1GHIA

Structure of beta-lactamase glu166asp:asn170gln mutant
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
257
structure length
257
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYDIELQYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Structures of the acyl-enzyme complexes of the Staphylococcus aureus beta-lactamase mutant Glu166Asp:Asn170Gln with benzylpenicillin and cephaloridine.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 89
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ghiA00
2I72A 1C3BA 2IWCA 3UDFA 4GDBA 1IELA 2WKEA 3N8LA 4IEDA 4P85A 1W5DA 4WZ5A 2QMIA 1FCMA 5CHJA 3WRZA 5E2HA 1SDEA 5EVIA 4FH4A 1PIOA 1GHPA 5AQ7A 5CHUA 3V50A 1FR1A 5J8XA 3WS0A 3ITBA 1KDSA 3GTCA 3M6HA 3UY6A 2Q9NA 1ES2A 2EFUA 3A3EA 4E3LA 3N4IA 5HAQA 5JYPA 4Y0UA 3DTMA 3IWIA 4E6XA 5KSHA 1SCWA 2P9VB 1ES4A 3OCLA 2Y59A 5CTMA 5HL1A 5F83A 3HLFA 2WGVA 4U0TA 3ZG9B 3ZG7B 2PU4A 1E3UD 1HD8A 2Y2IA 3CG5A 4LV1A 4OH0A 1PWGA 2WUQA 1K55A 4C6YA 5AQBA 3HREA 5FQIA 4EUZA 3SS4A 1TVFA 5U47A 3BFCA 5EVIB 4P0MA 2ZQCA 3QNCA 4RX2A 4OOYA 1JTDA 2VGJA 3G35A 5DF8A 1L0EA 3HLDA 3O86A 4EBLA 4MBKA 4DF6A 3C4PA 1I2WA 1PWDA 3IF6B 4IVKA 1E4DA 4DE0A 3V3SA 3VFHA 3NI9A 1XPBA 3M2JA 2X01A 5M19A 4M3KA 2J7VA 4GB7A 5DF9A 2HDUA 3A3IA 5GL9A 2ZC3B 3VMAA 2EX9A 1K57C 3NCKA 4JBFA 1MBLA 2JC7A 4N9KA 5EVID 4S2MA 1K56A 4XUXA 3IT9A 1KVLA 3BRMA 3HLGA 4UA7A 3C5AA 1VM1A 4OLDA 1G6AA 4ZBEA 1TDLA 4GD6A 3MZDA 5CXWA 4C75A 4E3NA 4E6WA 3M2KA 1XA1A 3PAGA 4D2OA 2PBYA 4UA9A 3ZCZA 2QPNA 2WKHA 1BLCA 1GCEA 2C6WB 1YLWA 3ZG5A 2JBFA 1ZKJA 2JCHA 3C7VA 3SS3A 3GVBA 1J9MA 1ES3A 1MY8A 2FFYA 3D4FA 4DE2A 5FAPA 5GHXA 1GHMA 3WRTA 1YLJA 5FQMA 1MWSA 3N7WA 1ONHA 1DJBA 1YMSA 2FFFB 1YQSA 1JWZA 5HAPA 1L2SA 1LI0A 1M6KA 2Y2MA 1JWVA 1BTLA 5GLAA 4KG2A 2H10A 2V20A 3LO7A 4JLFA 3HBRA 3Q7ZA 1YMXA 3BECA 3IXGA 1GHIA 2EX2A 3PBRA 4OP8A 5FI6A 5CTNA 2R9XA 3SOIA 2CC1A 3WS5A 3PBTA 3N8RA 3G4PA 1K25A 4BLMA 3VSLA 4BL2A 1GA9A 1K4FA 1N4OA 4QY5A 3ZVWA 3UPOA 3ZG8B 2IWBA 4OPQA 4HBTA 1IYPA 2PU2A 5EOOA 3VP0A 2Y55A 3BFDA 3O3VA 1IKGA 1H8ZA 2XEPA 4R4SA 1KE4A 4K0XA 4JXVA 5DF7A 3GQZA 5AQ9A 4OLGA 4OVDA 2Y2GA 1N9BA 3IH9A 4LENA 2XR0A 5CERA 3LY3A 1TEMA 5CGXA 4KZ4A 1K54C 5FQJA 3UE0A 4XXRA 5E2GA 3ZGAB 3QHYA 2ZC5B 1O07A 2DRWA 3NDEA 1ALQA 1TDGA 2XH9A 5EVLA 2ZC6B 5GHZA 2P74A 4MLLA 1M40A 2HDQA 4DRTA 1NRFA 4X69A 3G2ZA 5KSCA 4HESA 1FR6A 3HUNA 4KQOA 5CGWA 4NK3A 4EV4A 1NYMA 4S2LA 1E25A 3IWOA 1SHVA 2H0YA 3C7UA 3W8KA 5KZHA 4S2NC 3GMWA 4GOGA 3NBLA 1W79A 3E2LA 3MXSA 4OKPA 1BLHA 1CEFA 1VQQA 2J9PA 3OC2A 4KZAA 4IBXA 3SH7A 1W7FA 3BFFA 1PZOA 5HARA 5TGFA 4LV3A 3V5MA 3FKVA 1ONGA 1LLBA 2HP5A 3G31A 2ZQDA 5CEDA 3O87A 1K4EA 1RCJA 3HUOA 1LHYA 1YLZA 3HL9A 3PBQA 1Q2PA 3IF6A 2Y2KA 3ZVTA 5M18A 3HLBA 1PI5A 4IVIA 3UE3A 1K6RA 4R3JA 5A93A 1PYYA 1MXOA 2G2UA 1JVJA 4OPZA 1WYCA 3TG9A 5IHVA 5A90A 2HDSA 4E3JA 1ZC2A 2WGWA 3HLCA 4KG5A 3BFEA 1FQGA 3IF5A 2XD5A 4FSFA 1QMEA 4BENA 3NIAA 1JTGA 3GRJA 3GV9A 5TFQA 1EI5A 4EBNA 1K57A 3WS2A 1EWZA 1ERMA 3RJUA 1PZPA 2XK1A 4LCMA 4WBGA 5EECA 1ES5A 1SDNA 4UHUA 2X02A 1MWUA 2XDMA 2X71A 3FWLA 3OPHA 4S2PA 4FD8A 1ZG6A 4WZ5C 2RCXA 2H0TA 3A3JA 3UN7A 4OOMA 3I7JA 4PM7A 2HPBA 2OSUA 4MBHA 4MBFA 4QB8A 5L2FA 4K91A 5GHYA 2WGWB 4B4ZA 4Y0TA 4R4RA 4WEJA 3CZDA 4L0LA 4ZJ3A 5AQAA 1ZG4A 4H8RA 4CPKA 2G2WA 4OONA 4DE3A 2HP9A 3IWQA 1NZUA 4PM5A 4QY6A 3SH9A 1KE3A 4NETA 2J9OA 3N6IA 3PBNA 1EROA 1K38A 3OPLA 3Q81A 2WGIA 2EXAA 3MXRA 5FDHA 4KENB 3VP3A 5F1GA 1G68A 4WELA 5HFOA 4WZ4A 4DDSA 2ZM2A 1W8QA 5BOHA 1IEMA 2Y2LA 3DWKA 3S22A 2VGKA 3PAEA 1IYSA 2WAEA 1KE0A 5JYOA 5GLCA 4R0QA 3TSGA 2Y2JA 4WEKA 4GD8A 2WAFA 4ZDXA 4RX3A 3ZNTA 2WYXA 5EPHA 2ZJ9A 1RGZA 2Q9MA 1H8YA 3BLMA 3PBOA 4YFMA 4ZAMA 3RXXA 3VSKA 1LL5A 2EX8A 4KZ5A 3LEZA 1O7EA 3A3DA 3IXDA 4S2JA 1L0DA 4JPMA 1NXYA 3Q82A 1IYQA 1ESIA 1I2SA 4BD0A 5F1FA 1WYBA 1XGJA 3V39A 3QNBA 1CEGA 3DWZA 5G18A 3SH8A 1YT4A 1Q2QA 4HBUA 4EBPA 1QMFA 4LV2A 4GN2A 1KGGA 4DXCA 4R23A 2WKIA 2B5RA 3MZEA 4OQIA 5FASA 3BFGA 2Y2QA 4GDNA 4OOLA 4Y7PA 4Z9QA 3S1YA 3VP1A 1K56D 4KZ7A 5HW3A 3V3RA 1CK3A 5DTSA 1L0FA 4Y0OA 5CECA 1XXMA 3CMZA 3FZCA 3LY4A 3DW0A 3GSGA 1OMEA 3VOYA 3ZFZA 3IXBA 3LCEA 5CHMA 1CI9A 4C3QA 5FI7A 2XFSA 2WZZA 1XX2A 3WS1A 4WYYA 2ZC4B 4JF4A 4PMAA 3IHBA 4N1HA 4RVAA 4RYEA 5E43A 1YLYA 5EUAA 2A3UA 4E3IA 3RXWA 4CJNA 3E2KA 2Y2OA 4OPYA 4OQGA 4U0XA 2Y2PA 4BJPA 4DKIA 3AGFA 3A3FA 3Q7VA 4X56A 2OV5A 3W4PA 4ID4A 2GDNA 4EWFA 5FI2A 3ZNYA 3MFDA 5I94A 1BUEA 2JE5A 5EE8A 4OQ0A 4N1XA 2C5WB 4S2OA 1H5XA 1ERQA 1BULA 2UWXA 3P98A 5E2EA 3HLWA 1PW8A 4MEZA 1CI8A 2XD1A 5CGSA 3MKEA 4Q8IA 5KMWA 3IQAA 2H5SA 4GNUA 5FQKA 3M6BA 1BLSA 1MPLA 3FV7A 3HLEA 3MKFA 5FSRA 4HEFA 1Y54A 4S2IA 1KDWA 5GLDA 5GLBA 3S4XA 2DCFA 4B88A 1KGFA 1ESUA 4O7DA 3VP4A 5FQ9A 4ZJ1A 3W4QA 2XLNA 5A92A 2E8IA 2DNSA 3Q7VB 3VFFA 1MKIA 3MBZA 3W4OA 5M1AA 3GR2A 4X53A 1IKIA 4JXWA 5CRFA 4N92A 3ZDJA 3BM6A 4X6TA 1NZOA 2BLSA 3G2YA 3OZHA 4E3OA 1LI9A 3FKWA 3AGEA 5EVIC 1NY0A 3UO9A 3C4OA 4MNRA 3EQUA 2HDRA 4QHCA 3OPRA 3B3XA 2XGNA 2RL3A 4DE1A 2V1ZA 1FCOA 4U3TA 1S6RA 4QJGA 2EFXA 2ZLYA 3UDXA 3IF6C 5FA7A 1XP4A 4BQMA 1BT5A 3MZFA 4OQHA 3BYDA 1FSYA 1PWCA 3UPNA 1PI4A 3FYZA 4FH2A 4N9LA 4YINA 3PBSA 1WE4A 1BSGA 1U60A 3IXHA 4X55A 3OPPA 4QU3A 1HTZA 4KG6A 1K55C 3PTEA 4BL3A 4F94A 2EX6A 1K6SA 2A49A 4KZ6A 5FAQA 3ZHHA 1RGYA 2R9WA 5E2FA 4DDYA 1FSWA 5FQQA 4PPRA 2Y2NA 3TOIA 4KZ9A 4OPRA 4WMCA 4A5RA 4R3BA 4WM9A 4RA7A 3BEBA 4LV0A 1XGIA 4JF6A 3Q07A 4S2KA 2IWDA 2Y4AA 3WWXA 4PM6A 4K0WA 4P6BA 4X68A 2ZM0A 1XA7A 1YM1A 4JF5A 1DY6A 1AXBA 5TR7A 1I5QA 2QZ6A 3NC8A 1GA0A 3VOZA 3BLSA 1MWRA 3AGDA 2Z2MB 3JYIA 3N8SA 1BZAA 2ZQAA 4OP5A 1FOFA 3IHAA 4QD4A 2XF3A 3HVFA 2OLVA 4B4XA 4JKTA 1S0WA 4XUZA 3UNWA 1K54A 2ZQ8A 4E3MA 2ZMAA 4PM8A 1HZOA 2WADA 1NYYA 5DTKA 4GZBA 3SS5A 4KZBA 4R1GA 3G34A 4E3KA 3UPPA 3G32A 1NJ4A 3G30A 4DXBA 5EOEA 5HAIA 3NY4A 4KZ3A 1RP5A 5FAOA 1DJAA 4PM9A 1DJCA 2HP6A 4ZTKA 4S2NA 3ITAA 3OCNA 5DTTA 3UDIA 4UA6A 5DVAA 4ZJ2A 3WS4A 4UAAA 3IH8A 2ZQ7A 3UE1A 5D3OA 1YLTA 5F82A 4IBRA 4KZ8A 4P87A 1HVBA 1FCNA 4GKUA 4LCLA 3HUMA 4WMCD 3ZG0A 1E3UA 1W8YA 3P09A 2ZC7A 3EQVA 1PW1A 2XFTA 2OLUA 5FATA 1LL9A 3Q1FA 5CEBA 3VP2A 2ZD8A 4JXGA 1KGEA 2Y2HA 2XQZA 4JXSA 2ZM8A 1IYOA 5HX9A 1L0GA 4KQQA 3O88A 2Z2LB 1YLPA 4FCFA 1MWTA 1Z6FA 3NDGA 1XKZA 3ISGA 5A91A 2P9VA 2WK0A 1BLPA 2BG1A 2EXBA 1KVMA 1SKFA 2J8YA 4KQRA 2V2FF 2WZXA 2Y91A 2ZQ9A 4BD1A 1JWPA 3CJMA 4EQIA
chains in the Genus database with same CATH superfamily
3T1RA 1N9NA 2QMIA 1S4RA 5I5LA 5E2HA 3WS0A 3ITBA 3T4OA 1KDSA 2ZMVA 3N4IA 5HAQA 5JYPA 3MJQA 1WA9A 5C5KA 4DMZA 5KSHA 2B95A 5CTMA 5HL1A 3ZG9B 1YKDA 3H7WB 4IUHA 3CG5A 4LV1A 3JPUA 1K55A 4C6YA 3HREA 1MC0A 2D02A 1AWIA 3IS2A 4RQ9A 2ZQCA 3K3CA 4RX2A 5DKKA 4EUVA 2J3WA 4MBKA 1E4DA 2PDRA 4B93A 1Y4OA 3T4SA 3M2JA 4GB7A 4HJ6A 5GL9A 3IBJA 1MBLA 4GS9A 4IHQA 4N9KA 5EVID 1N9LA 3C5AA 1NRJA 2WKPA 3MZDA 4JGRA 3VV4A 1GCEA 1YLWA 5DKLA 1MY8A 1FIKA 3D4FA 3K2NA 3WRTA 1YLJA 5FQMA 1ONHA 1DJBA 2FFFB 2L4RA 3B47A 5HAPA 1M6KA 5HPIA 5GLAA 2VV7A 3U4LP 3BJNA 3N8RA 3G4PA 2Z6DA 1GA9A 3UPOA 3ZG8B 4HBTA 2V8FA 5EOOA 2Y55A 3BFDA 3O3VA 1H8ZA 3GQZA 4OLGA 4OVDA 1SKOA 2EWVA 2VGLM 2XR0A 3KX0X 3LY3A 4LENA 3S7QA 5CGXA 1K54C 2FZ0A 3UE0A 3QHYA 1TDGA 5HWVA 5L09A 3UB7A 4MLLA 1M40A 2HDQA 2KLIA 2A24B 3F1OA 4X69A 5KSCA 4HESA 4NK3A 4S2LA 1SHVA 3NBLA 1YPRA 1BLHA 3SH7A 3QP6A 4LV3A 3G31A 3O87A 1K4EA 1LHYA 1YSPA 1YLZA 3PBQA 3IF6A 3ICYA 3ZVTA 4IVIA 3UE3A 1K6RA 3LEQA 4OPZA 2HDSA 1ZC2A 3BFEA 4BENA 3GRJA 3GV9A 2A2LA 4NEED 4BWIA 3R4KA 2ZL1A 4LCMA 2GX5A 2XK1A 1SDNA 2XDMA 4G3WA 1NLZA 3VE4A 1PRQA 3UN7A 3I7JA 4PM7A 4MBHA 1ZHHB 3OBFA 5L2FA 1P0ZA 4B4ZA 4R4RA 1GSWA 4IJGA 4L0LA 3OOVA 4ZJ3A 5AQAA 1ZG4A 2ZOIA 4H8RA 4DE3A 1NZUA 3SH9A 4NETA 1D7EA 2WGIA 4KENB 5F1GA 5HFOA 4WZ4A 3PYPA 1N9OA 3PAEA 3B33A 4ZDXA 4RX3A 3ZNTA 3QP4A 1OTEA 1O7EA 3IXDA 4S2JA 3HJKA 3V39A 4EESA 2Q0OA 3KO6A 2G7UA 4LV2A 4HOIA 5HL6A 3D9YA 4L9FA 3BFGA 3S1YA 4KZ7A 3CMZA 2VGLS 3FZCA 3GSGA 4WL9A 3L7HA 1XX2A 2JKRI 2ZC4B 4PMAA 3IHBA 2O9AA 1YLYA 3RXWA 1G5UA 3SZTA 4DKIA 4DN0A 5AVFA 4ID4A 3ZNYA 1CF0A 2B18A 4Q0JA 4Y13A 3A0VA 4S2OA 2UWXA 3HLWA 5KMWA 2H5SA 3MKFA 1S67L 1TS8A 1KGFA 1ESUA 2W0NA 2XLNA 2OWJA 3VFFA 3MBZA 5M1AA 3GR2A 4X53A 4N92A 1NZOA 2BLSA 3AGEA 1NY0A 3UO9A 4MNRA 3TE8A 5HDSA 4QHCA 3B3XA 1PFLA 4QJGA 3UDXA 5FA7A 3MZFA 3NOUC 5EM1A 1G6OA 5G4ZA 3PR6A 4N9LA 1BSGA 4GJ4A 4X55A 3OPPA 2EX6A 1K6SA 5FAQA 2R9WA 5E2FA 5FQQA 2D01A 2J3TC 4WMCA 4R3BA 2HV1A 4R38A 3Q07A 4BMWA 2W3EA 3WWXA 1T1AA 3IS2B 5F5YA 5TR7A 5TJJA 2BASA 4MN6A 1I5QA 2AVXA 3N8SA 3JYIA 1T19A 1Z09A 5HSQA 4OP5A 2XF3A 3O5YA 1YSQA 1S0WA 4EEUA 1LSWA 1NYYA 2MJ6A 3G34A 3UPPA 1NJ4A 5HAIA 3NY4A 4PM9A 5DTTA 4EXOA 4ZJ2A 3WS4A 4P87A 4GKUA 1D06A 2ZC7A 1OT6A 1PW1A 1UWPX 2XFTA 5FATA 5CEBA 2M7UA 1IYOA 5HX9A 4KQQA 2Z2LB 2M7VA 3EEAA 3NDGA 1XKZA 3ISGA 2ZBBA 1BLPA 2WK0A 1OT9A 2V2FF 4BD1A 3HLCA 1C3BA 4GDBA 1OJ5A 2WKEA 4IEDA 5EM0A 4WZ5A 3CUEC 4KUOA 5EVIA 2PD7A 5AQ7A 3KYZA 5HD5A 1SKOB 3M6HA 2Q9NA 5LBRA 2Y8HA 3DTMA 4LRYC 1SCWA 1ES4A 2Y59A 5AVEA 3SW1A 4GCZA 5F83A 3HLFA 4U0TA 1HD8A 2QJ5A 4OH0A 1PWGA 1JNUA 4UEYA 3BFCA 2PR6A 3P7NA 4OOYA 1JTDA 3G35A 5DF8A 2V0WA 3MXQA 3IF6B 1XFQA 4DE0A 1Y28A 3VFHA 3NI9A 1MZUA 5M19A 2P08A 2EA9A 3A3IA 3EOIA 2EX9A 1K57C 4S2MA 3LUQA 1KVLA 3BRMA 1VM1A 2PD8A 4YNRA 4E3NA 4E6WA 3M2KA 3PAGA 2PBYA 4HJ4A 2JKTI 2C6WB 4PKYA 3LFVA 2JBFA 1ZKJA 3GVBA 1J9MA 2FFYA 2KOIA 5FAPA 1DP9A 5GHXA 5HDDA 1MWSA 4EEPA 2HJ9C 1JWZA 2PAVP 2J3TD 2UV0E 4F3LB 2H10A 3LO7A 2EX2A 3PBRA 2JN7A 2CC1A 3T1SA 4WF0A 4Y17A 1S1ZA 3VSLA 4BL2A 1K4FA 1N4OA 4QY5A 3ZVWA 1IYPA 1H8MA 3FPVA 2XEPA 1LL8A 1P9WA 4FTXA 5AQ9A 2VK3A 2QYBA 4KZ4A 4XXRA 2ZC5B 2P04A 2DRWA 3NDEA 3RH8B 1ALQA 5EVLA 2ZC6B 4NXFA 4DRTA 1NRFA 1FR6A 5CGWA 2R78A 3TRCA 1E25A 3W8KA 5L8MA 4S2NC 4GOGA 1K0KA 4Y15A 3E2LA 1CEFA 2J9PA 3BFFA 2WKRA 3FKVA 1DRMA 1ONGA 1RCJA 3HUOA 3HL9A 1Q2PA 4R3JA 2P7JA 5A93A 1PYYA 5IHVA 4FSFA 1QMEA 3NIAA 1JTGA 1VEUA 4EBNA 3WS2A 1TS0A 2V9AA 1ERMA 4I3AA 3FWLA 3OPHA 2RCXA 2NUTC 2PR5A 2XA7M 5TBMA 2WGWB 3LIBA 4EU0A 1GSVA 4Y0TA 4WEJA 3H82A 1V9YA 3E4QA 3IWQA 1OJGA 1VETB 4Y5FA 4PM5A 3N6IA 1EROA 1K38A 1XFNA 3OPLA 5FDHA 2W27A 1G68A 4WELA 3TJZC 2OWHA 4MN7A 3DWKA 4DJ2A 4R0QA 4GD8A 2WAFA 4GHIA 4PAUA 2PBDP 1RGZA 1H8YA 3PBOA 4YFMA 1LL5A 3T4KA 3A3DA 3T1XA 1H3QA 3LIAA 1IYQA 1ESIA 1I2SA 1H0MA 1XGJA 2YKFA 1F9IA 3C38A 3QNBA 3SH8A 3DWZA 1Q2QA 2O99A 1QMFA 5FEFA 4PKYG 2VLGA 4Q0IA 4GDNA 4OOLA 3R7WB 3BY9A 1XXMA 3LY4A 2K7SA 2KDKA 3LCEA 5FI7A 2WZZA 4YWZA 4JF4A 5E43A 3LYXA 4Q0HA 2ZOHA 4E3IA 3LIDA 4OPYA 4U0XA 3AGFA 1DP6A 2GDNA 3MFDA 2JE5A 4ETZA 5EE8A 4OQ0A 2C5WB 1ERQA 5CGSA 3H9WA 3IQAA 3M6BA 3FV7A 3DTIA 1KDWA 5GLBA 2DCFA 4B88A 3DTKA 4O7DA 3U2AA 5FQ9A 3F1PB 4I39A 5A92A 1EW0A 4CLCD 2DNSA 3Q7VB 5KIZA 2PT7A 3T4QA 4CLCE 1HLUP 4JGOA 2ACGA 4X6TA 3IX3A 4E3OA 1VB6A 2XA7S 4HIAA 3OPRA 4KQDA 1P97A 2XGNA 4G3KA 2V1ZA 1FCOA 3VOLA 1S6RA 2QWSA 2ZLYA 3IF6C 1XP4A 4OQHA 3BYDA 1PWCA 4YINA 1WE4A 3DAVA 5AJGA 1L3LA 4BL3A 2A49A 4KZ6A 4ETXA 4H6JA 1RGYA 4DDYA 1FSWA 4PPRA 4A5RA 2W3FA 3CPTB 2BTFP 2INWA 4NXEA 4PM6A 4K0WA 4WLAA 1YM1A 4JF5A 1J3WA 1DY6A 3VOZA 3BLSA 3AGDA 2Z2MB 1BZAA 5EV0A 1FOFA 4QD4A 3HVFA 1TD5A 2OLVA 3A0SA 4XUZA 3UNWA 4ARZA 4WN5A 2WADA 4WUJA 3SS5A 1XJ3A 2JKGA 3MR0A 4UAAA 4UQIM 3IH8A 1A0KA 3UE1A 5F82A 1W8YA 2GJ3A 5FL3A 4DJ3A 3Q1FA 2ZD8A 5FDSA 2Y2HA 4JXSA 3MFXA 1VHMA 3C2WA 1L0GA 1Z6FA 2EXBA 2BG1A 1SKFA 4KQRA 4IUKA 2ZQ9A 1JWPA 4EQIA 3W2ZA 3H7WA 1IELA 3N8LA 3RTYA 1IOUA 1SDEA 4FH4A 4FUWA 1GHPA 1FR1A 2Z6CA 3A3EA 1ES2A 2EFUA 2PHYA 3B42A 4E6XA 2P9VB 3OCLA 3ZG7B 1E3UD 2WUQA 5FQIA 4EUZA 3NJAA 1TVFA 2VA0A 3QNCA 3HLDA 2XROA 4QWOA 4I3IA 3C4PA 1I2WA 1PWDA 3NOTC 3V3SA 1XPBA 2J7VA 3NCKA 4JBFA 2W1TA 1K56A 3IT9A 4UA7A 4OLDA 4GD6A 4C75A 4UA9A 3KYEA 2WKHA 1BLCA 3C7VA 3SS3A 1GHMA 3N7WA 1YQSA 2FH5A 2ZMFA 1L2SA 4GS9B 3T4JA 1BTLA 4KG2A 2YKHA 3H82B 3HBRA 3IXGA 5FI6A 3IX4A 3SOIA 2R9XA 1K25A 4BLMA 4HP4A 4UQIS 2IWBA 4MDZA 1IKGA 3E4OA 5J7EA 1KE4A 4JXVA 2EWWA 5DF7A 4B9OA 5CERA 4M4XA 1BYWA 1TEMA 1GSXA 3MQQA 5FQJA 4O8GA 5E2GA 3ZGAB 2WKQA 4O0PA 1T18A 2B02A 2K2NA 3EGXC 5GHZA 2P74A 3G2ZA 4KQOA 4EV4A 4II7A 3C7UA 2H0YA 3LIFA 4OKPA 1W7FA 1PZOA 5HARA 5TGFA 3MQ0A 1LLBA 2ZQDA 4LRZE 5CEDA 2Y2KA 3D72A 3BQ8A 2QKPA 3F1OB 3P01A 1WYCA 3K3DA 2HGVA 5TFQA 1K57A 3D3OA 3RJUA 4HH3A 3FC7A 4P6ZM 1YAXA 4WBGA 3VE3A 4UHUA 4S2PA 1MWUA 4WZ5C 5FEGA 4FD8A 1UWNX 2HF6A 2OSUA 4MBFA 4QB8A 5GHYA 4L9GA 5IU1A 3CZDA 3UMEA 2G2WA 4OONA 2ZL1B 3DTEA 2HP9A 1ODVA 4QY6A 1KE3A 3PBNA 3Q81A 2EXAA 3MXRA 2OAP1 4DDSA 2ZM2A 1W8QA 1IEMA 3S22A 2VGKA 5DFXA 1IYSA 2WAEA 5JYOA 5GLCA 1S66L 3TSGA 2V1AA 3LR5A 1XJ6A 2WYXA 3CAXA 2ZJ9A 1IFQA 2Q9MA 3RXXA 3FPWA 3LEZA 3Q82A 5EFWA 5HWTA 1CEGA 1YT4A 4EBPA 4GN2A 4R23A 2WKIA 1ACFA 1PNEA 4OQIA 3BY8A 4CLCA 3OLOA 1K56D 5HW3A 1CK3A 1L0FA 4Y0OA 4BBTA 3IXBA 5CHMA 1CI9A 4HQAA 4RVAA 4HNBA 1W63M 3MQOA 4CJNA 2Y2OA 1G28A 4MCWA 3C8CA 4OQGA 1T1BA 3A3FA 2DMWA 3ULFA 2OV5A 4GLQA 5FI2A 5I94A 3CITA 2VJWA 1H5XA 1BULA 4MEZA 1CI8A 5DJTA 3GDIA 1BLSA 3HLEA 3UB5P 4HEFA 4S2IA 3S4XA 2VZWA 5HD3A 4KUKA 4XT2A 3VP4A 3W4QA 3MS6A 5CX7A 4MN5A 2W3DA 3MMHA 2M1CA 2VX8A 4Y2FA 2V8CA 1KOUA 4LRXC 4P6ZS 4R6LA 1IKIA 4JXWA 5CRFA 3ZDJA 3BM6A 3NULA 5DJUA 3G2YA 3OZHA 1LI9A 1OTIA 3FKWA 3EQUA 2HDRA 4LGWA 5HZHA 3ZYTA 5MC7A 2RL3A 4BBVA 4DE1A 4U3TA 2EFXA 4LFUA 3T12B 1CJFA 1OTAA 4HH2A 1FSYA 3PBSA 1U60A 4QU3A 4KG6A 1K55C 3PTEA 4FOFA 3V67A 2Y79A 2O9CA 4F94A 3ZHHA 1OTDA 2Y2NA 3C30A 2L1MA 4R70A 4WM9A 2VV6A 4RA7A 3BEBA 4LV0A 3EWKA 4P6BA 4X68A 2ZM0A 4HJ3A 2E8JA 5J3WA 2QZ6A 3CI6A 2ZQAA 1V9ZA 3IHAA 2LB9A 2J80A 4JKTA 3JVVA 1K54A 2ZQ8A 4E3MA 2ZMAA 4MMNA 2O0YA 1HZOA 2W1TB 4GZBA 4KZBA 4R1GA 2H28A 4E3KA 3G30A 4DXBA 1OPXA 4KZ3A 5FAOA 1DJAA 1DJCA 2HP6A 4ZTKA 3ITAA 4UA6A 2PRFA 2ZQ7A 2HZ5A 5D3OA 1YLTA 4IBRA 1FCNA 1XJ2A 3ZG0A 1E3UA 1TS6A 5L10A 3P09A 3KSHA 3F1NA 3E4PA 3LIEA 2OLUA 1LL9A 3VP2A 2I9VA 2PYPA 2XQZA 3QP2A 3S7OA 3LR3A 1YLPA 2OOLA 3JVUA 4NG2A 4FCFA 1KVMA 2J8YA 3ZQ5A 2WZXA 2Y91A 5EVEA 3CJMA 2I72A 3UDFA 2IWCA 4EERA 4O01A 4P85A 1W5DA 1FCMA 5CHJA 3WRZA 3BWLA 1PIOA 1F5MA 5CHUA 4ESPA 5J8XA 4BBUA 3UB6A 3GTCA 3UY6A 4E3LA 4G3VA 4Y0UA 3IWIA 1XJ4A 2XRNA 1OTBA 2WGVA 2PU4A 2Y2IA 3KSGA 5AQBA 3SS4A 4QPRA 5U47A 5EVIB 4P0MA 3MSHA 2VGJA 3T50A 1L0EA 1W63Q 3O86A 4EBLA 4DF6A 4IVKA 5HDCA 2X01A 4M3KA 5DF9A 2HDUA 3VMAA 2ZC3B 4Z1WA 3RFBA 1F98A 4CQHA 1SZVA 4K08A 2JC7A 4XUXA 3QP8A 4F3LA 3HLGA 1G6AA 2VEAA 4ZBEA 1TDLA 5CXWA 1XA1A 3LI8A 4D2OA 5F68A 2W1RA 3NHQA 3ZCZA 2QPNA 3HJIA 2NUPC 5F6AA 3ZG5A 2IA2A 2JCHA 1ES3A 4DE2A 1YMSA 5DFYA 3G6OA 4HI4A 1LI0A 2Y2MA 1JWVA 1S4SA 1T1CA 2V20A 4JLFA 3Q7ZA 1YMXA 3BECA 1GHIA 3L9KA 4OP8A 3WS5A 5CTNA 4EETB 3PBTA 1MKMA 1ZTUA 2L0WA 5HPFA 4OPQA 3VP0A 2PU2A 1FILA 2XSSA 5IT5A 4R4SA 4K0XA 2QHKA 2Y2GA 1N9BA 3IH9A 4NXGA 3BW6A 5L07A 1O07A 2XH9A 2GZAA 2JKRM 1CQAA 3HUNA 1NYMA 3IWOA 3KYQA 5KZHA 3QP5A 3GMWA 3NECA 1W79A 3MXSA 4HHDA 4CLCB 1VQQA 3OC2A 4KZAA 4IBXA 2PYRA 3V5MA 3QP1A 2HP5A 3T1QB 5M18A 3HLBA 1PI5A 4I5SA 5K5BA 1MXOA 2G2UA 1JVJA 3TG9A 5A90A 1UGUA 4E3JA 2WGWA 4EQ1A 4KG5A 1FQGA 3IF5A 2XD5A 5F69A 3BQAA 4Y3IA 1EI5A 4NXBA 1LT0A 1LSXA 1EWZA 1VETA 1PZPA 5EECA 1ES5A 2X02A 2X71A 1ZG6A 2LB5A 2H0TA 3A3JA 1P9RA 4OOMA 3LGOA 3MF0A 3HCYA 2HPBA 4XT2B 3E0YA 5IS1A 3GECA 4K91A 3IX8A 1STZA 1VEUB 4CPKA 3E98A 3S7NA 2J9OA 3EGDC 4R3AA 3UB9A 3VP3A 3PHYA 1S1YA 5BOHA 4X25A 2Y2LA 4ZRRA 1KE0A 3CWFA 3R7WA 5TBMB 2Y2JA 4WEKA 4EW7A 3T4TA 2O9BA 2QJ7A 4YOFA 5EPHA 3BLMA 4ZAMA 3VSKA 2K31A 2EX8A 4KZ5A 2VKSA 1L0DA 2VV8A 4JPMA 1NXYA 4GW9A 4BD0A 5F1FA 1WYBA 1NWZA 3TW8A 4JGQA 2A24A 5G18A 5A8BA 4HBUA 4DXCA 1KGGA 2B5RA 3MZEA 5J4EA 5FASA 4X1LA 2Y2QA 4ME4A 3KSFA 4Y7PA 4Z9QA 3VP1A 3T4LA 3V3RA 4GHIB 5DTSA 1LSVA 4LLOB 3S7PA 5CECA 3DW0A 1OMEA 3VOYA 3ZFZA 4C3QA 3CUEA 2XFSA 3WS1A 4WYYA 2KX6A 2OAQ1 4N1HA 4RYEA 5EUAA 2A3UA 4I3JA 3E2KA 3F1PA 5HWWA 4JGPA 2Y2PA 4BJPA 4D60A 3Q7VA 4X56A 3A0RA 3W4PA 4EWFA 1BUEA 2JHEA 4N1XA 3P98A 3UB8A 5E2EA 1PW8A 2XD1A 3MKEA 4Q8IA 4GNUA 5FQKA 3V50A 1MPLA 5FSRA 4NKPA 1Y54A 5GLDA 3F1NB 4ZJ1A 3UE6A 2E8IA 1MKIA 3PXPA 3W4OA 3LICA 1TF1A 1NLYA 3LR4A 4E04A 2CMNA 4LPZA 5EVIC 3C4OA 1D1JA 3CLOA 3CPTA 3IBRA 4L9EA 4X1MA 4BQMA 1BT5A 1X0OA 3FG8A 3UPNA 1PI4A 3FYZA 4FH2A 2HJEA 3IXHA 4HP9A 1HTZA 3EEHA 1F2KA 3CHWP 2JKFA 3TOIA 4KZ9A 3LR0A 4OPRA 4PHTA 1XGIA 4JF6A 4S2KA 2IWDA 2Y4AA 5G4YA 1XA7A 2GNXA 1AXBA 2V1BA 3NC8A 1GA0A 1MWRA 3DBAA 3LI9A 4B4XA 4H6JB 2JKTM 1TS7A 3UMDA 4PM8A 5DTKA 3KSIA 3G32A 5EOEA 1RP5A 2W3HA 4S2NA 2V0UA 3OCNA 3UDIA 5DVAA 4KZ8A 1HVBA 4LCLA 3HUMA 4WMCD 4ARZB 4AFIA 3EQVA 2W3GA 4JXGA 1DP8A 4I38A 1KGEA 2ZM8A 3O88A 1MWTA 3NOPC 5A91A 2P9VA 4HY8A 4CLCC
chains in the Genus database with same CATH topology
2I72A 1C3BA 2IWCA 3UDFA 4GDBA 1IELA 2WKEA 3N8LA 4IEDA 4P85A 1W5DA 4WZ5A 2QMIA 1FCMA 5CHJA 3WRZA 5E2HA 1SDEA 5EVIA 4FH4A 1PIOA 1GHPA 5AQ7A 5CHUA 3V50A 1FR1A 5J8XA 3WS0A 3ITBA 1KDSA 3GTCA 3M6HA 3UY6A 2Q9NA 1ES2A 2EFUA 3A3EA 4E3LA 3N4IA 5HAQA 5JYPA 4Y0UA 3DTMA 3IWIA 4E6XA 5KSHA 1SCWA 2P9VB 1ES4A 3OCLA 2Y59A 5CTMA 5HL1A 5F83A 3HLFA 2WGVA 4U0TA 3ZG9B 3ZG7B 2PU4A 1E3UD 1HD8A 2Y2IA 3CG5A 4LV1A 4OH0A 1PWGA 2WUQA 1K55A 4C6YA 5AQBA 3HREA 5FQIA 4EUZA 3SS4A 1TVFA 5U47A 3BFCA 5EVIB 4P0MA 2ZQCA 3QNCA 4RX2A 4OOYA 1JTDA 2VGJA 3G35A 5DF8A 1L0EA 3HLDA 3O86A 4EBLA 4MBKA 4DF6A 3C4PA 1I2WA 1PWDA 3IF6B 4IVKA 1E4DA 4DE0A 3V3SA 3VFHA 3NI9A 1XPBA 3M2JA 2X01A 5M19A 4M3KA 2J7VA 4GB7A 5DF9A 2HDUA 3A3IA 5GL9A 2ZC3B 3VMAA 2EX9A 1K57C 3NCKA 4JBFA 1MBLA 2JC7A 4N9KA 5EVID 4S2MA 1K56A 4XUXA 3IT9A 1KVLA 3BRMA 3HLGA 4UA7A 3C5AA 1VM1A 4OLDA 1G6AA 4ZBEA 1TDLA 4GD6A 3MZDA 5CXWA 4C75A 4E3NA 4E6WA 3M2KA 1XA1A 3PAGA 4D2OA 2PBYA 4UA9A 3ZCZA 2QPNA 2WKHA 1BLCA 1GCEA 2C6WB 1YLWA 3ZG5A 2JBFA 1ZKJA 2JCHA 3C7VA 3SS3A 3GVBA 1J9MA 1ES3A 1MY8A 2FFYA 3D4FA 4DE2A 5FAPA 5GHXA 1GHMA 3WRTA 1YLJA 5FQMA 1MWSA 3N7WA 1ONHA 1DJBA 1YMSA 2FFFB 1YQSA 1JWZA 5HAPA 1L2SA 1LI0A 1M6KA 2Y2MA 1JWVA 1BTLA 5GLAA 4KG2A 2H10A 2V20A 3LO7A 4JLFA 3HBRA 3Q7ZA 1YMXA 3BECA 3IXGA 1GHIA 2EX2A 3PBRA 4OP8A 5FI6A 5CTNA 2R9XA 3SOIA 2CC1A 3WS5A 3PBTA 3N8RA 3G4PA 1K25A 4BLMA 3VSLA 4BL2A 1GA9A 1K4FA 1N4OA 4QY5A 3ZVWA 3UPOA 3ZG8B 2IWBA 4OPQA 4HBTA 1IYPA 2PU2A 5EOOA 3VP0A 2Y55A 3BFDA 3O3VA 1IKGA 1H8ZA 2XEPA 4R4SA 1KE4A 4K0XA 4JXVA 5DF7A 3GQZA 5AQ9A 4OLGA 4OVDA 2Y2GA 1N9BA 3IH9A 4LENA 2XR0A 5CERA 3LY3A 1TEMA 5CGXA 4KZ4A 1K54C 5FQJA 3UE0A 4XXRA 5E2GA 3ZGAB 3QHYA 2ZC5B 1O07A 2DRWA 3NDEA 1ALQA 1TDGA 2XH9A 5EVLA 2ZC6B 5GHZA 2P74A 4MLLA 1M40A 2HDQA 4DRTA 1NRFA 4X69A 3G2ZA 5KSCA 4HESA 1FR6A 3HUNA 4KQOA 5CGWA 4NK3A 4EV4A 1NYMA 4S2LA 1E25A 3IWOA 1SHVA 2H0YA 3C7UA 3W8KA 5KZHA 4S2NC 3GMWA 4GOGA 3NBLA 1W79A 3E2LA 3MXSA 4OKPA 1BLHA 1CEFA 1VQQA 2J9PA 3OC2A 4KZAA 4IBXA 3SH7A 1W7FA 3BFFA 1PZOA 5HARA 5TGFA 4LV3A 3V5MA 3FKVA 1ONGA 1LLBA 2HP5A 3G31A 2ZQDA 5CEDA 3O87A 1K4EA 1RCJA 3HUOA 1LHYA 1YLZA 3HL9A 3PBQA 1Q2PA 3IF6A 2Y2KA 3ZVTA 5M18A 3HLBA 1PI5A 4IVIA 3UE3A 1K6RA 4R3JA 5A93A 1PYYA 1MXOA 2G2UA 1JVJA 4OPZA 1WYCA 3TG9A 5IHVA 5A90A 2HDSA 4E3JA 1ZC2A 2WGWA 3HLCA 4KG5A 3BFEA 1FQGA 3IF5A 2XD5A 4FSFA 1QMEA 4BENA 3NIAA 1JTGA 3GRJA 3GV9A 5TFQA 1EI5A 4EBNA 1K57A 3WS2A 1EWZA 1ERMA 3RJUA 1PZPA 2XK1A 4LCMA 4WBGA 5EECA 1ES5A 1SDNA 4UHUA 2X02A 1MWUA 2XDMA 2X71A 3FWLA 3OPHA 4S2PA 4FD8A 1ZG6A 4WZ5C 2RCXA 2H0TA 3A3JA 3UN7A 4OOMA 3I7JA 4PM7A 2HPBA 2OSUA 4MBHA 4MBFA 4QB8A 5L2FA 4K91A 5GHYA 2WGWB 4B4ZA 4Y0TA 4R4RA 4WEJA 3CZDA 4L0LA 4ZJ3A 5AQAA 1ZG4A 4H8RA 4CPKA 2G2WA 4OONA 4DE3A 2HP9A 3IWQA 1NZUA 4PM5A 4QY6A 3SH9A 1KE3A 4NETA 2J9OA 3N6IA 3PBNA 1EROA 1K38A 3OPLA 3Q81A 2WGIA 2EXAA 3MXRA 5FDHA 4KENB 3VP3A 5F1GA 1G68A 4WELA 5HFOA 4WZ4A 4DDSA 2ZM2A 1W8QA 5BOHA 1IEMA 2Y2LA 3DWKA 3S22A 2VGKA 3PAEA 1IYSA 2WAEA 1KE0A 5JYOA 5GLCA 4R0QA 3TSGA 2Y2JA 4WEKA 4GD8A 2WAFA 4ZDXA 4RX3A 3ZNTA 2WYXA 5EPHA 2ZJ9A 1RGZA 2Q9MA 1H8YA 3BLMA 3PBOA 4YFMA 4ZAMA 3RXXA 3VSKA 1LL5A 2EX8A 4KZ5A 3LEZA 1O7EA 3A3DA 3IXDA 4S2JA 1L0DA 4JPMA 1NXYA 3Q82A 1IYQA 1ESIA 1I2SA 4BD0A 5F1FA 1WYBA 1XGJA 3V39A 3QNBA 1CEGA 3DWZA 5G18A 3SH8A 1YT4A 1Q2QA 4HBUA 4EBPA 1QMFA 4LV2A 4GN2A 1KGGA 4DXCA 4R23A 2WKIA 2B5RA 3MZEA 4OQIA 5FASA 3BFGA 2Y2QA 4GDNA 4OOLA 4Y7PA 4Z9QA 3S1YA 3VP1A 1K56D 4KZ7A 5HW3A 3V3RA 1CK3A 5DTSA 1L0FA 4Y0OA 5CECA 1XXMA 3CMZA 3FZCA 3LY4A 3DW0A 3GSGA 1OMEA 3VOYA 3ZFZA 3IXBA 3LCEA 5CHMA 1CI9A 4C3QA 5FI7A 2XFSA 2WZZA 1XX2A 3WS1A 4WYYA 2ZC4B 4JF4A 4PMAA 3IHBA 4N1HA 4RVAA 4RYEA 5E43A 1YLYA 5EUAA 2A3UA 4E3IA 3RXWA 4CJNA 3E2KA 2Y2OA 4OPYA 4OQGA 4U0XA 2Y2PA 4BJPA 4DKIA 3AGFA 3A3FA 3Q7VA 4X56A 2OV5A 3W4PA 4ID4A 2GDNA 4EWFA 5FI2A 3ZNYA 3MFDA 5I94A 1BUEA 2JE5A 5EE8A 4OQ0A 4N1XA 2C5WB 4S2OA 1H5XA 1ERQA 1BULA 2UWXA 3P98A 5E2EA 3HLWA 1PW8A 4MEZA 1CI8A 2XD1A 5CGSA 3MKEA 4Q8IA 5KMWA 3IQAA 2H5SA 4GNUA 5FQKA 3M6BA 1BLSA 1MPLA 3FV7A 3HLEA 3MKFA 5FSRA 4HEFA 1Y54A 4S2IA 1KDWA 5GLDA 5GLBA 3S4XA 2DCFA 4B88A 1KGFA 1ESUA 4O7DA 3VP4A 5FQ9A 4ZJ1A 3W4QA 2XLNA 5A92A 2E8IA 2DNSA 3Q7VB 3VFFA 1MKIA 3MBZA 3W4OA 5M1AA 3GR2A 4X53A 1IKIA 4JXWA 5CRFA 4N92A 3ZDJA 3BM6A 4X6TA 1NZOA 2BLSA 3G2YA 3OZHA 4E3OA 1LI9A 3FKWA 3AGEA 5EVIC 1NY0A 3UO9A 3C4OA 4MNRA 3EQUA 2HDRA 4QHCA 3OPRA 3B3XA 2XGNA 2RL3A 4DE1A 2V1ZA 1FCOA 4U3TA 1S6RA 4QJGA 2EFXA 2ZLYA 3UDXA 3IF6C 5FA7A 1XP4A 4BQMA 1BT5A 3MZFA 4OQHA 3BYDA 1FSYA 1PWCA 3UPNA 1PI4A 3FYZA 4FH2A 4N9LA 4YINA 3PBSA 1WE4A 1BSGA 1U60A 3IXHA 4X55A 3OPPA 4QU3A 1HTZA 4KG6A 1K55C 3PTEA 4BL3A 4F94A 2EX6A 1K6SA 2A49A 4KZ6A 5FAQA 3ZHHA 1RGYA 2R9WA 5E2FA 4DDYA 1FSWA 5FQQA 4PPRA 2Y2NA 3TOIA 4KZ9A 4OPRA 4WMCA 4A5RA 4R3BA 4WM9A 4RA7A 3BEBA 4LV0A 1XGIA 4JF6A 3Q07A 4S2KA 2IWDA 2Y4AA 3WWXA 4PM6A 4K0WA 4P6BA 4X68A 2ZM0A 1XA7A 1YM1A 4JF5A 1DY6A 1AXBA 5TR7A 1I5QA 2QZ6A 3NC8A 1GA0A 3VOZA 3BLSA 1MWRA 3AGDA 2Z2MB 3JYIA 3N8SA 1BZAA 2ZQAA 4OP5A 1FOFA 3IHAA 4QD4A 2XF3A 3HVFA 2OLVA 4B4XA 4JKTA 1S0WA 4XUZA 3UNWA 1K54A 2ZQ8A 4E3MA 2ZMAA 4PM8A 1HZOA 2WADA 1NYYA 5DTKA 4GZBA 3SS5A 4KZBA 4R1GA 3G34A 4E3KA 3UPPA 3G32A 1NJ4A 3G30A 4DXBA 5EOEA 5HAIA 3NY4A 4KZ3A 1RP5A 5FAOA 1DJAA 4PM9A 1DJCA 2HP6A 4ZTKA 4S2NA 3ITAA 3OCNA 5DTTA 3UDIA 4UA6A 5DVAA 4ZJ2A 3WS4A 4UAAA 3IH8A 2ZQ7A 3UE1A 5D3OA 1YLTA 5F82A 4IBRA 4KZ8A 4P87A 1HVBA 1FCNA 4GKUA 4LCLA 3HUMA 4WMCD 3ZG0A 1E3UA 1W8YA 3P09A 2ZC7A 3EQVA 1PW1A 2XFTA 2OLUA 5FATA 1LL9A 3Q1FA 5CEBA 3VP2A 2ZD8A 4JXGA 1KGEA 2Y2HA 2XQZA 4JXSA 2ZM8A 1IYOA 5HX9A 1L0GA 4KQQA 3O88A 2Z2LB 1YLPA 4FCFA 1MWTA 1Z6FA 3NDGA 1XKZA 3ISGA 5A91A 2P9VA 2WK0A 1BLPA 2BG1A 2EXBA 1KVMA 1SKFA 2J8YA 4KQRA 2V2FF 2WZXA 2Y91A 2ZQ9A 4BD1A 1JWPA 3CJMA 4EQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I72 A;  1C3B A;  2IWC A;  3UDF A;  4GDB A;  1IEL A;  2WKE A;  3N8L A;  4IED A;  4P85 A;  1W5D A;  4WZ5 A;  2QMI A;  1FCM A;  5CHJ A;  3WRZ A;  5E2H A;  1SDE A;  5EVI A;  4FH4 A;  1PIO A;  1GHP A;  5AQ7 A;  5CHU A;  3V50 A;  1FR1 A;  5J8X A;  3WS0 A;  3ITB A;  1KDS A;  3GTC A;  3M6H A;  3UY6 A;  2Q9N A;  1ES2 A;  2EFU A;  3A3E A;  4E3L A;  3N4I A;  5HAQ A;  5JYP A;  4Y0U A;  3DTM A;  3IWI A;  4E6X A;  5KSH A;  1SCW A;  2P9V B;  1ES4 A;  3OCL A;  2Y59 A;  5CTM A;  5HL1 A;  5F83 A;  3HLF A;  2WGV A;  4U0T A;  3ZG9 B;  3ZG7 B;  2PU4 A;  1E3U D;  1HD8 A;  2Y2I A;  3CG5 A;  4LV1 A;  4OH0 A;  1PWG A;  2WUQ A;  1K55 A;  4C6Y A;  5AQB A;  3HRE A;  5FQI A;  4EUZ A;  3SS4 A;  1TVF A;  5U47 A;  3BFC A;  5EVI B;  4P0M A;  2ZQC A;  3QNC A;  4RX2 A;  4OOY A;  1JTD A;  2VGJ A;  3G35 A;  5DF8 A;  1L0E A;  3HLD A;  3O86 A;  4EBL A;  4MBK A;  4DF6 A;  3C4P A;  1I2W A;  1PWD A;  3IF6 B;  4IVK A;  1E4D A;  4DE0 A;  3V3S A;  3VFH A;  3NI9 A;  1XPB A;  3M2J A;  2X01 A;  5M19 A;  4M3K A;  2J7V A;  4GB7 A;  5DF9 A;  2HDU A;  3A3I A;  5GL9 A;  2ZC3 B;  3VMA A;  2EX9 A;  1K57 C;  3NCK A;  4JBF A;  1MBL A;  2JC7 A;  4N9K A;  5EVI D;  4S2M A;  1K56 A;  4XUX A;  3IT9 A;  1KVL A;  3BRM A;  3HLG A;  4UA7 A;  3C5A A;  1VM1 A;  4OLD A;  1G6A A;  4ZBE A;  1TDL A;  4GD6 A;  3MZD A;  5CXW A;  4C75 A;  4E3N A;  4E6W A;  3M2K A;  1XA1 A;  3PAG A;  4D2O A;  2PBY A;  4UA9 A;  3ZCZ A;  2QPN A;  2WKH A;  1BLC A;  1GCE A;  2C6W B;  1YLW A;  3ZG5 A;  2JBF A;  1ZKJ A;  2JCH A;  3C7V A;  3SS3 A;  3GVB A;  1J9M A;  1ES3 A;  1MY8 A;  2FFY A;  3D4F A;  4DE2 A;  5FAP A;  5GHX A;  1GHM A;  3WRT A;  1YLJ A;  5FQM A;  1MWS A;  3N7W A;  1ONH A;  1DJB A;  1YMS A;  2FFF B;  1YQS A;  1JWZ A;  5HAP A;  1L2S A;  1LI0 A;  1M6K A;  2Y2M A;  1JWV A;  1BTL A;  5GLA A;  4KG2 A;  2H10 A;  2V20 A;  3LO7 A;  4JLF A;  3HBR A;  3Q7Z A;  1YMX A;  3BEC A;  3IXG A;  1GHI A;  2EX2 A;  3PBR A;  4OP8 A;  5FI6 A;  5CTN A;  2R9X A;  3SOI A;  2CC1 A;  3WS5 A;  3PBT A;  3N8R A;  3G4P A;  1K25 A;  4BLM A;  3VSL A;  4BL2 A;  1GA9 A;  1K4F A;  1N4O A;  4QY5 A;  3ZVW A;  3UPO A;  3ZG8 B;  2IWB A;  4OPQ A;  4HBT A;  1IYP A;  2PU2 A;  5EOO A;  3VP0 A;  2Y55 A;  3BFD A;  3O3V A;  1IKG A;  1H8Z A;  2XEP A;  4R4S A;  1KE4 A;  4K0X A;  4JXV A;  5DF7 A;  3GQZ A;  5AQ9 A;  4OLG A;  4OVD A;  2Y2G A;  1N9B A;  3IH9 A;  4LEN A;  2XR0 A;  5CER A;  3LY3 A;  1TEM A;  5CGX A;  4KZ4 A;  1K54 C;  5FQJ A;  3UE0 A;  4XXR A;  5E2G A;  3ZGA B;  3QHY A;  2ZC5 B;  1O07 A;  2DRW A;  3NDE A;  1ALQ A;  1TDG A;  2XH9 A;  5EVL A;  2ZC6 B;  5GHZ A;  2P74 A;  4MLL A;  1M40 A;  2HDQ A;  4DRT A;  1NRF A;  4X69 A;  3G2Z A;  5KSC A;  4HES A;  1FR6 A;  3HUN A;  4KQO A;  5CGW A;  4NK3 A;  4EV4 A;  1NYM A;  4S2L A;  1E25 A;  3IWO A;  1SHV A;  2H0Y A;  3C7U A;  3W8K A;  5KZH A;  4S2N C;  3GMW A;  4GOG A;  3NBL A;  1W79 A;  3E2L A;  3MXS A;  4OKP A;  1BLH A;  1CEF A;  1VQQ A;  2J9P A;  3OC2 A;  4KZA A;  4IBX A;  3SH7 A;  1W7F A;  3BFF A;  1PZO A;  5HAR A;  5TGF A;  4LV3 A;  3V5M A;  3FKV A;  1ONG A;  1LLB A;  2HP5 A;  3G31 A;  2ZQD A;  5CED A;  3O87 A;  1K4E A;  1RCJ A;  3HUO A;  1LHY A;  1YLZ A;  3HL9 A;  3PBQ A;  1Q2P A;  3IF6 A;  2Y2K A;  3ZVT A;  5M18 A;  3HLB A;  1PI5 A;  4IVI A;  3UE3 A;  1K6R A;  4R3J A;  5A93 A;  1PYY A;  1MXO A;  2G2U A;  1JVJ A;  4OPZ A;  1WYC A;  3TG9 A;  5IHV A;  5A90 A;  2HDS A;  4E3J A;  1ZC2 A;  2WGW A;  3HLC A;  4KG5 A;  3BFE A;  1FQG A;  3IF5 A;  2XD5 A;  4FSF A;  1QME A;  4BEN A;  3NIA A;  1JTG A;  3GRJ A;  3GV9 A;  5TFQ A;  1EI5 A;  4EBN A;  1K57 A;  3WS2 A;  1EWZ A;  1ERM A;  3RJU A;  1PZP A;  2XK1 A;  4LCM A;  4WBG A;  5EEC A;  1ES5 A;  1SDN A;  4UHU A;  2X02 A;  1MWU A;  2XDM A;  2X71 A;  3FWL A;  3OPH A;  4S2P A;  4FD8 A;  1ZG6 A;  4WZ5 C;  2RCX A;  2H0T A;  3A3J A;  3UN7 A;  4OOM A;  3I7J A;  4PM7 A;  2HPB A;  2OSU A;  4MBH A;  4MBF A;  4QB8 A;  5L2F A;  4K91 A;  5GHY A;  2WGW B;  4B4Z A;  4Y0T A;  4R4R A;  4WEJ A;  3CZD A;  4L0L A;  4ZJ3 A;  5AQA A;  1ZG4 A;  4H8R A;  4CPK A;  2G2W A;  4OON A;  4DE3 A;  2HP9 A;  3IWQ A;  1NZU A;  4PM5 A;  4QY6 A;  3SH9 A;  1KE3 A;  4NET A;  2J9O A;  3N6I A;  3PBN A;  1ERO A;  1K38 A;  3OPL A;  3Q81 A;  2WGI A;  2EXA A;  3MXR A;  5FDH A;  4KEN B;  3VP3 A;  5F1G A;  1G68 A;  4WEL A;  5HFO A;  4WZ4 A;  4DDS A;  2ZM2 A;  1W8Q A;  5BOH A;  1IEM A;  2Y2L A;  3DWK A;  3S22 A;  2VGK A;  3PAE A;  1IYS A;  2WAE A;  1KE0 A;  5JYO A;  5GLC A;  4R0Q A;  3TSG A;  2Y2J A;  4WEK A;  4GD8 A;  2WAF A;  4ZDX A;  4RX3 A;  3ZNT A;  2WYX A;  5EPH A;  2ZJ9 A;  1RGZ A;  2Q9M A;  1H8Y A;  3BLM A;  3PBO A;  4YFM A;  4ZAM A;  3RXX A;  3VSK A;  1LL5 A;  2EX8 A;  4KZ5 A;  3LEZ A;  1O7E A;  3A3D A;  3IXD A;  4S2J A;  1L0D A;  4JPM A;  1NXY A;  3Q82 A;  1IYQ A;  1ESI A;  1I2S A;  4BD0 A;  5F1F A;  1WYB A;  1XGJ A;  3V39 A;  3QNB A;  1CEG A;  3DWZ A;  5G18 A;  3SH8 A;  1YT4 A;  1Q2Q A;  4HBU A;  4EBP A;  1QMF A;  4LV2 A;  4GN2 A;  1KGG A;  4DXC A;  4R23 A;  2WKI A;  2B5R A;  3MZE A;  4OQI A;  5FAS A;  3BFG A;  2Y2Q A;  4GDN A;  4OOL A;  4Y7P A;  4Z9Q A;  3S1Y A;  3VP1 A;  1K56 D;  4KZ7 A;  5HW3 A;  3V3R A;  1CK3 A;  5DTS A;  1L0F A;  4Y0O A;  5CEC A;  1XXM A;  3CMZ A;  3FZC A;  3LY4 A;  3DW0 A;  3GSG A;  1OME A;  3VOY A;  3ZFZ A;  3IXB A;  3LCE A;  5CHM A;  1CI9 A;  4C3Q A;  5FI7 A;  2XFS A;  2WZZ A;  1XX2 A;  3WS1 A;  4WYY A;  2ZC4 B;  4JF4 A;  4PMA A;  3IHB A;  4N1H A;  4RVA A;  4RYE A;  5E43 A;  1YLY A;  5EUA A;  2A3U A;  4E3I A;  3RXW A;  4CJN A;  3E2K A;  2Y2O A;  4OPY A;  4OQG A;  4U0X A;  2Y2P A;  4BJP A;  4DKI A;  3AGF A;  3A3F A;  3Q7V A;  4X56 A;  2OV5 A;  3W4P A;  4ID4 A;  2GDN A;  4EWF A;  5FI2 A;  3ZNY A;  3MFD A;  5I94 A;  1BUE A;  2JE5 A;  5EE8 A;  4OQ0 A;  4N1X A;  2C5W B;  4S2O A;  1H5X A;  1ERQ A;  1BUL A;  2UWX A;  3P98 A;  5E2E A;  3HLW A;  1PW8 A;  4MEZ A;  1CI8 A;  2XD1 A;  5CGS A;  3MKE A;  4Q8I A;  5KMW A;  3IQA A;  2H5S A;  4GNU A;  5FQK A;  3M6B A;  1BLS A;  1MPL A;  3FV7 A;  3HLE A;  3MKF A;  5FSR A;  4HEF A;  1Y54 A;  4S2I A;  1KDW A;  5GLD A;  5GLB A;  3S4X A;  2DCF A;  4B88 A;  1KGF A;  1ESU A;  4O7D A;  3VP4 A;  5FQ9 A;  4ZJ1 A;  3W4Q A;  2XLN A;  5A92 A;  2E8I A;  2DNS A;  3Q7V B;  3VFF A;  1MKI A;  3MBZ A;  3W4O A;  5M1A A;  3GR2 A;  4X53 A;  1IKI A;  4JXW A;  5CRF A;  4N92 A;  3ZDJ A;  3BM6 A;  4X6T A;  1NZO A;  2BLS A;  3G2Y A;  3OZH A;  4E3O A;  1LI9 A;  3FKW A;  3AGE A;  5EVI C;  1NY0 A;  3UO9 A;  3C4O A;  4MNR A;  3EQU A;  2HDR A;  4QHC A;  3OPR A;  3B3X A;  2XGN A;  2RL3 A;  4DE1 A;  2V1Z A;  1FCO A;  4U3T A;  1S6R A;  4QJG A;  2EFX A;  2ZLY A;  3UDX A;  3IF6 C;  5FA7 A;  1XP4 A;  4BQM A;  1BT5 A;  3MZF A;  4OQH A;  3BYD A;  1FSY A;  1PWC A;  3UPN A;  1PI4 A;  3FYZ A;  4FH2 A;  4N9L A;  4YIN A;  3PBS A;  1WE4 A;  1BSG A;  1U60 A;  3IXH A;  4X55 A;  3OPP A;  4QU3 A;  1HTZ A;  4KG6 A;  1K55 C;  3PTE A;  4BL3 A;  4F94 A;  2EX6 A;  1K6S A;  2A49 A;  4KZ6 A;  5FAQ A;  3ZHH A;  1RGY A;  2R9W A;  5E2F A;  4DDY A;  1FSW A;  5FQQ A;  4PPR A;  2Y2N A;  3TOI A;  4KZ9 A;  4OPR A;  4WMC A;  4A5R A;  4R3B A;  4WM9 A;  4RA7 A;  3BEB A;  4LV0 A;  1XGI A;  4JF6 A;  3Q07 A;  4S2K A;  2IWD A;  2Y4A A;  3WWX A;  4PM6 A;  4K0W A;  4P6B A;  4X68 A;  2ZM0 A;  1XA7 A;  1YM1 A;  4JF5 A;  1DY6 A;  1AXB A;  5TR7 A;  1I5Q A;  2QZ6 A;  3NC8 A;  1GA0 A;  3VOZ A;  3BLS A;  1MWR A;  3AGD A;  2Z2M B;  3JYI A;  3N8S A;  1BZA A;  2ZQA A;  4OP5 A;  1FOF A;  3IHA A;  4QD4 A;  2XF3 A;  3HVF A;  2OLV A;  4B4X A;  4JKT A;  1S0W A;  4XUZ A;  3UNW A;  1K54 A;  2ZQ8 A;  4E3M A;  2ZMA A;  4PM8 A;  1HZO A;  2WAD A;  1NYY A;  5DTK A;  4GZB A;  3SS5 A;  4KZB A;  4R1G A;  3G34 A;  4E3K A;  3UPP A;  3G32 A;  1NJ4 A;  3G30 A;  4DXB A;  5EOE A;  5HAI A;  3NY4 A;  4KZ3 A;  1RP5 A;  5FAO A;  1DJA A;  4PM9 A;  1DJC A;  2HP6 A;  4ZTK A;  4S2N A;  3ITA A;  3OCN A;  5DTT A;  3UDI A;  4UA6 A;  5DVA A;  4ZJ2 A;  3WS4 A;  4UAA A;  3IH8 A;  2ZQ7 A;  3UE1 A;  5D3O A;  1YLT A;  5F82 A;  4IBR A;  4KZ8 A;  4P87 A;  1HVB A;  1FCN A;  4GKU A;  4LCL A;  3HUM A;  4WMC D;  3ZG0 A;  1E3U A;  1W8Y A;  3P09 A;  2ZC7 A;  3EQV A;  1PW1 A;  2XFT A;  2OLU A;  5FAT A;  1LL9 A;  3Q1F A;  5CEB A;  3VP2 A;  2ZD8 A;  4JXG A;  1KGE A;  2Y2H A;  2XQZ A;  4JXS A;  2ZM8 A;  1IYO A;  5HX9 A;  1L0G A;  4KQQ A;  3O88 A;  2Z2L B;  1YLP A;  4FCF A;  1MWT A;  1Z6F A;  3NDG A;  1XKZ A;  3ISG A;  5A91 A;  2P9V A;  2WK0 A;  1BLP A;  2BG1 A;  2EXB A;  1KVM A;  1SKF A;  2J8Y A;  4KQR A;  2V2F F;  2WZX A;  2Y91 A;  2ZQ9 A;  4BD1 A;  1JWP A;  3CJM A;  4EQI A; 
#chains in the Genus database with same CATH topology
 3T1R A;  1N9N A;  2QMI A;  1S4R A;  5I5L A;  5E2H A;  3WS0 A;  3ITB A;  3T4O A;  1KDS A;  2ZMV A;  3N4I A;  5HAQ A;  5JYP A;  3MJQ A;  1WA9 A;  5C5K A;  4DMZ A;  5KSH A;  2B95 A;  5CTM A;  5HL1 A;  3ZG9 B;  1YKD A;  3H7W B;  4IUH A;  3CG5 A;  4LV1 A;  3JPU A;  1K55 A;  4C6Y A;  3HRE A;  1MC0 A;  2D02 A;  1AWI A;  3IS2 A;  4RQ9 A;  2ZQC A;  3K3C A;  4RX2 A;  5DKK A;  4EUV A;  2J3W A;  4MBK A;  1E4D A;  2PDR A;  4B93 A;  1Y4O A;  3T4S A;  3M2J A;  4GB7 A;  4HJ6 A;  5GL9 A;  3IBJ A;  1MBL A;  4GS9 A;  4IHQ A;  4N9K A;  5EVI D;  1N9L A;  3C5A A;  1NRJ A;  2WKP A;  3MZD A;  4JGR A;  3VV4 A;  1GCE A;  1YLW A;  5DKL A;  1MY8 A;  1FIK A;  3D4F A;  3K2N A;  3WRT A;  1YLJ A;  5FQM A;  1ONH A;  1DJB A;  2FFF B;  2L4R A;  3B47 A;  5HAP A;  1M6K A;  5HPI A;  5GLA A;  2VV7 A;  3U4L P;  3BJN A;  3N8R A;  3G4P A;  2Z6D A;  1GA9 A;  3UPO A;  3ZG8 B;  4HBT A;  2V8F A;  5EOO A;  2Y55 A;  3BFD A;  3O3V A;  1H8Z A;  3GQZ A;  4OLG A;  4OVD A;  1SKO A;  2EWV A;  2VGL M;  2XR0 A;  3KX0 X;  3LY3 A;  4LEN A;  3S7Q A;  5CGX A;  1K54 C;  2FZ0 A;  3UE0 A;  3QHY A;  1TDG A;  5HWV A;  5L09 A;  3UB7 A;  4MLL A;  1M40 A;  2HDQ A;  2KLI A;  2A24 B;  3F1O A;  4X69 A;  5KSC A;  4HES A;  4NK3 A;  4S2L A;  1SHV A;  3NBL A;  1YPR A;  1BLH A;  3SH7 A;  3QP6 A;  4LV3 A;  3G31 A;  3O87 A;  1K4E A;  1LHY A;  1YSP A;  1YLZ A;  3PBQ A;  3IF6 A;  3ICY A;  3ZVT A;  4IVI A;  3UE3 A;  1K6R A;  3LEQ A;  4OPZ A;  2HDS A;  1ZC2 A;  3BFE A;  4BEN A;  3GRJ A;  3GV9 A;  2A2L A;  4NEE D;  4BWI A;  3R4K A;  2ZL1 A;  4LCM A;  2GX5 A;  2XK1 A;  1SDN A;  2XDM A;  4G3W A;  1NLZ A;  3VE4 A;  1PRQ A;  3UN7 A;  3I7J A;  4PM7 A;  4MBH A;  1ZHH B;  3OBF A;  5L2F A;  1P0Z A;  4B4Z A;  4R4R A;  1GSW A;  4IJG A;  4L0L A;  3OOV A;  4ZJ3 A;  5AQA A;  1ZG4 A;  2ZOI A;  4H8R A;  4DE3 A;  1NZU A;  3SH9 A;  4NET A;  1D7E A;  2WGI A;  4KEN B;  5F1G A;  5HFO A;  4WZ4 A;  3PYP A;  1N9O A;  3PAE A;  3B33 A;  4ZDX A;  4RX3 A;  3ZNT A;  3QP4 A;  1OTE A;  1O7E A;  3IXD A;  4S2J A;  3HJK A;  3V39 A;  4EES A;  2Q0O A;  3KO6 A;  2G7U A;  4LV2 A;  4HOI A;  5HL6 A;  3D9Y A;  4L9F A;  3BFG A;  3S1Y A;  4KZ7 A;  3CMZ A;  2VGL S;  3FZC A;  3GSG A;  4WL9 A;  3L7H A;  1XX2 A;  2JKR I;  2ZC4 B;  4PMA A;  3IHB A;  2O9A A;  1YLY A;  3RXW A;  1G5U A;  3SZT A;  4DKI A;  4DN0 A;  5AVF A;  4ID4 A;  3ZNY A;  1CF0 A;  2B18 A;  4Q0J A;  4Y13 A;  3A0V A;  4S2O A;  2UWX A;  3HLW A;  5KMW A;  2H5S A;  3MKF A;  1S67 L;  1TS8 A;  1KGF A;  1ESU A;  2W0N A;  2XLN A;  2OWJ A;  3VFF A;  3MBZ A;  5M1A A;  3GR2 A;  4X53 A;  4N92 A;  1NZO A;  2BLS A;  3AGE A;  1NY0 A;  3UO9 A;  4MNR A;  3TE8 A;  5HDS A;  4QHC A;  3B3X A;  1PFL A;  4QJG A;  3UDX A;  5FA7 A;  3MZF A;  3NOU C;  5EM1 A;  1G6O A;  5G4Z A;  3PR6 A;  4N9L A;  1BSG A;  4GJ4 A;  4X55 A;  3OPP A;  2EX6 A;  1K6S A;  5FAQ A;  2R9W A;  5E2F A;  5FQQ A;  2D01 A;  2J3T C;  4WMC A;  4R3B A;  2HV1 A;  4R38 A;  3Q07 A;  4BMW A;  2W3E A;  3WWX A;  1T1A A;  3IS2 B;  5F5Y A;  5TR7 A;  5TJJ A;  2BAS A;  4MN6 A;  1I5Q A;  2AVX A;  3N8S A;  3JYI A;  1T19 A;  1Z09 A;  5HSQ A;  4OP5 A;  2XF3 A;  3O5Y A;  1YSQ A;  1S0W A;  4EEU A;  1LSW A;  1NYY A;  2MJ6 A;  3G34 A;  3UPP A;  1NJ4 A;  5HAI A;  3NY4 A;  4PM9 A;  5DTT A;  4EXO A;  4ZJ2 A;  3WS4 A;  4P87 A;  4GKU A;  1D06 A;  2ZC7 A;  1OT6 A;  1PW1 A;  1UWP X;  2XFT A;  5FAT A;  5CEB A;  2M7U A;  1IYO A;  5HX9 A;  4KQQ A;  2Z2L B;  2M7V A;  3EEA A;  3NDG A;  1XKZ A;  3ISG A;  2ZBB A;  1BLP A;  2WK0 A;  1OT9 A;  2V2F F;  4BD1 A;  3HLC A;  1C3B A;  4GDB A;  1OJ5 A;  2WKE A;  4IED A;  5EM0 A;  4WZ5 A;  3CUE C;  4KUO A;  5EVI A;  2PD7 A;  5AQ7 A;  3KYZ A;  5HD5 A;  1SKO B;  3M6H A;  2Q9N A;  5LBR A;  2Y8H A;  3DTM A;  4LRY C;  1SCW A;  1ES4 A;  2Y59 A;  5AVE A;  3SW1 A;  4GCZ A;  5F83 A;  3HLF A;  4U0T A;  1HD8 A;  2QJ5 A;  4OH0 A;  1PWG A;  1JNU A;  4UEY A;  3BFC A;  2PR6 A;  3P7N A;  4OOY A;  1JTD A;  3G35 A;  5DF8 A;  2V0W A;  3MXQ A;  3IF6 B;  1XFQ A;  4DE0 A;  1Y28 A;  3VFH A;  3NI9 A;  1MZU A;  5M19 A;  2P08 A;  2EA9 A;  3A3I A;  3EOI A;  2EX9 A;  1K57 C;  4S2M A;  3LUQ A;  1KVL A;  3BRM A;  1VM1 A;  2PD8 A;  4YNR A;  4E3N A;  4E6W A;  3M2K A;  3PAG A;  2PBY A;  4HJ4 A;  2JKT I;  2C6W B;  4PKY A;  3LFV A;  2JBF A;  1ZKJ A;  3GVB A;  1J9M A;  2FFY A;  2KOI A;  5FAP A;  1DP9 A;  5GHX A;  5HDD A;  1MWS A;  4EEP A;  2HJ9 C;  1JWZ A;  2PAV P;  2J3T D;  2UV0 E;  4F3L B;  2H10 A;  3LO7 A;  2EX2 A;  3PBR A;  2JN7 A;  2CC1 A;  3T1S A;  4WF0 A;  4Y17 A;  1S1Z A;  3VSL A;  4BL2 A;  1K4F A;  1N4O A;  4QY5 A;  3ZVW A;  1IYP A;  1H8M A;  3FPV A;  2XEP A;  1LL8 A;  1P9W A;  4FTX A;  5AQ9 A;  2VK3 A;  2QYB A;  4KZ4 A;  4XXR A;  2ZC5 B;  2P04 A;  2DRW A;  3NDE A;  3RH8 B;  1ALQ A;  5EVL A;  2ZC6 B;  4NXF A;  4DRT A;  1NRF A;  1FR6 A;  5CGW A;  2R78 A;  3TRC A;  1E25 A;  3W8K A;  5L8M A;  4S2N C;  4GOG A;  1K0K A;  4Y15 A;  3E2L A;  1CEF A;  2J9P A;  3BFF A;  2WKR A;  3FKV A;  1DRM A;  1ONG A;  1RCJ A;  3HUO A;  3HL9 A;  1Q2P A;  4R3J A;  2P7J A;  5A93 A;  1PYY A;  5IHV A;  4FSF A;  1QME A;  3NIA A;  1JTG A;  1VEU A;  4EBN A;  3WS2 A;  1TS0 A;  2V9A A;  1ERM A;  4I3A A;  3FWL A;  3OPH A;  2RCX A;  2NUT C;  2PR5 A;  2XA7 M;  5TBM A;  2WGW B;  3LIB A;  4EU0 A;  1GSV A;  4Y0T A;  4WEJ A;  3H82 A;  1V9Y A;  3E4Q A;  3IWQ A;  1OJG A;  1VET B;  4Y5F A;  4PM5 A;  3N6I A;  1ERO A;  1K38 A;  1XFN A;  3OPL A;  5FDH A;  2W27 A;  1G68 A;  4WEL A;  3TJZ C;  2OWH A;  4MN7 A;  3DWK A;  4DJ2 A;  4R0Q A;  4GD8 A;  2WAF A;  4GHI A;  4PAU A;  2PBD P;  1RGZ A;  1H8Y A;  3PBO A;  4YFM A;  1LL5 A;  3T4K A;  3A3D A;  3T1X A;  1H3Q A;  3LIA A;  1IYQ A;  1ESI A;  1I2S A;  1H0M A;  1XGJ A;  2YKF A;  1F9I A;  3C38 A;  3QNB A;  3SH8 A;  3DWZ A;  1Q2Q A;  2O99 A;  1QMF A;  5FEF A;  4PKY G;  2VLG A;  4Q0I A;  4GDN A;  4OOL A;  3R7W B;  3BY9 A;  1XXM A;  3LY4 A;  2K7S A;  2KDK A;  3LCE A;  5FI7 A;  2WZZ A;  4YWZ A;  4JF4 A;  5E43 A;  3LYX A;  4Q0H A;  2ZOH A;  4E3I A;  3LID A;  4OPY A;  4U0X A;  3AGF A;  1DP6 A;  2GDN A;  3MFD A;  2JE5 A;  4ETZ A;  5EE8 A;  4OQ0 A;  2C5W B;  1ERQ A;  5CGS A;  3H9W A;  3IQA A;  3M6B A;  3FV7 A;  3DTI A;  1KDW A;  5GLB A;  2DCF A;  4B88 A;  3DTK A;  4O7D A;  3U2A A;  5FQ9 A;  3F1P B;  4I39 A;  5A92 A;  1EW0 A;  4CLC D;  2DNS A;  3Q7V B;  5KIZ A;  2PT7 A;  3T4Q A;  4CLC E;  1HLU P;  4JGO A;  2ACG A;  4X6T A;  3IX3 A;  4E3O A;  1VB6 A;  2XA7 S;  4HIA A;  3OPR A;  4KQD A;  1P97 A;  2XGN A;  4G3K A;  2V1Z A;  1FCO A;  3VOL A;  1S6R A;  2QWS A;  2ZLY A;  3IF6 C;  1XP4 A;  4OQH A;  3BYD A;  1PWC A;  4YIN A;  1WE4 A;  3DAV A;  5AJG A;  1L3L A;  4BL3 A;  2A49 A;  4KZ6 A;  4ETX A;  4H6J A;  1RGY A;  4DDY A;  1FSW A;  4PPR A;  4A5R A;  2W3F A;  3CPT B;  2BTF P;  2INW A;  4NXE A;  4PM6 A;  4K0W A;  4WLA A;  1YM1 A;  4JF5 A;  1J3W A;  1DY6 A;  3VOZ A;  3BLS A;  3AGD A;  2Z2M B;  1BZA A;  5EV0 A;  1FOF A;  4QD4 A;  3HVF A;  1TD5 A;  2OLV A;  3A0S A;  4XUZ A;  3UNW A;  4ARZ A;  4WN5 A;  2WAD A;  4WUJ A;  3SS5 A;  1XJ3 A;  2JKG A;  3MR0 A;  4UAA A;  4UQI M;  3IH8 A;  1A0K A;  3UE1 A;  5F82 A;  1W8Y A;  2GJ3 A;  5FL3 A;  4DJ3 A;  3Q1F A;  2ZD8 A;  5FDS A;  2Y2H A;  4JXS A;  3MFX A;  1VHM A;  3C2W A;  1L0G A;  1Z6F A;  2EXB A;  2BG1 A;  1SKF A;  4KQR A;  4IUK A;  2ZQ9 A;  1JWP A;  4EQI A;  3W2Z A;  3H7W A;  1IEL A;  3N8L A;  3RTY A;  1IOU A;  1SDE A;  4FH4 A;  4FUW A;  1GHP A;  1FR1 A;  2Z6C A;  3A3E A;  1ES2 A;  2EFU A;  2PHY A;  3B42 A;  4E6X A;  2P9V B;  3OCL A;  3ZG7 B;  1E3U D;  2WUQ A;  5FQI A;  4EUZ A;  3NJA A;  1TVF A;  2VA0 A;  3QNC A;  3HLD A;  2XRO A;  4QWO A;  4I3I A;  3C4P A;  1I2W A;  1PWD A;  3NOT C;  3V3S A;  1XPB A;  2J7V A;  3NCK A;  4JBF A;  2W1T A;  1K56 A;  3IT9 A;  4UA7 A;  4OLD A;  4GD6 A;  4C75 A;  4UA9 A;  3KYE A;  2WKH A;  1BLC A;  3C7V A;  3SS3 A;  1GHM A;  3N7W A;  1YQS A;  2FH5 A;  2ZMF A;  1L2S A;  4GS9 B;  3T4J A;  1BTL A;  4KG2 A;  2YKH A;  3H82 B;  3HBR A;  3IXG A;  5FI6 A;  3IX4 A;  3SOI A;  2R9X A;  1K25 A;  4BLM A;  4HP4 A;  4UQI S;  2IWB A;  4MDZ A;  1IKG A;  3E4O A;  5J7E A;  1KE4 A;  4JXV A;  2EWW A;  5DF7 A;  4B9O A;  5CER A;  4M4X A;  1BYW A;  1TEM A;  1GSX A;  3MQQ A;  5FQJ A;  4O8G A;  5E2G A;  3ZGA B;  2WKQ A;  4O0P A;  1T18 A;  2B02 A;  2K2N A;  3EGX C;  5GHZ A;  2P74 A;  3G2Z A;  4KQO A;  4EV4 A;  4II7 A;  3C7U A;  2H0Y A;  3LIF A;  4OKP A;  1W7F A;  1PZO A;  5HAR A;  5TGF A;  3MQ0 A;  1LLB A;  2ZQD A;  4LRZ E;  5CED A;  2Y2K A;  3D72 A;  3BQ8 A;  2QKP A;  3F1O B;  3P01 A;  1WYC A;  3K3D A;  2HGV A;  5TFQ A;  1K57 A;  3D3O A;  3RJU A;  4HH3 A;  3FC7 A;  4P6Z M;  1YAX A;  4WBG A;  3VE3 A;  4UHU A;  4S2P A;  1MWU A;  4WZ5 C;  5FEG A;  4FD8 A;  1UWN X;  2HF6 A;  2OSU A;  4MBF A;  4QB8 A;  5GHY A;  4L9G A;  5IU1 A;  3CZD A;  3UME A;  2G2W A;  4OON A;  2ZL1 B;  3DTE A;  2HP9 A;  1ODV A;  4QY6 A;  1KE3 A;  3PBN A;  3Q81 A;  2EXA A;  3MXR A;  2OAP 1;  4DDS A;  2ZM2 A;  1W8Q A;  1IEM A;  3S22 A;  2VGK A;  5DFX A;  1IYS A;  2WAE A;  5JYO A;  5GLC A;  1S66 L;  3TSG A;  2V1A A;  3LR5 A;  1XJ6 A;  2WYX A;  3CAX A;  2ZJ9 A;  1IFQ A;  2Q9M A;  3RXX A;  3FPW A;  3LEZ A;  3Q82 A;  5EFW A;  5HWT A;  1CEG A;  1YT4 A;  4EBP A;  4GN2 A;  4R23 A;  2WKI A;  1ACF A;  1PNE A;  4OQI A;  3BY8 A;  4CLC A;  3OLO A;  1K56 D;  5HW3 A;  1CK3 A;  1L0F A;  4Y0O A;  4BBT A;  3IXB A;  5CHM A;  1CI9 A;  4HQA A;  4RVA A;  4HNB A;  1W63 M;  3MQO A;  4CJN A;  2Y2O A;  1G28 A;  4MCW A;  3C8C A;  4OQG A;  1T1B A;  3A3F A;  2DMW A;  3ULF A;  2OV5 A;  4GLQ A;  5FI2 A;  5I94 A;  3CIT A;  2VJW A;  1H5X A;  1BUL A;  4MEZ A;  1CI8 A;  5DJT A;  3GDI A;  1BLS A;  3HLE A;  3UB5 P;  4HEF A;  4S2I A;  3S4X A;  2VZW A;  5HD3 A;  4KUK A;  4XT2 A;  3VP4 A;  3W4Q A;  3MS6 A;  5CX7 A;  4MN5 A;  2W3D A;  3MMH A;  2M1C A;  2VX8 A;  4Y2F A;  2V8C A;  1KOU A;  4LRX C;  4P6Z S;  4R6L A;  1IKI A;  4JXW A;  5CRF A;  3ZDJ A;  3BM6 A;  3NUL A;  5DJU A;  3G2Y A;  3OZH A;  1LI9 A;  1OTI A;  3FKW A;  3EQU A;  2HDR A;  4LGW A;  5HZH A;  3ZYT A;  5MC7 A;  2RL3 A;  4BBV A;  4DE1 A;  4U3T A;  2EFX A;  4LFU A;  3T12 B;  1CJF A;  1OTA A;  4HH2 A;  1FSY A;  3PBS A;  1U60 A;  4QU3 A;  4KG6 A;  1K55 C;  3PTE A;  4FOF A;  3V67 A;  2Y79 A;  2O9C A;  4F94 A;  3ZHH A;  1OTD A;  2Y2N A;  3C30 A;  2L1M A;  4R70 A;  4WM9 A;  2VV6 A;  4RA7 A;  3BEB A;  4LV0 A;  3EWK A;  4P6B A;  4X68 A;  2ZM0 A;  4HJ3 A;  2E8J A;  5J3W A;  2QZ6 A;  3CI6 A;  2ZQA A;  1V9Z A;  3IHA A;  2LB9 A;  2J80 A;  4JKT A;  3JVV A;  1K54 A;  2ZQ8 A;  4E3M A;  2ZMA A;  4MMN A;  2O0Y A;  1HZO A;  2W1T B;  4GZB A;  4KZB A;  4R1G A;  2H28 A;  4E3K A;  3G30 A;  4DXB A;  1OPX A;  4KZ3 A;  5FAO A;  1DJA A;  1DJC A;  2HP6 A;  4ZTK A;  3ITA A;  4UA6 A;  2PRF A;  2ZQ7 A;  2HZ5 A;  5D3O A;  1YLT A;  4IBR A;  1FCN A;  1XJ2 A;  3ZG0 A;  1E3U A;  1TS6 A;  5L10 A;  3P09 A;  3KSH A;  3F1N A;  3E4P A;  3LIE A;  2OLU A;  1LL9 A;  3VP2 A;  2I9V A;  2PYP A;  2XQZ A;  3QP2 A;  3S7O A;  3LR3 A;  1YLP A;  2OOL A;  3JVU A;  4NG2 A;  4FCF A;  1KVM A;  2J8Y A;  3ZQ5 A;  2WZX A;  2Y91 A;  5EVE A;  3CJM A;  2I72 A;  3UDF A;  2IWC A;  4EER A;  4O01 A;  4P85 A;  1W5D A;  1FCM A;  5CHJ A;  3WRZ A;  3BWL A;  1PIO A;  1F5M A;  5CHU A;  4ESP A;  5J8X A;  4BBU A;  3UB6 A;  3GTC A;  3UY6 A;  4E3L A;  4G3V A;  4Y0U A;  3IWI A;  1XJ4 A;  2XRN A;  1OTB A;  2WGV A;  2PU4 A;  2Y2I A;  3KSG A;  5AQB A;  3SS4 A;  4QPR A;  5U47 A;  5EVI B;  4P0M A;  3MSH A;  2VGJ A;  3T50 A;  1L0E A;  1W63 Q;  3O86 A;  4EBL A;  4DF6 A;  4IVK A;  5HDC A;  2X01 A;  4M3K A;  5DF9 A;  2HDU A;  3VMA A;  2ZC3 B;  4Z1W A;  3RFB A;  1F98 A;  4CQH A;  1SZV A;  4K08 A;  2JC7 A;  4XUX A;  3QP8 A;  4F3L A;  3HLG A;  1G6A A;  2VEA A;  4ZBE A;  1TDL A;  5CXW A;  1XA1 A;  3LI8 A;  4D2O A;  5F68 A;  2W1R A;  3NHQ A;  3ZCZ A;  2QPN A;  3HJI A;  2NUP C;  5F6A A;  3ZG5 A;  2IA2 A;  2JCH A;  1ES3 A;  4DE2 A;  1YMS A;  5DFY A;  3G6O A;  4HI4 A;  1LI0 A;  2Y2M A;  1JWV A;  1S4S A;  1T1C A;  2V20 A;  4JLF A;  3Q7Z A;  1YMX A;  3BEC A;  1GHI A;  3L9K A;  4OP8 A;  3WS5 A;  5CTN A;  4EET B;  3PBT A;  1MKM A;  1ZTU A;  2L0W A;  5HPF A;  4OPQ A;  3VP0 A;  2PU2 A;  1FIL A;  2XSS A;  5IT5 A;  4R4S A;  4K0X A;  2QHK A;  2Y2G A;  1N9B A;  3IH9 A;  4NXG A;  3BW6 A;  5L07 A;  1O07 A;  2XH9 A;  2GZA A;  2JKR M;  1CQA A;  3HUN A;  1NYM A;  3IWO A;  3KYQ A;  5KZH A;  3QP5 A;  3GMW A;  3NEC A;  1W79 A;  3MXS A;  4HHD A;  4CLC B;  1VQQ A;  3OC2 A;  4KZA A;  4IBX A;  2PYR A;  3V5M A;  3QP1 A;  2HP5 A;  3T1Q B;  5M18 A;  3HLB A;  1PI5 A;  4I5S A;  5K5B A;  1MXO A;  2G2U A;  1JVJ A;  3TG9 A;  5A90 A;  1UGU A;  4E3J A;  2WGW A;  4EQ1 A;  4KG5 A;  1FQG A;  3IF5 A;  2XD5 A;  5F69 A;  3BQA A;  4Y3I A;  1EI5 A;  4NXB A;  1LT0 A;  1LSX A;  1EWZ A;  1VET A;  1PZP A;  5EEC A;  1ES5 A;  2X02 A;  2X71 A;  1ZG6 A;  2LB5 A;  2H0T A;  3A3J A;  1P9R A;  4OOM A;  3LGO A;  3MF0 A;  3HCY A;  2HPB A;  4XT2 B;  3E0Y A;  5IS1 A;  3GEC A;  4K91 A;  3IX8 A;  1STZ A;  1VEU B;  4CPK A;  3E98 A;  3S7N A;  2J9O A;  3EGD C;  4R3A A;  3UB9 A;  3VP3 A;  3PHY A;  1S1Y A;  5BOH A;  4X25 A;  2Y2L A;  4ZRR A;  1KE0 A;  3CWF A;  3R7W A;  5TBM B;  2Y2J A;  4WEK A;  4EW7 A;  3T4T A;  2O9B A;  2QJ7 A;  4YOF A;  5EPH A;  3BLM A;  4ZAM A;  3VSK A;  2K31 A;  2EX8 A;  4KZ5 A;  2VKS A;  1L0D A;  2VV8 A;  4JPM A;  1NXY A;  4GW9 A;  4BD0 A;  5F1F A;  1WYB A;  1NWZ A;  3TW8 A;  4JGQ A;  2A24 A;  5G18 A;  5A8B A;  4HBU A;  4DXC A;  1KGG A;  2B5R A;  3MZE A;  5J4E A;  5FAS A;  4X1L A;  2Y2Q A;  4ME4 A;  3KSF A;  4Y7P A;  4Z9Q A;  3VP1 A;  3T4L A;  3V3R A;  4GHI B;  5DTS A;  1LSV A;  4LLO B;  3S7P A;  5CEC A;  3DW0 A;  1OME A;  3VOY A;  3ZFZ A;  4C3Q A;  3CUE A;  2XFS A;  3WS1 A;  4WYY A;  2KX6 A;  2OAQ 1;  4N1H A;  4RYE A;  5EUA A;  2A3U A;  4I3J A;  3E2K A;  3F1P A;  5HWW A;  4JGP A;  2Y2P A;  4BJP A;  4D60 A;  3Q7V A;  4X56 A;  3A0R A;  3W4P A;  4EWF A;  1BUE A;  2JHE A;  4N1X A;  3P98 A;  3UB8 A;  5E2E A;  1PW8 A;  2XD1 A;  3MKE A;  4Q8I A;  4GNU A;  5FQK A;  3V50 A;  1MPL A;  5FSR A;  4NKP A;  1Y54 A;  5GLD A;  3F1N B;  4ZJ1 A;  3UE6 A;  2E8I A;  1MKI A;  3PXP A;  3W4O A;  3LIC A;  1TF1 A;  1NLY A;  3LR4 A;  4E04 A;  2CMN A;  4LPZ A;  5EVI C;  3C4O A;  1D1J A;  3CLO A;  3CPT A;  3IBR A;  4L9E A;  4X1M A;  4BQM A;  1BT5 A;  1X0O A;  3FG8 A;  3UPN A;  1PI4 A;  3FYZ A;  4FH2 A;  2HJE A;  3IXH A;  4HP9 A;  1HTZ A;  3EEH A;  1F2K A;  3CHW P;  2JKF A;  3TOI A;  4KZ9 A;  3LR0 A;  4OPR A;  4PHT A;  1XGI A;  4JF6 A;  4S2K A;  2IWD A;  2Y4A A;  5G4Y A;  1XA7 A;  2GNX A;  1AXB A;  2V1B A;  3NC8 A;  1GA0 A;  1MWR A;  3DBA A;  3LI9 A;  4B4X A;  4H6J B;  2JKT M;  1TS7 A;  3UMD A;  4PM8 A;  5DTK A;  3KSI A;  3G32 A;  5EOE A;  1RP5 A;  2W3H A;  4S2N A;  2V0U A;  3OCN A;  3UDI A;  5DVA A;  4KZ8 A;  1HVB A;  4LCL A;  3HUM A;  4WMC D;  4ARZ B;  4AFI A;  3EQV A;  2W3G A;  4JXG A;  1DP8 A;  4I38 A;  1KGE A;  2ZM8 A;  3O88 A;  1MWT A;  3NOP C;  5A91 A;  2P9V A;  4HY8 A;  4CLC C; 
#chains in the Genus database with same CATH homology
 2I72 A;  1C3B A;  2IWC A;  3UDF A;  4GDB A;  1IEL A;  2WKE A;  3N8L A;  4IED A;  4P85 A;  1W5D A;  4WZ5 A;  2QMI A;  1FCM A;  5CHJ A;  3WRZ A;  5E2H A;  1SDE A;  5EVI A;  4FH4 A;  1PIO A;  1GHP A;  5AQ7 A;  5CHU A;  3V50 A;  1FR1 A;  5J8X A;  3WS0 A;  3ITB A;  1KDS A;  3GTC A;  3M6H A;  3UY6 A;  2Q9N A;  1ES2 A;  2EFU A;  3A3E A;  4E3L A;  3N4I A;  5HAQ A;  5JYP A;  4Y0U A;  3DTM A;  3IWI A;  4E6X A;  5KSH A;  1SCW A;  2P9V B;  1ES4 A;  3OCL A;  2Y59 A;  5CTM A;  5HL1 A;  5F83 A;  3HLF A;  2WGV A;  4U0T A;  3ZG9 B;  3ZG7 B;  2PU4 A;  1E3U D;  1HD8 A;  2Y2I A;  3CG5 A;  4LV1 A;  4OH0 A;  1PWG A;  2WUQ A;  1K55 A;  4C6Y A;  5AQB A;  3HRE A;  5FQI A;  4EUZ A;  3SS4 A;  1TVF A;  5U47 A;  3BFC A;  5EVI B;  4P0M A;  2ZQC A;  3QNC A;  4RX2 A;  4OOY A;  1JTD A;  2VGJ A;  3G35 A;  5DF8 A;  1L0E A;  3HLD A;  3O86 A;  4EBL A;  4MBK A;  4DF6 A;  3C4P A;  1I2W A;  1PWD A;  3IF6 B;  4IVK A;  1E4D A;  4DE0 A;  3V3S A;  3VFH A;  3NI9 A;  1XPB A;  3M2J A;  2X01 A;  5M19 A;  4M3K A;  2J7V A;  4GB7 A;  5DF9 A;  2HDU A;  3A3I A;  5GL9 A;  2ZC3 B;  3VMA A;  2EX9 A;  1K57 C;  3NCK A;  4JBF A;  1MBL A;  2JC7 A;  4N9K A;  5EVI D;  4S2M A;  1K56 A;  4XUX A;  3IT9 A;  1KVL A;  3BRM A;  3HLG A;  4UA7 A;  3C5A A;  1VM1 A;  4OLD A;  1G6A A;  4ZBE A;  1TDL A;  4GD6 A;  3MZD A;  5CXW A;  4C75 A;  4E3N A;  4E6W A;  3M2K A;  1XA1 A;  3PAG A;  4D2O A;  2PBY A;  4UA9 A;  3ZCZ A;  2QPN A;  2WKH A;  1BLC A;  1GCE A;  2C6W B;  1YLW A;  3ZG5 A;  2JBF A;  1ZKJ A;  2JCH A;  3C7V A;  3SS3 A;  3GVB A;  1J9M A;  1ES3 A;  1MY8 A;  2FFY A;  3D4F A;  4DE2 A;  5FAP A;  5GHX A;  1GHM A;  3WRT A;  1YLJ A;  5FQM A;  1MWS A;  3N7W A;  1ONH A;  1DJB A;  1YMS A;  2FFF B;  1YQS A;  1JWZ A;  5HAP A;  1L2S A;  1LI0 A;  1M6K A;  2Y2M A;  1JWV A;  1BTL A;  5GLA A;  4KG2 A;  2H10 A;  2V20 A;  3LO7 A;  4JLF A;  3HBR A;  3Q7Z A;  1YMX A;  3BEC A;  3IXG A;  1GHI A;  2EX2 A;  3PBR A;  4OP8 A;  5FI6 A;  5CTN A;  2R9X A;  3SOI A;  2CC1 A;  3WS5 A;  3PBT A;  3N8R A;  3G4P A;  1K25 A;  4BLM A;  3VSL A;  4BL2 A;  1GA9 A;  1K4F A;  1N4O A;  4QY5 A;  3ZVW A;  3UPO A;  3ZG8 B;  2IWB A;  4OPQ A;  4HBT A;  1IYP A;  2PU2 A;  5EOO A;  3VP0 A;  2Y55 A;  3BFD A;  3O3V A;  1IKG A;  1H8Z A;  2XEP A;  4R4S A;  1KE4 A;  4K0X A;  4JXV A;  5DF7 A;  3GQZ A;  5AQ9 A;  4OLG A;  4OVD A;  2Y2G A;  1N9B A;  3IH9 A;  4LEN A;  2XR0 A;  5CER A;  3LY3 A;  1TEM A;  5CGX A;  4KZ4 A;  1K54 C;  5FQJ A;  3UE0 A;  4XXR A;  5E2G A;  3ZGA B;  3QHY A;  2ZC5 B;  1O07 A;  2DRW A;  3NDE A;  1ALQ A;  1TDG A;  2XH9 A;  5EVL A;  2ZC6 B;  5GHZ A;  2P74 A;  4MLL A;  1M40 A;  2HDQ A;  4DRT A;  1NRF A;  4X69 A;  3G2Z A;  5KSC A;  4HES A;  1FR6 A;  3HUN A;  4KQO A;  5CGW A;  4NK3 A;  4EV4 A;  1NYM A;  4S2L A;  1E25 A;  3IWO A;  1SHV A;  2H0Y A;  3C7U A;  3W8K A;  5KZH A;  4S2N C;  3GMW A;  4GOG A;  3NBL A;  1W79 A;  3E2L A;  3MXS A;  4OKP A;  1BLH A;  1CEF A;  1VQQ A;  2J9P A;  3OC2 A;  4KZA A;  4IBX A;  3SH7 A;  1W7F A;  3BFF A;  1PZO A;  5HAR A;  5TGF A;  4LV3 A;  3V5M A;  3FKV A;  1ONG A;  1LLB A;  2HP5 A;  3G31 A;  2ZQD A;  5CED A;  3O87 A;  1K4E A;  1RCJ A;  3HUO A;  1LHY A;  1YLZ A;  3HL9 A;  3PBQ A;  1Q2P A;  3IF6 A;  2Y2K A;  3ZVT A;  5M18 A;  3HLB A;  1PI5 A;  4IVI A;  3UE3 A;  1K6R A;  4R3J A;  5A93 A;  1PYY A;  1MXO A;  2G2U A;  1JVJ A;  4OPZ A;  1WYC A;  3TG9 A;  5IHV A;  5A90 A;  2HDS A;  4E3J A;  1ZC2 A;  2WGW A;  3HLC A;  4KG5 A;  3BFE A;  1FQG A;  3IF5 A;  2XD5 A;  4FSF A;  1QME A;  4BEN A;  3NIA A;  1JTG A;  3GRJ A;  3GV9 A;  5TFQ A;  1EI5 A;  4EBN A;  1K57 A;  3WS2 A;  1EWZ A;  1ERM A;  3RJU A;  1PZP A;  2XK1 A;  4LCM A;  4WBG A;  5EEC A;  1ES5 A;  1SDN A;  4UHU A;  2X02 A;  1MWU A;  2XDM A;  2X71 A;  3FWL A;  3OPH A;  4S2P A;  4FD8 A;  1ZG6 A;  4WZ5 C;  2RCX A;  2H0T A;  3A3J A;  3UN7 A;  4OOM A;  3I7J A;  4PM7 A;  2HPB A;  2OSU A;  4MBH A;  4MBF A;  4QB8 A;  5L2F A;  4K91 A;  5GHY A;  2WGW B;  4B4Z A;  4Y0T A;  4R4R A;  4WEJ A;  3CZD A;  4L0L A;  4ZJ3 A;  5AQA A;  1ZG4 A;  4H8R A;  4CPK A;  2G2W A;  4OON A;  4DE3 A;  2HP9 A;  3IWQ A;  1NZU A;  4PM5 A;  4QY6 A;  3SH9 A;  1KE3 A;  4NET A;  2J9O A;  3N6I A;  3PBN A;  1ERO A;  1K38 A;  3OPL A;  3Q81 A;  2WGI A;  2EXA A;  3MXR A;  5FDH A;  4KEN B;  3VP3 A;  5F1G A;  1G68 A;  4WEL A;  5HFO A;  4WZ4 A;  4DDS A;  2ZM2 A;  1W8Q A;  5BOH A;  1IEM A;  2Y2L A;  3DWK A;  3S22 A;  2VGK A;  3PAE A;  1IYS A;  2WAE A;  1KE0 A;  5JYO A;  5GLC A;  4R0Q A;  3TSG A;  2Y2J A;  4WEK A;  4GD8 A;  2WAF A;  4ZDX A;  4RX3 A;  3ZNT A;  2WYX A;  5EPH A;  2ZJ9 A;  1RGZ A;  2Q9M A;  1H8Y A;  3BLM A;  3PBO A;  4YFM A;  4ZAM A;  3RXX A;  3VSK A;  1LL5 A;  2EX8 A;  4KZ5 A;  3LEZ A;  1O7E A;  3A3D A;  3IXD A;  4S2J A;  1L0D A;  4JPM A;  1NXY A;  3Q82 A;  1IYQ A;  1ESI A;  1I2S A;  4BD0 A;  5F1F A;  1WYB A;  1XGJ A;  3V39 A;  3QNB A;  1CEG A;  3DWZ A;  5G18 A;  3SH8 A;  1YT4 A;  1Q2Q A;  4HBU A;  4EBP A;  1QMF A;  4LV2 A;  4GN2 A;  1KGG A;  4DXC A;  4R23 A;  2WKI A;  2B5R A;  3MZE A;  4OQI A;  5FAS A;  3BFG A;  2Y2Q A;  4GDN A;  4OOL A;  4Y7P A;  4Z9Q A;  3S1Y A;  3VP1 A;  1K56 D;  4KZ7 A;  5HW3 A;  3V3R A;  1CK3 A;  5DTS A;  1L0F A;  4Y0O A;  5CEC A;  1XXM A;  3CMZ A;  3FZC A;  3LY4 A;  3DW0 A;  3GSG A;  1OME A;  3VOY A;  3ZFZ A;  3IXB A;  3LCE A;  5CHM A;  1CI9 A;  4C3Q A;  5FI7 A;  2XFS A;  2WZZ A;  1XX2 A;  3WS1 A;  4WYY A;  2ZC4 B;  4JF4 A;  4PMA A;  3IHB A;  4N1H A;  4RVA A;  4RYE A;  5E43 A;  1YLY A;  5EUA A;  2A3U A;  4E3I A;  3RXW A;  4CJN A;  3E2K A;  2Y2O A;  4OPY A;  4OQG A;  4U0X A;  2Y2P A;  4BJP A;  4DKI A;  3AGF A;  3A3F A;  3Q7V A;  4X56 A;  2OV5 A;  3W4P A;  4ID4 A;  2GDN A;  4EWF A;  5FI2 A;  3ZNY A;  3MFD A;  5I94 A;  1BUE A;  2JE5 A;  5EE8 A;  4OQ0 A;  4N1X A;  2C5W B;  4S2O A;  1H5X A;  1ERQ A;  1BUL A;  2UWX A;  3P98 A;  5E2E A;  3HLW A;  1PW8 A;  4MEZ A;  1CI8 A;  2XD1 A;  5CGS A;  3MKE A;  4Q8I A;  5KMW A;  3IQA A;  2H5S A;  4GNU A;  5FQK A;  3M6B A;  1BLS A;  1MPL A;  3FV7 A;  3HLE A;  3MKF A;  5FSR A;  4HEF A;  1Y54 A;  4S2I A;  1KDW A;  5GLD A;  5GLB A;  3S4X A;  2DCF A;  4B88 A;  1KGF A;  1ESU A;  4O7D A;  3VP4 A;  5FQ9 A;  4ZJ1 A;  3W4Q A;  2XLN A;  5A92 A;  2E8I A;  2DNS A;  3Q7V B;  3VFF A;  1MKI A;  3MBZ A;  3W4O A;  5M1A A;  3GR2 A;  4X53 A;  1IKI A;  4JXW A;  5CRF A;  4N92 A;  3ZDJ A;  3BM6 A;  4X6T A;  1NZO A;  2BLS A;  3G2Y A;  3OZH A;  4E3O A;  1LI9 A;  3FKW A;  3AGE A;  5EVI C;  1NY0 A;  3UO9 A;  3C4O A;  4MNR A;  3EQU A;  2HDR A;  4QHC A;  3OPR A;  3B3X A;  2XGN A;  2RL3 A;  4DE1 A;  2V1Z A;  1FCO A;  4U3T A;  1S6R A;  4QJG A;  2EFX A;  2ZLY A;  3UDX A;  3IF6 C;  5FA7 A;  1XP4 A;  4BQM A;  1BT5 A;  3MZF A;  4OQH A;  3BYD A;  1FSY A;  1PWC A;  3UPN A;  1PI4 A;  3FYZ A;  4FH2 A;  4N9L A;  4YIN A;  3PBS A;  1WE4 A;  1BSG A;  1U60 A;  3IXH A;  4X55 A;  3OPP A;  4QU3 A;  1HTZ A;  4KG6 A;  1K55 C;  3PTE A;  4BL3 A;  4F94 A;  2EX6 A;  1K6S A;  2A49 A;  4KZ6 A;  5FAQ A;  3ZHH A;  1RGY A;  2R9W A;  5E2F A;  4DDY A;  1FSW A;  5FQQ A;  4PPR A;  2Y2N A;  3TOI A;  4KZ9 A;  4OPR A;  4WMC A;  4A5R A;  4R3B A;  4WM9 A;  4RA7 A;  3BEB A;  4LV0 A;  1XGI A;  4JF6 A;  3Q07 A;  4S2K A;  2IWD A;  2Y4A A;  3WWX A;  4PM6 A;  4K0W A;  4P6B A;  4X68 A;  2ZM0 A;  1XA7 A;  1YM1 A;  4JF5 A;  1DY6 A;  1AXB A;  5TR7 A;  1I5Q A;  2QZ6 A;  3NC8 A;  1GA0 A;  3VOZ A;  3BLS A;  1MWR A;  3AGD A;  2Z2M B;  3JYI A;  3N8S A;  1BZA A;  2ZQA A;  4OP5 A;  1FOF A;  3IHA A;  4QD4 A;  2XF3 A;  3HVF A;  2OLV A;  4B4X A;  4JKT A;  1S0W A;  4XUZ A;  3UNW A;  1K54 A;  2ZQ8 A;  4E3M A;  2ZMA A;  4PM8 A;  1HZO A;  2WAD A;  1NYY A;  5DTK A;  4GZB A;  3SS5 A;  4KZB A;  4R1G A;  3G34 A;  4E3K A;  3UPP A;  3G32 A;  1NJ4 A;  3G30 A;  4DXB A;  5EOE A;  5HAI A;  3NY4 A;  4KZ3 A;  1RP5 A;  5FAO A;  1DJA A;  4PM9 A;  1DJC A;  2HP6 A;  4ZTK A;  4S2N A;  3ITA A;  3OCN A;  5DTT A;  3UDI A;  4UA6 A;  5DVA A;  4ZJ2 A;  3WS4 A;  4UAA A;  3IH8 A;  2ZQ7 A;  3UE1 A;  5D3O A;  1YLT A;  5F82 A;  4IBR A;  4KZ8 A;  4P87 A;  1HVB A;  1FCN A;  4GKU A;  4LCL A;  3HUM A;  4WMC D;  3ZG0 A;  1E3U A;  1W8Y A;  3P09 A;  2ZC7 A;  3EQV A;  1PW1 A;  2XFT A;  2OLU A;  5FAT A;  1LL9 A;  3Q1F A;  5CEB A;  3VP2 A;  2ZD8 A;  4JXG A;  1KGE A;  2Y2H A;  2XQZ A;  4JXS A;  2ZM8 A;  1IYO A;  5HX9 A;  1L0G A;  4KQQ A;  3O88 A;  2Z2L B;  1YLP A;  4FCF A;  1MWT A;  1Z6F A;  3NDG A;  1XKZ A;  3ISG A;  5A91 A;  2P9V A;  2WK0 A;  1BLP A;  2BG1 A;  2EXB A;  1KVM A;  1SKF A;  2J8Y A;  4KQR A;  2V2F F;  2WZX A;  2Y91 A;  2ZQ9 A;  4BD1 A;  1JWP A;  3CJM A;  4EQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...