1GHPA

Structures of the acyl-enzyme complex of the staphylococcus aureus beta-lactamase mutant glu166asp:asn170gln with degraded benzylpenicillin
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
257
structure length
257
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYDIELQYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Structures of the acyl-enzyme complexes of the Staphylococcus aureus beta-lactamase mutant Glu166Asp:Asn170Gln with benzylpenicillin and cephaloridine.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 95
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ghpA00
2H0TA 2A49A 4JXVA 2WZXA 3HREA 5EECA 1VQQA 1DJCA 1FQGA 1BULA 3C4OA 3CG5A 2XFTA 1Z6FA 1KGEA 2J7VA 3BLMA 2JCHA 2Y2JA 3EQUA 3QHYA 1PZOA 2WGVA 4KQOA 3C4PA 1LL9A 1MWUA 2ZC7A 5F82A 4RX3A 3NDGA 2Y2NA 4LV3A 4M3KA 1I2SA 5FATA 5BOHA 1LHYA 3M6BA 4EBNA 3OPRA 2P9VB 5FI6A 3GVBA 4HBTA 3G2YA 3D4FA 3BFDA 3HLWA 5EUAA 4S2OA 3IF5A 3PTEA 4XUXA 5HW3A 1FCNA 1W8YA 4MBKA 1O7EA 4EV4A 2HDUA 1AXBA 2V2FF 4O7DA 1G6AA 5EOEA 1YLYA 3BFEA 3IXDA 3N6IA 3OPPA 3IWQA 2XGNA 4R3JA 3PBNA 5M18A 4N9KA 3VMAA 2XFSA 4X69A 3MFDA 4E3NA 4OOYA 5J8XA 3PBQA 1BUEA 4PM9A 5FQMA 1MKIA 2EX8A 4S2MA 3FKVA 4WEKA 1S6RA 4KZ3A 2V20A 1W8QA 3N8SA 5GL9A 1K4EA 2C6WB 4E6WA 3HLCA 1MY8A 3TSGA 2A3UA 2Y2IA 3SS3A 3UDIA 4DKIA 5CERA 2P74A 5M1AA 5AQBA 4BL2A 3VSLA 5HAQA 2Y2KA 1K25A 5HX9A 2H5SA 3HVFA 4E3KA 1WYCA 1NRFA 1ZG4A 1QMEA 2XLNA 3GMWA 4PM6A 2OV5A 5FQKA 1GA9A 2G2UA 1YLTA 4PM8A 2GDNA 3WRZA 5E2GA 3FV7A 2RL3A 4UHUA 2B5RA 3C7UA 1YM1A 1LI0A 4FSFA 5DVAA 3RXWA 5CHUA 3G4PA 5FDHA 4KG6A 5FQQA 4RVAA 1SKFA 2ZQ8A 3IF6B 2IWBA 2XD5A 4OLDA 4WYYA 2ZC3B 1L0DA 1IYSA 4BJPA 3BYDA 3DW0A 1BSGA 3NIAA 2Y55A 4KG5A 2X02A 4K0WA 3ZG0A 3PBSA 4S2KA 5GHXA 4QHCA 3HLEA 3SH9A 2WKEA 2ZQ9A 3G34A 1KGGA 3V50A 1BLPA 2WYXA 5CGWA 1FOFA 5E2FA 4D2OA 4E3OA 4KZ9A 1FSWA 2EX6A 3VOYA 3O86A 4PPRA 4BD0A 5HFOA 4JF5A 2R9XA 4DE2A 3N4IA 1ZG6A 3ZVWA 4KZ6A 4P6BA 5KMWA 3N8RA 2G2WA 1SHVA 3BFCA 4OOLA 3WWXA 1E4DA 3S1YA 3IH9A 5EVIB 5CGXA 5FA7A 3ZG5A 5CHJA 1BLSA 3IXBA 4IBRA 1QMFA 2BLSA 2WAFA 2Z2LB 1YT4A 2ZC5B 4K91A 3UY6A 2XF3A 3V39A 2ZQDA 4DE1A 1RGYA 4WZ5C 5G18A 4MBFA 4JF6A 1O07A 1NZUA 1KDWA 2ZC6B 4OP5A 1MBLA 3GR2A 3HLGA 3ZG9B 2HP6A 4QU3A 4S2IA 2XEPA 1K6RA 5GLBA 4BQMA 1PI5A 5FAOA 4QY6A 3DWZA 4R3BA 1HVBA 5TR7A 4Q8IA 2ZJ9A 1JWPA 4IVKA 4U3TA 1EROA 3GTCA 1PWCA 4HBUA 3ITBA 3O88A 4LV2A 5E2HA 3A3EA 2XD1A 2WZZA 4JBFA 5JYPA 1ES5A 1ES3A 2FFFB 5CEBA 4ZJ3A 5E43A 2E8IA 1ONHA 4R1GA 2BG1A 3W8KA 4P85A 5KSHA 4K0XA 3NDEA 3S4XA 5FQ9A 1KGFA 4NK3A 1XX2A 5DF9A 5AQAA 1KDSA 2JC7A 4IVIA 1LLBA 5CECA 1MXOA 1Q2QA 4N9LA 5EE8A 2OLUA 2WK0A 3LY3A 4PM5A 5GHYA 4DRTA 1HZOA 4YINA 1MWTA 1BLCA 2ZM8A 5DF7A 4OPQA 3SH7A 4H8RA 1HTZA 4IEDA 2EXAA 3VFFA 4Z9QA 3IT9A 5GLAA 1YLPA 3WS5A 4GKUA 4LCMA 1BT5A 4KZ5A 4ZBEA 4L0LA 2EFXA 4MLLA 4E6XA 1LI9A 3G32A 3OCLA 1IYPA 1NJ4A 4JLFA 3ZDJA 3Q81A 1KE0A 3VP3A 1SDEA 1K57A 3MKFA 1XP4A 1N4OA 1PW8A 2ZD8A 4OLGA 4CPKA 4OKPA 3WS1A 4FD8A 1IYQA 2IWDA 1K57C 2ZC4B 4PM7A 2HP9A 4JPMA 4MEZA 1YMXA 5JYOA 3NCKA 1YLJA 4OQIA 3M2JA 1YLWA 2ZM2A 1H8ZA 3Q1FA 3HUOA 4WELA 1MWRA 3VFHA 2HDQA 2VGJA 1XPBA 3W4OA 3ZHHA 4NETA 4KENB 1GA0A 3MZDA 3ISGA 1Y54A 4DE0A 5FSRA 3HUMA 4ZAMA 4UAAA 3N8LA 3C7VA 3IWOA 2VGKA 1ESUA 4X6TA 4Y0UA 3LEZA 4QD4A 4JKTA 1XXMA 2H10A 4E3LA 5FI7A 3ZCZA 2FFYA 3MBZA 2C5WB 2HDSA 4EBPA 4PMAA 3WS0A 2WAEA 2ZMAA 3GQZA 3QNCA 2WUQA 4QB8A 4S2NA 4YFMA 5AQ9A 2X01A 5I94A 3IF6C 4OONA 1TEMA 2H0YA 4WZ4A 1ERQA 4P0MA 4S2NC 3BM6A 3A3IA 5A92A 4Y7PA 5EPHA 1RGZA 1NXYA 4KQQA 4MBHA 1GHPA 3PBOA 3ITAA 3UPPA 5U47A 2IWCA 3Q7VA 1NY0A 4ZJ2A 1S0WA 3OZHA 5A91A 5FAPA 4OPYA 5F1GA 5DTSA 2EX2A 4FH2A 5DF8A 4ZJ1A 4HEFA 3W4QA 3LCEA 5CHMA 2WGIA 1CK3A 1LL5A 3AGDA 3UN7A 2DNSA 1RCJA 3Q7ZA 1EWZA 1K56D 2EXBA 5A90A 1PYYA 1IYOA 4JXSA 5HAIA 2ZLYA 1N9BA 3A3FA 3OCNA 3DWKA 3RXXA 3NY4A 1YLZA 3GSGA 1G68A 4E3IA 4OH0A 4QJGA 4EUZA 3HLFA 1I2WA 1KVMA 5DTTA 1FCOA 4X68A 5E2EA 1K56A 4WZ5A 1KE3A 4A5RA 4MNRA 4KZBA 2Q9MA 3ZFZA 3VP4A 4OQGA 1ZKJA 2HP5A 4OPZA 1DJAA 3IQAA 3V3SA 4JXWA 3M6HA 5CXWA 2WGWA 1PWDA 2Y2MA 3S22A 4EQIA 4DDYA 4S2JA 4OPRA 3UDXA 3ZGAB 1TDGA 1ONGA 1PI4A 4P87A 3LO7A 1NYYA 4C75A 3G2ZA 3TOIA 4BD1A 3MZFA 3C5AA 4U0XA 1BTLA 3UE1A 3N7WA 4QY5A 4GDNA 4BL3A 2EX9A 4JXGA 5AQ7A 1HD8A 3VP0A 3UDFA 4OOMA 5TGFA 1MWSA 1VM1A 3E2LA 1M40A 1CI9A 1K54A 5KSCA 3CJMA 5F1FA 5EOOA 1M6KA 3OPHA 3WS2A 1JTGA 1K54C 2QMIA 3VOZA 3BRMA 3W4PA 3B3XA 3CZDA 5HAPA 4Y0TA 2QPNA 3TG9A 4C6YA 3FWLA 4RA7A 1BLHA 1PIOA 2Y2LA 1I5QA 2J9OA 3ZG7B 4LV1A 2Y2OA 3MXRA 2DCFA 1MPLA 3LY4A 1ES4A 4E3JA 3IWIA 5A93A 1W79A 3FYZA 1NYMA 2R9WA 3AGFA 2J9PA 1OMEA 1JWZA 3VSKA 2JBFA 1H8YA 1ALQA 1FR6A 2P9VA 4C3QA 2EFUA 3A3JA 1WYBA 1NZOA 4LENA 1JTDA 1PW1A 2OSUA 3BEBA 1XGIA 1CI8A 1XA1A 1FCMA 2WKIA 4S2PA 4WEJA 1E25A 3GV9A 3HLBA 4XXRA 1DY6A 1K55C 5EVLA 5IHVA 3PAGA 4OQ0A 2PU4A 3SS4A 5HARA 3VP1A 5TFQA 3SOIA 4DXCA 4RX2A 4OVDA 3G30A 4WBGA 1DJBA 4KZ8A 1E3UA 2V1ZA 4DF6A 1IKGA 3PBTA 1SCWA 4HESA 4GDBA 3CMZA 1L0GA 4E3MA 1RP5A 1J9MA 3PAEA 2Z2MB 3O3VA 3HBRA 3IHBA 4GB7A 4UA9A 3A3DA 5FI2A 3M2KA 4GNUA 1FSYA 5GLCA 1W7FA 2HDRA 4ZTKA 3IXGA 4Y0OA 1CEFA 4GZBA 1EI5A 3IXHA 3UPOA 1GHMA 2Q9NA 4N1HA 3Q82A 4DXBA 3IF6A 4LV0A 2Y2HA 4OQHA 2Y59A 5GLDA 4CJNA 3HLDA 3SH8A 4WMCD 5DTKA 1FR1A 3V3RA 2DRWA 3JYIA 4JF4A 5KZHA 3FKWA 2ZQ7A 3AGEA 2WADA 2I72A 3MKEA 1KE4A 4DE3A 1IELA 4R0QA 1ZC2A 3HL9A 5EVID 5M19A 3WS4A 2Y2QA 4WMCA 3MXSA 1YQSA 2X71A 2ZM0A 1WE4A 5FASA 3IH8A 3ZG8B 1BZAA 2ZQAA 4IBXA 1K4FA 2OLVA 2XH9A 3UPNA 3ZVTA 4B88A 5EVIA 1ES2A 1JVJA 2PU2A 3UE0A 3ZNTA 3GRJA 3P09A 4R23A 3OC2A 4R4RA 3FZCA 5EVIC 3UE3A 3V5MA 3BFGA 4X56A 4OP8A 1H5XA 2XDMA 3BECA 4BLMA 3O87A 5CEDA 4GD8A 2Y91A 4UA7A 4ZDXA 3UO9A 4FCFA 4DDSA 1ERMA 1C3BA 5CRFA 4R4SA 4KZ7A 4B4XA 5FQIA 3VP2A 4KZAA 3BLSA 1K38A 4S2LA 3Q7VB 3PBRA 2UWXA 3ZNYA 2RCXA 3NI9A 4N92A 4KG2A 4LCLA 2PBYA 4GOGA 5FQJA 1L0FA 3G35A 3NC8A 4UA6A 3SS5A 3NBLA 5GHZA 1YMSA 2CC1A 2QZ6A 3Q07A 3QNBA 4X53A 3HUNA 2Y4AA 4EWFA 1SDNA 5CGSA 1CEGA 1GCEA 1TDLA 1PWGA 1XGJA 5F83A 3E2KA 3G31A 1IEMA 1TVFA 3MZEA 3I7JA 4KQRA 5D3OA 4X55A 3UNWA 2XQZA 3P98A 4KZ4A 1IKIA 4EBLA 5HL1A 5CTMA 3RJUA 1XA7A 2JE5A 4XUZA 4BENA 4ID4A 3EQVA 4GN2A 1K6SA 1W5DA 1L2SA 5FAQA 4F94A 2WGWB 3DTMA 2J8YA 3OPLA 3BFFA 5L2FA 2Y2PA 4GD6A 4RYEA 4WM9A 1L0EA 2HPBA 2WKHA 1XKZA 1K55A 2Y2GA 2XK1A 1U60A 3WRTA 1ESIA 1E3UD 2ZQCA 1JWVA 2XR0A 4N1XA 1PZPA 5CTNA 1KVLA 3IHAA 4U0TA 1Q2PA 1GHIA 4FH4A 4B4ZA
chains in the Genus database with same CATH superfamily
2OOLA 3T4QA 2WZXA 3HREA 5EECA 1VQQA 4CLCE 4WUJA 1G28A 1BULA 3C4OA 2J7VA 3BJNA 1OTAA 3EQUA 3A0SA 1X0OA 2WGVA 3C4PA 1LL9A 1MWUA 2ZC7A 3MFXA 5LBRA 4M3KA 1MKMA 1I2SA 4KQDA 5FATA 1LHYA 4JGQA 5EV0A 3UB8A 4XUXA 1W8YA 4MBKA 2J3WA 2V2FF 1MC0A 4O7DA 1HLUP 1UWNX 3BY9A 4R3JA 3PBNA 5M18A 1OTEA 4X69A 4E3NA 4OOYA 1BUEA 4NXBA 1MKIA 3K2NA 1S6RA 3LICA 3HLCA 3TSGA 2A3UA 2Y2IA 3S7QA 3VSLA 3T1SA 1K25A 5HX9A 2H5SA 2PYRA 4E3KA 1NRFA 1ZG4A 3WRZA 5DFYA 5E2GA 5J7EA 3G4PA 5FDHA 4RVAA 3EEAA 5IS1A 3UB5P 1VEUB 3NIAA 2QKPA 2X02A 3ZG0A 2WKEA 1BLPA 3ZYTA 1OTDA 5E2FA 2EX6A 4PPRA 3CWFA 3ZVWA 4P6BA 5HDDA 2W1TB 3N8RA 3H82B 3BFCA 4YNRA 4IBRA 4HY8A 2XF3A 2Q0OA 5G18A 5AVFA 3PHYA 1MBLA 3GR2A 3HLGA 1K6RA 1DP9A 3FPWA 4QY6A 4HH2A 1VHMA 1HVBA 4Q8IA 1JWPA 4IVKA 2OWHA 4ZRRA 3A0VA 3ITBA 1ACFA 4LV2A 4K08A 4MMNA 2B95A 1ES3A 2FFFB 5E43A 3LR4A 3E4QA 4R1GA 4YWZA 4QWOA 5KSHA 2B02A 3RH8B 1KGFA 1F98A 5DF9A 1KDSA 4IVIA 1LLBA 1XJ6A 5HD3A 3GECA 4FOFA 4G3VA 1YSQA 4H8RA 3VFFA 3CITA 1PFLA 4KZ5A 1LI9A 3OCLA 4LGWA 4JLFA 3ZDJA 4CLCB 3E4PA 3UMEA 1SDEA 1OTIA 1XP4A 2ZD8A 3UB6A 4BBUA 1NLYA 3TW8A 4PM7A 1YMXA 4KUOA 1YLJA 3LI9A 4MN7A 2VGJA 4KENB 3IS2B 3N8LA 3C7VA 3IWOA 2VGKA 5F69A 1ESUA 4X6TA 1S1YA 1S67L 2PYPA 3ZCZA 4PMAA 3B42A 4CQHA 3IF6C 3T4TA 1TEMA 2H0YA 1ERQA 1F2KA 5EPHA 2W0NA 1NXYA 5U47A 2IWCA 3Q7VA 4XT2A 1DP8A 1S0WA 4OPYA 5DTSA 3V67A 3LCEA 1RCJA 4I38A 5A90A 1IYOA 1YAXA 1CF0A 2ZLYA 3RXXA 4E3IA 4EUZA 3O5YA 1I2WA 2VV8A 3H7WB 1KE3A 3T4SA 2IA2A 4OQGA 1ZKJA 2HP5A 2V8CA 4OPRA 3FC7A 4P87A 4BD1A 3C5AA 3UE1A 4QY5A 4B93A 5AQ7A 3UDFA 4MDZA 3E2LA 1M40A 5KSCA 3TRCA 2FH5A 1M6KA 1JTGA 2QMIA 3W4PA 3B3XA 1BLHA 1K0KA 1OPXA 2J9OA 2Y2LA 4LV1A 1MPLA 3LY4A 1ES4A 4E3JA 3IWIA 1W63Q 1W79A 3FYZA 2D01A 5DJTA 1H8YA 5IT5A 3A3JA 1H0MA 5MC7A 5HAIA 2O9CA 3GV9A 4NKPA 1NRJA 4OQ0A 4X1LA 2PU4A 3SS4A 5HARA 4MN6A 5TFQA 4DXCA 1OJ5A 4RX2A 3SW1A 4KZ8A 1E3UA 1L0GA 4E3MA 4R70A 3T1XA 3A3DA 5FI2A 3MJQA 3JPUA 4Y15A 1TS7A 1FILA 3IXHA 2Q9NA 3Q82A 4Q0JA 4DXBA 3C38A 4OQHA 2Y59A 4JGRA 3HLDA 2JKRM 4UQIM 3D3OA 2JKTM 3MXSA 2X71A 3UPNA 2OLVA 4B88A 5EVIA 2PU2A 3GRJA 4R23A 5EVIC 1L3LA 3FZCA 3BFGA 4Y2FA 2XDMA 3MQQA 1UWPX 2YKHA 4LRXC 1TF1A 3F1PA 4FCFA 1ERMA 3CHWP 4EETB 1YKDA 5FQIA 3BLSA 5G4YA 4X25A 3ZNYA 3NI9A 4N92A 4LCLA 4GOGA 3QP6A 3G35A 5HZHA 4UA6A 3NBLA 2O99A 1YMSA 2QZ6A 4X53A 4EWFA 2VEAA 3P7NA 1XGJA 1P97A 3E2KA 3MZEA 4BWIA 2EA9A 4KZ4A 3HCYA 4EBLA 5CTMA 4Q0HA 4PAUA 4ID4A 1K6SA 1L2SA 3JVVA 3BFFA 5J3WA 4RQ9A 4ETXA 4RYEA 2Y2GA 1K55A 1N9OA 3WRTA 2ZQCA 1H3QA 5CTNA 3IHAA 5J4EA 1GHIA 4KUKA 4GLQA 2A49A 1D1JA 1FQGA 4FUWA 2M7VA 3CPTA 4RX3A 4WL9A 3NDGA 4LV3A 5BOHA 3M6BA 4LPZA 3OPRA 3GVBA 4LRZE 3G2YA 3LIBA 3KYQA 3HLWA 4S2OA 1N9NA 3IF5A 1FCNA 1AXBA 1YLYA 3CUEA 3OPPA 3F1NA 5HWWA 3VMAA 2KDKA 4HI4A 3CUEC 5J8XA 3OOVA 3PBQA 4PM9A 2EX8A 3FKVA 3N8SA 1K4EA 4HH3A 4E6WA 3BQAA 5CERA 3UPOA 3HVFA 1QMEA 1GSXA 5FQKA 1GA9A 3E0YA 2RL3A 3IX3A 2B5RA 4IUHA 4FSFA 4UEYA 3RXWA 3S7OA 1SKFA 2ZQ8A 4BJPA 1XFNA 4KG5A 3PBSA 4S2KA 1BYWA 5GHXA 2XROA 4EXOA 3T4OA 2ACGA 4P6ZM 3PR6A 2R9XA 4DE2A 3N4IA 5KMWA 3WWXA 2BASA 1AWIA 3IH9A 1BLSA 2HZ5A 3V39A 4WZ5C 4MBFA 5KIZA 3ZG9B 4QU3A 4S2IA 2XEPA 1PI5A 2JKRI 4R3BA 4DJ2A 3GTCA 1PWCA 4HBUA 2INWA 5E2HA 3BY8A 1ONHA 3MQ0A 4HOIA 3A0RA 2W1RA 1W63M 1MXOA 1Q2QA 4N9LA 3MS6A 3LY3A 4X1MA 3KYEA 1G5UA 2HJEA 1HTZA 3IT9A 3WS5A 2EWVA 3S7PA 1P0ZA 4MLLA 3VE3A 3MR0A 3Q81A 3PXPA 3MKFA 1K57A 1PW8A 1SZVA 2IWDA 1K57C 1YLWA 3Q1FA 4HJ3A 5DKLA 4WELA 3VFHA 3KX0X 2ZOHA 3ZHHA 4NETA 4GHIA 4GCZA 3MZDA 3ISGA 1Y54A 5DKKA 4IUKA 4Y0UA 3CI6A 4NG2A 5FI7A 3MBZA 3W2ZA 3GQZA 4S2NA 3LIDA 2HGVA 2X01A 4S2NC 3BM6A 3H9WA 1V9YA 1JNUA 1NY0A 4ZJ2A 3NULA 5FAPA 4FH2A 4ZJ1A 2EWWA 4HNBA 1LL8A 1CK3A 3F1OA 2ZL1A 4EERA 2O9BA 2P04A 3GSGA 1G68A 5DTTA 1LT0A 1S4RA 1K56A 4A5RA 4MNRA 4KZBA 1DJAA 3IQAA 1CQAA 1T1CA 1PWDA 3QP5A 4S2JA 1ONGA 1NYYA 4C75A 1BTLA 2K31A 3N7WA 4GDNA 4BL3A 4II7A 4JXGA 4UQIS 1K54A 2KOIA 5F1FA 1SKOA 3LR0A 3WS2A 1K54C 3BRMA 3CZDA 5HAPA 4Y0TA 5L09A 1I5QA 2Y2OA 5G4ZA 2DCFA 1D06A 3FPVA 5A93A 2A24A 2I9VA 1JWZA 5HL6A 3VSKA 2PD8A 1ALQA 2P9VA 4C3QA 1WYBA 1T19A 3NOUC 3BEBA 1XGIA 4WEJA 2WKIA 4XXRA 4S2PA 3DBAA 3HLBA 3VP1A 5HDCA 3G30A 3BW6A 4QPRA 1IKGA 1SCWA 4HESA 2VLGA 3RFBA 3UB7A 2JKFA 5K5BA 4ETZA 3M2KA 4GNUA 2JHEA 5GLCA 2HDRA 4ZTKA 5AVEA 3IXGA 2V9AA 2QHKA 4LRYC 4NXFA 2PAVP 3LIAA 4N1HA 3IF6A 4LV0A 2Y2HA 5GLDA 3B33A 1T1AA 1FR1A 5FDSA 2J3TD 4JF4A 4M4XA 1VETA 1ZC2A 3HL9A 5M19A 4WMCA 1YQSA 2ZM0A 3IH8A 3JVUA 1BZAA 2XH9A 1DP6A 4R4RA 3OC2A 4BLMA 4PKYA 4X56A 4OP8A 3BECA 1Y4OA 1C3BA 1Y28A 2OWJA 4KZ7A 4B4XA 4G3WA 2J80A 1K38A 3Q7VB 4XT2B 4HP4A 4KG2A 3T4LA 2JN7A 5FQJA 1L0FA 3NC8A 1P9RA 1LSVA 3HUNA 3LR5A 4O0PA 1GCEA 1TDLA 2V0UA 1OJGA 2CMNA 2JKGA 3UB9A 3UNWA 2XQZA 3P98A 3R4KA 1WA9A 4L9EA 3B47A 5HL1A 3RJUA 2JE5A 5TJJA 4GN2A 1W5DA 3LYXA 5DFXA 1P9WA 4WM9A 2HPBA 2XK1A 1YPRA 1U60A 1JWVA 2XR0A 4U0TA 3S4XA 4FH4A 4B4ZA 2H0TA 4JXVA 2VKSA 2OAQ1 3CG5A 4P6ZS 1KGEA 3BLMA 2JCHA 3DTKA 1PZOA 5F6AA 2Y2NA 5FI6A 4HBTA 3D4FA 3BFDA 4I39A 5EUAA 2L0WA 4EV4A 5TBMA 5FEFA 3E4OA 3N6IA 3IXDA 3IWQA 2XGNA 2WKQA 3T4KA 5FQMA 4WEKA 2V20A 3SS3A 1S1ZA 2P74A 2PR5A 5AQBA 5M1AA 4BL2A 5HAQA 2Y2KA 1WYCA 4PM6A 4F3LA 2G2UA 3ZQ5A 3FV7A 1PNEA 3C7UA 1LI0A 5CHUA 4KG6A 2IWBA 1L0DA 2W3EA 3BYDA 1YSPA 4K0WA 4QHCA 3SH9A 3G34A 1KGGA 4R3AA 5CGWA 4D2OA 3VOYA 4I3IA 5HFOA 4KZ6A 2G2WA 2K7SA 4OOLA 5EVIB 3VOLA 5CGXA 3ZG5A 3DAVA 5CHJA 1QMFA 2BLSA 2WAFA 2Z2LB 1YT4A 2ZC5B 3LGOA 5EM0A 3UY6A 2ZQDA 4DE1A 3LIEA 1RGYA 3C30A 4LFUA 4EESA 1O07A 1KDWA 2ZC6B 2HP6A 3F1PB 5GLBA 4G3KA 4CLCD 3DWZA 3MXQA 5TR7A 3O88A 2XD1A 4R38A 4JBFA 5JYPA 5CEBA 4ZJ3A 2BG1A 3E98A 4K0XA 2R78A 5FQ9A 4NK3A 2VK3A 5CECA 5EE8A 2ZMFA 2OLUA 4PM5A 4DRTA 2P7JA 2EXAA 4Z9QA 5HDSA 4LCMA 5HPIA 2PHYA 3DTEA 1BT5A 4ZBEA 3LFVA 4L0LA 2EFXA 3G32A 1IYPA 1NJ4A 1T18A 3LI8A 2M7UA 1N4OA 3KSIA 4OLGA 4OKPA 1TS0A 4E04A 4FD8A 2XA7S 4GS9A 1IYQA 5CX7A 3R7WA 3MF0A 3LUQA 2HP9A 2QJ5A 2O9AA 4JPMA 4MEZA 5JYOA 4OQIA 1XJ2A 2ZM2A 3NOTC 1MWRA 2B18A 2HDQA 1GA0A 2YKFA 4JGOA 2W3DA 3HUMA 4ZAMA 4UAAA 3K3DA 1D7EA 3CPTB 3LEZA 4HJ6A 4JKTA 1XXMA 2H10A 2C5WB 2HDSA 4R6LA 3QP1A 2WUQA 2ZOIA 1UGUA 4QB8A 4FTXA 4OONA 5HWTA 4ARZA 4GS9B 4WZ4A 3A3IA 4IJGA 1RGZA 3T4JA 4MBHA 1TD5A 4DMZA 1GHPA 1ZHHB 3ITAA 3F1NB 4Y13A 3S7NA 4HHDA 3OZHA 3T1QB 5F1GA 3T50A 2UV0E 2EX2A 4EEPA 1F5MA 4HEFA 3W4QA 1OT9A 5CHMA 1LL5A 3UN7A 2DNSA 3Q7ZA 2GZAA 1EWZA 2EXBA 4JXSA 4WLAA 3A3FA 3OCNA 3DWKA 3NY4A 1YLZA 2QWSA 1KVMA 4X68A 4WZ5A 5EFWA 2Q9MA 3VP4A 3IX8A 4OPZA 4BBTA 3V3SA 3M6HA 1S66L 1H8MA 2WGWA 4DDYA 3UDXA 2NUPC 3ZGAB 1TDGA 1DRMA 3MZFA 4U0XA 3RTYA 1OTBA 3VP0A 5TGFA 1MWSA 1VM1A 3EOIA 1CI9A 2JKTI 5EOOA 3U2AA 3EGDC 4L9FA 4O01A 4C6YA 4RA7A 1PIOA 4GW9A 3MXRA 4PHTA 2W3HA 3C2WA 1NYMA 2R9WA 3AGFA 1J3WA 3BWLA 1OMEA 2JBFA 2EFUA 4DN0A 1JTDA 2G7UA 2V0WA 4E3OA 1CI8A 1XA1A 2LB9A 1DY6A 4I3AA 3MQOA 3SOIA 2V1ZA 1V9ZA 2NUTC 2W27A 3PBTA 4YOFA 4GDBA 5HPFA 1RP5A 2Z2MB 3IX4A 3LEQA 3O3VA 3IHBA 4GB7A 4UA9A 4MCWA 1FSYA 2WKRA 4Y0OA 4B9OA 4GZBA 5DJUA 3U4LP 1GHMA 2H28A 3OLOA 1T1BA 3V3RA 2Y79A 4L9GA 1VEUA 2DRWA 2GNXA 5KZHA 3FKWA 2ZQ7A 3AGEA 3TJZC 3MKEA 1IELA 4R0QA 5EVID 5FASA 1WE4A 3KSGA 3KSHA 2OAP1 4GHIB 2W1TA 3P01A 2ZQAA 3H82A 1K4FA 4IBXA 2VA0A 1ES2A 2D02A 1JVJA 3P09A 3W8KA 3UE3A 5CEDA 4GD8A 2Y91A 3MMHA 1GSVA 2GJ3A 4PKYG 2XA7M 4KZAA 4S2LA 2RCXA 2PBYA 3SS5A 5HWVA 3ICYA 5GHZA 3F1OB 2CC1A 3Q07A 3QNBA 4BMWA 2ZL1B 2Y4AA 5CGSA 4HIAA 2WKPA 5F83A 3G31A 1TVFA 3FG8A 4EEUA 3I7JA 5D3OA 4X55A 3VE4A 3KSFA 1NLZA 1NWZA 4BENA 3EQVA 4F94A 2VJWA 3DTMA 2V1BA 5L2FA 4CLCA 1XJ3A 5F5YA 4HP9A 2E8JA 2WKHA 1XKZA 2M1CA 5HD5A 4CLCC 5FL3A 1PZPA 1Q2PA 1SKOB 5I5LA 1DJCA 4EW7A 4O8GA 3IS2A 2XFTA 4NXGA 1Z6FA 2ZBBA 2VV7A 2Y2JA 3QHYA 4KQOA 2A24B 5F82A 2P08A 4EBNA 2P9VB 2HJ9C 2K2NA 1GSWA 3PTEA 4Y3IA 5HW3A 3LR3A 4MN5A 1O7EA 2HDUA 1G6AA 5EOEA 3BFEA 4N9KA 2XFSA 4Q0IA 3MFDA 4S2MA 4KZ3A 1W8QA 5GL9A 2C6WB 4DKIA 1MY8A 3UDIA 3K3CA 3QP4A 2OV5A 2AVXA 2XLNA 3GMWA 4PM8A 1YLTA 2VGLM 2GDNA 2GX5A 4WF0A 2PT7A 4UHUA 1YM1A 3H7WA 5EM1A 5DVAA 3L7HA 2LB5A 3MSHA 5FQQA 3IF6B 2XD5A 4OLDA 4WYYA 3PYPA 2ZC3B 5A8BA 1IYSA 3DW0A 1BSGA 2BTFP 2Y55A 2Z6DA 2A2LA 3HLEA 2ZQ9A 1VETB 3V50A 2WYXA 1FOFA 1G6OA 4KZ9A 1FSWA 3O86A 4BD0A 4JF5A 4NXEA 1ZG6A 1SHVA 1IFQA 1E4DA 3S1YA 4Z1WA 5FA7A 4JGPA 4ESPA 3IXBA 2VX8A 4K91A 4AFIA 1F9IA 1LSXA 3EWKA 4JF6A 1NZUA 4I5SA 4OP5A 3SZTA 4BQMA 5FAOA 2V8FA 5IU1A 2ZJ9A 4U3TA 2KLIA 1EROA 2FZ0A 3A3EA 2WZZA 2XRNA 1ES5A 3NHQA 2E8IA 4EU0A 4P85A 3C8CA 3NDEA 1XX2A 5AQAA 2JC7A 5C5KA 1IOUA 2WK0A 5GHYA 1HZOA 4YINA 1MWTA 5L10A 1BLCA 2ZM8A 5DF7A 4Y17A 4OPQA 3SH7A 4IEDA 2L4RA 1OT6A 1YLPA 5GLAA 4GKUA 3T1RA 1KOUA 2PRFA 5L07A 4E6XA 1KE0A 3VP3A 3GDIA 2PDRA 4CPKA 1CJFA 2ZMVA 3WS1A 3NJAA 2ZC4B 3NCKA 3M2JA 1H8ZA 4EQ1A 4IHQA 3HUOA 1XPBA 3W4OA 2L1MA 4HJ4A 4DE0A 2Y8HA 5FSRA 2HF6A 3OBFA 3D72A 1XJ4A 2O0YA 3CLOA 3NECA 4QD4A 4E3LA 2FFYA 2VZWA 5F68A 4EBPA 3WS0A 5HSQA 2WAEA 2ZMAA 3QNCA 1Z09A 4YFMA 5AQ9A 5I94A 4H6JA 4P0MA 2W3GA 5A92A 4Y7PA 4KQQA 3PBOA 5TBMB 2XSSA 3UPPA 5A91A 3G6OA 3EEHA 5DF8A 3KO6A 3UE6A 2WGIA 3AGDA 3TE8A 1K56D 2DMWA 1PYYA 1N9BA 4F3LB 3ULFA 4OH0A 4QJGA 3HLFA 1MZUA 3KYZA 1FCOA 5E2EA 4H6JB 3ZFZA 4JXWA 5CXWA 2Y2MA 3S22A 4EQIA 2PR6A 1PI4A 3LO7A 3G2ZA 3TOIA 2EX9A 4I3JA 1HD8A 4OOMA 3CJMA 4D60A 3D9YA 3OPHA 3VOZA 3EGXC 2QPNA 3TG9A 3FWLA 3ZG7B 2MJ6A 2J9PA 2PBDP 1FR6A 1NZOA 4LENA 1PW1A 2OSUA 1FIKA 1FCMA 5EVLA 1E25A 1K55C 5IHVA 3PAGA 4OVDA 4WBGA 1DJBA 3HJIA 4DF6A 1TS8A 4Y5FA 4DJ3A 1XFQA 2PD7A 3CMZA 2HV1A 1J9MA 1S4SA 2VV6A 3PAEA 2KX6A 3HBRA 1STZA 1W7FA 1LSWA 3UMDA 5AJGA 1CEFA 1EI5A 3QP2A 1ODVA 4CJNA 3DTIA 3SH8A 4WMCD 1A0KA 5DTKA 4WN5A 3VV4A 3JYIA 3R7WB 2WADA 2I72A 1KE4A 4DE3A 3QP8A 3WS4A 2V1AA 2Y2QA 3L9KA 4LLOB 5L8MA 3ZG8B 2J3TC 3ZVTA 1EW0A 4HQAA 2Z6CA 3HJKA 4GJ4A 3UE0A 3ZNTA 3V5MA 1ZTUA 1H5XA 2W3FA 3O87A 4ME4A 4UA7A 4ZDXA 3UO9A 4ARZB 4DDSA 3NOPC 5CRFA 4R4SA 3VP2A 1PRQA 4NEED 4EUVA 3PBRA 2UWXA 3BQ8A 5FEGA 1SDNA 1CEGA 1PWGA 3IBRA 3LIFA 1IEMA 1N9LA 4KQRA 1IKIA 3CAXA 1XA7A 5EVEA 4XUZA 3IBJA 2VGLS 1VB6A 5FAQA 2WGWB 2J8YA 3OPLA 2QJ7A 2Y2PA 4GD6A 2QYBA 1L0EA 1ESIA 1E3UD 3T12B 4N1XA 1TS6A 1KVLA 4BBVA
chains in the Genus database with same CATH topology
2H0TA 2A49A 4JXVA 2WZXA 3HREA 5EECA 1VQQA 1DJCA 1FQGA 1BULA 3C4OA 3CG5A 2XFTA 1Z6FA 1KGEA 2J7VA 3BLMA 2JCHA 2Y2JA 3EQUA 3QHYA 1PZOA 2WGVA 4KQOA 3C4PA 1LL9A 1MWUA 2ZC7A 5F82A 4RX3A 3NDGA 2Y2NA 4LV3A 4M3KA 1I2SA 5FATA 5BOHA 1LHYA 3M6BA 4EBNA 3OPRA 2P9VB 5FI6A 3GVBA 4HBTA 3G2YA 3D4FA 3BFDA 3HLWA 5EUAA 4S2OA 3IF5A 3PTEA 4XUXA 5HW3A 1FCNA 1W8YA 4MBKA 1O7EA 4EV4A 2HDUA 1AXBA 2V2FF 4O7DA 1G6AA 5EOEA 1YLYA 3BFEA 3IXDA 3N6IA 3OPPA 3IWQA 2XGNA 4R3JA 3PBNA 5M18A 4N9KA 3VMAA 2XFSA 4X69A 3MFDA 4E3NA 4OOYA 5J8XA 3PBQA 1BUEA 4PM9A 5FQMA 1MKIA 2EX8A 4S2MA 3FKVA 4WEKA 1S6RA 4KZ3A 2V20A 1W8QA 3N8SA 5GL9A 1K4EA 2C6WB 4E6WA 3HLCA 1MY8A 3TSGA 2A3UA 2Y2IA 3SS3A 3UDIA 4DKIA 5CERA 2P74A 5M1AA 5AQBA 4BL2A 3VSLA 5HAQA 2Y2KA 1K25A 5HX9A 2H5SA 3HVFA 4E3KA 1WYCA 1NRFA 1ZG4A 1QMEA 2XLNA 3GMWA 4PM6A 2OV5A 5FQKA 1GA9A 2G2UA 1YLTA 4PM8A 2GDNA 3WRZA 5E2GA 3FV7A 2RL3A 4UHUA 2B5RA 3C7UA 1YM1A 1LI0A 4FSFA 5DVAA 3RXWA 5CHUA 3G4PA 5FDHA 4KG6A 5FQQA 4RVAA 1SKFA 2ZQ8A 3IF6B 2IWBA 2XD5A 4OLDA 4WYYA 2ZC3B 1L0DA 1IYSA 4BJPA 3BYDA 3DW0A 1BSGA 3NIAA 2Y55A 4KG5A 2X02A 4K0WA 3ZG0A 3PBSA 4S2KA 5GHXA 4QHCA 3HLEA 3SH9A 2WKEA 2ZQ9A 3G34A 1KGGA 3V50A 1BLPA 2WYXA 5CGWA 1FOFA 5E2FA 4D2OA 4E3OA 4KZ9A 1FSWA 2EX6A 3VOYA 3O86A 4PPRA 4BD0A 5HFOA 4JF5A 2R9XA 4DE2A 3N4IA 1ZG6A 3ZVWA 4KZ6A 4P6BA 5KMWA 3N8RA 2G2WA 1SHVA 3BFCA 4OOLA 3WWXA 1E4DA 3S1YA 3IH9A 5EVIB 5CGXA 5FA7A 3ZG5A 5CHJA 1BLSA 3IXBA 4IBRA 1QMFA 2BLSA 2WAFA 2Z2LB 1YT4A 2ZC5B 4K91A 3UY6A 2XF3A 3V39A 2ZQDA 4DE1A 1RGYA 4WZ5C 5G18A 4MBFA 4JF6A 1O07A 1NZUA 1KDWA 2ZC6B 4OP5A 1MBLA 3GR2A 3HLGA 3ZG9B 2HP6A 4QU3A 4S2IA 2XEPA 1K6RA 5GLBA 4BQMA 1PI5A 5FAOA 4QY6A 3DWZA 4R3BA 1HVBA 5TR7A 4Q8IA 2ZJ9A 1JWPA 4IVKA 4U3TA 1EROA 3GTCA 1PWCA 4HBUA 3ITBA 3O88A 4LV2A 5E2HA 3A3EA 2XD1A 2WZZA 4JBFA 5JYPA 1ES5A 1ES3A 2FFFB 5CEBA 4ZJ3A 5E43A 2E8IA 1ONHA 4R1GA 2BG1A 3W8KA 4P85A 5KSHA 4K0XA 3NDEA 3S4XA 5FQ9A 1KGFA 4NK3A 1XX2A 5DF9A 5AQAA 1KDSA 2JC7A 4IVIA 1LLBA 5CECA 1MXOA 1Q2QA 4N9LA 5EE8A 2OLUA 2WK0A 3LY3A 4PM5A 5GHYA 4DRTA 1HZOA 4YINA 1MWTA 1BLCA 2ZM8A 5DF7A 4OPQA 3SH7A 4H8RA 1HTZA 4IEDA 2EXAA 3VFFA 4Z9QA 3IT9A 5GLAA 1YLPA 3WS5A 4GKUA 4LCMA 1BT5A 4KZ5A 4ZBEA 4L0LA 2EFXA 4MLLA 4E6XA 1LI9A 3G32A 3OCLA 1IYPA 1NJ4A 4JLFA 3ZDJA 3Q81A 1KE0A 3VP3A 1SDEA 1K57A 3MKFA 1XP4A 1N4OA 1PW8A 2ZD8A 4OLGA 4CPKA 4OKPA 3WS1A 4FD8A 1IYQA 2IWDA 1K57C 2ZC4B 4PM7A 2HP9A 4JPMA 4MEZA 1YMXA 5JYOA 3NCKA 1YLJA 4OQIA 3M2JA 1YLWA 2ZM2A 1H8ZA 3Q1FA 3HUOA 4WELA 1MWRA 3VFHA 2HDQA 2VGJA 1XPBA 3W4OA 3ZHHA 4NETA 4KENB 1GA0A 3MZDA 3ISGA 1Y54A 4DE0A 5FSRA 3HUMA 4ZAMA 4UAAA 3N8LA 3C7VA 3IWOA 2VGKA 1ESUA 4X6TA 4Y0UA 3LEZA 4QD4A 4JKTA 1XXMA 2H10A 4E3LA 5FI7A 3ZCZA 2FFYA 3MBZA 2C5WB 2HDSA 4EBPA 4PMAA 3WS0A 2WAEA 2ZMAA 3GQZA 3QNCA 2WUQA 4QB8A 4S2NA 4YFMA 5AQ9A 2X01A 5I94A 3IF6C 4OONA 1TEMA 2H0YA 4WZ4A 1ERQA 4P0MA 4S2NC 3BM6A 3A3IA 5A92A 4Y7PA 5EPHA 1RGZA 1NXYA 4KQQA 4MBHA 1GHPA 3PBOA 3ITAA 3UPPA 5U47A 2IWCA 3Q7VA 1NY0A 4ZJ2A 1S0WA 3OZHA 5A91A 5FAPA 4OPYA 5F1GA 5DTSA 2EX2A 4FH2A 5DF8A 4ZJ1A 4HEFA 3W4QA 3LCEA 5CHMA 2WGIA 1CK3A 1LL5A 3AGDA 3UN7A 2DNSA 1RCJA 3Q7ZA 1EWZA 1K56D 2EXBA 5A90A 1PYYA 1IYOA 4JXSA 5HAIA 2ZLYA 1N9BA 3A3FA 3OCNA 3DWKA 3RXXA 3NY4A 1YLZA 3GSGA 1G68A 4E3IA 4OH0A 4QJGA 4EUZA 3HLFA 1I2WA 1KVMA 5DTTA 1FCOA 4X68A 5E2EA 1K56A 4WZ5A 1KE3A 4A5RA 4MNRA 4KZBA 2Q9MA 3ZFZA 3VP4A 4OQGA 1ZKJA 2HP5A 4OPZA 1DJAA 3IQAA 3V3SA 4JXWA 3M6HA 5CXWA 2WGWA 1PWDA 2Y2MA 3S22A 4EQIA 4DDYA 4S2JA 4OPRA 3UDXA 3ZGAB 1TDGA 1ONGA 1PI4A 4P87A 3LO7A 1NYYA 4C75A 3G2ZA 3TOIA 4BD1A 3MZFA 3C5AA 4U0XA 1BTLA 3UE1A 3N7WA 4QY5A 4GDNA 4BL3A 2EX9A 4JXGA 5AQ7A 1HD8A 3VP0A 3UDFA 4OOMA 5TGFA 1MWSA 1VM1A 3E2LA 1M40A 1CI9A 1K54A 5KSCA 3CJMA 5F1FA 5EOOA 1M6KA 3OPHA 3WS2A 1JTGA 1K54C 2QMIA 3VOZA 3BRMA 3W4PA 3B3XA 3CZDA 5HAPA 4Y0TA 2QPNA 3TG9A 4C6YA 3FWLA 4RA7A 1BLHA 1PIOA 2Y2LA 1I5QA 2J9OA 3ZG7B 4LV1A 2Y2OA 3MXRA 2DCFA 1MPLA 3LY4A 1ES4A 4E3JA 3IWIA 5A93A 1W79A 3FYZA 1NYMA 2R9WA 3AGFA 2J9PA 1OMEA 1JWZA 3VSKA 2JBFA 1H8YA 1ALQA 1FR6A 2P9VA 4C3QA 2EFUA 3A3JA 1WYBA 1NZOA 4LENA 1JTDA 1PW1A 2OSUA 3BEBA 1XGIA 1CI8A 1XA1A 1FCMA 2WKIA 4S2PA 4WEJA 1E25A 3GV9A 3HLBA 4XXRA 1DY6A 1K55C 5EVLA 5IHVA 3PAGA 4OQ0A 2PU4A 3SS4A 5HARA 3VP1A 5TFQA 3SOIA 4DXCA 4RX2A 4OVDA 3G30A 4WBGA 1DJBA 4KZ8A 1E3UA 2V1ZA 4DF6A 1IKGA 3PBTA 1SCWA 4HESA 4GDBA 3CMZA 1L0GA 4E3MA 1RP5A 1J9MA 3PAEA 2Z2MB 3O3VA 3HBRA 3IHBA 4GB7A 4UA9A 3A3DA 5FI2A 3M2KA 4GNUA 1FSYA 5GLCA 1W7FA 2HDRA 4ZTKA 3IXGA 4Y0OA 1CEFA 4GZBA 1EI5A 3IXHA 3UPOA 1GHMA 2Q9NA 4N1HA 3Q82A 4DXBA 3IF6A 4LV0A 2Y2HA 4OQHA 2Y59A 5GLDA 4CJNA 3HLDA 3SH8A 4WMCD 5DTKA 1FR1A 3V3RA 2DRWA 3JYIA 4JF4A 5KZHA 3FKWA 2ZQ7A 3AGEA 2WADA 2I72A 3MKEA 1KE4A 4DE3A 1IELA 4R0QA 1ZC2A 3HL9A 5EVID 5M19A 3WS4A 2Y2QA 4WMCA 3MXSA 1YQSA 2X71A 2ZM0A 1WE4A 5FASA 3IH8A 3ZG8B 1BZAA 2ZQAA 4IBXA 1K4FA 2OLVA 2XH9A 3UPNA 3ZVTA 4B88A 5EVIA 1ES2A 1JVJA 2PU2A 3UE0A 3ZNTA 3GRJA 3P09A 4R23A 3OC2A 4R4RA 3FZCA 5EVIC 3UE3A 3V5MA 3BFGA 4X56A 4OP8A 1H5XA 2XDMA 3BECA 4BLMA 3O87A 5CEDA 4GD8A 2Y91A 4UA7A 4ZDXA 3UO9A 4FCFA 4DDSA 1ERMA 1C3BA 5CRFA 4R4SA 4KZ7A 4B4XA 5FQIA 3VP2A 4KZAA 3BLSA 1K38A 4S2LA 3Q7VB 3PBRA 2UWXA 3ZNYA 2RCXA 3NI9A 4N92A 4KG2A 4LCLA 2PBYA 4GOGA 5FQJA 1L0FA 3G35A 3NC8A 4UA6A 3SS5A 3NBLA 5GHZA 1YMSA 2CC1A 2QZ6A 3Q07A 3QNBA 4X53A 3HUNA 2Y4AA 4EWFA 1SDNA 5CGSA 1CEGA 1GCEA 1TDLA 1PWGA 1XGJA 5F83A 3E2KA 3G31A 1IEMA 1TVFA 3MZEA 3I7JA 4KQRA 5D3OA 4X55A 3UNWA 2XQZA 3P98A 4KZ4A 1IKIA 4EBLA 5HL1A 5CTMA 3RJUA 1XA7A 2JE5A 4XUZA 4BENA 4ID4A 3EQVA 4GN2A 1K6SA 1W5DA 1L2SA 5FAQA 4F94A 2WGWB 3DTMA 2J8YA 3OPLA 3BFFA 5L2FA 2Y2PA 4GD6A 4RYEA 4WM9A 1L0EA 2HPBA 2WKHA 1XKZA 1K55A 2Y2GA 2XK1A 1U60A 3WRTA 1ESIA 1E3UD 2ZQCA 1JWVA 2XR0A 4N1XA 1PZPA 5CTNA 1KVLA 3IHAA 4U0TA 1Q2PA 1GHIA 4FH4A 4B4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H0T A;  2A49 A;  4JXV A;  2WZX A;  3HRE A;  5EEC A;  1VQQ A;  1DJC A;  1FQG A;  1BUL A;  3C4O A;  3CG5 A;  2XFT A;  1Z6F A;  1KGE A;  2J7V A;  3BLM A;  2JCH A;  2Y2J A;  3EQU A;  3QHY A;  1PZO A;  2WGV A;  4KQO A;  3C4P A;  1LL9 A;  1MWU A;  2ZC7 A;  5F82 A;  4RX3 A;  3NDG A;  2Y2N A;  4LV3 A;  4M3K A;  1I2S A;  5FAT A;  5BOH A;  1LHY A;  3M6B A;  4EBN A;  3OPR A;  2P9V B;  5FI6 A;  3GVB A;  4HBT A;  3G2Y A;  3D4F A;  3BFD A;  3HLW A;  5EUA A;  4S2O A;  3IF5 A;  3PTE A;  4XUX A;  5HW3 A;  1FCN A;  1W8Y A;  4MBK A;  1O7E A;  4EV4 A;  2HDU A;  1AXB A;  2V2F F;  4O7D A;  1G6A A;  5EOE A;  1YLY A;  3BFE A;  3IXD A;  3N6I A;  3OPP A;  3IWQ A;  2XGN A;  4R3J A;  3PBN A;  5M18 A;  4N9K A;  3VMA A;  2XFS A;  4X69 A;  3MFD A;  4E3N A;  4OOY A;  5J8X A;  3PBQ A;  1BUE A;  4PM9 A;  5FQM A;  1MKI A;  2EX8 A;  4S2M A;  3FKV A;  4WEK A;  1S6R A;  4KZ3 A;  2V20 A;  1W8Q A;  3N8S A;  5GL9 A;  1K4E A;  2C6W B;  4E6W A;  3HLC A;  1MY8 A;  3TSG A;  2A3U A;  2Y2I A;  3SS3 A;  3UDI A;  4DKI A;  5CER A;  2P74 A;  5M1A A;  5AQB A;  4BL2 A;  3VSL A;  5HAQ A;  2Y2K A;  1K25 A;  5HX9 A;  2H5S A;  3HVF A;  4E3K A;  1WYC A;  1NRF A;  1ZG4 A;  1QME A;  2XLN A;  3GMW A;  4PM6 A;  2OV5 A;  5FQK A;  1GA9 A;  2G2U A;  1YLT A;  4PM8 A;  2GDN A;  3WRZ A;  5E2G A;  3FV7 A;  2RL3 A;  4UHU A;  2B5R A;  3C7U A;  1YM1 A;  1LI0 A;  4FSF A;  5DVA A;  3RXW A;  5CHU A;  3G4P A;  5FDH A;  4KG6 A;  5FQQ A;  4RVA A;  1SKF A;  2ZQ8 A;  3IF6 B;  2IWB A;  2XD5 A;  4OLD A;  4WYY A;  2ZC3 B;  1L0D A;  1IYS A;  4BJP A;  3BYD A;  3DW0 A;  1BSG A;  3NIA A;  2Y55 A;  4KG5 A;  2X02 A;  4K0W A;  3ZG0 A;  3PBS A;  4S2K A;  5GHX A;  4QHC A;  3HLE A;  3SH9 A;  2WKE A;  2ZQ9 A;  3G34 A;  1KGG A;  3V50 A;  1BLP A;  2WYX A;  5CGW A;  1FOF A;  5E2F A;  4D2O A;  4E3O A;  4KZ9 A;  1FSW A;  2EX6 A;  3VOY A;  3O86 A;  4PPR A;  4BD0 A;  5HFO A;  4JF5 A;  2R9X A;  4DE2 A;  3N4I A;  1ZG6 A;  3ZVW A;  4KZ6 A;  4P6B A;  5KMW A;  3N8R A;  2G2W A;  1SHV A;  3BFC A;  4OOL A;  3WWX A;  1E4D A;  3S1Y A;  3IH9 A;  5EVI B;  5CGX A;  5FA7 A;  3ZG5 A;  5CHJ A;  1BLS A;  3IXB A;  4IBR A;  1QMF A;  2BLS A;  2WAF A;  2Z2L B;  1YT4 A;  2ZC5 B;  4K91 A;  3UY6 A;  2XF3 A;  3V39 A;  2ZQD A;  4DE1 A;  1RGY A;  4WZ5 C;  5G18 A;  4MBF A;  4JF6 A;  1O07 A;  1NZU A;  1KDW A;  2ZC6 B;  4OP5 A;  1MBL A;  3GR2 A;  3HLG A;  3ZG9 B;  2HP6 A;  4QU3 A;  4S2I A;  2XEP A;  1K6R A;  5GLB A;  4BQM A;  1PI5 A;  5FAO A;  4QY6 A;  3DWZ A;  4R3B A;  1HVB A;  5TR7 A;  4Q8I A;  2ZJ9 A;  1JWP A;  4IVK A;  4U3T A;  1ERO A;  3GTC A;  1PWC A;  4HBU A;  3ITB A;  3O88 A;  4LV2 A;  5E2H A;  3A3E A;  2XD1 A;  2WZZ A;  4JBF A;  5JYP A;  1ES5 A;  1ES3 A;  2FFF B;  5CEB A;  4ZJ3 A;  5E43 A;  2E8I A;  1ONH A;  4R1G A;  2BG1 A;  3W8K A;  4P85 A;  5KSH A;  4K0X A;  3NDE A;  3S4X A;  5FQ9 A;  1KGF A;  4NK3 A;  1XX2 A;  5DF9 A;  5AQA A;  1KDS A;  2JC7 A;  4IVI A;  1LLB A;  5CEC A;  1MXO A;  1Q2Q A;  4N9L A;  5EE8 A;  2OLU A;  2WK0 A;  3LY3 A;  4PM5 A;  5GHY A;  4DRT A;  1HZO A;  4YIN A;  1MWT A;  1BLC A;  2ZM8 A;  5DF7 A;  4OPQ A;  3SH7 A;  4H8R A;  1HTZ A;  4IED A;  2EXA A;  3VFF A;  4Z9Q A;  3IT9 A;  5GLA A;  1YLP A;  3WS5 A;  4GKU A;  4LCM A;  1BT5 A;  4KZ5 A;  4ZBE A;  4L0L A;  2EFX A;  4MLL A;  4E6X A;  1LI9 A;  3G32 A;  3OCL A;  1IYP A;  1NJ4 A;  4JLF A;  3ZDJ A;  3Q81 A;  1KE0 A;  3VP3 A;  1SDE A;  1K57 A;  3MKF A;  1XP4 A;  1N4O A;  1PW8 A;  2ZD8 A;  4OLG A;  4CPK A;  4OKP A;  3WS1 A;  4FD8 A;  1IYQ A;  2IWD A;  1K57 C;  2ZC4 B;  4PM7 A;  2HP9 A;  4JPM A;  4MEZ A;  1YMX A;  5JYO A;  3NCK A;  1YLJ A;  4OQI A;  3M2J A;  1YLW A;  2ZM2 A;  1H8Z A;  3Q1F A;  3HUO A;  4WEL A;  1MWR A;  3VFH A;  2HDQ A;  2VGJ A;  1XPB A;  3W4O A;  3ZHH A;  4NET A;  4KEN B;  1GA0 A;  3MZD A;  3ISG A;  1Y54 A;  4DE0 A;  5FSR A;  3HUM A;  4ZAM A;  4UAA A;  3N8L A;  3C7V A;  3IWO A;  2VGK A;  1ESU A;  4X6T A;  4Y0U A;  3LEZ A;  4QD4 A;  4JKT A;  1XXM A;  2H10 A;  4E3L A;  5FI7 A;  3ZCZ A;  2FFY A;  3MBZ A;  2C5W B;  2HDS A;  4EBP A;  4PMA A;  3WS0 A;  2WAE A;  2ZMA A;  3GQZ A;  3QNC A;  2WUQ A;  4QB8 A;  4S2N A;  4YFM A;  5AQ9 A;  2X01 A;  5I94 A;  3IF6 C;  4OON A;  1TEM A;  2H0Y A;  4WZ4 A;  1ERQ A;  4P0M A;  4S2N C;  3BM6 A;  3A3I A;  5A92 A;  4Y7P A;  5EPH A;  1RGZ A;  1NXY A;  4KQQ A;  4MBH A;  1GHP A;  3PBO A;  3ITA A;  3UPP A;  5U47 A;  2IWC A;  3Q7V A;  1NY0 A;  4ZJ2 A;  1S0W A;  3OZH A;  5A91 A;  5FAP A;  4OPY A;  5F1G A;  5DTS A;  2EX2 A;  4FH2 A;  5DF8 A;  4ZJ1 A;  4HEF A;  3W4Q A;  3LCE A;  5CHM A;  2WGI A;  1CK3 A;  1LL5 A;  3AGD A;  3UN7 A;  2DNS A;  1RCJ A;  3Q7Z A;  1EWZ A;  1K56 D;  2EXB A;  5A90 A;  1PYY A;  1IYO A;  4JXS A;  5HAI A;  2ZLY A;  1N9B A;  3A3F A;  3OCN A;  3DWK A;  3RXX A;  3NY4 A;  1YLZ A;  3GSG A;  1G68 A;  4E3I A;  4OH0 A;  4QJG A;  4EUZ A;  3HLF A;  1I2W A;  1KVM A;  5DTT A;  1FCO A;  4X68 A;  5E2E A;  1K56 A;  4WZ5 A;  1KE3 A;  4A5R A;  4MNR A;  4KZB A;  2Q9M A;  3ZFZ A;  3VP4 A;  4OQG A;  1ZKJ A;  2HP5 A;  4OPZ A;  1DJA A;  3IQA A;  3V3S A;  4JXW A;  3M6H A;  5CXW A;  2WGW A;  1PWD A;  2Y2M A;  3S22 A;  4EQI A;  4DDY A;  4S2J A;  4OPR A;  3UDX A;  3ZGA B;  1TDG A;  1ONG A;  1PI4 A;  4P87 A;  3LO7 A;  1NYY A;  4C75 A;  3G2Z A;  3TOI A;  4BD1 A;  3MZF A;  3C5A A;  4U0X A;  1BTL A;  3UE1 A;  3N7W A;  4QY5 A;  4GDN A;  4BL3 A;  2EX9 A;  4JXG A;  5AQ7 A;  1HD8 A;  3VP0 A;  3UDF A;  4OOM A;  5TGF A;  1MWS A;  1VM1 A;  3E2L A;  1M40 A;  1CI9 A;  1K54 A;  5KSC A;  3CJM A;  5F1F A;  5EOO A;  1M6K A;  3OPH A;  3WS2 A;  1JTG A;  1K54 C;  2QMI A;  3VOZ A;  3BRM A;  3W4P A;  3B3X A;  3CZD A;  5HAP A;  4Y0T A;  2QPN A;  3TG9 A;  4C6Y A;  3FWL A;  4RA7 A;  1BLH A;  1PIO A;  2Y2L A;  1I5Q A;  2J9O A;  3ZG7 B;  4LV1 A;  2Y2O A;  3MXR A;  2DCF A;  1MPL A;  3LY4 A;  1ES4 A;  4E3J A;  3IWI A;  5A93 A;  1W79 A;  3FYZ A;  1NYM A;  2R9W A;  3AGF A;  2J9P A;  1OME A;  1JWZ A;  3VSK A;  2JBF A;  1H8Y A;  1ALQ A;  1FR6 A;  2P9V A;  4C3Q A;  2EFU A;  3A3J A;  1WYB A;  1NZO A;  4LEN A;  1JTD A;  1PW1 A;  2OSU A;  3BEB A;  1XGI A;  1CI8 A;  1XA1 A;  1FCM A;  2WKI A;  4S2P A;  4WEJ A;  1E25 A;  3GV9 A;  3HLB A;  4XXR A;  1DY6 A;  1K55 C;  5EVL A;  5IHV A;  3PAG A;  4OQ0 A;  2PU4 A;  3SS4 A;  5HAR A;  3VP1 A;  5TFQ A;  3SOI A;  4DXC A;  4RX2 A;  4OVD A;  3G30 A;  4WBG A;  1DJB A;  4KZ8 A;  1E3U A;  2V1Z A;  4DF6 A;  1IKG A;  3PBT A;  1SCW A;  4HES A;  4GDB A;  3CMZ A;  1L0G A;  4E3M A;  1RP5 A;  1J9M A;  3PAE A;  2Z2M B;  3O3V A;  3HBR A;  3IHB A;  4GB7 A;  4UA9 A;  3A3D A;  5FI2 A;  3M2K A;  4GNU A;  1FSY A;  5GLC A;  1W7F A;  2HDR A;  4ZTK A;  3IXG A;  4Y0O A;  1CEF A;  4GZB A;  1EI5 A;  3IXH A;  3UPO A;  1GHM A;  2Q9N A;  4N1H A;  3Q82 A;  4DXB A;  3IF6 A;  4LV0 A;  2Y2H A;  4OQH A;  2Y59 A;  5GLD A;  4CJN A;  3HLD A;  3SH8 A;  4WMC D;  5DTK A;  1FR1 A;  3V3R A;  2DRW A;  3JYI A;  4JF4 A;  5KZH A;  3FKW A;  2ZQ7 A;  3AGE A;  2WAD A;  2I72 A;  3MKE A;  1KE4 A;  4DE3 A;  1IEL A;  4R0Q A;  1ZC2 A;  3HL9 A;  5EVI D;  5M19 A;  3WS4 A;  2Y2Q A;  4WMC A;  3MXS A;  1YQS A;  2X71 A;  2ZM0 A;  1WE4 A;  5FAS A;  3IH8 A;  3ZG8 B;  1BZA A;  2ZQA A;  4IBX A;  1K4F A;  2OLV A;  2XH9 A;  3UPN A;  3ZVT A;  4B88 A;  5EVI A;  1ES2 A;  1JVJ A;  2PU2 A;  3UE0 A;  3ZNT A;  3GRJ A;  3P09 A;  4R23 A;  3OC2 A;  4R4R A;  3FZC A;  5EVI C;  3UE3 A;  3V5M A;  3BFG A;  4X56 A;  4OP8 A;  1H5X A;  2XDM A;  3BEC A;  4BLM A;  3O87 A;  5CED A;  4GD8 A;  2Y91 A;  4UA7 A;  4ZDX A;  3UO9 A;  4FCF A;  4DDS A;  1ERM A;  1C3B A;  5CRF A;  4R4S A;  4KZ7 A;  4B4X A;  5FQI A;  3VP2 A;  4KZA A;  3BLS A;  1K38 A;  4S2L A;  3Q7V B;  3PBR A;  2UWX A;  3ZNY A;  2RCX A;  3NI9 A;  4N92 A;  4KG2 A;  4LCL A;  2PBY A;  4GOG A;  5FQJ A;  1L0F A;  3G35 A;  3NC8 A;  4UA6 A;  3SS5 A;  3NBL A;  5GHZ A;  1YMS A;  2CC1 A;  2QZ6 A;  3Q07 A;  3QNB A;  4X53 A;  3HUN A;  2Y4A A;  4EWF A;  1SDN A;  5CGS A;  1CEG A;  1GCE A;  1TDL A;  1PWG A;  1XGJ A;  5F83 A;  3E2K A;  3G31 A;  1IEM A;  1TVF A;  3MZE A;  3I7J A;  4KQR A;  5D3O A;  4X55 A;  3UNW A;  2XQZ A;  3P98 A;  4KZ4 A;  1IKI A;  4EBL A;  5HL1 A;  5CTM A;  3RJU A;  1XA7 A;  2JE5 A;  4XUZ A;  4BEN A;  4ID4 A;  3EQV A;  4GN2 A;  1K6S A;  1W5D A;  1L2S A;  5FAQ A;  4F94 A;  2WGW B;  3DTM A;  2J8Y A;  3OPL A;  3BFF A;  5L2F A;  2Y2P A;  4GD6 A;  4RYE A;  4WM9 A;  1L0E A;  2HPB A;  2WKH A;  1XKZ A;  1K55 A;  2Y2G A;  2XK1 A;  1U60 A;  3WRT A;  1ESI A;  1E3U D;  2ZQC A;  1JWV A;  2XR0 A;  4N1X A;  1PZP A;  5CTN A;  1KVL A;  3IHA A;  4U0T A;  1Q2P A;  1GHI A;  4FH4 A;  4B4Z A; 
#chains in the Genus database with same CATH topology
 2OOL A;  3T4Q A;  2WZX A;  3HRE A;  5EEC A;  1VQQ A;  4CLC E;  4WUJ A;  1G28 A;  1BUL A;  3C4O A;  2J7V A;  3BJN A;  1OTA A;  3EQU A;  3A0S A;  1X0O A;  2WGV A;  3C4P A;  1LL9 A;  1MWU A;  2ZC7 A;  3MFX A;  5LBR A;  4M3K A;  1MKM A;  1I2S A;  4KQD A;  5FAT A;  1LHY A;  4JGQ A;  5EV0 A;  3UB8 A;  4XUX A;  1W8Y A;  4MBK A;  2J3W A;  2V2F F;  1MC0 A;  4O7D A;  1HLU P;  1UWN X;  3BY9 A;  4R3J A;  3PBN A;  5M18 A;  1OTE A;  4X69 A;  4E3N A;  4OOY A;  1BUE A;  4NXB A;  1MKI A;  3K2N A;  1S6R A;  3LIC A;  3HLC A;  3TSG A;  2A3U A;  2Y2I A;  3S7Q A;  3VSL A;  3T1S A;  1K25 A;  5HX9 A;  2H5S A;  2PYR A;  4E3K A;  1NRF A;  1ZG4 A;  3WRZ A;  5DFY A;  5E2G A;  5J7E A;  3G4P A;  5FDH A;  4RVA A;  3EEA A;  5IS1 A;  3UB5 P;  1VEU B;  3NIA A;  2QKP A;  2X02 A;  3ZG0 A;  2WKE A;  1BLP A;  3ZYT A;  1OTD A;  5E2F A;  2EX6 A;  4PPR A;  3CWF A;  3ZVW A;  4P6B A;  5HDD A;  2W1T B;  3N8R A;  3H82 B;  3BFC A;  4YNR A;  4IBR A;  4HY8 A;  2XF3 A;  2Q0O A;  5G18 A;  5AVF A;  3PHY A;  1MBL A;  3GR2 A;  3HLG A;  1K6R A;  1DP9 A;  3FPW A;  4QY6 A;  4HH2 A;  1VHM A;  1HVB A;  4Q8I A;  1JWP A;  4IVK A;  2OWH A;  4ZRR A;  3A0V A;  3ITB A;  1ACF A;  4LV2 A;  4K08 A;  4MMN A;  2B95 A;  1ES3 A;  2FFF B;  5E43 A;  3LR4 A;  3E4Q A;  4R1G A;  4YWZ A;  4QWO A;  5KSH A;  2B02 A;  3RH8 B;  1KGF A;  1F98 A;  5DF9 A;  1KDS A;  4IVI A;  1LLB A;  1XJ6 A;  5HD3 A;  3GEC A;  4FOF A;  4G3V A;  1YSQ A;  4H8R A;  3VFF A;  3CIT A;  1PFL A;  4KZ5 A;  1LI9 A;  3OCL A;  4LGW A;  4JLF A;  3ZDJ A;  4CLC B;  3E4P A;  3UME A;  1SDE A;  1OTI A;  1XP4 A;  2ZD8 A;  3UB6 A;  4BBU A;  1NLY A;  3TW8 A;  4PM7 A;  1YMX A;  4KUO A;  1YLJ A;  3LI9 A;  4MN7 A;  2VGJ A;  4KEN B;  3IS2 B;  3N8L A;  3C7V A;  3IWO A;  2VGK A;  5F69 A;  1ESU A;  4X6T A;  1S1Y A;  1S67 L;  2PYP A;  3ZCZ A;  4PMA A;  3B42 A;  4CQH A;  3IF6 C;  3T4T A;  1TEM A;  2H0Y A;  1ERQ A;  1F2K A;  5EPH A;  2W0N A;  1NXY A;  5U47 A;  2IWC A;  3Q7V A;  4XT2 A;  1DP8 A;  1S0W A;  4OPY A;  5DTS A;  3V67 A;  3LCE A;  1RCJ A;  4I38 A;  5A90 A;  1IYO A;  1YAX A;  1CF0 A;  2ZLY A;  3RXX A;  4E3I A;  4EUZ A;  3O5Y A;  1I2W A;  2VV8 A;  3H7W B;  1KE3 A;  3T4S A;  2IA2 A;  4OQG A;  1ZKJ A;  2HP5 A;  2V8C A;  4OPR A;  3FC7 A;  4P87 A;  4BD1 A;  3C5A A;  3UE1 A;  4QY5 A;  4B93 A;  5AQ7 A;  3UDF A;  4MDZ A;  3E2L A;  1M40 A;  5KSC A;  3TRC A;  2FH5 A;  1M6K A;  1JTG A;  2QMI A;  3W4P A;  3B3X A;  1BLH A;  1K0K A;  1OPX A;  2J9O A;  2Y2L A;  4LV1 A;  1MPL A;  3LY4 A;  1ES4 A;  4E3J A;  3IWI A;  1W63 Q;  1W79 A;  3FYZ A;  2D01 A;  5DJT A;  1H8Y A;  5IT5 A;  3A3J A;  1H0M A;  5MC7 A;  5HAI A;  2O9C A;  3GV9 A;  4NKP A;  1NRJ A;  4OQ0 A;  4X1L A;  2PU4 A;  3SS4 A;  5HAR A;  4MN6 A;  5TFQ A;  4DXC A;  1OJ5 A;  4RX2 A;  3SW1 A;  4KZ8 A;  1E3U A;  1L0G A;  4E3M A;  4R70 A;  3T1X A;  3A3D A;  5FI2 A;  3MJQ A;  3JPU A;  4Y15 A;  1TS7 A;  1FIL A;  3IXH A;  2Q9N A;  3Q82 A;  4Q0J A;  4DXB A;  3C38 A;  4OQH A;  2Y59 A;  4JGR A;  3HLD A;  2JKR M;  4UQI M;  3D3O A;  2JKT M;  3MXS A;  2X71 A;  3UPN A;  2OLV A;  4B88 A;  5EVI A;  2PU2 A;  3GRJ A;  4R23 A;  5EVI C;  1L3L A;  3FZC A;  3BFG A;  4Y2F A;  2XDM A;  3MQQ A;  1UWP X;  2YKH A;  4LRX C;  1TF1 A;  3F1P A;  4FCF A;  1ERM A;  3CHW P;  4EET B;  1YKD A;  5FQI A;  3BLS A;  5G4Y A;  4X25 A;  3ZNY A;  3NI9 A;  4N92 A;  4LCL A;  4GOG A;  3QP6 A;  3G35 A;  5HZH A;  4UA6 A;  3NBL A;  2O99 A;  1YMS A;  2QZ6 A;  4X53 A;  4EWF A;  2VEA A;  3P7N A;  1XGJ A;  1P97 A;  3E2K A;  3MZE A;  4BWI A;  2EA9 A;  4KZ4 A;  3HCY A;  4EBL A;  5CTM A;  4Q0H A;  4PAU A;  4ID4 A;  1K6S A;  1L2S A;  3JVV A;  3BFF A;  5J3W A;  4RQ9 A;  4ETX A;  4RYE A;  2Y2G A;  1K55 A;  1N9O A;  3WRT A;  2ZQC A;  1H3Q A;  5CTN A;  3IHA A;  5J4E A;  1GHI A;  4KUK A;  4GLQ A;  2A49 A;  1D1J A;  1FQG A;  4FUW A;  2M7V A;  3CPT A;  4RX3 A;  4WL9 A;  3NDG A;  4LV3 A;  5BOH A;  3M6B A;  4LPZ A;  3OPR A;  3GVB A;  4LRZ E;  3G2Y A;  3LIB A;  3KYQ A;  3HLW A;  4S2O A;  1N9N A;  3IF5 A;  1FCN A;  1AXB A;  1YLY A;  3CUE A;  3OPP A;  3F1N A;  5HWW A;  3VMA A;  2KDK A;  4HI4 A;  3CUE C;  5J8X A;  3OOV A;  3PBQ A;  4PM9 A;  2EX8 A;  3FKV A;  3N8S A;  1K4E A;  4HH3 A;  4E6W A;  3BQA A;  5CER A;  3UPO A;  3HVF A;  1QME A;  1GSX A;  5FQK A;  1GA9 A;  3E0Y A;  2RL3 A;  3IX3 A;  2B5R A;  4IUH A;  4FSF A;  4UEY A;  3RXW A;  3S7O A;  1SKF A;  2ZQ8 A;  4BJP A;  1XFN A;  4KG5 A;  3PBS A;  4S2K A;  1BYW A;  5GHX A;  2XRO A;  4EXO A;  3T4O A;  2ACG A;  4P6Z M;  3PR6 A;  2R9X A;  4DE2 A;  3N4I A;  5KMW A;  3WWX A;  2BAS A;  1AWI A;  3IH9 A;  1BLS A;  2HZ5 A;  3V39 A;  4WZ5 C;  4MBF A;  5KIZ A;  3ZG9 B;  4QU3 A;  4S2I A;  2XEP A;  1PI5 A;  2JKR I;  4R3B A;  4DJ2 A;  3GTC A;  1PWC A;  4HBU A;  2INW A;  5E2H A;  3BY8 A;  1ONH A;  3MQ0 A;  4HOI A;  3A0R A;  2W1R A;  1W63 M;  1MXO A;  1Q2Q A;  4N9L A;  3MS6 A;  3LY3 A;  4X1M A;  3KYE A;  1G5U A;  2HJE A;  1HTZ A;  3IT9 A;  3WS5 A;  2EWV A;  3S7P A;  1P0Z A;  4MLL A;  3VE3 A;  3MR0 A;  3Q81 A;  3PXP A;  3MKF A;  1K57 A;  1PW8 A;  1SZV A;  2IWD A;  1K57 C;  1YLW A;  3Q1F A;  4HJ3 A;  5DKL A;  4WEL A;  3VFH A;  3KX0 X;  2ZOH A;  3ZHH A;  4NET A;  4GHI A;  4GCZ A;  3MZD A;  3ISG A;  1Y54 A;  5DKK A;  4IUK A;  4Y0U A;  3CI6 A;  4NG2 A;  5FI7 A;  3MBZ A;  3W2Z A;  3GQZ A;  4S2N A;  3LID A;  2HGV A;  2X01 A;  4S2N C;  3BM6 A;  3H9W A;  1V9Y A;  1JNU A;  1NY0 A;  4ZJ2 A;  3NUL A;  5FAP A;  4FH2 A;  4ZJ1 A;  2EWW A;  4HNB A;  1LL8 A;  1CK3 A;  3F1O A;  2ZL1 A;  4EER A;  2O9B A;  2P04 A;  3GSG A;  1G68 A;  5DTT A;  1LT0 A;  1S4R A;  1K56 A;  4A5R A;  4MNR A;  4KZB A;  1DJA A;  3IQA A;  1CQA A;  1T1C A;  1PWD A;  3QP5 A;  4S2J A;  1ONG A;  1NYY A;  4C75 A;  1BTL A;  2K31 A;  3N7W A;  4GDN A;  4BL3 A;  4II7 A;  4JXG A;  4UQI S;  1K54 A;  2KOI A;  5F1F A;  1SKO A;  3LR0 A;  3WS2 A;  1K54 C;  3BRM A;  3CZD A;  5HAP A;  4Y0T A;  5L09 A;  1I5Q A;  2Y2O A;  5G4Z A;  2DCF A;  1D06 A;  3FPV A;  5A93 A;  2A24 A;  2I9V A;  1JWZ A;  5HL6 A;  3VSK A;  2PD8 A;  1ALQ A;  2P9V A;  4C3Q A;  1WYB A;  1T19 A;  3NOU C;  3BEB A;  1XGI A;  4WEJ A;  2WKI A;  4XXR A;  4S2P A;  3DBA A;  3HLB A;  3VP1 A;  5HDC A;  3G30 A;  3BW6 A;  4QPR A;  1IKG A;  1SCW A;  4HES A;  2VLG A;  3RFB A;  3UB7 A;  2JKF A;  5K5B A;  4ETZ A;  3M2K A;  4GNU A;  2JHE A;  5GLC A;  2HDR A;  4ZTK A;  5AVE A;  3IXG A;  2V9A A;  2QHK A;  4LRY C;  4NXF A;  2PAV P;  3LIA A;  4N1H A;  3IF6 A;  4LV0 A;  2Y2H A;  5GLD A;  3B33 A;  1T1A A;  1FR1 A;  5FDS A;  2J3T D;  4JF4 A;  4M4X A;  1VET A;  1ZC2 A;  3HL9 A;  5M19 A;  4WMC A;  1YQS A;  2ZM0 A;  3IH8 A;  3JVU A;  1BZA A;  2XH9 A;  1DP6 A;  4R4R A;  3OC2 A;  4BLM A;  4PKY A;  4X56 A;  4OP8 A;  3BEC A;  1Y4O A;  1C3B A;  1Y28 A;  2OWJ A;  4KZ7 A;  4B4X A;  4G3W A;  2J80 A;  1K38 A;  3Q7V B;  4XT2 B;  4HP4 A;  4KG2 A;  3T4L A;  2JN7 A;  5FQJ A;  1L0F A;  3NC8 A;  1P9R A;  1LSV A;  3HUN A;  3LR5 A;  4O0P A;  1GCE A;  1TDL A;  2V0U A;  1OJG A;  2CMN A;  2JKG A;  3UB9 A;  3UNW A;  2XQZ A;  3P98 A;  3R4K A;  1WA9 A;  4L9E A;  3B47 A;  5HL1 A;  3RJU A;  2JE5 A;  5TJJ A;  4GN2 A;  1W5D A;  3LYX A;  5DFX A;  1P9W A;  4WM9 A;  2HPB A;  2XK1 A;  1YPR A;  1U60 A;  1JWV A;  2XR0 A;  4U0T A;  3S4X A;  4FH4 A;  4B4Z A;  2H0T A;  4JXV A;  2VKS A;  2OAQ 1;  3CG5 A;  4P6Z S;  1KGE A;  3BLM A;  2JCH A;  3DTK A;  1PZO A;  5F6A A;  2Y2N A;  5FI6 A;  4HBT A;  3D4F A;  3BFD A;  4I39 A;  5EUA A;  2L0W A;  4EV4 A;  5TBM A;  5FEF A;  3E4O A;  3N6I A;  3IXD A;  3IWQ A;  2XGN A;  2WKQ A;  3T4K A;  5FQM A;  4WEK A;  2V20 A;  3SS3 A;  1S1Z A;  2P74 A;  2PR5 A;  5AQB A;  5M1A A;  4BL2 A;  5HAQ A;  2Y2K A;  1WYC A;  4PM6 A;  4F3L A;  2G2U A;  3ZQ5 A;  3FV7 A;  1PNE A;  3C7U A;  1LI0 A;  5CHU A;  4KG6 A;  2IWB A;  1L0D A;  2W3E A;  3BYD A;  1YSP A;  4K0W A;  4QHC A;  3SH9 A;  3G34 A;  1KGG A;  4R3A A;  5CGW A;  4D2O A;  3VOY A;  4I3I A;  5HFO A;  4KZ6 A;  2G2W A;  2K7S A;  4OOL A;  5EVI B;  3VOL A;  5CGX A;  3ZG5 A;  3DAV A;  5CHJ A;  1QMF A;  2BLS A;  2WAF A;  2Z2L B;  1YT4 A;  2ZC5 B;  3LGO A;  5EM0 A;  3UY6 A;  2ZQD A;  4DE1 A;  3LIE A;  1RGY A;  3C30 A;  4LFU A;  4EES A;  1O07 A;  1KDW A;  2ZC6 B;  2HP6 A;  3F1P B;  5GLB A;  4G3K A;  4CLC D;  3DWZ A;  3MXQ A;  5TR7 A;  3O88 A;  2XD1 A;  4R38 A;  4JBF A;  5JYP A;  5CEB A;  4ZJ3 A;  2BG1 A;  3E98 A;  4K0X A;  2R78 A;  5FQ9 A;  4NK3 A;  2VK3 A;  5CEC A;  5EE8 A;  2ZMF A;  2OLU A;  4PM5 A;  4DRT A;  2P7J A;  2EXA A;  4Z9Q A;  5HDS A;  4LCM A;  5HPI A;  2PHY A;  3DTE A;  1BT5 A;  4ZBE A;  3LFV A;  4L0L A;  2EFX A;  3G32 A;  1IYP A;  1NJ4 A;  1T18 A;  3LI8 A;  2M7U A;  1N4O A;  3KSI A;  4OLG A;  4OKP A;  1TS0 A;  4E04 A;  4FD8 A;  2XA7 S;  4GS9 A;  1IYQ A;  5CX7 A;  3R7W A;  3MF0 A;  3LUQ A;  2HP9 A;  2QJ5 A;  2O9A A;  4JPM A;  4MEZ A;  5JYO A;  4OQI A;  1XJ2 A;  2ZM2 A;  3NOT C;  1MWR A;  2B18 A;  2HDQ A;  1GA0 A;  2YKF A;  4JGO A;  2W3D A;  3HUM A;  4ZAM A;  4UAA A;  3K3D A;  1D7E A;  3CPT B;  3LEZ A;  4HJ6 A;  4JKT A;  1XXM A;  2H10 A;  2C5W B;  2HDS A;  4R6L A;  3QP1 A;  2WUQ A;  2ZOI A;  1UGU A;  4QB8 A;  4FTX A;  4OON A;  5HWT A;  4ARZ A;  4GS9 B;  4WZ4 A;  3A3I A;  4IJG A;  1RGZ A;  3T4J A;  4MBH A;  1TD5 A;  4DMZ A;  1GHP A;  1ZHH B;  3ITA A;  3F1N B;  4Y13 A;  3S7N A;  4HHD A;  3OZH A;  3T1Q B;  5F1G A;  3T50 A;  2UV0 E;  2EX2 A;  4EEP A;  1F5M A;  4HEF A;  3W4Q A;  1OT9 A;  5CHM A;  1LL5 A;  3UN7 A;  2DNS A;  3Q7Z A;  2GZA A;  1EWZ A;  2EXB A;  4JXS A;  4WLA A;  3A3F A;  3OCN A;  3DWK A;  3NY4 A;  1YLZ A;  2QWS A;  1KVM A;  4X68 A;  4WZ5 A;  5EFW A;  2Q9M A;  3VP4 A;  3IX8 A;  4OPZ A;  4BBT A;  3V3S A;  3M6H A;  1S66 L;  1H8M A;  2WGW A;  4DDY A;  3UDX A;  2NUP C;  3ZGA B;  1TDG A;  1DRM A;  3MZF A;  4U0X A;  3RTY A;  1OTB A;  3VP0 A;  5TGF A;  1MWS A;  1VM1 A;  3EOI A;  1CI9 A;  2JKT I;  5EOO A;  3U2A A;  3EGD C;  4L9F A;  4O01 A;  4C6Y A;  4RA7 A;  1PIO A;  4GW9 A;  3MXR A;  4PHT A;  2W3H A;  3C2W A;  1NYM A;  2R9W A;  3AGF A;  1J3W A;  3BWL A;  1OME A;  2JBF A;  2EFU A;  4DN0 A;  1JTD A;  2G7U A;  2V0W A;  4E3O A;  1CI8 A;  1XA1 A;  2LB9 A;  1DY6 A;  4I3A A;  3MQO A;  3SOI A;  2V1Z A;  1V9Z A;  2NUT C;  2W27 A;  3PBT A;  4YOF A;  4GDB A;  5HPF A;  1RP5 A;  2Z2M B;  3IX4 A;  3LEQ A;  3O3V A;  3IHB A;  4GB7 A;  4UA9 A;  4MCW A;  1FSY A;  2WKR A;  4Y0O A;  4B9O A;  4GZB A;  5DJU A;  3U4L P;  1GHM A;  2H28 A;  3OLO A;  1T1B A;  3V3R A;  2Y79 A;  4L9G A;  1VEU A;  2DRW A;  2GNX A;  5KZH A;  3FKW A;  2ZQ7 A;  3AGE A;  3TJZ C;  3MKE A;  1IEL A;  4R0Q A;  5EVI D;  5FAS A;  1WE4 A;  3KSG A;  3KSH A;  2OAP 1;  4GHI B;  2W1T A;  3P01 A;  2ZQA A;  3H82 A;  1K4F A;  4IBX A;  2VA0 A;  1ES2 A;  2D02 A;  1JVJ A;  3P09 A;  3W8K A;  3UE3 A;  5CED A;  4GD8 A;  2Y91 A;  3MMH A;  1GSV A;  2GJ3 A;  4PKY G;  2XA7 M;  4KZA A;  4S2L A;  2RCX A;  2PBY A;  3SS5 A;  5HWV A;  3ICY A;  5GHZ A;  3F1O B;  2CC1 A;  3Q07 A;  3QNB A;  4BMW A;  2ZL1 B;  2Y4A A;  5CGS A;  4HIA A;  2WKP A;  5F83 A;  3G31 A;  1TVF A;  3FG8 A;  4EEU A;  3I7J A;  5D3O A;  4X55 A;  3VE4 A;  3KSF A;  1NLZ A;  1NWZ A;  4BEN A;  3EQV A;  4F94 A;  2VJW A;  3DTM A;  2V1B A;  5L2F A;  4CLC A;  1XJ3 A;  5F5Y A;  4HP9 A;  2E8J A;  2WKH A;  1XKZ A;  2M1C A;  5HD5 A;  4CLC C;  5FL3 A;  1PZP A;  1Q2P A;  1SKO B;  5I5L A;  1DJC A;  4EW7 A;  4O8G A;  3IS2 A;  2XFT A;  4NXG A;  1Z6F A;  2ZBB A;  2VV7 A;  2Y2J A;  3QHY A;  4KQO A;  2A24 B;  5F82 A;  2P08 A;  4EBN A;  2P9V B;  2HJ9 C;  2K2N A;  1GSW A;  3PTE A;  4Y3I A;  5HW3 A;  3LR3 A;  4MN5 A;  1O7E A;  2HDU A;  1G6A A;  5EOE A;  3BFE A;  4N9K A;  2XFS A;  4Q0I A;  3MFD A;  4S2M A;  4KZ3 A;  1W8Q A;  5GL9 A;  2C6W B;  4DKI A;  1MY8 A;  3UDI A;  3K3C A;  3QP4 A;  2OV5 A;  2AVX A;  2XLN A;  3GMW A;  4PM8 A;  1YLT A;  2VGL M;  2GDN A;  2GX5 A;  4WF0 A;  2PT7 A;  4UHU A;  1YM1 A;  3H7W A;  5EM1 A;  5DVA A;  3L7H A;  2LB5 A;  3MSH A;  5FQQ A;  3IF6 B;  2XD5 A;  4OLD A;  4WYY A;  3PYP A;  2ZC3 B;  5A8B A;  1IYS A;  3DW0 A;  1BSG A;  2BTF P;  2Y55 A;  2Z6D A;  2A2L A;  3HLE A;  2ZQ9 A;  1VET B;  3V50 A;  2WYX A;  1FOF A;  1G6O A;  4KZ9 A;  1FSW A;  3O86 A;  4BD0 A;  4JF5 A;  4NXE A;  1ZG6 A;  1SHV A;  1IFQ A;  1E4D A;  3S1Y A;  4Z1W A;  5FA7 A;  4JGP A;  4ESP A;  3IXB A;  2VX8 A;  4K91 A;  4AFI A;  1F9I A;  1LSX A;  3EWK A;  4JF6 A;  1NZU A;  4I5S A;  4OP5 A;  3SZT A;  4BQM A;  5FAO A;  2V8F A;  5IU1 A;  2ZJ9 A;  4U3T A;  2KLI A;  1ERO A;  2FZ0 A;  3A3E A;  2WZZ A;  2XRN A;  1ES5 A;  3NHQ A;  2E8I A;  4EU0 A;  4P85 A;  3C8C A;  3NDE A;  1XX2 A;  5AQA A;  2JC7 A;  5C5K A;  1IOU A;  2WK0 A;  5GHY A;  1HZO A;  4YIN A;  1MWT A;  5L10 A;  1BLC A;  2ZM8 A;  5DF7 A;  4Y17 A;  4OPQ A;  3SH7 A;  4IED A;  2L4R A;  1OT6 A;  1YLP A;  5GLA A;  4GKU A;  3T1R A;  1KOU A;  2PRF A;  5L07 A;  4E6X A;  1KE0 A;  3VP3 A;  3GDI A;  2PDR A;  4CPK A;  1CJF A;  2ZMV A;  3WS1 A;  3NJA A;  2ZC4 B;  3NCK A;  3M2J A;  1H8Z A;  4EQ1 A;  4IHQ A;  3HUO A;  1XPB A;  3W4O A;  2L1M A;  4HJ4 A;  4DE0 A;  2Y8H A;  5FSR A;  2HF6 A;  3OBF A;  3D72 A;  1XJ4 A;  2O0Y A;  3CLO A;  3NEC A;  4QD4 A;  4E3L A;  2FFY A;  2VZW A;  5F68 A;  4EBP A;  3WS0 A;  5HSQ A;  2WAE A;  2ZMA A;  3QNC A;  1Z09 A;  4YFM A;  5AQ9 A;  5I94 A;  4H6J A;  4P0M A;  2W3G A;  5A92 A;  4Y7P A;  4KQQ A;  3PBO A;  5TBM B;  2XSS A;  3UPP A;  5A91 A;  3G6O A;  3EEH A;  5DF8 A;  3KO6 A;  3UE6 A;  2WGI A;  3AGD A;  3TE8 A;  1K56 D;  2DMW A;  1PYY A;  1N9B A;  4F3L B;  3ULF A;  4OH0 A;  4QJG A;  3HLF A;  1MZU A;  3KYZ A;  1FCO A;  5E2E A;  4H6J B;  3ZFZ A;  4JXW A;  5CXW A;  2Y2M A;  3S22 A;  4EQI A;  2PR6 A;  1PI4 A;  3LO7 A;  3G2Z A;  3TOI A;  2EX9 A;  4I3J A;  1HD8 A;  4OOM A;  3CJM A;  4D60 A;  3D9Y A;  3OPH A;  3VOZ A;  3EGX C;  2QPN A;  3TG9 A;  3FWL A;  3ZG7 B;  2MJ6 A;  2J9P A;  2PBD P;  1FR6 A;  1NZO A;  4LEN A;  1PW1 A;  2OSU A;  1FIK A;  1FCM A;  5EVL A;  1E25 A;  1K55 C;  5IHV A;  3PAG A;  4OVD A;  4WBG A;  1DJB A;  3HJI A;  4DF6 A;  1TS8 A;  4Y5F A;  4DJ3 A;  1XFQ A;  2PD7 A;  3CMZ A;  2HV1 A;  1J9M A;  1S4S A;  2VV6 A;  3PAE A;  2KX6 A;  3HBR A;  1STZ A;  1W7F A;  1LSW A;  3UMD A;  5AJG A;  1CEF A;  1EI5 A;  3QP2 A;  1ODV A;  4CJN A;  3DTI A;  3SH8 A;  4WMC D;  1A0K A;  5DTK A;  4WN5 A;  3VV4 A;  3JYI A;  3R7W B;  2WAD A;  2I72 A;  1KE4 A;  4DE3 A;  3QP8 A;  3WS4 A;  2V1A A;  2Y2Q A;  3L9K A;  4LLO B;  5L8M A;  3ZG8 B;  2J3T C;  3ZVT A;  1EW0 A;  4HQA A;  2Z6C A;  3HJK A;  4GJ4 A;  3UE0 A;  3ZNT A;  3V5M A;  1ZTU A;  1H5X A;  2W3F A;  3O87 A;  4ME4 A;  4UA7 A;  4ZDX A;  3UO9 A;  4ARZ B;  4DDS A;  3NOP C;  5CRF A;  4R4S A;  3VP2 A;  1PRQ A;  4NEE D;  4EUV A;  3PBR A;  2UWX A;  3BQ8 A;  5FEG A;  1SDN A;  1CEG A;  1PWG A;  3IBR A;  3LIF A;  1IEM A;  1N9L A;  4KQR A;  1IKI A;  3CAX A;  1XA7 A;  5EVE A;  4XUZ A;  3IBJ A;  2VGL S;  1VB6 A;  5FAQ A;  2WGW B;  2J8Y A;  3OPL A;  2QJ7 A;  2Y2P A;  4GD6 A;  2QYB A;  1L0E A;  1ESI A;  1E3U D;  3T12 B;  4N1X A;  1TS6 A;  1KVL A;  4BBV A; 
#chains in the Genus database with same CATH homology
 2H0T A;  2A49 A;  4JXV A;  2WZX A;  3HRE A;  5EEC A;  1VQQ A;  1DJC A;  1FQG A;  1BUL A;  3C4O A;  3CG5 A;  2XFT A;  1Z6F A;  1KGE A;  2J7V A;  3BLM A;  2JCH A;  2Y2J A;  3EQU A;  3QHY A;  1PZO A;  2WGV A;  4KQO A;  3C4P A;  1LL9 A;  1MWU A;  2ZC7 A;  5F82 A;  4RX3 A;  3NDG A;  2Y2N A;  4LV3 A;  4M3K A;  1I2S A;  5FAT A;  5BOH A;  1LHY A;  3M6B A;  4EBN A;  3OPR A;  2P9V B;  5FI6 A;  3GVB A;  4HBT A;  3G2Y A;  3D4F A;  3BFD A;  3HLW A;  5EUA A;  4S2O A;  3IF5 A;  3PTE A;  4XUX A;  5HW3 A;  1FCN A;  1W8Y A;  4MBK A;  1O7E A;  4EV4 A;  2HDU A;  1AXB A;  2V2F F;  4O7D A;  1G6A A;  5EOE A;  1YLY A;  3BFE A;  3IXD A;  3N6I A;  3OPP A;  3IWQ A;  2XGN A;  4R3J A;  3PBN A;  5M18 A;  4N9K A;  3VMA A;  2XFS A;  4X69 A;  3MFD A;  4E3N A;  4OOY A;  5J8X A;  3PBQ A;  1BUE A;  4PM9 A;  5FQM A;  1MKI A;  2EX8 A;  4S2M A;  3FKV A;  4WEK A;  1S6R A;  4KZ3 A;  2V20 A;  1W8Q A;  3N8S A;  5GL9 A;  1K4E A;  2C6W B;  4E6W A;  3HLC A;  1MY8 A;  3TSG A;  2A3U A;  2Y2I A;  3SS3 A;  3UDI A;  4DKI A;  5CER A;  2P74 A;  5M1A A;  5AQB A;  4BL2 A;  3VSL A;  5HAQ A;  2Y2K A;  1K25 A;  5HX9 A;  2H5S A;  3HVF A;  4E3K A;  1WYC A;  1NRF A;  1ZG4 A;  1QME A;  2XLN A;  3GMW A;  4PM6 A;  2OV5 A;  5FQK A;  1GA9 A;  2G2U A;  1YLT A;  4PM8 A;  2GDN A;  3WRZ A;  5E2G A;  3FV7 A;  2RL3 A;  4UHU A;  2B5R A;  3C7U A;  1YM1 A;  1LI0 A;  4FSF A;  5DVA A;  3RXW A;  5CHU A;  3G4P A;  5FDH A;  4KG6 A;  5FQQ A;  4RVA A;  1SKF A;  2ZQ8 A;  3IF6 B;  2IWB A;  2XD5 A;  4OLD A;  4WYY A;  2ZC3 B;  1L0D A;  1IYS A;  4BJP A;  3BYD A;  3DW0 A;  1BSG A;  3NIA A;  2Y55 A;  4KG5 A;  2X02 A;  4K0W A;  3ZG0 A;  3PBS A;  4S2K A;  5GHX A;  4QHC A;  3HLE A;  3SH9 A;  2WKE A;  2ZQ9 A;  3G34 A;  1KGG A;  3V50 A;  1BLP A;  2WYX A;  5CGW A;  1FOF A;  5E2F A;  4D2O A;  4E3O A;  4KZ9 A;  1FSW A;  2EX6 A;  3VOY A;  3O86 A;  4PPR A;  4BD0 A;  5HFO A;  4JF5 A;  2R9X A;  4DE2 A;  3N4I A;  1ZG6 A;  3ZVW A;  4KZ6 A;  4P6B A;  5KMW A;  3N8R A;  2G2W A;  1SHV A;  3BFC A;  4OOL A;  3WWX A;  1E4D A;  3S1Y A;  3IH9 A;  5EVI B;  5CGX A;  5FA7 A;  3ZG5 A;  5CHJ A;  1BLS A;  3IXB A;  4IBR A;  1QMF A;  2BLS A;  2WAF A;  2Z2L B;  1YT4 A;  2ZC5 B;  4K91 A;  3UY6 A;  2XF3 A;  3V39 A;  2ZQD A;  4DE1 A;  1RGY A;  4WZ5 C;  5G18 A;  4MBF A;  4JF6 A;  1O07 A;  1NZU A;  1KDW A;  2ZC6 B;  4OP5 A;  1MBL A;  3GR2 A;  3HLG A;  3ZG9 B;  2HP6 A;  4QU3 A;  4S2I A;  2XEP A;  1K6R A;  5GLB A;  4BQM A;  1PI5 A;  5FAO A;  4QY6 A;  3DWZ A;  4R3B A;  1HVB A;  5TR7 A;  4Q8I A;  2ZJ9 A;  1JWP A;  4IVK A;  4U3T A;  1ERO A;  3GTC A;  1PWC A;  4HBU A;  3ITB A;  3O88 A;  4LV2 A;  5E2H A;  3A3E A;  2XD1 A;  2WZZ A;  4JBF A;  5JYP A;  1ES5 A;  1ES3 A;  2FFF B;  5CEB A;  4ZJ3 A;  5E43 A;  2E8I A;  1ONH A;  4R1G A;  2BG1 A;  3W8K A;  4P85 A;  5KSH A;  4K0X A;  3NDE A;  3S4X A;  5FQ9 A;  1KGF A;  4NK3 A;  1XX2 A;  5DF9 A;  5AQA A;  1KDS A;  2JC7 A;  4IVI A;  1LLB A;  5CEC A;  1MXO A;  1Q2Q A;  4N9L A;  5EE8 A;  2OLU A;  2WK0 A;  3LY3 A;  4PM5 A;  5GHY A;  4DRT A;  1HZO A;  4YIN A;  1MWT A;  1BLC A;  2ZM8 A;  5DF7 A;  4OPQ A;  3SH7 A;  4H8R A;  1HTZ A;  4IED A;  2EXA A;  3VFF A;  4Z9Q A;  3IT9 A;  5GLA A;  1YLP A;  3WS5 A;  4GKU A;  4LCM A;  1BT5 A;  4KZ5 A;  4ZBE A;  4L0L A;  2EFX A;  4MLL A;  4E6X A;  1LI9 A;  3G32 A;  3OCL A;  1IYP A;  1NJ4 A;  4JLF A;  3ZDJ A;  3Q81 A;  1KE0 A;  3VP3 A;  1SDE A;  1K57 A;  3MKF A;  1XP4 A;  1N4O A;  1PW8 A;  2ZD8 A;  4OLG A;  4CPK A;  4OKP A;  3WS1 A;  4FD8 A;  1IYQ A;  2IWD A;  1K57 C;  2ZC4 B;  4PM7 A;  2HP9 A;  4JPM A;  4MEZ A;  1YMX A;  5JYO A;  3NCK A;  1YLJ A;  4OQI A;  3M2J A;  1YLW A;  2ZM2 A;  1H8Z A;  3Q1F A;  3HUO A;  4WEL A;  1MWR A;  3VFH A;  2HDQ A;  2VGJ A;  1XPB A;  3W4O A;  3ZHH A;  4NET A;  4KEN B;  1GA0 A;  3MZD A;  3ISG A;  1Y54 A;  4DE0 A;  5FSR A;  3HUM A;  4ZAM A;  4UAA A;  3N8L A;  3C7V A;  3IWO A;  2VGK A;  1ESU A;  4X6T A;  4Y0U A;  3LEZ A;  4QD4 A;  4JKT A;  1XXM A;  2H10 A;  4E3L A;  5FI7 A;  3ZCZ A;  2FFY A;  3MBZ A;  2C5W B;  2HDS A;  4EBP A;  4PMA A;  3WS0 A;  2WAE A;  2ZMA A;  3GQZ A;  3QNC A;  2WUQ A;  4QB8 A;  4S2N A;  4YFM A;  5AQ9 A;  2X01 A;  5I94 A;  3IF6 C;  4OON A;  1TEM A;  2H0Y A;  4WZ4 A;  1ERQ A;  4P0M A;  4S2N C;  3BM6 A;  3A3I A;  5A92 A;  4Y7P A;  5EPH A;  1RGZ A;  1NXY A;  4KQQ A;  4MBH A;  1GHP A;  3PBO A;  3ITA A;  3UPP A;  5U47 A;  2IWC A;  3Q7V A;  1NY0 A;  4ZJ2 A;  1S0W A;  3OZH A;  5A91 A;  5FAP A;  4OPY A;  5F1G A;  5DTS A;  2EX2 A;  4FH2 A;  5DF8 A;  4ZJ1 A;  4HEF A;  3W4Q A;  3LCE A;  5CHM A;  2WGI A;  1CK3 A;  1LL5 A;  3AGD A;  3UN7 A;  2DNS A;  1RCJ A;  3Q7Z A;  1EWZ A;  1K56 D;  2EXB A;  5A90 A;  1PYY A;  1IYO A;  4JXS A;  5HAI A;  2ZLY A;  1N9B A;  3A3F A;  3OCN A;  3DWK A;  3RXX A;  3NY4 A;  1YLZ A;  3GSG A;  1G68 A;  4E3I A;  4OH0 A;  4QJG A;  4EUZ A;  3HLF A;  1I2W A;  1KVM A;  5DTT A;  1FCO A;  4X68 A;  5E2E A;  1K56 A;  4WZ5 A;  1KE3 A;  4A5R A;  4MNR A;  4KZB A;  2Q9M A;  3ZFZ A;  3VP4 A;  4OQG A;  1ZKJ A;  2HP5 A;  4OPZ A;  1DJA A;  3IQA A;  3V3S A;  4JXW A;  3M6H A;  5CXW A;  2WGW A;  1PWD A;  2Y2M A;  3S22 A;  4EQI A;  4DDY A;  4S2J A;  4OPR A;  3UDX A;  3ZGA B;  1TDG A;  1ONG A;  1PI4 A;  4P87 A;  3LO7 A;  1NYY A;  4C75 A;  3G2Z A;  3TOI A;  4BD1 A;  3MZF A;  3C5A A;  4U0X A;  1BTL A;  3UE1 A;  3N7W A;  4QY5 A;  4GDN A;  4BL3 A;  2EX9 A;  4JXG A;  5AQ7 A;  1HD8 A;  3VP0 A;  3UDF A;  4OOM A;  5TGF A;  1MWS A;  1VM1 A;  3E2L A;  1M40 A;  1CI9 A;  1K54 A;  5KSC A;  3CJM A;  5F1F A;  5EOO A;  1M6K A;  3OPH A;  3WS2 A;  1JTG A;  1K54 C;  2QMI A;  3VOZ A;  3BRM A;  3W4P A;  3B3X A;  3CZD A;  5HAP A;  4Y0T A;  2QPN A;  3TG9 A;  4C6Y A;  3FWL A;  4RA7 A;  1BLH A;  1PIO A;  2Y2L A;  1I5Q A;  2J9O A;  3ZG7 B;  4LV1 A;  2Y2O A;  3MXR A;  2DCF A;  1MPL A;  3LY4 A;  1ES4 A;  4E3J A;  3IWI A;  5A93 A;  1W79 A;  3FYZ A;  1NYM A;  2R9W A;  3AGF A;  2J9P A;  1OME A;  1JWZ A;  3VSK A;  2JBF A;  1H8Y A;  1ALQ A;  1FR6 A;  2P9V A;  4C3Q A;  2EFU A;  3A3J A;  1WYB A;  1NZO A;  4LEN A;  1JTD A;  1PW1 A;  2OSU A;  3BEB A;  1XGI A;  1CI8 A;  1XA1 A;  1FCM A;  2WKI A;  4S2P A;  4WEJ A;  1E25 A;  3GV9 A;  3HLB A;  4XXR A;  1DY6 A;  1K55 C;  5EVL A;  5IHV A;  3PAG A;  4OQ0 A;  2PU4 A;  3SS4 A;  5HAR A;  3VP1 A;  5TFQ A;  3SOI A;  4DXC A;  4RX2 A;  4OVD A;  3G30 A;  4WBG A;  1DJB A;  4KZ8 A;  1E3U A;  2V1Z A;  4DF6 A;  1IKG A;  3PBT A;  1SCW A;  4HES A;  4GDB A;  3CMZ A;  1L0G A;  4E3M A;  1RP5 A;  1J9M A;  3PAE A;  2Z2M B;  3O3V A;  3HBR A;  3IHB A;  4GB7 A;  4UA9 A;  3A3D A;  5FI2 A;  3M2K A;  4GNU A;  1FSY A;  5GLC A;  1W7F A;  2HDR A;  4ZTK A;  3IXG A;  4Y0O A;  1CEF A;  4GZB A;  1EI5 A;  3IXH A;  3UPO A;  1GHM A;  2Q9N A;  4N1H A;  3Q82 A;  4DXB A;  3IF6 A;  4LV0 A;  2Y2H A;  4OQH A;  2Y59 A;  5GLD A;  4CJN A;  3HLD A;  3SH8 A;  4WMC D;  5DTK A;  1FR1 A;  3V3R A;  2DRW A;  3JYI A;  4JF4 A;  5KZH A;  3FKW A;  2ZQ7 A;  3AGE A;  2WAD A;  2I72 A;  3MKE A;  1KE4 A;  4DE3 A;  1IEL A;  4R0Q A;  1ZC2 A;  3HL9 A;  5EVI D;  5M19 A;  3WS4 A;  2Y2Q A;  4WMC A;  3MXS A;  1YQS A;  2X71 A;  2ZM0 A;  1WE4 A;  5FAS A;  3IH8 A;  3ZG8 B;  1BZA A;  2ZQA A;  4IBX A;  1K4F A;  2OLV A;  2XH9 A;  3UPN A;  3ZVT A;  4B88 A;  5EVI A;  1ES2 A;  1JVJ A;  2PU2 A;  3UE0 A;  3ZNT A;  3GRJ A;  3P09 A;  4R23 A;  3OC2 A;  4R4R A;  3FZC A;  5EVI C;  3UE3 A;  3V5M A;  3BFG A;  4X56 A;  4OP8 A;  1H5X A;  2XDM A;  3BEC A;  4BLM A;  3O87 A;  5CED A;  4GD8 A;  2Y91 A;  4UA7 A;  4ZDX A;  3UO9 A;  4FCF A;  4DDS A;  1ERM A;  1C3B A;  5CRF A;  4R4S A;  4KZ7 A;  4B4X A;  5FQI A;  3VP2 A;  4KZA A;  3BLS A;  1K38 A;  4S2L A;  3Q7V B;  3PBR A;  2UWX A;  3ZNY A;  2RCX A;  3NI9 A;  4N92 A;  4KG2 A;  4LCL A;  2PBY A;  4GOG A;  5FQJ A;  1L0F A;  3G35 A;  3NC8 A;  4UA6 A;  3SS5 A;  3NBL A;  5GHZ A;  1YMS A;  2CC1 A;  2QZ6 A;  3Q07 A;  3QNB A;  4X53 A;  3HUN A;  2Y4A A;  4EWF A;  1SDN A;  5CGS A;  1CEG A;  1GCE A;  1TDL A;  1PWG A;  1XGJ A;  5F83 A;  3E2K A;  3G31 A;  1IEM A;  1TVF A;  3MZE A;  3I7J A;  4KQR A;  5D3O A;  4X55 A;  3UNW A;  2XQZ A;  3P98 A;  4KZ4 A;  1IKI A;  4EBL A;  5HL1 A;  5CTM A;  3RJU A;  1XA7 A;  2JE5 A;  4XUZ A;  4BEN A;  4ID4 A;  3EQV A;  4GN2 A;  1K6S A;  1W5D A;  1L2S A;  5FAQ A;  4F94 A;  2WGW B;  3DTM A;  2J8Y A;  3OPL A;  3BFF A;  5L2F A;  2Y2P A;  4GD6 A;  4RYE A;  4WM9 A;  1L0E A;  2HPB A;  2WKH A;  1XKZ A;  1K55 A;  2Y2G A;  2XK1 A;  1U60 A;  3WRT A;  1ESI A;  1E3U D;  2ZQC A;  1JWV A;  2XR0 A;  4N1X A;  1PZP A;  5CTN A;  1KVL A;  3IHA A;  4U0T A;  1Q2P A;  1GHI A;  4FH4 A;  4B4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...