZA 3BFFA 2Y2PA 3S22A 1K38A 4IBXA 5CTNA 4DE0A 3AGEA 3AGDA 3OPPA 1NJ4A 4DRTA 1GA9A 5BOHA 4GDBA 5FI7A 2OV5A 1YLWA 4K91A 3ZG5A 1MY8A 4FD8A 1K57C 3VP4A 3TG9A 4LV3A 1TEMA 1ES2A 1NRFA 5CXWA 5GHYA 3NCKA 3A3DA 5E43A 2XQZA 2R9XA 3MXSA 1YM1A 3O87A 3MZFA 2WKIA 5CRFA 3NY4A 2H0TA 4MLLA 3UPOA 4PPRA 4K0WA 2Z2LB 3NI9A 1Q2QA 2EFUA 4PM9A 4OOYA 5U47A
chains in the Genus database with same CATH superfamily
4HJ6A 1W63Q 3V5MA 1FSWA 2WGWB 1CEFA 3C7UA 2PD7A 2XFSA 3CMZA 4QY5A 2PBYA 3T4JA 5CECA 5L2FA 4RQ9A 3MKEA 4B4XA 3BM6A 4XUZA 2W0NA 3CPTA 5EVLA 5EVIA 1OTEA 2A49A 5EECA 2M7UA 5DJTA 4Y0OA 4F3LB 2K2NA 3E2LA 1S1YA 4LCLA 4M4XA 5HWTA 3G31A 4NXBA 1WA9A 4JGPA 3IF6C 3Q81A 1STZA 3T4OA 2KDKA 2EA9A 5FI2A 1YMXA 1Y4OA 3UO9A 4JF4A 3ZGAB 5HL6A 5GLCA 1HVBA 3TW8A 2H0YA 4MBHA 1DP8A 3PAEA 5M1AA 3CAXA 1U60A 3Q7ZA 3R7WB 2QWSA 5L09A 1OT9A 1PWCA 4OQHA 3HREA 3FWLA 4JLFA 2XK1A 4LRYC 1HLUP 3UE6A 2V20A 2XD1A 1K55A 3OPRA 5DF8A 3KYQA 3ZG8B 3VSLA 4IUHA 4N92A 3BQAA 3KSGA 4OONA 1VEUA 3PBOA 4I5SA 4JXGA 4GD8A 3LI9A 3P01A 5HPFA 3HVFA 1YKDA 2JKRI 5HAQA 1CEGA 4YOFA 3HJIA 3ICYA 1O07A 2E8JA 5E2HA 4HJ4A 4Y7PA 1ACFA 2H10A 4LFUA 4Y3IA 3HLFA 2VZWA 4O01A 1ALQA 2Y2JA 5CERA 4GD6A 4ME4A 3LIDA 1JWZA 3P09A 3UNWA 1TDGA 3VV4A 1QMEA 2GNXA 4DXBA 4BBUA 3IS2A 2EFXA 3IHAA 3MZEA 2VGKA 4OLGA 3MZDA 4JXWA 5DVAA 3GSGA 4U3TA 1CI8A 3OPLA 2NUPC 5FEGA 1KDSA 3EWKA 4U0TA 1XGJA 3E4OA 1L3LA 3B33A 3K3CA 1ZG4A 2PD8A 3F1OB 4ESPA 2C5WB 2Y91A 1WYBA 1NZUA 2P9VB 3Q82A 5C5KA 2R9WA 3SS4A 4JGRA 4KZ9A 1EROA 5FATA 4OQIA 1YLZA 4S2LA 1S0WA 5HARA 2YKFA 1SKOB 3LGOA 4GS9A 2HJEA 1ES4A 1X0OA 4DKIA 1ES5A 3IX3A 4ZTKA 5HD3A 4EV4A 1LSXA 5KMWA 3LIBA 4O0PA 3BRMA 3S1YA 2VV8A 2XGNA 3HLDA 4KZ5A 2B5RA 4KG2A 1ESIA 3UE0A 3FKWA 4R70A 2Y2QA 4WZ5C 2ZQCA 2Z2MB 2O0YA 4PM8A 1TDLA 1TS0A 4MEZA 1LL9A 3C8CA 1N9BA 3TJZC 5GLDA 2QYBA 1XJ3A 2Z6CA 4BJPA 4E3MA 2BG1A 4P6ZS 3WRZA 2ZC3B 5A90A 2DNSA 3T1XA 1TS6A 1ODVA 4BBTA 2PDRA 3FV7A 4WMCA 3OCLA 5IS1A 3LIEA 4YFMA 5FQIA 3H82A 3BY9A 4Y15A 1LLBA 4PM6A 3UB5P 2VLGA 4R3JA 4OPRA 5HDCA 2GDNA 2XA7S 1NWZA 2JE5A 5LBRA 3GMWA 3WWXA 4DE1A 3JVUA 5A8BA 1T19A 3GR2A 1YLJA 2INWA 3EGXC 5EUAA 1YPRA 1ZC2A 1T1CA 3P7NA 5G18A 3FZCA 1IKIA 4WZ4A 1OJ5A 1TF1A 4BENA 4OPQA 3NOPC 3IBRA 1FCMA 2B18A 4IJGA 2ZC4B 1H0MA 5DFYA 3Q7VA 4H8RA 2RL3A 1LSVA 4WYYA 1N9LA 4S2PA 4X6TA 1K0KA 4LV0A 5FI6A 2WAEA 4MN7A 3F1NA 4EU0A 1IYQA 4E3OA 1UGUA 4O8GA 3PHYA 4F94A 3HCYA 3DTIA 1L0DA 3U2AA 5EVIC 1K54A 2O9BA 1T18A 3E0YA 4Y5FA 2WKQA 3WS0A 3BFCA 2HF6A 2Y4AA 1ERQA 1TVFA 4FUWA 5A92A 2QJ7A 3HLCA 2XF3A 4NKPA 1T1BA 4CQHA 4LCMA 1XJ4A 1KE4A 4EUZA 3IWQA 3SH7A 3H9WA 4HBTA 2FFFB 3A3IA 1DY6A 2DCFA 3WRTA 4B9OA 1GCEA 3RTYA 2GJ3A 1CK3A 3IT9A 4Q8IA 3SS5A 5AQAA 1ONGA 3D9YA 2J3TD 2Y2OA 3GVBA 1BLCA 1CF0A 4QY6A 1UWPX 4R38A 1K6SA 2Y59A 3OZHA 1LL8A 4GNUA 5KZHA 3UPPA 4NXFA 3BFDA 4E3KA 2QPNA 3N8RA 1VEUB 2W3FA 2ACGA 5AJGA 4NXGA 1PZOA 2C6WB 1PRQA 5M19A 2W3DA 5FI7A 1YLWA 3ZG5A 1DP9A 4FD8A 4LV3A 1TEMA 1ES2A 1NRFA 2EWVA 5E43A 1YM1A 3O87A 3MZFA 4LRXC 5CRFA 3NY4A 4PPRA 2ZMFA 3VOLA 4NETA 2VA0A 3C5AA 3EQVA 4Z9QA 2J9PA 2EX6A 1OTDA 1IYOA 2A24A 4HH2A 1L0GA 1KVLA 3NDEA 4OOLA 3EEHA 4R1GA 3IS2B 4ZRRA 4YWZA 1D1JA 4L9EA 5FDHA 4KZ4A 4Z1WA 4R4RA 3T12B 4JBFA 4OQ0A 1CI9A 2ZMVA 3AGFA 3IH8A 2ZLYA 4BD0A 1JNUA 3QHYA 4X53A 1FR1A 1H8YA 2HP9A 1FQGA 2VKSA 4Y0TA 2V8CA 4MMNA 2B95A 3BECA 3MXRA 1W8QA 5F69A 2E8IA 3ISGA 3ZVWA 4XT2A 4JGOA 3A0RA 4LRZE 3VOYA 3IXDA 2BTFP 1S4RA 3NBLA 4GS9B 2WGIA 4WL9A 3CITA 3K2NA 5HWWA 3WS2A 2J7VA 4EEUA 4X55A 2Q9MA 3EEAA 2R78A 4HY8A 4IVKA 4R3AA 5FA7A 3PYPA 1H3QA 4WUJA 2VGLS 2HGVA 4GOGA 1MKIA 2X01A 1MWTA 3CJMA 3UN7A 1IELA 1OPXA 1VM1A 2X02A 2ZC5B 2WK0A 4WEJA 2D02A 3VMAA 2MJ6A 2BLSA 5GHXA 1YQSA 1UWNX 2EXBA 2NUTC 2ZQAA 3O88A 3UE1A 3JYIA 4RA7A 3EGDC 2XH9A 3T4QA 3JVVA 3H82B 3W8KA 5EOEA 3BFGA 1XA1A 3S7QA 5HAPA 1IYSA 2M7VA 4WM9A 4JPMA 2PU2A 3NIAA 2AVXA 4RX2A 4L9FA 3G6OA 3CG5A 4PM7A 3IXGA 3KO6A 1XJ6A 1QMFA 5DKKA 3N4IA 5G4ZA 5DTSA 4S2OA 5CTMA 4KQRA 4HIAA 3ITBA 4E3JA 4S2NA 5EVID 3QNBA 2W3HA 1OT6A 5GLAA 3BWLA 3B47A 3ZG9B 5FQ9A 4GKUA 3V3SA 3HLEA 1AWIA 3M2KA 1EW0A 3Q7VB 4KZ8A 1TS8A 4K0XA 2Z6DA 3IWOA 2OAQ1 1S1ZA 3NDGA 3F1NB 2QMIA 1YT4A 2WKPA 5L07A 3FG8A 3FKVA 1O7EA 3UE3A 3VE4A 5FQJA 4HBUA 1K6RA 3DTEA 5CEDA 2ZBBA 4QWOA 4LV1A 5EOOA 4X68A 2B02A 1G6AA 3IQAA 4IHQA 3S4XA 2Y2IA 4B88A 3LY3A 4KQOA 1MWUA 1DP6A 1FR6A 5F5YA 2X71A 5F1FA 4FOFA 1IYPA 1SZVA 2ZOHA 3NECA 1ZTUA 3OC2A 4ZJ3A 3O3VA 1LI0A 3D72A 2WKEA 3MF0A 1HD8A 3EQUA 2J3TC 4DE3A 3HL9A 2ZOIA 5AQBA 1BLSA 3KSHA 3WS5A 4HI4A 1KGFA 1MXOA 4UA7A 4DF6A 1IFQA 3D4FA 3DW0A 1V9ZA 3NJAA 3U4LP 2K31A 2G7UA 3A0SA 1XGIA 2J9OA 2PYPA 2GX5A 2DRWA 4BL2A 1PIOA 3MBZA 2WKRA 4EXOA 4UA9A 3DAVA 1BSGA 3ZG0A 3V39A 4EEPA 4OH0A 4IBRA 3BY8A 4ZAMA 5FAPA 4QPRA 3O5YA 3VSKA 1OMEA 2XROA 1VB6A 4BLMA 5FQQA 1OJGA 5CHUA 3HUOA 5DF9A 5I94A 5A93A 4BBVA 4HH3A 4L0LA 1EI5A 3Q1FA 2OLVA 3CZDA 1LL5A 4WLAA 4PKYA 2A2LA 2ZQ9A 5GHZA 5KSCA 4LPZA 4AFIA 2ZL1A 2A24B 1MPLA 1G6OA 3KYZA 5TFQA 5EM0A 5HZHA 1XX2A 1MWRA 3LUQA 3VP2A 2EX2A 2PT7A 4HP4A 4OLDA 4DMZA 1N9NA 1W5DA 4KZ3A 3VFFA 4X1MA 1XJ2A 3MKFA 1SDEA 1LT0A 4S2MA 1S66L 3F1PA 1PI4A 3A3EA 3IBJA 4II7A 4MNRA 4Q0JA 2HV1A 1FCNA 5E2EA 4CLCA 2VV7A 4JXSA 4D2OA 4NK3A 4XT2B 2HP6A 4Q0HA 2UV0E 3ZG7B 4I3IA 4OVDA 3LI8A 4OPYA 4MDZA 4A5RA 1MWSA 3LEZA 1YSQA 1WYCA 4LLOB 2Q0OA 1DJCA 2KX6A 2DMWA 4CLCE 4DJ3A 4WMCD 1PFLA 5AVEA 4KUKA 4L9GA 1ERMA 2WZXA 4Y13A 2JHEA 3T4LA 1Y28A 1GSWA 2Y55A 2W1RA 1FOFA 3BFFA 4IBXA 5CTNA 4DE0A 3OPPA 4DRTA 3PXPA 5BOHA 2PYRA 2OV5A 3TG9A 2XSSA 3LFVA 3KX0X 5GHYA 4YNRA 3MXSA 3BW6A 3UPOA 1VETA 2H0TA 4K0WA 3UB7A 1Q2QA 4PM9A 5IU1A 1F2KA 1XP4A 5FL3A 2FFYA 1NLZA 1GHIA 3UDXA 3DWZA 2EX8A 4KZBA 3BFEA 4P6ZM 3DTMA 4EBLA 4E6XA 3G2YA 3ZNYA 5J7EA 4WEKA 4OPZA 2OSUA 3FPVA 4MN5A 4QJGA 3OLOA 4E6WA 2HDRA 3V50A 1VQQA 5GLBA 2HPBA 4S2NC 1L0EA 3DBAA 2XA7M 2IWCA 4GZBA 1K4EA 4UQIS 3B3XA 2XD5A 4M3KA 2WUQA 5HWVA 1JVJA 2OOLA 4FSFA 3LEQA 4GDNA 2M1CA 4DDYA 3VP3A 4S2JA 2BASA 5TBMA 2ZQDA 1KE3A 3SH9A 1L0FA 4ID4A 1ZHHB 3MFXA 1ZG6A 1ONHA 3N8LA 2JKGA 1BLPA 5EM1A 3ZVTA 1YSPA 1NZOA 2JKRM 3E98A 2YKHA 5IHVA 4RYEA 1K55C 1IOUA 4QD4A 4G3VA 1K57A 3QP6A 4KUOA 3BQ8A 4MBFA 2K7SA 2XEPA 4NEED 1RGYA 3BJNA 2L0WA 3LIAA 2G2WA 1E4DA 3R4KA 5FAQA 3V67A 1W8YA 2A3UA 2ZD8A 3LCEA 2Y2HA 1Z6FA 2HZ5A 1JTGA 4ETZA 1RCJA 4IEDA 5HDDA 3T4SA 1K56A 1L2SA 1BLHA 1XPBA 3A3FA 3FC7A 3W4QA 3SOIA 4LENA 4KZ7A 5F83A 1VHMA 3ZFZA 3MQQA 5KSHA 4N9LA 4EUVA 5AQ9A 1FSYA 5K5BA 2I9VA 1NYMA 4KQDA 3Q07A 1H8ZA 5AVFA 2VJWA 5HSQA 1W63M 3QP1A 3E4QA 1NLYA 5HPIA 4GHIA 4GJ4A 2ZC7A 4D60A 4P87A 3UDFA 4KQQA 2JKTI 3PR6A 4ETXA 1JWVA 1GHPA 1PI5A 4KG5A 2PR6A 5J3WA 3QP5A 3G35A 1XFQA 4KZ6A 4I38A 1J9MA 1NXYA 4ARZA 1TS7A 3P98A 1I2SA 4HP9A 3W2ZA 1SHVA 2ZL1B 3IX4A 3UMDA 1AXBA 3LY4A 5F82A 4DE2A 2G2UA 1W79A 3C30A 1J3WA 4GB7A 1PWDA 3UPNA 1E3UA 1N9OA 2WGVA 3GECA 3ZNTA 4CPKA 4EW7A 5DTKA 3A0VA 1MC0A 3T1SA 1LI9A 4QHCA 2JCHA 3UB9A 1I5QA 5CGXA 1GSXA 3F1PB 2V1BA 2P7JA 1KVMA 1WE4A 3C4OA 3S7PA 1K25A 3M2JA 4CLCB 5L8MA 1SCWA 1LHYA 3E4PA 4Q0IA 4KENB 3GRJA 3E2KA 1D7EA 2H28A 4N9KA 4CLCC 3HJKA 2JKFA 3SZTA 5E2GA 4BD1A 3MSHA 4HJ3A 1GA0A 4Y2FA 2ZC6B 4BQMA 4E04A 3T50A 3QNCA 4RX3A 4MCWA 5CX7A 3TSGA 5TGFA 2H5SA 1MZUA 3MQ0A 5FQKA 3HLBA 2EXAA 3D3OA 2OWJA 4ZBEA 3NULA 1FCOA 1LSWA 2ZM8A 4E3IA 2WADA 1W7FA 1PW8A 3PBSA 5EPHA 2VGLM 4EETB 3NHQA 1BUEA 1VETB 1NRJA 2I72A 1T1AA 2JBFA 4C75A 5HAIA 5DTTA 5FSRA 3LO7A 4PAUA 3WS4A 3C38A 4FTXA 5JYPA 3TE8A 2QJ5A 4EERA 1ES3A 4X1LA 2VK3A 3IF6B 3RXWA 5CHJA 3UB8A 2V1ZA 2V8FA 3ZDJA 4P0MA 3UMEA 3VOZA 5DFXA 5D3OA 4JGQA 3G34A 4WN5A 3DWKA 5CHMA 3HLGA 3NOUC 2IA2A 1K54C 5MC7A 1OTIA 3QP8A 2WKHA 3ULFA 2Y8HA 4WF0A 4JKTA 3CWFA 4Y0UA 1PNEA 1P0ZA 1YLYA 2GZAA 2ZQ8A 4H6JA 3O86A 4OOMA 3ZCZA 3N6IA 4X56A 2Y2LA 5EFWA 1BT5A 1S67L 1PYYA 3ZYTA 2W27A 5FQMA 3N7WA 5TBMB 1IKGA 3T1QB 2KOIA 3KYEA 3OCNA 1NYYA 2CC1A 4BL3A 2W1TA 3GDIA 4PM5A 1HZOA 3ZQ5A 3C2WA 2OAP1 3IF5A 4YINA 3MFDA 1JWPA 3NOTC 1A0KA 1YMSA 5AQ7A 4EQIA 3BLMA 3M6HA 1I2WA 1GSVA 3AGEA 1NJ4A 3LICA 1GA9A 3CUEA 4GDBA 4K91A 3LR5A 1MY8A 1K57C 3VP4A 5CXWA 3NCKA 3A3DA 2Z2LB 4EQ1A 3SW1A 4OOYA 4R3BA 3LR0A 5FAOA 3PBNA 5CGWA 1SDNA 1FILA 4E3LA 1XFNA 2JKTM 4IUKA 2VEAA 2HDQA 2Y2KA 2VGJA 2OWHA 3H7WA 4B4ZA 3HBRA 2Y2MA 2EX9A 4P85A 3T4KA 2O9CA 2IWBA 4KG6A 5HX9A 4IVIA 2XLNA 3M6BA 4HNBA 4GHIB 1KGGA 3IX8A 2FZ0A 3KSFA 1F5MA 3SS3A 3TOIA 1RP5A 2PAVP 2Y2NA 4B93A 2L1MA 5KIZA 2LB5A 4R0QA 4ARZB 1GHMA 4S2IA 3KSIA 2V1AA 4C3QA 2VV6A 2V9AA 2JN7A 4N1HA 5JYOA 4CLCD 2XDMA 4GW9A 1XA7A 3G30A 3IXBA 1JTDA 3IXHA 2PR5A 3SH8A 3S7OA 1RGZA 1P9WA 4NG2A 3K3DA 3QP4A 3IH9A 1OTBA 2J8YA 3L7HA 4EESA 4JF5A 3GTCA 5FASA 1KGEA 4ZJ2A 5HL1A 3GQZA 1H5XA 3VFHA 3W4PA 4LV2A 4EBPA 1G68A 4CJNA 3IHBA 3T1RA 2XRNA 4DJ2A 4FH4A 1G5UA 2P08A 1YAXA 2XFTA 1S6RA 5IT5A 5M18A 1NY0A 3EOIA 4WBGA 2WGWA 4OKPA 5J4EA 1EWZA 1H8MA 3RJUA 4HOIA 1BTLA 3CHWP 3G2ZA 4ZDXA 5FDSA 5CGSA 1FIKA 2HJ9C 3VP1A 5J8XA 2O9AA 4PMAA 3BLSA 1BULA 4R23A 5HW3A 3VP0A 4KZAA 1SKFA 4F3LA 3RFBA 2WAFA 2V0WA 2W3GA 3MQOA 3IF6A 3V3RA 3CLOA 4JXVA 4P6BA 4I3JA 1S4SA 1OTAA 4DDSA 5TJJA 4EBNA 2WYXA 4LGWA 3A3JA 2XR0A 4FCFA 5GL9A 5F68A 1XXMA 1D06A 4OP8A 3WS1A 2ZM2A 5DJUA 2PRFA 3OBFA 3HUMA 4JF6A 3B42A 3CPTB 1KDWA 5EVIB 4PHTA 5HFOA 2EWWA 4ZJ1A 3R7WA 1ZKJA 4DN0A 4PKYG 4BMWA 1BYWA 3PBRA 4Y17A 1DJAA 4GLQA 3LR4A 5HD5A 3UY6A 1F98A 4MBKA 1F9IA 2V2FF 4G3KA 3OOVA 4I39A 1ESUA 4OQGA 5CEBA 2ZMAA 4E3NA 2ZM0A 5EVEA 2PBDP 1MBLA 1N4OA 2IWDA 3GV9A 3LYXA 2P74A 1DJBA 2WZZA 2QHKA 3L9KA 4R4SA 3PBQA 4S2KA 1BZAA 4N1XA 1M40A 4H6JB 2HDUA 1Q2PA 3MJQA 4XUXA 4UEYA 3OPHA 1V9YA 3PTEA 2D01A 3ITAA 3BYDA 5EE8A 1M6KA 4UQIM 4HHDA 3ZHHA 2W3EA 2PU4A 2W1TB 4HESA 2V0UA 3DTKA 4HEFA 1G28A 4GN2A 2J80A 3FPWA 5F6AA 2FH5A 5FEFA 1K56D 3LR3A 2CMNA 1YLTA 2KLIA 3I7JA 1DRMA 3T4TA 3BEBA 1YLPA 4UAAA 5HDSA 4NXEA 3C7VA 3PBTA 1Y54A 3CUEC 3G32A 3FYZA 4I3AA 2QZ6A 3F1OA 4FH2A 1PW1A 4EWFA 2P9VA 2J3WA 3LIFA 5EV0A 3TRCA 3MS6A 2PHYA 3NC8A 2JC7A 5DF7A 3UB6A 3VE3A 5A91A 1KE0A 3IWIA 1SKOA 4BWIA 5DKLA 3UDIA 2RCXA 3PAGA 4OP5A 4U0XA 3S7NA 4K08A 3C4PA 1PWGA 3H7WB 1KOUA 3W4OA 4MN6A 4RVAA 1Z09A 4DXCA 1K4FA 2OLUA 1C3BA 2QKPA 3MR0A 2HDSA 4WZ5A 3MMHA 3CI6A 2O99A 1HTZA 5L10A 1E3UD 3G4PA 4O7DA 4HQAA 3MXQA 1TD5A 2Y2GA 4UA6A 4XXRA 5F1GA 1E25A 1IEMA 4R6LA 1CQAA 2ZQ7A 4G3WA 2UWXA 4QB8A 4X69A 2VX8A 2ZJ9A 1PZPA 2Q9NA 1CJFA 1P9RA 5G4YA 5I5LA 2LB9A 3HLWA 4X25A 2Y79A 5E2FA 4C6YA 3N8SA 4GCZA 5TR7A 3RXXA 4UHUA 2HP5A 3HUNA 2L4RA 4QU3A 4WELA 1XKZA 2Y2PA 3S22A 1K38A 3AGDA 3QP2A 3RH8B 2P04A 3JPUA 1P97A 2XQZA 2R9XA 1MKMA 2WKIA 4MLLA 3NI9A 2EFUA 5U47A
chains in the Genus database with same CATH topology
4NETA 4R3BA 3V5MA 1FSWA 1XP4A 1CEFA 2WGWB 3C7UA 3C5AA 3PBNA 5FAOA 2FFYA 5CGWA 1SDNA 1GHIA 2XFSA 3CMZA 3EQVA 3UDXA 4QY5A 3DWZA 4Z9QA 2J9PA 2PBYA 2EX6A 5CECA 4E3LA 5L2FA 3MKEA 4B4XA 3BM6A 1IYOA 2EX8A 4KZBA 1L0GA 3BFEA 1KVLA 4XUZA 3NDEA 5EVLA 5EVIA 2A49A 5EECA 3DTMA 4OOLA 2HDQA 4EBLA 4R1GA 2Y2KA 4Y0OA 2VGJA 4E6XA 3G2YA 3ZNYA 3E2LA 4B4ZA 4WEKA 5FDHA 3HBRA 4KZ4A 4R4RA 2Y2MA 2EX9A 4LCLA 4OPZA 4P85A 2OSUA 4JBFA 4OQ0A 2IWBA 1CI9A 4KG6A 5HX9A 4IVIA 4QJGA 3AGFA 3G31A 3IH8A 2ZLYA 4E6WA 2XLNA 2HDRA 3M6BA 3V50A 4BD0A 1VQQA 3IF6C 5GLBA 3Q81A 3QHYA 4X53A 2HPBA 1FR1A 1H8YA 1KGGA 4S2NC 5FI2A 1L0EA 2HP9A 1FQGA 4Y0TA 1YMXA 2IWCA 4GZBA 3SS3A 3TOIA 3UO9A 4JF4A 3BECA 1K4EA 3MXRA 3ZGAB 5GLCA 1HVBA 1RP5A 3B3XA 2Y2NA 1W8QA 2XD5A 2H0YA 2E8IA 4M3KA 4MBHA 3ISGA 3PAEA 4R0QA 3ZVWA 1GHMA 2WUQA 1JVJA 5M1AA 1U60A 3Q7ZA 4S2IA 4FSFA 3VOYA 3IXDA 4GDNA 3NBLA 4DDYA 2WGIA 4C3QA 1PWCA 3VP3A 4OQHA 3HREA 3FWLA 4JLFA 2XK1A 4N1HA 4S2JA 5JYOA 3WS2A 2J7VA 2XDMA 1XA7A 2ZQDA 4X55A 2Q9MA 3G30A 1KE3A 2V20A 2XD1A 1K55A 4IVKA 3IXBA 3SH9A 3OPRA 5FA7A 1JTDA 3IXHA 1L0FA 5DF8A 4ID4A 3SH8A 1ZG6A 1ONHA 3N8LA 3ZG8B 1BLPA 1RGZA 3VSLA 3ZVTA 4N92A 4GOGA 1NZOA 4OONA 3IH9A 1MKIA 2X01A 3PBOA 2J8YA 1MWTA 3CJMA 5IHVA 4JXGA 4RYEA 1K55C 4GD8A 4QD4A 4JF5A 3UN7A 1IELA 1K57A 1VM1A 2X02A 3GTCA 5FASA 1KGEA 2ZC5B 4ZJ2A 3HVFA 4MBFA 5HL1A 2XEPA 3GQZA 1RGYA 1H5XA 2WK0A 3VFHA 3W4PA 4LV2A 1CEGA 4WEJA 3VMAA 5HAQA 2G2WA 1E4DA 4EBPA 1G68A 4CJNA 2BLSA 1O07A 3IHBA 5E2HA 4Y7PA 4FH4A 5FAQA 2H10A 5GHXA 1W8YA 2A3UA 2ZD8A 1YQSA 3HLFA 2Y2HA 1Z6FA 3LCEA 1JTGA 2EXBA 2ZQAA 2XFTA 1S6RA 3O88A 3UE1A 1ALQA 1RCJA 4IEDA 5M18A 2Y2JA 1NY0A 3JYIA 4RA7A 5CERA 4WBGA 2WGWA 1K56A 4OKPA 2XH9A 1L2SA 4GD6A 1BLHA 1XPBA 1EWZA 3A3FA 5EOEA 3W8KA 3BFGA 1XA1A 3RJUA 5HAPA 1IYSA 1BTLA 3W4QA 3SOIA 1JWZA 4LENA 4JPMA 4WM9A 3G2ZA 4KZ7A 2PU2A 3NIAA 3P09A 4ZDXA 5F83A 5CGSA 3UNWA 3ZFZA 4RX2A 1TDGA 3VP1A 5KSHA 5J8XA 3CG5A 4PMAA 3BLSA 1BULA 4R23A 4N9LA 3VP0A 5HW3A 1QMEA 4KZAA 5AQ9A 1FSYA 4PM7A 4DXBA 2EFXA 3IXGA 1NYMA 1SKFA 2WAFA 3IHAA 3MZEA 2VGKA 3Q07A 1QMFA 4OLGA 1H8ZA 3MZDA 3N4IA 4JXWA 5DVAA 5DTSA 4S2OA 5CTMA 4KQRA 3GSGA 3IF6A 4U3TA 3ITBA 3V3RA 4E3JA 4S2NA 4JXVA 4P6BA 1CI8A 3OPLA 4DDSA 5EVID 1KDSA 4EBNA 2WYXA 4U0TA 3QNBA 2ZC7A 3A3JA 1XGJA 4P87A 5GLAA 4KQQA 3UDFA 3ZG9B 2XR0A 5FQ9A 1ZG4A 4GKUA 4FCFA 3V3SA 5GL9A 1JWVA 1GHPA 3HLEA 2C5WB 2Y91A 1PI5A 4KG5A 1WYBA 1NZUA 1XXMA 2P9VB 3Q82A 2R9WA 4OP8A 3SS4A 3M2KA 3WS1A 2ZM2A 3Q7VB 3G35A 4KZ9A 4KZ6A 1EROA 4KZ8A 4K0XA 3HUMA 1J9MA 5FATA 4JF6A 1NXYA 4OQIA 3IWOA 1YLZA 1KDWA 5EVIB 5HFOA 4S2LA 3P98A 4ZJ1A 1ZKJA 1I2SA 1S0WA 5HARA 1SHVA 3NDGA 1ES4A 2QMIA 1YT4A 1AXBA 3PBRA 3LY4A 5F82A 4DKIA 1ES5A 4DE2A 1DJAA 2G2UA 4ZTKA 4EV4A 1W79A 5KMWA 3FKVA 1O7EA 1PWDA 3BRMA 4GB7A 3UE3A 5FQJA 3UPNA 3UY6A 4MBKA 3S1YA 2V2FF 1E3UA 2WGVA 2XGNA 4HBUA 1K6RA 3ZNTA 4CPKA 5CEDA 1ESUA 3HLDA 4KZ5A 4LV1A 2B5RA 4KG2A 5DTKA 1ESIA 4OQGA 3UE0A 5CEBA 5EOOA 2ZMAA 4X68A 1G6AA 1LI9A 4E3NA 2ZM0A 3IQAA 4QHCA 2JCHA 3S4XA 1I5QA 1MBLA 2Y2IA 1N4OA 4B88A 2IWDA 3FKWA 3GV9A 5CGXA 3LY3A 2Y2QA 4WZ5C 2P74A 4KQOA 2ZQCA 2Z2MB 1MWUA 1FR6A 1KVMA 1DJBA 2WZZA 4PM8A 1TDLA 1WE4A 3C4OA 4R4SA 2X71A 5F1FA 4MEZA 1LL9A 3PBQA 4S2KA 1N9BA 1IYPA 5GLDA 1K25A 3M2JA 1BZAA 4BJPA 4N1XA 4E3MA 1SCWA 2BG1A 1LHYA 1M40A 3OC2A 4ZJ3A 3O3VA 3WRZA 2HDUA 4KENB 3GRJA 2ZC3B 3E2KA 1LI0A 1Q2PA 4N9KA 5A90A 2WKEA 1HD8A 2DNSA 3EQUA 4DE3A 3HL9A 5E2GA 4BD1A 3FV7A 4XUXA 5AQBA 1GA0A 4WMCA 1BLSA 3OCLA 2ZC6B 3OPHA 3PTEA 3WS5A 4YFMA 5FQIA 4BQMA 1KGFA 1MXOA 3ITAA 3QNCA 4RX3A 4UA7A 1LLBA 3BYDA 1M6KA 4PM6A 5EE8A 4DF6A 3D4FA 3DW0A 3ZHHA 3TSGA 2PU4A 4HESA 4R3JA 5TGFA 2H5SA 4OPRA 2GDNA 1XGIA 2JE5A 4HEFA 3GMWA 5FQKA 4GN2A 3WWXA 2J9OA 3HLBA 2EXAA 4DE1A 1K56D 2DRWA 4BL2A 1PIOA 3MBZA 1YLTA 3I7JA 4UA9A 4ZBEA 3GR2A 1BSGA 1YLJA 5EUAA 3ZG0A 3BEBA 1FCOA 1ZC2A 1YLPA 3V39A 4UAAA 4OH0A 4IBRA 2ZM8A 4ZAMA 5FAPA 4E3IA 2WADA 3C7VA 1W7FA 3PBTA 5G18A 3VSKA 3FZCA 1IKIA 1Y54A 1OMEA 1PW8A 3PBSA 4WZ4A 5EPHA 4BENA 4BLMA 3G32A 5FQQA 4OPQA 5CHUA 3FYZA 3HUOA 5DF9A 5I94A 1BUEA 2QZ6A 1FCMA 5A93A 4L0LA 4FH2A 1PW1A 4EWFA 2ZC4B 1EI5A 2P9VA 3Q1FA 2OLVA 2I72A 2JBFA 3CZDA 3Q7VA 1LL5A 4H8RA 5HAIA 4C75A 5DTTA 3NC8A 2JC7A 2RL3A 5FSRA 3LO7A 5DF7A 2ZQ9A 4WYYA 3WS4A 5GHZA 5A91A 4S2PA 4X6TA 5KSCA 4LV0A 5FI6A 5JYPA 1KE0A 3IWIA 2WAEA 1ES3A 1MPLA 3UDIA 2RCXA 3PAGA 4OP5A 1IYQA 4E3OA 4U0XA 3IF6B 3RXWA 5TFQA 5CHJA 4F94A 3C4PA 1PWGA 1L0DA 1XX2A 2V1ZA 1MWRA 5EVIC 3W4OA 3ZDJA 1K54A 3VP2A 4P0MA 4RVAA 2EX2A 4OLDA 4DXCA 1K4FA 2OLUA 3VOZA 1C3BA 5D3OA 1W5DA 4KZ3A 3WS0A 3VFFA 3BFCA 2HDSA 2Y4AA 3G34A 4WZ5A 1ERQA 1TVFA 5A92A 1HTZA 3DWKA 5CHMA 3MKFA 1SDEA 3HLGA 3HLCA 2XF3A 1E3UD 1K54C 3G4PA 4S2MA 4LCMA 1PI4A 3A3EA 4O7DA 1KE4A 4MNRA 4EUZA 2WKHA 2Y2GA 3IWQA 3SH7A 4UA6A 4HBTA 2FFFB 3A3IA 1DY6A 2DCFA 3WRTA 1FCNA 5E2EA 1GCEA 4JKTA 4JXSA 4XXRA 4D2OA 4Y0UA 5F1GA 4NK3A 1CK3A 1YLYA 2ZQ8A 2HP6A 3IT9A 3O86A 4OOMA 3ZG7B 3SS5A 4Q8IA 3ZCZA 4OVDA 5AQAA 1ONGA 3N6IA 4OPYA 1E25A 1IEMA 4X56A 2Y2LA 1BT5A 2Y2OA 3GVBA 2ZQ7A 1PYYA 4A5RA 2UWXA 1BLCA 4QY6A 4QB8A 4X69A 1MWSA 3LEZA 5FQMA 2ZJ9A 3N7WA 1IKGA 1K6SA 1PZPA 1WYCA 2Q9NA 2Y59A 3OZHA 4GNUA 3OCNA 5KZHA 1DJCA 3UPPA 1NYYA 2CC1A 4BL3A 4PM5A 1HZOA 3HLWA 3IF5A 3BFDA 4WMCD 4E3KA 4YINA 2QPNA 3MFDA 3N8RA 1JWPA 5E2FA 1YMSA 4C6YA 3N8SA 1ERMA 2WZXA 5TR7A 5AQ7A 1PZOA 3RXXA 2Y55A 2C6WB 4UHUA 4EQIA 2HP5A 3BLMA 3HUNA 1FOFA 3M6HA 4WELA 4QU3A 1I2WA 5M19A 1XKZA 3BFFA 2Y2PA 3S22A 1K38A 4IBXA 5CTNA 4DE0A 3AGEA 3AGDA 3OPPA 1NJ4A 4DRTA 1GA9A 5BOHA 4GDBA 5FI7A 2OV5A 1YLWA 4K91A 3ZG5A 1MY8A 4FD8A 1K57C 3VP4A 3TG9A 4LV3A 1TEMA 1ES2A 1NRFA 5CXWA 5GHYA 3NCKA 3A3DA 5E43A 2XQZA 2R9XA 3MXSA 1YM1A 3O87A 3MZFA 2WKIA 5CRFA 3NY4A 2H0TA 4MLLA 3UPOA 4PPRA 4K0WA 2Z2LB 3NI9A 1Q2QA 2EFUA 4PM9A 4OOYA 5U47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NET A;  4R3B A;  3V5M A;  1FSW A;  1XP4 A;  1CEF A;  2WGW B;  3C7U A;  3C5A A;  3PBN A;  5FAO A;  2FFY A;  5CGW A;  1SDN A;  1GHI A;  2XFS A;  3CMZ A;  3EQV A;  3UDX A;  4QY5 A;  3DWZ A;  4Z9Q A;  2J9P A;  2PBY A;  2EX6 A;  5CEC A;  4E3L A;  5L2F A;  3MKE A;  4B4X A;  3BM6 A;  1IYO A;  2EX8 A;  4KZB A;  1L0G A;  3BFE A;  1KVL A;  4XUZ A;  3NDE A;  5EVL A;  5EVI A;  2A49 A;  5EEC A;  3DTM A;  4OOL A;  2HDQ A;  4EBL A;  4R1G A;  2Y2K A;  4Y0O A;  2VGJ A;  4E6X A;  3G2Y A;  3ZNY A;  3E2L A;  4B4Z A;  4WEK A;  5FDH A;  3HBR A;  4KZ4 A;  4R4R A;  2Y2M A;  2EX9 A;  4LCL A;  4OPZ A;  4P85 A;  2OSU A;  4JBF A;  4OQ0 A;  2IWB A;  1CI9 A;  4KG6 A;  5HX9 A;  4IVI A;  4QJG A;  3AGF A;  3G31 A;  3IH8 A;  2ZLY A;  4E6W A;  2XLN A;  2HDR A;  3M6B A;  3V50 A;  4BD0 A;  1VQQ A;  3IF6 C;  5GLB A;  3Q81 A;  3QHY A;  4X53 A;  2HPB A;  1FR1 A;  1H8Y A;  1KGG A;  4S2N C;  5FI2 A;  1L0E A;  2HP9 A;  1FQG A;  4Y0T A;  1YMX A;  2IWC A;  4GZB A;  3SS3 A;  3TOI A;  3UO9 A;  4JF4 A;  3BEC A;  1K4E A;  3MXR A;  3ZGA B;  5GLC A;  1HVB A;  1RP5 A;  3B3X A;  2Y2N A;  1W8Q A;  2XD5 A;  2H0Y A;  2E8I A;  4M3K A;  4MBH A;  3ISG A;  3PAE A;  4R0Q A;  3ZVW A;  1GHM A;  2WUQ A;  1JVJ A;  5M1A A;  1U60 A;  3Q7Z A;  4S2I A;  4FSF A;  3VOY A;  3IXD A;  4GDN A;  3NBL A;  4DDY A;  2WGI A;  4C3Q A;  1PWC A;  3VP3 A;  4OQH A;  3HRE A;  3FWL A;  4JLF A;  2XK1 A;  4N1H A;  4S2J A;  5JYO A;  3WS2 A;  2J7V A;  2XDM A;  1XA7 A;  2ZQD A;  4X55 A;  2Q9M A;  3G30 A;  1KE3 A;  2V20 A;  2XD1 A;  1K55 A;  4IVK A;  3IXB A;  3SH9 A;  3OPR A;  5FA7 A;  1JTD A;  3IXH A;  1L0F A;  5DF8 A;  4ID4 A;  3SH8 A;  1ZG6 A;  1ONH A;  3N8L A;  3ZG8 B;  1BLP A;  1RGZ A;  3VSL A;  3ZVT A;  4N92 A;  4GOG A;  1NZO A;  4OON A;  3IH9 A;  1MKI A;  2X01 A;  3PBO A;  2J8Y A;  1MWT A;  3CJM A;  5IHV A;  4JXG A;  4RYE A;  1K55 C;  4GD8 A;  4QD4 A;  4JF5 A;  3UN7 A;  1IEL A;  1K57 A;  1VM1 A;  2X02 A;  3GTC A;  5FAS A;  1KGE A;  2ZC5 B;  4ZJ2 A;  3HVF A;  4MBF A;  5HL1 A;  2XEP A;  3GQZ A;  1RGY A;  1H5X A;  2WK0 A;  3VFH A;  3W4P A;  4LV2 A;  1CEG A;  4WEJ A;  3VMA A;  5HAQ A;  2G2W A;  1E4D A;  4EBP A;  1G68 A;  4CJN A;  2BLS A;  1O07 A;  3IHB A;  5E2H A;  4Y7P A;  4FH4 A;  5FAQ A;  2H10 A;  5GHX A;  1W8Y A;  2A3U A;  2ZD8 A;  1YQS A;  3HLF A;  2Y2H A;  1Z6F A;  3LCE A;  1JTG A;  2EXB A;  2ZQA A;  2XFT A;  1S6R A;  3O88 A;  3UE1 A;  1ALQ A;  1RCJ A;  4IED A;  5M18 A;  2Y2J A;  1NY0 A;  3JYI A;  4RA7 A;  5CER A;  4WBG A;  2WGW A;  1K56 A;  4OKP A;  2XH9 A;  1L2S A;  4GD6 A;  1BLH A;  1XPB A;  1EWZ A;  3A3F A;  5EOE A;  3W8K A;  3BFG A;  1XA1 A;  3RJU A;  5HAP A;  1IYS A;  1BTL A;  3W4Q A;  3SOI A;  1JWZ A;  4LEN A;  4JPM A;  4WM9 A;  3G2Z A;  4KZ7 A;  2PU2 A;  3NIA A;  3P09 A;  4ZDX A;  5F83 A;  5CGS A;  3UNW A;  3ZFZ A;  4RX2 A;  1TDG A;  3VP1 A;  5KSH A;  5J8X A;  3CG5 A;  4PMA A;  3BLS A;  1BUL A;  4R23 A;  4N9L A;  3VP0 A;  5HW3 A;  1QME A;  4KZA A;  5AQ9 A;  1FSY A;  4PM7 A;  4DXB A;  2EFX A;  3IXG A;  1NYM A;  1SKF A;  2WAF A;  3IHA A;  3MZE A;  2VGK A;  3Q07 A;  1QMF A;  4OLG A;  1H8Z A;  3MZD A;  3N4I A;  4JXW A;  5DVA A;  5DTS A;  4S2O A;  5CTM A;  4KQR A;  3GSG A;  3IF6 A;  4U3T A;  3ITB A;  3V3R A;  4E3J A;  4S2N A;  4JXV A;  4P6B A;  1CI8 A;  3OPL A;  4DDS A;  5EVI D;  1KDS A;  4EBN A;  2WYX A;  4U0T A;  3QNB A;  2ZC7 A;  3A3J A;  1XGJ A;  4P87 A;  5GLA A;  4KQQ A;  3UDF A;  3ZG9 B;  2XR0 A;  5FQ9 A;  1ZG4 A;  4GKU A;  4FCF A;  3V3S A;  5GL9 A;  1JWV A;  1GHP A;  3HLE A;  2C5W B;  2Y91 A;  1PI5 A;  4KG5 A;  1WYB A;  1NZU A;  1XXM A;  2P9V B;  3Q82 A;  2R9W A;  4OP8 A;  3SS4 A;  3M2K A;  3WS1 A;  2ZM2 A;  3Q7V B;  3G35 A;  4KZ9 A;  4KZ6 A;  1ERO A;  4KZ8 A;  4K0X A;  3HUM A;  1J9M A;  5FAT A;  4JF6 A;  1NXY A;  4OQI A;  3IWO A;  1YLZ A;  1KDW A;  5EVI B;  5HFO A;  4S2L A;  3P98 A;  4ZJ1 A;  1ZKJ A;  1I2S A;  1S0W A;  5HAR A;  1SHV A;  3NDG A;  1ES4 A;  2QMI A;  1YT4 A;  1AXB A;  3PBR A;  3LY4 A;  5F82 A;  4DKI A;  1ES5 A;  4DE2 A;  1DJA A;  2G2U A;  4ZTK A;  4EV4 A;  1W79 A;  5KMW A;  3FKV A;  1O7E A;  1PWD A;  3BRM A;  4GB7 A;  3UE3 A;  5FQJ A;  3UPN A;  3UY6 A;  4MBK A;  3S1Y A;  2V2F F;  1E3U A;  2WGV A;  2XGN A;  4HBU A;  1K6R A;  3ZNT A;  4CPK A;  5CED A;  1ESU A;  3HLD A;  4KZ5 A;  4LV1 A;  2B5R A;  4KG2 A;  5DTK A;  1ESI A;  4OQG A;  3UE0 A;  5CEB A;  5EOO A;  2ZMA A;  4X68 A;  1G6A A;  1LI9 A;  4E3N A;  2ZM0 A;  3IQA A;  4QHC A;  2JCH A;  3S4X A;  1I5Q A;  1MBL A;  2Y2I A;  1N4O A;  4B88 A;  2IWD A;  3FKW A;  3GV9 A;  5CGX A;  3LY3 A;  2Y2Q A;  4WZ5 C;  2P74 A;  4KQO A;  2ZQC A;  2Z2M B;  1MWU A;  1FR6 A;  1KVM A;  1DJB A;  2WZZ A;  4PM8 A;  1TDL A;  1WE4 A;  3C4O A;  4R4S A;  2X71 A;  5F1F A;  4MEZ A;  1LL9 A;  3PBQ A;  4S2K A;  1N9B A;  1IYP A;  5GLD A;  1K25 A;  3M2J A;  1BZA A;  4BJP A;  4N1X A;  4E3M A;  1SCW A;  2BG1 A;  1LHY A;  1M40 A;  3OC2 A;  4ZJ3 A;  3O3V A;  3WRZ A;  2HDU A;  4KEN B;  3GRJ A;  2ZC3 B;  3E2K A;  1LI0 A;  1Q2P A;  4N9K A;  5A90 A;  2WKE A;  1HD8 A;  2DNS A;  3EQU A;  4DE3 A;  3HL9 A;  5E2G A;  4BD1 A;  3FV7 A;  4XUX A;  5AQB A;  1GA0 A;  4WMC A;  1BLS A;  3OCL A;  2ZC6 B;  3OPH A;  3PTE A;  3WS5 A;  4YFM A;  5FQI A;  4BQM A;  1KGF A;  1MXO A;  3ITA A;  3QNC A;  4RX3 A;  4UA7 A;  1LLB A;  3BYD A;  1M6K A;  4PM6 A;  5EE8 A;  4DF6 A;  3D4F A;  3DW0 A;  3ZHH A;  3TSG A;  2PU4 A;  4HES A;  4R3J A;  5TGF A;  2H5S A;  4OPR A;  2GDN A;  1XGI A;  2JE5 A;  4HEF A;  3GMW A;  5FQK A;  4GN2 A;  3WWX A;  2J9O A;  3HLB A;  2EXA A;  4DE1 A;  1K56 D;  2DRW A;  4BL2 A;  1PIO A;  3MBZ A;  1YLT A;  3I7J A;  4UA9 A;  4ZBE A;  3GR2 A;  1BSG A;  1YLJ A;  5EUA A;  3ZG0 A;  3BEB A;  1FCO A;  1ZC2 A;  1YLP A;  3V39 A;  4UAA A;  4OH0 A;  4IBR A;  2ZM8 A;  4ZAM A;  5FAP A;  4E3I A;  2WAD A;  3C7V A;  1W7F A;  3PBT A;  5G18 A;  3VSK A;  3FZC A;  1IKI A;  1Y54 A;  1OME A;  1PW8 A;  3PBS A;  4WZ4 A;  5EPH A;  4BEN A;  4BLM A;  3G32 A;  5FQQ A;  4OPQ A;  5CHU A;  3FYZ A;  3HUO A;  5DF9 A;  5I94 A;  1BUE A;  2QZ6 A;  1FCM A;  5A93 A;  4L0L A;  4FH2 A;  1PW1 A;  4EWF A;  2ZC4 B;  1EI5 A;  2P9V A;  3Q1F A;  2OLV A;  2I72 A;  2JBF A;  3CZD A;  3Q7V A;  1LL5 A;  4H8R A;  5HAI A;  4C75 A;  5DTT A;  3NC8 A;  2JC7 A;  2RL3 A;  5FSR A;  3LO7 A;  5DF7 A;  2ZQ9 A;  4WYY A;  3WS4 A;  5GHZ A;  5A91 A;  4S2P A;  4X6T A;  5KSC A;  4LV0 A;  5FI6 A;  5JYP A;  1KE0 A;  3IWI A;  2WAE A;  1ES3 A;  1MPL A;  3UDI A;  2RCX A;  3PAG A;  4OP5 A;  1IYQ A;  4E3O A;  4U0X A;  3IF6 B;  3RXW A;  5TFQ A;  5CHJ A;  4F94 A;  3C4P A;  1PWG A;  1L0D A;  1XX2 A;  2V1Z A;  1MWR A;  5EVI C;  3W4O A;  3ZDJ A;  1K54 A;  3VP2 A;  4P0M A;  4RVA A;  2EX2 A;  4OLD A;  4DXC A;  1K4F A;  2OLU A;  3VOZ A;  1C3B A;  5D3O A;  1W5D A;  4KZ3 A;  3WS0 A;  3VFF A;  3BFC A;  2HDS A;  2Y4A A;  3G34 A;  4WZ5 A;  1ERQ A;  1TVF A;  5A92 A;  1HTZ A;  3DWK A;  5CHM A;  3MKF A;  1SDE A;  3HLG A;  3HLC A;  2XF3 A;  1E3U D;  1K54 C;  3G4P A;  4S2M A;  4LCM A;  1PI4 A;  3A3E A;  4O7D A;  1KE4 A;  4MNR A;  4EUZ A;  2WKH A;  2Y2G A;  3IWQ A;  3SH7 A;  4UA6 A;  4HBT A;  2FFF B;  3A3I A;  1DY6 A;  2DCF A;  3WRT A;  1FCN A;  5E2E A;  1GCE A;  4JKT A;  4JXS A;  4XXR A;  4D2O A;  4Y0U A;  5F1G A;  4NK3 A;  1CK3 A;  1YLY A;  2ZQ8 A;  2HP6 A;  3IT9 A;  3O86 A;  4OOM A;  3ZG7 B;  3SS5 A;  4Q8I A;  3ZCZ A;  4OVD A;  5AQA A;  1ONG A;  3N6I A;  4OPY A;  1E25 A;  1IEM A;  4X56 A;  2Y2L A;  1BT5 A;  2Y2O A;  3GVB A;  2ZQ7 A;  1PYY A;  4A5R A;  2UWX A;  1BLC A;  4QY6 A;  4QB8 A;  4X69 A;  1MWS A;  3LEZ A;  5FQM A;  2ZJ9 A;  3N7W A;  1IKG A;  1K6S A;  1PZP A;  1WYC A;  2Q9N A;  2Y59 A;  3OZH A;  4GNU A;  3OCN A;  5KZH A;  1DJC A;  3UPP A;  1NYY A;  2CC1 A;  4BL3 A;  4PM5 A;  1HZO A;  3HLW A;  3IF5 A;  3BFD A;  4WMC D;  4E3K A;  4YIN A;  2QPN A;  3MFD A;  3N8R A;  1JWP A;  5E2F A;  1YMS A;  4C6Y A;  3N8S A;  1ERM A;  2WZX A;  5TR7 A;  5AQ7 A;  1PZO A;  3RXX A;  2Y55 A;  2C6W B;  4UHU A;  4EQI A;  2HP5 A;  3BLM A;  3HUN A;  1FOF A;  3M6H A;  4WEL A;  4QU3 A;  1I2W A;  5M19 A;  1XKZ A;  3BFF A;  2Y2P A;  3S22 A;  1K38 A;  4IBX A;  5CTN A;  4DE0 A;  3AGE A;  3AGD A;  3OPP A;  1NJ4 A;  4DRT A;  1GA9 A;  5BOH A;  4GDB A;  5FI7 A;  2OV5 A;  1YLW A;  4K91 A;  3ZG5 A;  1MY8 A;  4FD8 A;  1K57 C;  3VP4 A;  3TG9 A;  4LV3 A;  1TEM A;  1ES2 A;  1NRF A;  5CXW A;  5GHY A;  3NCK A;  3A3D A;  5E43 A;  2XQZ A;  2R9X A;  3MXS A;  1YM1 A;  3O87 A;  3MZF A;  2WKI A;  5CRF A;  3NY4 A;  2H0T A;  4MLL A;  3UPO A;  4PPR A;  4K0W A;  2Z2L B;  3NI9 A;  1Q2Q A;  2EFU A;  4PM9 A;  4OOY A;  5U47 A; 
#chains in the Genus database with same CATH topology
 4HJ6 A;  1W63 Q;  3V5M A;  1FSW A;  2WGW B;  1CEF A;  3C7U A;  2PD7 A;  2XFS A;  3CMZ A;  4QY5 A;  2PBY A;  3T4J A;  5CEC A;  5L2F A;  4RQ9 A;  3MKE A;  4B4X A;  3BM6 A;  4XUZ A;  2W0N A;  3CPT A;  5EVL A;  5EVI A;  1OTE A;  2A49 A;  5EEC A;  2M7U A;  5DJT A;  4Y0O A;  4F3L B;  2K2N A;  3E2L A;  1S1Y A;  4LCL A;  4M4X A;  5HWT A;  3G31 A;  4NXB A;  1WA9 A;  4JGP A;  3IF6 C;  3Q81 A;  1STZ A;  3T4O A;  2KDK A;  2EA9 A;  5FI2 A;  1YMX A;  1Y4O A;  3UO9 A;  4JF4 A;  3ZGA B;  5HL6 A;  5GLC A;  1HVB A;  3TW8 A;  2H0Y A;  4MBH A;  1DP8 A;  3PAE A;  5M1A A;  3CAX A;  1U60 A;  3Q7Z A;  3R7W B;  2QWS A;  5L09 A;  1OT9 A;  1PWC A;  4OQH A;  3HRE A;  3FWL A;  4JLF A;  2XK1 A;  4LRY C;  1HLU P;  3UE6 A;  2V20 A;  2XD1 A;  1K55 A;  3OPR A;  5DF8 A;  3KYQ A;  3ZG8 B;  3VSL A;  4IUH A;  4N92 A;  3BQA A;  3KSG A;  4OON A;  1VEU A;  3PBO A;  4I5S A;  4JXG A;  4GD8 A;  3LI9 A;  3P01 A;  5HPF A;  3HVF A;  1YKD A;  2JKR I;  5HAQ A;  1CEG A;  4YOF A;  3HJI A;  3ICY A;  1O07 A;  2E8J A;  5E2H A;  4HJ4 A;  4Y7P A;  1ACF A;  2H10 A;  4LFU A;  4Y3I A;  3HLF A;  2VZW A;  4O01 A;  1ALQ A;  2Y2J A;  5CER A;  4GD6 A;  4ME4 A;  3LID A;  1JWZ A;  3P09 A;  3UNW A;  1TDG A;  3VV4 A;  1QME A;  2GNX A;  4DXB A;  4BBU A;  3IS2 A;  2EFX A;  3IHA A;  3MZE A;  2VGK A;  4OLG A;  3MZD A;  4JXW A;  5DVA A;  3GSG A;  4U3T A;  1CI8 A;  3OPL A;  2NUP C;  5FEG A;  1KDS A;  3EWK A;  4U0T A;  1XGJ A;  3E4O A;  1L3L A;  3B33 A;  3K3C A;  1ZG4 A;  2PD8 A;  3F1O B;  4ESP A;  2C5W B;  2Y91 A;  1WYB A;  1NZU A;  2P9V B;  3Q82 A;  5C5K A;  2R9W A;  3SS4 A;  4JGR A;  4KZ9 A;  1ERO A;  5FAT A;  4OQI A;  1YLZ A;  4S2L A;  1S0W A;  5HAR A;  2YKF A;  1SKO B;  3LGO A;  4GS9 A;  2HJE A;  1ES4 A;  1X0O A;  4DKI A;  1ES5 A;  3IX3 A;  4ZTK A;  5HD3 A;  4EV4 A;  1LSX A;  5KMW A;  3LIB A;  4O0P A;  3BRM A;  3S1Y A;  2VV8 A;  2XGN A;  3HLD A;  4KZ5 A;  2B5R A;  4KG2 A;  1ESI A;  3UE0 A;  3FKW A;  4R70 A;  2Y2Q A;  4WZ5 C;  2ZQC A;  2Z2M B;  2O0Y A;  4PM8 A;  1TDL A;  1TS0 A;  4MEZ A;  1LL9 A;  3C8C A;  1N9B A;  3TJZ C;  5GLD A;  2QYB A;  1XJ3 A;  2Z6C A;  4BJP A;  4E3M A;  2BG1 A;  4P6Z S;  3WRZ A;  2ZC3 B;  5A90 A;  2DNS A;  3T1X A;  1TS6 A;  1ODV A;  4BBT A;  2PDR A;  3FV7 A;  4WMC A;  3OCL A;  5IS1 A;  3LIE A;  4YFM A;  5FQI A;  3H82 A;  3BY9 A;  4Y15 A;  1LLB A;  4PM6 A;  3UB5 P;  2VLG A;  4R3J A;  4OPR A;  5HDC A;  2GDN A;  2XA7 S;  1NWZ A;  2JE5 A;  5LBR A;  3GMW A;  3WWX A;  4DE1 A;  3JVU A;  5A8B A;  1T19 A;  3GR2 A;  1YLJ A;  2INW A;  3EGX C;  5EUA A;  1YPR A;  1ZC2 A;  1T1C A;  3P7N A;  5G18 A;  3FZC A;  1IKI A;  4WZ4 A;  1OJ5 A;  1TF1 A;  4BEN A;  4OPQ A;  3NOP C;  3IBR A;  1FCM A;  2B18 A;  4IJG A;  2ZC4 B;  1H0M A;  5DFY A;  3Q7V A;  4H8R A;  2RL3 A;  1LSV A;  4WYY A;  1N9L A;  4S2P A;  4X6T A;  1K0K A;  4LV0 A;  5FI6 A;  2WAE A;  4MN7 A;  3F1N A;  4EU0 A;  1IYQ A;  4E3O A;  1UGU A;  4O8G A;  3PHY A;  4F94 A;  3HCY A;  3DTI A;  1L0D A;  3U2A A;  5EVI C;  1K54 A;  2O9B A;  1T18 A;  3E0Y A;  4Y5F A;  2WKQ A;  3WS0 A;  3BFC A;  2HF6 A;  2Y4A A;  1ERQ A;  1TVF A;  4FUW A;  5A92 A;  2QJ7 A;  3HLC A;  2XF3 A;  4NKP A;  1T1B A;  4CQH A;  4LCM A;  1XJ4 A;  1KE4 A;  4EUZ A;  3IWQ A;  3SH7 A;  3H9W A;  4HBT A;  2FFF B;  3A3I A;  1DY6 A;  2DCF A;  3WRT A;  4B9O A;  1GCE A;  3RTY A;  2GJ3 A;  1CK3 A;  3IT9 A;  4Q8I A;  3SS5 A;  5AQA A;  1ONG A;  3D9Y A;  2J3T D;  2Y2O A;  3GVB A;  1BLC A;  1CF0 A;  4QY6 A;  1UWP X;  4R38 A;  1K6S A;  2Y59 A;  3OZH A;  1LL8 A;  4GNU A;  5KZH A;  3UPP A;  4NXF A;  3BFD A;  4E3K A;  2QPN A;  3N8R A;  1VEU B;  2W3F A;  2ACG A;  5AJG A;  4NXG A;  1PZO A;  2C6W B;  1PRQ A;  5M19 A;  2W3D A;  5FI7 A;  1YLW A;  3ZG5 A;  1DP9 A;  4FD8 A;  4LV3 A;  1TEM A;  1ES2 A;  1NRF A;  2EWV A;  5E43 A;  1YM1 A;  3O87 A;  3MZF A;  4LRX C;  5CRF A;  3NY4 A;  4PPR A;  2ZMF A;  3VOL A;  4NET A;  2VA0 A;  3C5A A;  3EQV A;  4Z9Q A;  2J9P A;  2EX6 A;  1OTD A;  1IYO A;  2A24 A;  4HH2 A;  1L0G A;  1KVL A;  3NDE A;  4OOL A;  3EEH A;  4R1G A;  3IS2 B;  4ZRR A;  4YWZ A;  1D1J A;  4L9E A;  5FDH A;  4KZ4 A;  4Z1W A;  4R4R A;  3T12 B;  4JBF A;  4OQ0 A;  1CI9 A;  2ZMV A;  3AGF A;  3IH8 A;  2ZLY A;  4BD0 A;  1JNU A;  3QHY A;  4X53 A;  1FR1 A;  1H8Y A;  2HP9 A;  1FQG A;  2VKS A;  4Y0T A;  2V8C A;  4MMN A;  2B95 A;  3BEC A;  3MXR A;  1W8Q A;  5F69 A;  2E8I A;  3ISG A;  3ZVW A;  4XT2 A;  4JGO A;  3A0R A;  4LRZ E;  3VOY A;  3IXD A;  2BTF P;  1S4R A;  3NBL A;  4GS9 B;  2WGI A;  4WL9 A;  3CIT A;  3K2N A;  5HWW A;  3WS2 A;  2J7V A;  4EEU A;  4X55 A;  2Q9M A;  3EEA A;  2R78 A;  4HY8 A;  4IVK A;  4R3A A;  5FA7 A;  3PYP A;  1H3Q A;  4WUJ A;  2VGL S;  2HGV A;  4GOG A;  1MKI A;  2X01 A;  1MWT A;  3CJM A;  3UN7 A;  1IEL A;  1OPX A;  1VM1 A;  2X02 A;  2ZC5 B;  2WK0 A;  4WEJ A;  2D02 A;  3VMA A;  2MJ6 A;  2BLS A;  5GHX A;  1YQS A;  1UWN X;  2EXB A;  2NUT C;  2ZQA A;  3O88 A;  3UE1 A;  3JYI A;  4RA7 A;  3EGD C;  2XH9 A;  3T4Q A;  3JVV A;  3H82 B;  3W8K A;  5EOE A;  3BFG A;  1XA1 A;  3S7Q A;  5HAP A;  1IYS A;  2M7V A;  4WM9 A;  4JPM A;  2PU2 A;  3NIA A;  2AVX A;  4RX2 A;  4L9F A;  3G6O A;  3CG5 A;  4PM7 A;  3IXG A;  3KO6 A;  1XJ6 A;  1QMF A;  5DKK A;  3N4I A;  5G4Z A;  5DTS A;  4S2O A;  5CTM A;  4KQR A;  4HIA A;  3ITB A;  4E3J A;  4S2N A;  5EVI D;  3QNB A;  2W3H A;  1OT6 A;  5GLA A;  3BWL A;  3B47 A;  3ZG9 B;  5FQ9 A;  4GKU A;  3V3S A;  3HLE A;  1AWI A;  3M2K A;  1EW0 A;  3Q7V B;  4KZ8 A;  1TS8 A;  4K0X A;  2Z6D A;  3IWO A;  2OAQ 1;  1S1Z A;  3NDG A;  3F1N B;  2QMI A;  1YT4 A;  2WKP A;  5L07 A;  3FG8 A;  3FKV A;  1O7E A;  3UE3 A;  3VE4 A;  5FQJ A;  4HBU A;  1K6R A;  3DTE A;  5CED A;  2ZBB A;  4QWO A;  4LV1 A;  5EOO A;  4X68 A;  2B02 A;  1G6A A;  3IQA A;  4IHQ A;  3S4X A;  2Y2I A;  4B88 A;  3LY3 A;  4KQO A;  1MWU A;  1DP6 A;  1FR6 A;  5F5Y A;  2X71 A;  5F1F A;  4FOF A;  1IYP A;  1SZV A;  2ZOH A;  3NEC A;  1ZTU A;  3OC2 A;  4ZJ3 A;  3O3V A;  1LI0 A;  3D72 A;  2WKE A;  3MF0 A;  1HD8 A;  3EQU A;  2J3T C;  4DE3 A;  3HL9 A;  2ZOI A;  5AQB A;  1BLS A;  3KSH A;  3WS5 A;  4HI4 A;  1KGF A;  1MXO A;  4UA7 A;  4DF6 A;  1IFQ A;  3D4F A;  3DW0 A;  1V9Z A;  3NJA A;  3U4L P;  2K31 A;  2G7U A;  3A0S A;  1XGI A;  2J9O A;  2PYP A;  2GX5 A;  2DRW A;  4BL2 A;  1PIO A;  3MBZ A;  2WKR A;  4EXO A;  4UA9 A;  3DAV A;  1BSG A;  3ZG0 A;  3V39 A;  4EEP A;  4OH0 A;  4IBR A;  3BY8 A;  4ZAM A;  5FAP A;  4QPR A;  3O5Y A;  3VSK A;  1OME A;  2XRO A;  1VB6 A;  4BLM A;  5FQQ A;  1OJG A;  5CHU A;  3HUO A;  5DF9 A;  5I94 A;  5A93 A;  4BBV A;  4HH3 A;  4L0L A;  1EI5 A;  3Q1F A;  2OLV A;  3CZD A;  1LL5 A;  4WLA A;  4PKY A;  2A2L A;  2ZQ9 A;  5GHZ A;  5KSC A;  4LPZ A;  4AFI A;  2ZL1 A;  2A24 B;  1MPL A;  1G6O A;  3KYZ A;  5TFQ A;  5EM0 A;  5HZH A;  1XX2 A;  1MWR A;  3LUQ A;  3VP2 A;  2EX2 A;  2PT7 A;  4HP4 A;  4OLD A;  4DMZ A;  1N9N A;  1W5D A;  4KZ3 A;  3VFF A;  4X1M A;  1XJ2 A;  3MKF A;  1SDE A;  1LT0 A;  4S2M A;  1S66 L;  3F1P A;  1PI4 A;  3A3E A;  3IBJ A;  4II7 A;  4MNR A;  4Q0J A;  2HV1 A;  1FCN A;  5E2E A;  4CLC A;  2VV7 A;  4JXS A;  4D2O A;  4NK3 A;  4XT2 B;  2HP6 A;  4Q0H A;  2UV0 E;  3ZG7 B;  4I3I A;  4OVD A;  3LI8 A;  4OPY A;  4MDZ A;  4A5R A;  1MWS A;  3LEZ A;  1YSQ A;  1WYC A;  4LLO B;  2Q0O A;  1DJC A;  2KX6 A;  2DMW A;  4CLC E;  4DJ3 A;  4WMC D;  1PFL A;  5AVE A;  4KUK A;  4L9G A;  1ERM A;  2WZX A;  4Y13 A;  2JHE A;  3T4L A;  1Y28 A;  1GSW A;  2Y55 A;  2W1R A;  1FOF A;  3BFF A;  4IBX A;  5CTN A;  4DE0 A;  3OPP A;  4DRT A;  3PXP A;  5BOH A;  2PYR A;  2OV5 A;  3TG9 A;  2XSS A;  3LFV A;  3KX0 X;  5GHY A;  4YNR A;  3MXS A;  3BW6 A;  3UPO A;  1VET A;  2H0T A;  4K0W A;  3UB7 A;  1Q2Q A;  4PM9 A;  5IU1 A;  1F2K A;  1XP4 A;  5FL3 A;  2FFY A;  1NLZ A;  1GHI A;  3UDX A;  3DWZ A;  2EX8 A;  4KZB A;  3BFE A;  4P6Z M;  3DTM A;  4EBL A;  4E6X A;  3G2Y A;  3ZNY A;  5J7E A;  4WEK A;  4OPZ A;  2OSU A;  3FPV A;  4MN5 A;  4QJG A;  3OLO A;  4E6W A;  2HDR A;  3V50 A;  1VQQ A;  5GLB A;  2HPB A;  4S2N C;  1L0E A;  3DBA A;  2XA7 M;  2IWC A;  4GZB A;  1K4E A;  4UQI S;  3B3X A;  2XD5 A;  4M3K A;  2WUQ A;  5HWV A;  1JVJ A;  2OOL A;  4FSF A;  3LEQ A;  4GDN A;  2M1C A;  4DDY A;  3VP3 A;  4S2J A;  2BAS A;  5TBM A;  2ZQD A;  1KE3 A;  3SH9 A;  1L0F A;  4ID4 A;  1ZHH B;  3MFX A;  1ZG6 A;  1ONH A;  3N8L A;  2JKG A;  1BLP A;  5EM1 A;  3ZVT A;  1YSP A;  1NZO A;  2JKR M;  3E98 A;  2YKH A;  5IHV A;  4RYE A;  1K55 C;  1IOU A;  4QD4 A;  4G3V A;  1K57 A;  3QP6 A;  4KUO A;  3BQ8 A;  4MBF A;  2K7S A;  2XEP A;  4NEE D;  1RGY A;  3BJN A;  2L0W A;  3LIA A;  2G2W A;  1E4D A;  3R4K A;  5FAQ A;  3V67 A;  1W8Y A;  2A3U A;  2ZD8 A;  3LCE A;  2Y2H A;  1Z6F A;  2HZ5 A;  1JTG A;  4ETZ A;  1RCJ A;  4IED A;  5HDD A;  3T4S A;  1K56 A;  1L2S A;  1BLH A;  1XPB A;  3A3F A;  3FC7 A;  3W4Q A;  3SOI A;  4LEN A;  4KZ7 A;  5F83 A;  1VHM A;  3ZFZ A;  3MQQ A;  5KSH A;  4N9L A;  4EUV A;  5AQ9 A;  1FSY A;  5K5B A;  2I9V A;  1NYM A;  4KQD A;  3Q07 A;  1H8Z A;  5AVF A;  2VJW A;  5HSQ A;  1W63 M;  3QP1 A;  3E4Q A;  1NLY A;  5HPI A;  4GHI A;  4GJ4 A;  2ZC7 A;  4D60 A;  4P87 A;  3UDF A;  4KQQ A;  2JKT I;  3PR6 A;  4ETX A;  1JWV A;  1GHP A;  1PI5 A;  4KG5 A;  2PR6 A;  5J3W A;  3QP5 A;  3G35 A;  1XFQ A;  4KZ6 A;  4I38 A;  1J9M A;  1NXY A;  4ARZ A;  1TS7 A;  3P98 A;  1I2S A;  4HP9 A;  3W2Z A;  1SHV A;  2ZL1 B;  3IX4 A;  3UMD A;  1AXB A;  3LY4 A;  5F82 A;  4DE2 A;  2G2U A;  1W79 A;  3C30 A;  1J3W A;  4GB7 A;  1PWD A;  3UPN A;  1E3U A;  1N9O A;  2WGV A;  3GEC A;  3ZNT A;  4CPK A;  4EW7 A;  5DTK A;  3A0V A;  1MC0 A;  3T1S A;  1LI9 A;  4QHC A;  2JCH A;  3UB9 A;  1I5Q A;  5CGX A;  1GSX A;  3F1P B;  2V1B A;  2P7J A;  1KVM A;  1WE4 A;  3C4O A;  3S7P A;  1K25 A;  3M2J A;  4CLC B;  5L8M A;  1SCW A;  1LHY A;  3E4P A;  4Q0I A;  4KEN B;  3GRJ A;  3E2K A;  1D7E A;  2H28 A;  4N9K A;  4CLC C;  3HJK A;  2JKF A;  3SZT A;  5E2G A;  4BD1 A;  3MSH A;  4HJ3 A;  1GA0 A;  4Y2F A;  2ZC6 B;  4BQM A;  4E04 A;  3T50 A;  3QNC A;  4RX3 A;  4MCW A;  5CX7 A;  3TSG A;  5TGF A;  2H5S A;  1MZU A;  3MQ0 A;  5FQK A;  3HLB A;  2EXA A;  3D3O A;  2OWJ A;  4ZBE A;  3NUL A;  1FCO A;  1LSW A;  2ZM8 A;  4E3I A;  2WAD A;  1W7F A;  1PW8 A;  3PBS A;  5EPH A;  2VGL M;  4EET B;  3NHQ A;  1BUE A;  1VET B;  1NRJ A;  2I72 A;  1T1A A;  2JBF A;  4C75 A;  5HAI A;  5DTT A;  5FSR A;  3LO7 A;  4PAU A;  3WS4 A;  3C38 A;  4FTX A;  5JYP A;  3TE8 A;  2QJ5 A;  4EER A;  1ES3 A;  4X1L A;  2VK3 A;  3IF6 B;  3RXW A;  5CHJ A;  3UB8 A;  2V1Z A;  2V8F A;  3ZDJ A;  4P0M A;  3UME A;  3VOZ A;  5DFX A;  5D3O A;  4JGQ A;  3G34 A;  4WN5 A;  3DWK A;  5CHM A;  3HLG A;  3NOU C;  2IA2 A;  1K54 C;  5MC7 A;  1OTI A;  3QP8 A;  2WKH A;  3ULF A;  2Y8H A;  4WF0 A;  4JKT A;  3CWF A;  4Y0U A;  1PNE A;  1P0Z A;  1YLY A;  2GZA A;  2ZQ8 A;  4H6J A;  3O86 A;  4OOM A;  3ZCZ A;  3N6I A;  4X56 A;  2Y2L A;  5EFW A;  1BT5 A;  1S67 L;  1PYY A;  3ZYT A;  2W27 A;  5FQM A;  3N7W A;  5TBM B;  1IKG A;  3T1Q B;  2KOI A;  3KYE A;  3OCN A;  1NYY A;  2CC1 A;  4BL3 A;  2W1T A;  3GDI A;  4PM5 A;  1HZO A;  3ZQ5 A;  3C2W A;  2OAP 1;  3IF5 A;  4YIN A;  3MFD A;  1JWP A;  3NOT C;  1A0K A;  1YMS A;  5AQ7 A;  4EQI A;  3BLM A;  3M6H A;  1I2W A;  1GSV A;  3AGE A;  1NJ4 A;  3LIC A;  1GA9 A;  3CUE A;  4GDB A;  4K91 A;  3LR5 A;  1MY8 A;  1K57 C;  3VP4 A;  5CXW A;  3NCK A;  3A3D A;  2Z2L B;  4EQ1 A;  3SW1 A;  4OOY A;  4R3B A;  3LR0 A;  5FAO A;  3PBN A;  5CGW A;  1SDN A;  1FIL A;  4E3L A;  1XFN A;  2JKT M;  4IUK A;  2VEA A;  2HDQ A;  2Y2K A;  2VGJ A;  2OWH A;  3H7W A;  4B4Z A;  3HBR A;  2Y2M A;  2EX9 A;  4P85 A;  3T4K A;  2O9C A;  2IWB A;  4KG6 A;  5HX9 A;  4IVI A;  2XLN A;  3M6B A;  4HNB A;  4GHI B;  1KGG A;  3IX8 A;  2FZ0 A;  3KSF A;  1F5M A;  3SS3 A;  3TOI A;  1RP5 A;  2PAV P;  2Y2N A;  4B93 A;  2L1M A;  5KIZ A;  2LB5 A;  4R0Q A;  4ARZ B;  1GHM A;  4S2I A;  3KSI A;  2V1A A;  4C3Q A;  2VV6 A;  2V9A A;  2JN7 A;  4N1H A;  5JYO A;  4CLC D;  2XDM A;  4GW9 A;  1XA7 A;  3G30 A;  3IXB A;  1JTD A;  3IXH A;  2PR5 A;  3SH8 A;  3S7O A;  1RGZ A;  1P9W A;  4NG2 A;  3K3D A;  3QP4 A;  3IH9 A;  1OTB A;  2J8Y A;  3L7H A;  4EES A;  4JF5 A;  3GTC A;  5FAS A;  1KGE A;  4ZJ2 A;  5HL1 A;  3GQZ A;  1H5X A;  3VFH A;  3W4P A;  4LV2 A;  4EBP A;  1G68 A;  4CJN A;  3IHB A;  3T1R A;  2XRN A;  4DJ2 A;  4FH4 A;  1G5U A;  2P08 A;  1YAX A;  2XFT A;  1S6R A;  5IT5 A;  5M18 A;  1NY0 A;  3EOI A;  4WBG A;  2WGW A;  4OKP A;  5J4E A;  1EWZ A;  1H8M A;  3RJU A;  4HOI A;  1BTL A;  3CHW P;  3G2Z A;  4ZDX A;  5FDS A;  5CGS A;  1FIK A;  2HJ9 C;  3VP1 A;  5J8X A;  2O9A A;  4PMA A;  3BLS A;  1BUL A;  4R23 A;  5HW3 A;  3VP0 A;  4KZA A;  1SKF A;  4F3L A;  3RFB A;  2WAF A;  2V0W A;  2W3G A;  3MQO A;  3IF6 A;  3V3R A;  3CLO A;  4JXV A;  4P6B A;  4I3J A;  1S4S A;  1OTA A;  4DDS A;  5TJJ A;  4EBN A;  2WYX A;  4LGW A;  3A3J A;  2XR0 A;  4FCF A;  5GL9 A;  5F68 A;  1XXM A;  1D06 A;  4OP8 A;  3WS1 A;  2ZM2 A;  5DJU A;  2PRF A;  3OBF A;  3HUM A;  4JF6 A;  3B42 A;  3CPT B;  1KDW A;  5EVI B;  4PHT A;  5HFO A;  2EWW A;  4ZJ1 A;  3R7W A;  1ZKJ A;  4DN0 A;  4PKY G;  4BMW A;  1BYW A;  3PBR A;  4Y17 A;  1DJA A;  4GLQ A;  3LR4 A;  5HD5 A;  3UY6 A;  1F98 A;  4MBK A;  1F9I A;  2V2F F;  4G3K A;  3OOV A;  4I39 A;  1ESU A;  4OQG A;  5CEB A;  2ZMA A;  4E3N A;  2ZM0 A;  5EVE A;  2PBD P;  1MBL A;  1N4O A;  2IWD A;  3GV9 A;  3LYX A;  2P74 A;  1DJB A;  2WZZ A;  2QHK A;  3L9K A;  4R4S A;  3PBQ A;  4S2K A;  1BZA A;  4N1X A;  1M40 A;  4H6J B;  2HDU A;  1Q2P A;  3MJQ A;  4XUX A;  4UEY A;  3OPH A;  1V9Y A;  3PTE A;  2D01 A;  3ITA A;  3BYD A;  5EE8 A;  1M6K A;  4UQI M;  4HHD A;  3ZHH A;  2W3E A;  2PU4 A;  2W1T B;  4HES A;  2V0U A;  3DTK A;  4HEF A;  1G28 A;  4GN2 A;  2J80 A;  3FPW A;  5F6A A;  2FH5 A;  5FEF A;  1K56 D;  3LR3 A;  2CMN A;  1YLT A;  2KLI A;  3I7J A;  1DRM A;  3T4T A;  3BEB A;  1YLP A;  4UAA A;  5HDS A;  4NXE A;  3C7V A;  3PBT A;  1Y54 A;  3CUE C;  3G32 A;  3FYZ A;  4I3A A;  2QZ6 A;  3F1O A;  4FH2 A;  1PW1 A;  4EWF A;  2P9V A;  2J3W A;  3LIF A;  5EV0 A;  3TRC A;  3MS6 A;  2PHY A;  3NC8 A;  2JC7 A;  5DF7 A;  3UB6 A;  3VE3 A;  5A91 A;  1KE0 A;  3IWI A;  1SKO A;  4BWI A;  5DKL A;  3UDI A;  2RCX A;  3PAG A;  4OP5 A;  4U0X A;  3S7N A;  4K08 A;  3C4P A;  1PWG A;  3H7W B;  1KOU A;  3W4O A;  4MN6 A;  4RVA A;  1Z09 A;  4DXC A;  1K4F A;  2OLU A;  1C3B A;  2QKP A;  3MR0 A;  2HDS A;  4WZ5 A;  3MMH A;  3CI6 A;  2O99 A;  1HTZ A;  5L10 A;  1E3U D;  3G4P A;  4O7D A;  4HQA A;  3MXQ A;  1TD5 A;  2Y2G A;  4UA6 A;  4XXR A;  5F1G A;  1E25 A;  1IEM A;  4R6L A;  1CQA A;  2ZQ7 A;  4G3W A;  2UWX A;  4QB8 A;  4X69 A;  2VX8 A;  2ZJ9 A;  1PZP A;  2Q9N A;  1CJF A;  1P9R A;  5G4Y A;  5I5L A;  2LB9 A;  3HLW A;  4X25 A;  2Y79 A;  5E2F A;  4C6Y A;  3N8S A;  4GCZ A;  5TR7 A;  3RXX A;  4UHU A;  2HP5 A;  3HUN A;  2L4R A;  4QU3 A;  4WEL A;  1XKZ A;  2Y2P A;  3S22 A;  1K38 A;  3AGD A;  3QP2 A;  3RH8 B;  2P04 A;  3JPU A;  1P97 A;  2XQZ A;  2R9X A;  1MKM A;  2WKI A;  4MLL A;  3NI9 A;  2EFU A;  5U47 A; 
#chains in the Genus database with same CATH homology
 4NET A;  4R3B A;  3V5M A;  1FSW A;  1XP4 A;  1CEF A;  2WGW B;  3C7U A;  3C5A A;  3PBN A;  5FAO A;  2FFY A;  5CGW A;  1SDN A;  1GHI A;  2XFS A;  3CMZ A;  3EQV A;  3UDX A;  4QY5 A;  3DWZ A;  4Z9Q A;  2J9P A;  2PBY A;  2EX6 A;  5CEC A;  4E3L A;  5L2F A;  3MKE A;  4B4X A;  3BM6 A;  1IYO A;  2EX8 A;  4KZB A;  1L0G A;  3BFE A;  1KVL A;  4XUZ A;  3NDE A;  5EVL A;  5EVI A;  2A49 A;  5EEC A;  3DTM A;  4OOL A;  2HDQ A;  4EBL A;  4R1G A;  2Y2K A;  4Y0O A;  2VGJ A;  4E6X A;  3G2Y A;  3ZNY A;  3E2L A;  4B4Z A;  4WEK A;  5FDH A;  3HBR A;  4KZ4 A;  4R4R A;  2Y2M A;  2EX9 A;  4LCL A;  4OPZ A;  4P85 A;  2OSU A;  4JBF A;  4OQ0 A;  2IWB A;  1CI9 A;  4KG6 A;  5HX9 A;  4IVI A;  4QJG A;  3AGF A;  3G31 A;  3IH8 A;  2ZLY A;  4E6W A;  2XLN A;  2HDR A;  3M6B A;  3V50 A;  4BD0 A;  1VQQ A;  3IF6 C;  5GLB A;  3Q81 A;  3QHY A;  4X53 A;  2HPB A;  1FR1 A;  1H8Y A;  1KGG A;  4S2N C;  5FI2 A;  1L0E A;  2HP9 A;  1FQG A;  4Y0T A;  1YMX A;  2IWC A;  4GZB A;  3SS3 A;  3TOI A;  3UO9 A;  4JF4 A;  3BEC A;  1K4E A;  3MXR A;  3ZGA B;  5GLC A;  1HVB A;  1RP5 A;  3B3X A;  2Y2N A;  1W8Q A;  2XD5 A;  2H0Y A;  2E8I A;  4M3K A;  4MBH A;  3ISG A;  3PAE A;  4R0Q A;  3ZVW A;  1GHM A;  2WUQ A;  1JVJ A;  5M1A A;  1U60 A;  3Q7Z A;  4S2I A;  4FSF A;  3VOY A;  3IXD A;  4GDN A;  3NBL A;  4DDY A;  2WGI A;  4C3Q A;  1PWC A;  3VP3 A;  4OQH A;  3HRE A;  3FWL A;  4JLF A;  2XK1 A;  4N1H A;  4S2J A;  5JYO A;  3WS2 A;  2J7V A;  2XDM A;  1XA7 A;  2ZQD A;  4X55 A;  2Q9M A;  3G30 A;  1KE3 A;  2V20 A;  2XD1 A;  1K55 A;  4IVK A;  3IXB A;  3SH9 A;  3OPR A;  5FA7 A;  1JTD A;  3IXH A;  1L0F A;  5DF8 A;  4ID4 A;  3SH8 A;  1ZG6 A;  1ONH A;  3N8L A;  3ZG8 B;  1BLP A;  1RGZ A;  3VSL A;  3ZVT A;  4N92 A;  4GOG A;  1NZO A;  4OON A;  3IH9 A;  1MKI A;  2X01 A;  3PBO A;  2J8Y A;  1MWT A;  3CJM A;  5IHV A;  4JXG A;  4RYE A;  1K55 C;  4GD8 A;  4QD4 A;  4JF5 A;  3UN7 A;  1IEL A;  1K57 A;  1VM1 A;  2X02 A;  3GTC A;  5FAS A;  1KGE A;  2ZC5 B;  4ZJ2 A;  3HVF A;  4MBF A;  5HL1 A;  2XEP A;  3GQZ A;  1RGY A;  1H5X A;  2WK0 A;  3VFH A;  3W4P A;  4LV2 A;  1CEG A;  4WEJ A;  3VMA A;  5HAQ A;  2G2W A;  1E4D A;  4EBP A;  1G68 A;  4CJN A;  2BLS A;  1O07 A;  3IHB A;  5E2H A;  4Y7P A;  4FH4 A;  5FAQ A;  2H10 A;  5GHX A;  1W8Y A;  2A3U A;  2ZD8 A;  1YQS A;  3HLF A;  2Y2H A;  1Z6F A;  3LCE A;  1JTG A;  2EXB A;  2ZQA A;  2XFT A;  1S6R A;  3O88 A;  3UE1 A;  1ALQ A;  1RCJ A;  4IED A;  5M18 A;  2Y2J A;  1NY0 A;  3JYI A;  4RA7 A;  5CER A;  4WBG A;  2WGW A;  1K56 A;  4OKP A;  2XH9 A;  1L2S A;  4GD6 A;  1BLH A;  1XPB A;  1EWZ A;  3A3F A;  5EOE A;  3W8K A;  3BFG A;  1XA1 A;  3RJU A;  5HAP A;  1IYS A;  1BTL A;  3W4Q A;  3SOI A;  1JWZ A;  4LEN A;  4JPM A;  4WM9 A;  3G2Z A;  4KZ7 A;  2PU2 A;  3NIA A;  3P09 A;  4ZDX A;  5F83 A;  5CGS A;  3UNW A;  3ZFZ A;  4RX2 A;  1TDG A;  3VP1 A;  5KSH A;  5J8X A;  3CG5 A;  4PMA A;  3BLS A;  1BUL A;  4R23 A;  4N9L A;  3VP0 A;  5HW3 A;  1QME A;  4KZA A;  5AQ9 A;  1FSY A;  4PM7 A;  4DXB A;  2EFX A;  3IXG A;  1NYM A;  1SKF A;  2WAF A;  3IHA A;  3MZE A;  2VGK A;  3Q07 A;  1QMF A;  4OLG A;  1H8Z A;  3MZD A;  3N4I A;  4JXW A;  5DVA A;  5DTS A;  4S2O A;  5CTM A;  4KQR A;  3GSG A;  3IF6 A;  4U3T A;  3ITB A;  3V3R A;  4E3J A;  4S2N A;  4JXV A;  4P6B A;  1CI8 A;  3OPL A;  4DDS A;  5EVI D;  1KDS A;  4EBN A;  2WYX A;  4U0T A;  3QNB A;  2ZC7 A;  3A3J A;  1XGJ A;  4P87 A;  5GLA A;  4KQQ A;  3UDF A;  3ZG9 B;  2XR0 A;  5FQ9 A;  1ZG4 A;  4GKU A;  4FCF A;  3V3S A;  5GL9 A;  1JWV A;  1GHP A;  3HLE A;  2C5W B;  2Y91 A;  1PI5 A;  4KG5 A;  1WYB A;  1NZU A;  1XXM A;  2P9V B;  3Q82 A;  2R9W A;  4OP8 A;  3SS4 A;  3M2K A;  3WS1 A;  2ZM2 A;  3Q7V B;  3G35 A;  4KZ9 A;  4KZ6 A;  1ERO A;  4KZ8 A;  4K0X A;  3HUM A;  1J9M A;  5FAT A;  4JF6 A;  1NXY A;  4OQI A;  3IWO A;  1YLZ A;  1KDW A;  5EVI B;  5HFO A;  4S2L A;  3P98 A;  4ZJ1 A;  1ZKJ A;  1I2S A;  1S0W A;  5HAR A;  1SHV A;  3NDG A;  1ES4 A;  2QMI A;  1YT4 A;  1AXB A;  3PBR A;  3LY4 A;  5F82 A;  4DKI A;  1ES5 A;  4DE2 A;  1DJA A;  2G2U A;  4ZTK A;  4EV4 A;  1W79 A;  5KMW A;  3FKV A;  1O7E A;  1PWD A;  3BRM A;  4GB7 A;  3UE3 A;  5FQJ A;  3UPN A;  3UY6 A;  4MBK A;  3S1Y A;  2V2F F;  1E3U A;  2WGV A;  2XGN A;  4HBU A;  1K6R A;  3ZNT A;  4CPK A;  5CED A;  1ESU A;  3HLD A;  4KZ5 A;  4LV1 A;  2B5R A;  4KG2 A;  5DTK A;  1ESI A;  4OQG A;  3UE0 A;  5CEB A;  5EOO A;  2ZMA A;  4X68 A;  1G6A A;  1LI9 A;  4E3N A;  2ZM0 A;  3IQA A;  4QHC A;  2JCH A;  3S4X A;  1I5Q A;  1MBL A;  2Y2I A;  1N4O A;  4B88 A;  2IWD A;  3FKW A;  3GV9 A;  5CGX A;  3LY3 A;  2Y2Q A;  4WZ5 C;  2P74 A;  4KQO A;  2ZQC A;  2Z2M B;  1MWU A;  1FR6 A;  1KVM A;  1DJB A;  2WZZ A;  4PM8 A;  1TDL A;  1WE4 A;  3C4O A;  4R4S A;  2X71 A;  5F1F A;  4MEZ A;  1LL9 A;  3PBQ A;  4S2K A;  1N9B A;  1IYP A;  5GLD A;  1K25 A;  3M2J A;  1BZA A;  4BJP A;  4N1X A;  4E3M A;  1SCW A;  2BG1 A;  1LHY A;  1M40 A;  3OC2 A;  4ZJ3 A;  3O3V A;  3WRZ A;  2HDU A;  4KEN B;  3GRJ A;  2ZC3 B;  3E2K A;  1LI0 A;  1Q2P A;  4N9K A;  5A90 A;  2WKE A;  1HD8 A;  2DNS A;  3EQU A;  4DE3 A;  3HL9 A;  5E2G A;  4BD1 A;  3FV7 A;  4XUX A;  5AQB A;  1GA0 A;  4WMC A;  1BLS A;  3OCL A;  2ZC6 B;  3OPH A;  3PTE A;  3WS5 A;  4YFM A;  5FQI A;  4BQM A;  1KGF A;  1MXO A;  3ITA A;  3QNC A;  4RX3 A;  4UA7 A;  1LLB A;  3BYD A;  1M6K A;  4PM6 A;  5EE8 A;  4DF6 A;  3D4F A;  3DW0 A;  3ZHH A;  3TSG A;  2PU4 A;  4HES A;  4R3J A;  5TGF A;  2H5S A;  4OPR A;  2GDN A;  1XGI A;  2JE5 A;  4HEF A;  3GMW A;  5FQK A;  4GN2 A;  3WWX A;  2J9O A;  3HLB A;  2EXA A;  4DE1 A;  1K56 D;  2DRW A;  4BL2 A;  1PIO A;  3MBZ A;  1YLT A;  3I7J A;  4UA9 A;  4ZBE A;  3GR2 A;  1BSG A;  1YLJ A;  5EUA A;  3ZG0 A;  3BEB A;  1FCO A;  1ZC2 A;  1YLP A;  3V39 A;  4UAA A;  4OH0 A;  4IBR A;  2ZM8 A;  4ZAM A;  5FAP A;  4E3I A;  2WAD A;  3C7V A;  1W7F A;  3PBT A;  5G18 A;  3VSK A;  3FZC A;  1IKI A;  1Y54 A;  1OME A;  1PW8 A;  3PBS A;  4WZ4 A;  5EPH A;  4BEN A;  4BLM A;  3G32 A;  5FQQ A;  4OPQ A;  5CHU A;  3FYZ A;  3HUO A;  5DF9 A;  5I94 A;  1BUE A;  2QZ6 A;  1FCM A;  5A93 A;  4L0L A;  4FH2 A;  1PW1 A;  4EWF A;  2ZC4 B;  1EI5 A;  2P9V A;  3Q1F A;  2OLV A;  2I72 A;  2JBF A;  3CZD A;  3Q7V A;  1LL5 A;  4H8R A;  5HAI A;  4C75 A;  5DTT A;  3NC8 A;  2JC7 A;  2RL3 A;  5FSR A;  3LO7 A;  5DF7 A;  2ZQ9 A;  4WYY A;  3WS4 A;  5GHZ A;  5A91 A;  4S2P A;  4X6T A;  5KSC A;  4LV0 A;  5FI6 A;  5JYP A;  1KE0 A;  3IWI A;  2WAE A;  1ES3 A;  1MPL A;  3UDI A;  2RCX A;  3PAG A;  4OP5 A;  1IYQ A;  4E3O A;  4U0X A;  3IF6 B;  3RXW A;  5TFQ A;  5CHJ A;  4F94 A;  3C4P A;  1PWG A;  1L0D A;  1XX2 A;  2V1Z A;  1MWR A;  5EVI C;  3W4O A;  3ZDJ A;  1K54 A;  3VP2 A;  4P0M A;  4RVA A;  2EX2 A;  4OLD A;  4DXC A;  1K4F A;  2OLU A;  3VOZ A;  1C3B A;  5D3O A;  1W5D A;  4KZ3 A;  3WS0 A;  3VFF A;  3BFC A;  2HDS A;  2Y4A A;  3G34 A;  4WZ5 A;  1ERQ A;  1TVF A;  5A92 A;  1HTZ A;  3DWK A;  5CHM A;  3MKF A;  1SDE A;  3HLG A;  3HLC A;  2XF3 A;  1E3U D;  1K54 C;  3G4P A;  4S2M A;  4LCM A;  1PI4 A;  3A3E A;  4O7D A;  1KE4 A;  4MNR A;  4EUZ A;  2WKH A;  2Y2G A;  3IWQ A;  3SH7 A;  4UA6 A;  4HBT A;  2FFF B;  3A3I A;  1DY6 A;  2DCF A;  3WRT A;  1FCN A;  5E2E A;  1GCE A;  4JKT A;  4JXS A;  4XXR A;  4D2O A;  4Y0U A;  5F1G A;  4NK3 A;  1CK3 A;  1YLY A;  2ZQ8 A;  2HP6 A;  3IT9 A;  3O86 A;  4OOM A;  3ZG7 B;  3SS5 A;  4Q8I A;  3ZCZ A;  4OVD A;  5AQA A;  1ONG A;  3N6I A;  4OPY A;  1E25 A;  1IEM A;  4X56 A;  2Y2L A;  1BT5 A;  2Y2O A;  3GVB A;  2ZQ7 A;  1PYY A;  4A5R A;  2UWX A;  1BLC A;  4QY6 A;  4QB8 A;  4X69 A;  1MWS A;  3LEZ A;  5FQM A;  2ZJ9 A;  3N7W A;  1IKG A;  1K6S A;  1PZP A;  1WYC A;  2Q9N A;  2Y59 A;  3OZH A;  4GNU A;  3OCN A;  5KZH A;  1DJC A;  3UPP A;  1NYY A;  2CC1 A;  4BL3 A;  4PM5 A;  1HZO A;  3HLW A;  3IF5 A;  3BFD A;  4WMC D;  4E3K A;  4YIN A;  2QPN A;  3MFD A;  3N8R A;  1JWP A;  5E2F A;  1YMS A;  4C6Y A;  3N8S A;  1ERM A;  2WZX A;  5TR7 A;  5AQ7 A;  1PZO A;  3RXX A;  2Y55 A;  2C6W B;  4UHU A;  4EQI A;  2HP5 A;  3BLM A;  3HUN A;  1FOF A;  3M6H A;  4WEL A;  4QU3 A;  1I2W A;  5M19 A;  1XKZ A;  3BFF A;  2Y2P A;  3S22 A;  1K38 A;  4IBX A;  5CTN A;  4DE0 A;  3AGE A;  3AGD A;  3OPP A;  1NJ4 A;  4DRT A;  1GA9 A;  5BOH A;  4GDB A;  5FI7 A;  2OV5 A;  1YLW A;  4K91 A;  3ZG5 A;  1MY8 A;  4FD8 A;  1K57 C;  3VP4 A;  3TG9 A;  4LV3 A;  1TEM A;  1ES2 A;  1NRF A;  5CXW A;  5GHY A;  3NCK A;  3A3D A;  5E43 A;  2XQZ A;  2R9X A;  3MXS A;  1YM1 A;  3O87 A;  3MZF A;  2WKI A;  5CRF A;  3NY4 A;  2H0T A;  4MLL A;  3UPO A;  4PPR A;  4K0W A;  2Z2L B;  3NI9 A;  1Q2Q A;  2EFU A;  4PM9 A;  4OOY A;  5U47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...