1GHRA

The three-dimensional structures of two plant beta-glucan endohydrolases with distinct substrate specificities
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
306
structure length
306
Chain Sequence
IGVCYGMSANNLPAASTVVSMFKSNGIKSMRLYAPNQAALQAVGGTGINVVVGAPNDVLSNLAASPAAAASWVKSNIQAYPKVSFRYVCVGNEVAGGATRNLVPAMKNVHGALVAAGLGHIKVTTSVSQAILGVFSPPSAGSFTGEAAAFMGPVVQFLARTNAPLMANIYPYLAWAYNPSAMDMGYALFNASGTVVRDGAYGYQNLFDTTVDAFYTAMGKHGGSSVKLVVSESGWPSGGGTAATPANARFYNQHLINHVGRGTPRHPGAIETYIFAMFNENQKDSGVEQNWGLFYPNMQHVYPINF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,3-1,4-BETA-GLUCANASE
publication title Three-dimensional structures of two plant beta-glucan endohydrolases with distinct substrate specificities.
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
total genus 95
structure length 306
sequence length 306
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 1993-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00332 Glyco_hydro_17 Glycosyl hydrolases family 17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ghrA00
4CU8A 3AQUA 2PC8A 2ZICA 2EJ1A 2HISA 2VCCA 4P7OA 1VJZA 2VX6A 3WN6A 1G1YA 5EFDA 3CZ8A 3F5LA 3W37A 2JF7A 2PB1A 5JBEA 1CLXA 1PPIA 2YDRA 4M81A 5BROA 3BGAA 2YLLA 3EDFA 5GNZA 5I3DA 2YDSA 2JE8A 4MB1A 4UZSA 1PX4A 3TONA 5M03A 4R27A 1QHOA 1WDQA 3VKKA 1V3KA 3WDRA 3JUGA 4JHZA 5FD0A 3ZM8A 5FCZA 1LF1A 2XSBA 1WE5A 5ABGA 1W3HA 3QHMA 1QNOA 3CMGA 4TX8A 3POHA 3VILA 2WMIB 1WDRA 3WQ5A 1EDGA 2CBUA 1J01A 2WVVB 3IK2A 3WF0A 2OYLA 3ARYA 4D6DA 1W2PA 3ARSA 1BVZA 2A3HA 4U5IA 4AIUA 2D22A 4PMXA 3FN9A 2VRJA 3VMPA 4EE9A 4RE3A 3AJ7A 3RDKA 1VFOA 4TXEA 4UQCA 1E40A 1B3ZA 5I6SA 2VTFA 5FIPA 3TTSA 3OGVA 4LYPA 1H3GA 3MUAA 1HNYA 1OB0A 2DT3A 2CCRA 1ZBKA 1E6QM 2JFEX 4H8VA 4JAWA 1ISZA 1V6VA 4PMYA 3SCRA 3AIEA 1NQ6A 2ZUTA 3WH5A 1KQYA 1B3XA 2JEPA 3PTQA 2W67A 2CERA 4AW7A 3VD9A 3N15A 4J3TA 4K68A 4UQ9A 4WIWA 5EB8A 1QNPA 3IAQA 2J79A 4CCDA 5A2AA 1H41A 3WBAA 4UFIA 3MV11 2G3MA 4AZGA 1ISVA 3W53A 5I23A 4WJXA 2GJRA 1B9ZA 2WHLA 1JYVA 1J0ZA 2J8FA 4ACZA 3F4VA 3OG2A 2J47A 5BWFA 1UR1A 4MAVA 5DMYA 4N42A 3WDIA 1WZMA 1AQMA 2WBKA 3NUKA 2VZVA 3BMVA 1KB3A 2D24A 3CGTA 3BAXA 3CZKA 3UERA 4UFLA 4GKLA 5BCAA 3F5JA 4R5EA 2PWDA 1Q6GA 3VDCA 2FGZA 4NZCA 3VGEA 3CZLA 3W82A 3CO4A 3W28A 5FL0A 1OIMA 1UWSA 3OZPA 1JD9A 4CUCA 1ISXA 3VD5A 4CVWA 1C90A 2J7HA 3AIVA 4C7FA 1VJSA 1XSKA 3K8MA 5DF0A 3WF1A 4GINA 1C3FA 2O9RA 1BHGA 1NARA 5BXTA 2NT1A 1GZJA 1UKOA 5E70A 4MDOA 1PZ2A 4BZYA 3PZQA 4KH2A 5GPRA 4HPHA 3WMBA 3RM8A 2D0HA 1E9LA 1SMAA 2ZXAA 1GJWA 2W92A 4CD4A 1HIZA 4AIOA 2VC9A 5JIWA 3NSNA 2WXDM 1M04A 1V3MA 1GORA 4ML4A 1WZAA 2GSJA 3A4AA 2DDXA 4OOZA 2EPNA 2ZX9A 2DSVA 4QLJA 1MW3A 1CEOA 1SFSA 4LYRA 1WZKA 1GUVA 2BHUA 2J8GA 5CJ5A 1FH9A 3VGGA 2Z1SA 1E71M 1TCMA 2CXGA 1TZ7A 2WB5A 4H41A 5A6LA 2BXYA 1BFNA 2C0HA 1AMYA 2WWDA 3THCA 3EDKA 1CENA 1V0LA 2CEQA 1HKJA 1B3VA 3MUIA 4D6CA 1PJ9A 4TOQA 4AZCA 2D3NA 3EDEA 1O6IA 4DWSC 1OD0A 1X6LA 3PN8A 4WSJA 3EYPA 1EOKA 3SCQA 1MXDA 3KEHA 2ZUSA 4F9DA 7CGTA 3KWXA 4UTFA 2WCAA 2QMJA 1GOIA 2ZWZA 3WFZA 5ABFB 4PCTA 4AD3A 1CGYA 2VX5A 2ZUNA 1JNDA 5A6SA 2V3FA 2WVSA 1NP2A 2VQUA 3WH6A 1W1TA 3PBGA 2VCBA 3BCDA 3VD4A 5D8WA 3AXIA 4S3KA 1EHNA 1H5VA 1OGGA 1QI4A 2D1ZA 3GH7A 3AMCA 3AIQA 1U30A 3SCWA 3K1DA 4GPNA 1PX3A 1W9DM 5I77A 2VR5A 3CTTA 3N18A 4JFUA 1CTNA 3EDJA 2CBJA 5LA2A 3ZMRA 3I3BA 1E1EA 1VEMA 1DWIM 1W3JA 4W93A 2VZTA 4EAMA 1W3KA 2FDMA 7A3HA 4MNKA 3ARZA 2D0GA 1YHTA 1Q6DA 4J7RA 3WNLA 3L4WA 5AYIA 2XGBA 4M24A 1YQ2A 4MJ4A 3LPGA 1KBBA 1LWJA 1UD6A 1E73M 2JF6A 2GDUA 5M3WA 1MW2A 5A6BD 1UWRA 5A2BA 8CGTA 4OUEA 2DPEA 2ZX5A 4B3LA 3PTMA 2ZUUA 3NCOA 2WANA 4TVUA 3WD1A 3CHEA 4CU6A 3SUVA 3CLWA 4IM4A 3EMCA 4J27A 3VM7A 1E5NA 2V5DA 1GJUA 4E8CA 1ZBVA 2E8YA 1OM0A 1JDCA 2CHNA 5HBFA 2UY3A 3SCUA 4D6FA 3II1A 3RILA 3VIIA 1UQZA 2OWWA 4M1RA 3GYCA 2WZHA 3HMCA 4OOUA 1CYGA 4ZE4A 3WNNA 3WUGA 1J9YA 2J7CA 3TA9A 1B1YA 3ZR6A 3AS2A 2XPKA 1GONA 1G01A 1HJSA 4W7UA 3OLEA 1NP0A 2Y4SA 3RM9A 1KGXA 3PZTA 2ZX8A 4AEEA 4HPGA 1E72M 3AZTA 2VRQA 4Q7NA 5FKYA 3SUSA 4NF7A 1WP6A 1DTUA 1PEZA 2ZXDA 4D6JA 1MQRA 4PCSA 3VGDA 5KZ6A 1BYCA 3VVGA 4GI9A 2YL6A 5CXPA 1US3A 2GK1B 1E70M 1WO2A 1RD6A 4UZUA 3BXWA 4CD6A 1J0HA 2OYKA 3N9KA 1V6YA 3KL0A 1CGTA 7TAAA 1UD2A 2XIBA 4TVDA 5HOSA 3ZIZA 3AICA 4P8WA 1XV8A 5E0CA 5C70A 2GUYA 3LPFA 1PX8A 3CUHA 3K8LA 2UY5A 5CGMA 3MSDA 3L2MA 1G0CA 3T2OA 2YBUA 3CH9A 2VZSA 1KCLA 3KL3A 5A69A 4TTGA 1EHAA 1HKIA 2D3LA 1VAHA 3ARUA 3VDHA 4Z2KA 1UZ1A 4TTUA 4W89A 3MUZ1 2YA1A 2NW0A 3ARTA 1E56A 1AQ0A 3M6DA 2J4GA 3K8KA 1MQPA 1W9UA 1XH0A 3WD2A 5IHRA 4CVUA 1V0NA 1Z32X 3EMQA 4QCEA 4DM1A 3T0AA 4P7NA 1GNXA 5E09A 3SCOA 1W32A 3VGFA 2W5FA 2J78A 2VVNA 4WSKA 1UR0A 2FHCA 5ABEA 1OBAA 2PWHA 5AC5A 2F2HA 2DSZA 4IISA 3WDHA 1WNOA 1UWQA 1H11A 4TX6A 2YDQA 5IXEA 1FOBA 1UD8A 3WSUA 1CGXA 4P7QA 4JHOA 1GCYA 2WNWA 2HVMA 3CMJA 3T08A 4MNLA 1KR0A 1H0GA 1V3LA 3ZJ6A 2PBGA 1CIUA 1KWGA 1CGVA 1JGIA 1L0PA 3CHDA 5CQ1A 2VUYA 1JAKA 1EDTA 1GOQA 2CYGA 3PZIA 1HJVA 3HJEA 1JFXA 2WBGA 3W38A 4AYSA 3MANA 3PZ9A 1XD1A 1XH1A 2QHAA 2XG9A 2WHKA 3AHZA 2WKGA 1U2YA 3NJ3A 1K9DA 2J77A 2OWCA 4AY1A 2G3IA 2D2OA 1HXJA 3GBEA 2YBTA 1OSEA 4B9ZA 1SMDA 4NRRA 3QHOA 3POCA 1JZ4A 4CD5A 1S46A 4QCFA 5CPTA 1C8QA 3MO4A 5IDIA 4B16A 3VD3A 1VFFA 3WMSA 1V08A 2XSAA 3NSMA 4HZ8A 5CLWA 1V02A 3RJXA 4BF7A 3GBDA 1UR2A 2BV9A 2QMKA 4D6EA 3OA5A 4AZ7A 4B3KA 2CPUA 3OLGA 1JZ5A 1EDQA 1B0IA 4UFHA 1VEOA 3U7BA 1H2JA 5A8NA 2V38A 5EMYA 1DWHM 3ZJ8A 4RE2A 3WH7A 2ZXBA 4GZIA 4PTXA 4U2ZA 4OBRA 4UOJA 4PUDA 2Y24A 6CGTA 2EBNA 4H8UA 3GNRA 2PWGA 3OZOA 1HKMA 3SUWA 1CGUA 4F66A 4D72A 3T2PA 2G4FA 1JZ6A 2BVYA 3L4TA 4AZIA 4ACZB 4AZ6A 3AS1A 1HP4A 3E1F1 4U33A 4HU0A 1ISWA 1MVYA 2YIHA 9CGTA 3UG4A 1ECEA 3A6OA 1UH2A 2CHOA 1BTCA 2YOCA 1UD3A 4AEFA 3WF3A 2CETA 1IT0A 3AIWA 3KZSA 3FXYA 2YL5A 1HJXA 2EPLX 5DO8A 4HZ6A 2DSKA 4W7WA 1GQIA 4AZBA 3SURA 1B90A 4ZFMA 1MW1A 2DT0A 1EQCA 2EPMX 2GJXA 4Z2LA 5I0DA 1NWRA 3GNPA 3G6LA 5JIPA 3CHCA 1V6XA 4CU7A 1H09A 2BY2A 1KXVA 1QPKA 4H7VA 5AC4A 1L8NA 4PMVA 1BAGA 1HJQA 3BH4A 3W24A 4GXPA 5E6ZA 3WIJA 5CLTA 4W84A 1OIFA 3W26A 3ZOAA 1R87A 1IZKA 5A6KA 2X05A 1OWQA 1HT6A 1V6WA 3U7VA 1LG2A 3B9AA 1J0YA 1VRXA 4D71A 2WWCA 1Y7VA 2XVLA 3BAYA 4AD2A 3I3DA 1GHSA 1JI1A 1QNQA 4FF5A 1AVAA 1J12A 2F61A 3L2LA 1CWYA 1VF8A 4AISA 3ARVA 2CBIA 1LL7A 4YHGA 4U5KA 3WBEA 1QHPA 3K4DA 4JKKA 1CXIA 1N82A 3A4XA 2ZX7A 1BGGA 1NWTA 4UR9A 3O2LA 4BQ2A 1GOWA 1BYDA 2WCSA 1KXHA 3PZVA 3QOMA 5M17A 4OKDA 1V3HA 1UWUA 2ZE0A 4M56A 3WKZA 3NIYA 3ZQ9A 1JF6A 1K9TA 2OSWA 2DQXA 4BQ4A 2ZX6A 2X1IA 4P8UA 1E3ZA 1NWSA 1CXHA 4KRUA 3VX1A 1C8YA 1UKQA 4J3UA 4ZXOA 3SUTA 1VBRA 1TMQA 4PMRA 1NOFA 1C7SA 3AHXA 1FP9A 3N1AA 3VMOA 2JALA 3WDQA 3CBWA 5A6JA 3O9NA 1EGZA 3VPLA 1UWIA 3KE0A 4FK9A 4V28A 2OLHA 3N17A 4AZCB 3PZOA 1JZ2A 2WMKA 4L4OA 1QI5A 1Q6CA 3CIVA 2WC4A 3GZAA 1I1WA 3VGHA 4ZXLA 2EO7A 5BRPA 1HX0A 5HPCA 3U5UA 4UFJA 1BG4A 1QNSA 4KGLA 4PMNA 3AIBA 3CUFA 1E5JA 2XUCA 3AI0A 3BAWA 1J0KA 1QOXA 1CNVA 3PZNA 1JL8A 4MB5A 5D9MA 1JI2A 5A8QA 5A94A 4IUGA 5CGTA 1C8XA 3QHNA 2J7GA 1VFMA 2J7EA 1VEPA 4UQEA 4MJ2A 4W5UA 5F7UA 2V3EA 2XFRA 1TUXA 6A3HA 4D6HA 2J7FA 3QGVA 1TR1A 1EQPA 2VZOA 2WC3A 2WC7A 1NOUA 4PTWA 2WM0A 1MFVA 5JUVA 4FLQA 4D6IA 5CPSA 3UG5A 4UOZA 1CPUA 3MMDA 3GXIA 3SCSA 3ZR5A 1V6UA 2FH6A 4DUVA 2FGLA 4QFUA 1DWFM 3AYSA 4MADA 2W66A 8A3HA 1OD8A 1JDAA 2UY2A 2Z1KA 2VI0A 1W2VA 4LPCA 4HOZA 3ZT7A 1XCXA 2XFYA 5ECUA 4WKAA 2BNJA 4ZENA 1GVIA 1WZLA 3OGRA 2E40A 4PUEA 2E3ZA 4AIEA 4V27A 2X09A 2MANA 4XUYA 2G3NA 2V5CA 4JKMA 5CSUA 1BF2A 2GJPA 4M29A 1XCWA 1MW0A 5I24A 3VOCA 1Q6FA 3B9EA 1EA9C 1B30A 3TTQA 1MFUA 4GZJA 2GVYA 1D2KA 1HN1A 1UKSA 3AMLA 1UR8A 4E2OA 1BYBA 2Y2WA 1ISYA 1GPFA 4AZ5A 3WH8A 4DUWA 3SCVA 3VX0A 5IFPA 3N13A 1BGAA 3VMNA 1PIFA 1UKPA 2IXVA 3OLIA 1MYRA 1DP0A 2EXOA 4PSRA 3VM5A 4TUFA 1TE1A 4YN5A 2O9OA 2CKSA 4NI3A 3UESA 4UOQA 4PMDA 4X9YA 4PMQA 3CUIA 3WL1A 4Z2GA 2DT2A 2AOSA 3MS8A 1CLVA 4HA1A 2XVPA 2Y8KA 3N04A 1F4AA 3WEOA 1VIWA 2G8ZA 2CBVA 1ZB5A 3DYOA 4J28A 2GDVA 2WLZA 3O6AA 3W4RA 1UR4A 1ITCA 3VD7A 2E4TA 2XM2A 4N0RA 4CGTA 5CPQA 2E9LA 1UZ4A 3GTNA 2BHZA 3S2CA 4HMCA 1MXGA 1W91A 1E4LA 2XVKA 3J7HA 4HZ7A 1EXPA 3DYPA 1HL9A 1LL4A 1E1FA 5IHSA 1TVPA 3T2QA 2AAAA 5A8PA 3WMCA 3UEQA 1CZ1A 4ATWA 1CXKA 2BY0A 4W87A 3RCNA 1E0XA 1E4MM 1JIBA 5HDRA 2Y5EA 5DT7A 5TD4A 3AIUA 1TA3A 3BAKA 1B31A 1FA2A 4AWEA 1VBUA 1WCGA 4Z2IA 2YA0A 5CG0A 5CZKA 3APGA 1EIBA 1NOWA 4XV0A 3G6MA 3WNKA 1LG1A 2BFGA 2X0HA 3RM4A 4HP5A 4OJYA 1E0WA 1BQCA 1E4NA 2ZUVA 3IANA 4BA0A 1JZ3A 5GNXA 2E9MA 2ZXQA 3TTOA 1CECA 4MB3A 4IPNB 5EBAA 3PZGA 3ZJ7A 2VO5A 5DFAA 1R7OA 2W4XA 4H04A 5IFTA 1NM9A 4X0NA 1JXKA 2V3DA 5LA0A 2E9BA 1BLIA 3WF2A 3D5HA 4KRTA 1KXTA 5GNYA 2FHFA 2BVTA 4JL1A 1UUQA 1V02E 1W9VA 5DEZA 4Z2JA 3M46A 1LJYA 3AISA 2PWEA 2A3CA 2PBOA 4PYSA 5C8BB 1R8LA 2UWFA 4HTYA 3IJ9A 4LX4A 5D8ZA 4GZEA 1JG9A 2EEXA 3L4ZA 1PZ3A 2IXUA 4JFWA 4A3YA 4J3WA 4H8HA 2WHJA 1WPCA 1WB0A 4ATLA 2OSXA 2QLYA 5FOOA 1LWHA 3WQ4A 1NWUA 1XYZA 3BSHA 2E8ZA 2FH8A 3VIJA 3L4XA 3WEZA 4MB4A 4U31A 1JF5A 4KWUA 3AOFA 4P7RA 1PBGA 3W6MA 3F5KA 4EKJA 1BG9A 3VIMA 3LMYA 4CD7A 4AXNA 3CPUA 1HKKA 1X1NA 3FHQA 4PBGA 3DHUA 4L4PA 4ATDA 1XRVA 4NSBA 2OWXA 2BXZA 3M07A 3B8SA 2O9PA 1QVBA 4LGXA 2GFTA 5A6AA 4PEEA 1Q4NX 5D9OA 4JL2A 4JFTA 2NSXA 2TAAA 3PZUA 1HJWA 4WF7A 4DWSA 4Y7EA 3LPOA 2WMFA 5A2CA 3WDPP 4J3VA 1RP8A 1CGWA 3SIMA 4HOWA 2WYSA 3SEPA 1UQYA 1GVYA 3IAPA 1FHLA 4FLOA 4U3AA 1UHVA 3AHTA 1RP9A 5CSYA 3GXDA 1JZ7A 2YKKA 2BS9A 4XB3A 3W6LA 3ZT5A 3NDYA 1BVNP 1H0IA 1HF6A 1X6NA 2D0FA 3GH4A 1XC6A 3AMGA 4V2XA 1K6AA 1V3JA 4W8BA 3L4VA 3WD3A 1I75A 3WNOA 2DH3A 3AXHA 4F8XA 1JYNA 4JCMA 1UYQA 2XHYA 2NT0A 2W63A 3GNOA 2D20A 4GO9A 4UFMA 1E6SM 2XM1A 4WKFA 4WK9A 1VENA 5E9AA 4BS0A 4J3SA 3WENA 1E4IA 2E0PA 4AD5A 2D23A 2GJXB 1UH4A 4DM2A 4LXFA 1LLOA 4B9YA 3DYMA 1UA3A 1TG7A 2QPSA 3ZO9A 2WPGA 1GW1A 3GXFA 1QI0A 1MWOA 2X8RA 2WMJA 4Q22A 3M7SA 4EANA 3AMDA 2WZEA 3AS3A 3GH5A 4CD8A 4B15A 1E6XM 3AZSA 5I2UA 1PAMA 4GI8A 2CITA 1JNEA 3FAXA 2VX7A 4W8AA 3WQ8A 1HJUA 5AY7A 4ACYA 4GQRA 5A1AA 2WAGA 1XSJA 4P8XA 3WD0A 3BLPX 3IJ7A 2W62A 4M80A 3MMWA 4W88A 5HNNA 3EDDA 2C8NA 1UH3A 4H2CA 2F8QA 4XZBA 1CBGA 4D6GA 5HXMA 3WEMA 3UG3A 4OBSA 3PHAA 3CUGA 4MAZA 2DSUA 1ZS2A 1U33A 4MNJA 3VIHA 2WMIA 3BLKA 3LPPA 4HMEA 1E6NA 2VVSA 2WVVA 4RE4A 3WNMA 3SCTA 3AXXA 2A3BA 3FW6A 1M53A 2XWEA 3WD4A 1JZ8A 2BHYA 1CDGA 5D9PA 3BAJA 3AZRA 2VMFA 4HOXA 2DGAA 1ESWA 5FL1A 4BQ5A 3VU2A 4F79A 3W29A 4D1JA 2XTKA 2VL4A 1B2YA 4FLRA 2VT0A 2VRKA 4A3HA 4A4AA 2BY1A 5BXPA 3K4AA 2VCAA 3SCNA 5AYBA 1GQLA 4JKLA 2JEQA 1R85A 1K9EA 3VIGA 5A8MA 3SCPA 1JYWA 3VTRA 2ZUMA 4DUXA 1W3LA 1A47A 4URIA 1QI3A 3W0KA 1V03A 3DC0A 2A3AA 1M03A 2WSPA 1KXQA 1J18A 4C7DA 4PN2A 2XGIA 3MUY1 5A8OA 3ECQA 2DIEA 1XHGA 4KMQA 4PTVA 1OGBA 3IJ8A 2CIPA 2G41A 3EBVA 1ODUA 1GQJA 5BXRA 3WUBA 4XZWA 3FNDA 3A3HA 1O7AA 2X0YA 1ODZA 1CXFA 3VINA 1ZJBA 4HA4A 5JBDA 2YL9A 1C92A 2WHMA 1WAWA 3U57A 1DWGM 1BPLB 1IZJA 1TVNA 2VURA 3VIOA 4UQBA 2O9TA 2J25A 1R7AA 1J0IA 1ZJAA 2PWFA 4UFKA 3CZGA 2VQTA 3FHAA 2OYMA 2RGMA 1R86A 3AHYA 3PZMA 3L4YA 5BRQA 4M82A 4BCEA 4CN4A 3PTKA 3WF4A 3T0BA 4FMVA 3AYRA 3WFLA 3WL0A 3QOKA 3UETA 2FHBA 3K46A 4S3JA 1AQHA 4W86A 4PMUA 1DHKA 1UOKA 1CXEA 3GM8A 1WDSA 2YJQA 3U5YA 4ZEPA 2ESCA 3WDJA 4CCEA 1XYFA 3UCQA 1FP8A 2XWDA 3MV01 4MPKA 1RH9A 4CN1A 3T0DA 4QLLA 3ARRA 1US2A 2CKRA 4JFSA 4HMDA 1EH9A 3KL5A 3A4WA 4PSPA 2EQDA 1E0VA 1H1NA 3AFBA 4PMZA 1VB9A 4XX6A 2B31A 5DT5A 1EO5A 1FFQA 1G5AA 1QI2A 2DIJA 1LL6A 2VX4A 4JZ5A 3N11A 2XIIA 2WKLA 3S6TA 2QF8A 2UY4A 3FY1A 1FH8A 1QBAA 4AD1A 3CUJA 2IUZA 1I1XA 2J7DA 3ARXA 1DWJM 4UNIA 5KEZA 4TVCA 1MQQA 1W9PA 2DH2A 2VNCA 5A6MA 3RJYA 3QR3A 3VNYA 5LYRA 3WELA 1SYTA 4EK7A 1OCQA 2EPOA 4NRSA 4CN6A 1D7FA 1B3WA 4Z2HA 1XSIA 2A3EA 1HL8A 4AD0A 2ZOXA 1OT2A 3TP4A 1KGUA 2ZUWA 2WW5A 4AMCA 4HU8A 1V0KA 2ZWYA 3MSGA 3BAIA 4QP0A 3RO8A 3CZEA 1J11A 3ALFA 5EFFA 3AS0A 3OIHA 4QDMA 1QHZA 3FAWA 2YL8A 1M7XA 2YLAA 4OIFA 2CNCA 5ABFA 1ITXA 1TA3B 4P7LA 4RL3A 5A95A 1BYAA 1W1PA 4ZE5A 4JFVA 5C71A 3VIFA 2X2YA 3VUPA 3OGSA 1JAEA 4E4PA 1XD0A 3VO0A 2XVGA 1LQ0A 1XH2A 1JDDA 4PRWA 1C91A 3TTYA 3VIPA 1G9HA 4W7VA 2W91A 2WMHA 1TFVA 2J62A 4W5ZA 4F9JA 2QV4A 1C93A 2PF0A 1KR1A 4UQAA 1E6PA 3D3AA 3UR7A 6TAAA 2BVDA 4OZOA 1E55A 2EPKX 2DEPA 3B9DA 2QPUA 3AHVA 5I5RA 4X0VA 2DT1A 5JBFA 1PIGA 3N12A 3NDZA 2OSYA 5E0FA 5D4YA 4U3CA 3RIKA 1HVXA 3CHFA 1HP5A 5M5DA 4LYQA 3OBAA 4MTVA 2WVUA 3WH9A 2AMGA 4PTMA 1ZU8A 2WCGA 1GOKA 2VZUA 2G3JA 3VDBA 1UWTA 2JIWA 2J75A 3WQVA 4AD4A 1KBKA 1OT1A 3ZJKA 3NSXA 1H4PA 4CKQA 1UG6A 3WNPA 1Q6EA 1K9FA 1E6RA 1IV8A 4QAWA 2XVNA 2WZIA 2CESA 3TOPA 3BSGA 4MNMA 2J74A 1DEDA 2XYLA 2JIEA 1QBBA 4JIEA 3VDAA 4J3XA 4W8LA 3W27A 2PI6A 5A6BA 1KWKA 1J0JA 1KQZA 3DECA 1W9BM 3SUUA 1W1YA 3VIKA 3VNZA 3ZSSA 3HU7A 1QW9A 4GO8A 2WLYA 4GI6A 1GOMA 1J10A 4QLKA 1B3YA 1NH6A 4PMOA 2C7FA 1H49A 1C7TA 1JXJA 1WDPA 2XJ7A 3WY1A 1ZBCA 1KFWA 1KCKA 1EOMA 2Y8VA 1JD7A 2VJXA 2WVTA 1BSIA 2WMGA 5D9NA 3WUEA 2BY3A 3OB8A 3BMWA 1UR9A 5LA1A 1ZL1A 4LQ1A 4DWSD 1V0MA 5GQBA 1W1VA 1EO7A 5I78A 3AIRA 4WLCA 5A3HA 3UR8A 3GDBA 4GIAA 2RGLA 1FFRA 3OLDA 4AZHA 3AMKA 3WQWA 1E3XA 4WKHA 2DSWA 4DWSB 1UD5A 1QW8A 3W25A 4YPJA 1VFUA 5BXSA 2GK1A 3ARPA 4U2YA 1UD4A 4FLSA 1A3HA 3I3EA 4IPLA 1GHRA 4YHEA 3RMEA 5E6YA 1M01A 3ZT6A 1UKTA 1OGSA 3NYDA 3WQ6A 1E15A 4KGJA 2Q8XA 3THDA 4P8VA 3GXMA 3BC9A 1GQKA 3BCFA 4CCCA 3MMUA 2YA2A 1F4HA 4E8DA 1E6ZA 3W81A 3CZJA 3T09A 1OINA 1RPKA 3AROA 1FHDA 3VGBA 4D1IA 3A47A 4MDPA 1QNRA 1WKYA 1KGWA 1E43A 1CXLA 3ALGA 1G94A 3HN3A 3ARQA 1JFHA 1XGZA 4C7GA 2J7BA 4UCFA 4BQ3A 2W61A 5HPOA 4HA3A 3DHPA 1D3CA 1SR0A 2VOTA 3EMZA 4M8UA 3MU7A 4JCLA 2ZIDA 4AC1X 1P6WA 5BYWA 5I79A 2WK2A 1GOOA 5ABHA 3ZSTA 1HVQA 1ZBWA 1V3IA 2WSKA 3RPMA 3ARWA 1FH7A 3MKKA 1DWAM 2VR4A 2V3GA 2XFFA 3L4UA 1W9XA 4GQQA 1UA7A 4UQDA 3WUFA 4W85A 1JYXA 2O92A
chains in the Genus database with same CATH superfamily
4CU8A 3AQUA 2EJ1A 2VCCA 4JBRA 1D8WA 4DO7A 1IEQA 5I3KA 1UUMA 3VCNA 1PPIA 3H23A 3BGAA 4NZFA 1TZ9A 3HG5A 1PX4A 3H7UA 5DY3A 1QHOA 3VKKA 4LY8A 2V68A 2OLSA 4KFPA 5FD0A 4FR1A 4ES4A 5FCZA 3OVQA 1XFBA 1YRRA 4LV4A 4ZMGA 2XSBA 1WE5A 2Y70A 1ONXA 3HURA 3GHRA 3POHA 1UMLA 4B3ZA 1WDRA 3WQ5A 1EDGA 2GQ8A 1G4PA 3E9AA 1B4KA 2WVVB 1YEYA 3IK2A 1Q85A 2IKHA 4D6DA 1YXYA 4U5IA 1O5RA 3OQ8A 2PRLA 1WOAA 3DKLA 3T05A 3KRZA 4GQBA 2NVAA 1MZRA 4C6EA 3WCZA 3UVAA 4LVGA 4TXEA 5B7ZA 5I6SA 4DNMA 5A6TC 1A4LA 4MGGA 1Y5WA 2B0MA 1YMYA 4PMYA 2VWTA 3A22A 3SCRA 4PODA 2VFGA 3STGA 2JEPA 1MDRA 4PE8A 3PTQA 2W67A 2CERA 3FA5A 4AW7A 3N15A 3RK8A 3IAQA 5A2AA 5CAHA 1H41A 3OP2A 3WBAA 2QUTA 3BG9A 1H5YA 1TIWA 4AEOA 2G3MA 3IEBA 3HV9A 1B9ZA 1KRAC 1J0ZA 4FPSA 4J40A 2ISFA 3OG2A 3RU8X 1OFOA 4AVNA 4MAVA 2DQWA 3C2YA 4N42A 4DEFA 4IQLA 3C8FA 1KB3A 5L6UA 1PVNA 3CGTA 3W1QA 3IARA 1NDYA 1JGMA 4K1GA 3PAOA 4R5EA 3FDKA 1S2AA 2PWDA 3M5XA 1EIXA 3MP3A 3UA4A 4FIRA 1VKFA 1Q6GA 3VDCA 2FGZA 1XIDA 3M5YA 1K1DA 3SRKA 4ZOCA 4ZO7A 1OIMA 2OOGA 2ACRA 4QDPA 1PS9A 2H9AA 3OZPA 3TEVA 1ISXA 2Y61A 4ICNA 1XG4A 4ZL1A 3WF1A 2PP0A 2QULA 3T55A 1O66A 4MLJA 2NT1A 3GWQA 1P48A 1UKOA 1A4MA 4MDOA 4BZYA 5DQPA 3WJSA 3AUJA 4NQ1A 3LLXA 3GZ3A 4HKPA 4RNJA 3IJLA 2D2JA 4IZGA 3GVRA 2XIOA 4O18A 2ZXAA 3IS4A 4IUOA 3CV1A 2VC9A 2PU1A 2OTDA 4G9PA 2ISWA 1M04A 5I00A 3UGVA 2REQB 5EY5A 4D8LA 1LRQA 2GSJA 4EXBA 3CQKA 4BEUA 3LS9A 4QLJA 3VDGA 1VBHA 1GUVA 1WZKA 2BHUA 1FH9A 2I5GA 1BF6A 1F3EA 3ONCA 3VGGA 1TCMA 3U0HA 2HEJA 2PTDA 2TODA 1B57A 2XGZA 2YYTA 1XICA 1YPIA 4IQJA 5J5DA 2IPFA 4UR8A 2ZQ0A 4HNCA 1LRTA 1N55A 1XLFA 1V0LA 1KLYA 1PJ9A 4AZCA 5E9XA 2QUNA 4UNKA 4N02A 2OVLA 1VBJA 3PN8A 3EYPA 4ZQPA 2NQHA 4F9DA 4IP7A 4UMBA 3NG3A 3KBSA 3URAA 5I3GA 3DFNA 3TN5A 2ZUNA 3OYZA 1OADA 2ZDRA 2Z24A 4S3BA 2VUNA 3C2VA 2VCBA 3BCDA 5T26A 4FSAA 5M2FX 3VNKA 3W7EA 4S3KA 3IRDA 3KHJA 1TPFA 1H5VA 2HVOA 4MHBA 2PDCA 3GH7A 3AIQA 1U30A 1OYBA 1W9DM 3VAVA 3W23A 1FY6A 2KX9A 2PLKA 5FAJA 2ZZ4A 3CAKA 1J5SA 4LV9A 2QW5A 4IL0A 1W3JA 1WYIA 4EAMA 5LNSA 3QN3A 2VEGA 2QCMA 4J7RA 5AYIA 1JR1A 1MRAA 2DZVA 1YQ2A 3MP4A 4RZBA 2YXOA 3G0UA 1KBBA 4DZIA 1SZRA 2E6YA 3F4CA 5G4WA 3O63A 4LTSA 4OUEA 5HWMA 4B3LA 4A8NA 6PTDA 5KZEA 4UTJA 1VYSX 3NCOA 3KRBA 4H9ZA 2WANA 3KOYA 3CHEA 3SUVA 4IM4A 3W2KA 4O12A 1UC5A 1I2RA 1OM0A 3C2EA 5HBFA 2UY3A 4DX3A 4B5WA 3W7OA 1UQZA 3E96A 4RZ4A 2OWWA 3G3MA 3HMCA 4OOUA 1VS1A 3WNNA 1BWKA 3GG7A 4NP7A 3WK1A 5K9XA 2J7CA 1RA5A 4LUJA 3QPEA 3ZR6A 3SW6A 3AS2A 4GVHA 1VP5A 4KKXA 1HJSA 3VFCA 4CQAA 2Y4SA 3VE7A 3RM9A 1OCBA 1F3TA 3TNBA 3TYCA 3O6CA 1EEXA 2RJHA 1KRBC 4D6JA 3P0WA 3HPZA 3VGDA 3VVGA 4GI9A 2YL6A 1G7VA 3ABSA 5CC5A 4HK7A 1PZ0A 2GQAA 1J0HA 2OYKA 1X6UA 3UYIA 4IGMA 3HZ3A 4LCRA 3TJLA 3AICA 1KM6A 1XV8A 2GUYA 1PX8A 3WQFA 5FSDC 4Y6GA 3I10A 1U1JA 3BURA 3C8NA 3C0SA 3R1ZA 3CH0A 2YBUA 3CH9A 1ME8A 4GFIA 5BWAA 3BZGA 2VZSA 1H7NA 1EBGA 3KL3A 4QEHA 1HKIA 2Z6IA 3CK5A 5BNKA 4G7EA 1L8PA 1SZEA 1Q2SA 1W1IE 2BLEA 1RLDA 2YA1A 5G2WA 3ARTA 4S3EA 3M6DA 1W9UA 1XH0A 2C19A 4CVUA 2JK2A 4K6AA 3W86A 2G0WA 5HQEA 3FKRA 2GVJA 4DM1A 4P7NA 1YDYA 3CQIA 2Z00A 3HGJA 1OBAA 2PWHA 2F2HA 2DSZA 3WDHA 3FFSA 1H11A 1XRTA 3R4IA 1G7UA 4W4QA 1CGXA 5CPLA 2PMQA 4X3ZA 4C6DA 2UV8G 4HYVA 2WNWA 3T08A 4WRHA 2WNQA 4CQ8A 1EWEA 1V3LA 3ZJ6A 3SB0A 1CIUA 3R8GA 1L0PA 3UWVA 3GTFA 1PWLA 1DJZA 2EKCA 4HCLA 1EDTA 1GOQA 1OX6A 2CYGA 3HPFA 1HJVA 1JFXA 4FA3A 4NU7A 3N2BA 3PK7A 4AYSA 3MANA 1QATA 1XD1A 1P4CA 3SI9A 1L6FA 3AHZA 4LYKA 4JTHA 3RR1A 2CFFA 3QHOA 2VELA 4PUUA 1FXPA 4DI8A 1S46A 4QCFA 3MO4A 3IWPA 2A4AA 1VFFA 1V08A 2QUMA 5CLWA 3I6EA 2BV9A 1JUKA 4OUIA 2EKGA 2PDJA 2HBXA 4AHPA 3RNDA 3IIVA 3PSVA 1B0IA 1M5WA 3KVKA 3H54A 1K4GA 5DXYA 1SO3A 1CT5A 2GGIA 3M5ZA 3HB9A 3TX9A 1JQVA 5CSSA 4PUDA 4IGHA 3LEPA 2A85A 3HV8A 2HROA 3GNRA 5G4EA 2Z25A 1OZMA 3T2PA 3NGJA 1GG1A 2G4FA 4O11A 1JZ6A 2OG9A 2H3BA 1RALA 1HP4A 1XW8A 2YIHA 2VC7A 4GOAA 3SQLA 9CGTA 1KM3A 1SPQA 2HZGA 3CC1A 2X7VA 2CETA 3NQDA 3KZSA 4O0ZA 2P0OA 4M6VA 2CZ5A 5DO8A 1IR2A 3W7CA 1B90A 4HN8A 3MVIA 4DF0A 1OC5A 2GJXA 3PG8A 4B90A 4Z2LA 3GHTA 1Q5MA 3QXBA 3G6LA 4C6CA 2ZZ1A 4CU7A 1QPKA 5AC4A 1BAGA 1W8GA 4UMAA 4L6OA 1ZENA 4JYDA 1DIEA 4LEFA 1GG0A 3M9YA 1HT6A 3SQMA 5AB3A 1V6WA 3U7VA 3B9AA 3GUGA 4D71A 4LBUA 1PB0A 3BAYA 3I3DA 1GHSA 1FHVA 4KCUA 3KDNA 1AVAA 1J12A 2Z1BA 1DJWA 1CWYA 4RDYA 1YTKA 3VOGA 3SRHA 4DJEA 4DQWA 3HF3A 1LL7A 4DF1A 2QJJA 5EMKA 3WBEA 1W3TA 2V5BA 3A4XA 3W7GA 4BQ2A 5H2ZA 2WCSA 1BYDA 2X1TA 4OKDA 5C9RA 1V3HA 5G4HC 1PL9A 4K39A 4LNCA 1T6MA 1L6WA 3EEGA 3LERA 3NIYA 4W9TA 2X1IA 3GIPA 4P8UA 2DW6A 3S9ZA 4KRUA 3Q65A 1OFPA 4NXSA 3AO0A 3S42A 3Q45A 4MMWA 4IJRA 4YYCA 3N1AA 3GDLA 3CO8A 3WJYA 4C1LA 3M0KA 1CLKA 5C54A 2PURA 2GUBA 3CXOA 2WKJA 1A50A 2OLHA 1GVOA 3SGGA 4LUYA 2EG7A 4JY9A 4JXCA 4Q6XA 3LN3A 2CZDA 1HX0A 2DW7A 2J24A 1ZAJA 3AU6A 4PMNA 4RX0A 3QW4B 1SVDA 2P3EA 2Z29A 4K8HA 3ZVHB 3MZ2A 4IG2A 4FF7A 4N9CA 4OHQA 5C2GA 3N29A 1JL8A 1ZCOA 5D9MA 2POTA 3G1YA 3DFTA 5KSWA 5LIXX 1PSCA 3F7JA 3GW3A 4JTTA 1C8XA 1V51A 3K1GA 1VFMA 5CKSA 5HWJA 1FWGC 3C0QA 3S47A 2V3EA 2XFRA 4RLIA 4NUWA 3H12A 4EPKA 2J7FA 4EAYA 3UWZA 1TR1A 1EQPA 4C1KA 4OFCA 3A9BA 1TELA 4WJ8A 2WC7A 2BX7A 2WM0A 4JTKA 5JUVA 3I65A 5CPSA 3UG5A 2Q8LA 3FDGA 4IFKB 5H6HA 4HSHA 3GXIA 2CLIA 1R3YA 1V79A 2H3DA 1SW7A 3AYSA 4MADA 1OK4A 2TRSA 1JDAA 3WLHA 3RLGA 5F2IA 1S5WA 3ZT7A 4WKAA 3OODA 4Q32A 3CNYA 4OGZA 4B5SA 3OGRA 4PUEA 4AWTA 4V27A 3BOLA 2G3NA 1I9CB 4NYUA 5CSUA 5T91A 1BF2A 4M29A 4Q8UA 1MW0A 3VOCA 4N9BA 1Q6FA 4HPNA 1EA9C 1HGWA 2YCLA 1UR8A 3MHGA 1BKSA 1J6PA 1GPFA 4AZ5A 3WH8A 4CNNA 3SCVA 5IFPA 3VMNA 1UKPA 1P6BA 2IXVA 3GS6A 3OLIA 5CPOA 3VM5A 1W8SA 3BW2A 3SGZA 3EPNA 2O9OA 5D03A 3APTA 4GC4A 4UOQA 3VOHA 3RITA 1KFBA 2OFJA 4O4VA 4HA1A 4ZODA 1SQ7A 5FJIA 2CBVA 4S23A 2POZA 1W1A1 1QR7A 3O6AA 3W4RA 2W27A 1ITCA 1SO6A 4CGTA 4HYRA 4ZGYA 3TIMA 1UZ4A 3GTNA 4Q4KA 4H4IA 1KFEA 4Q8NA 1MXGA 3S9YA 4WDUA 2HQAA 2V69A 4FXFA 4MUZA 3GQYA 4P61A 1JQXA 2VEKA 3S1UA 5IHSA 1TVPA 4O1CA 2OR2A 4MYXA 2P88A 3ABRA 3T2QA 2PP1A 4NNCA 2YCEA 3VE9A 5HATA 1ONRA 4HTBA 3FGCB 4L9YA 1FWDC 3T8QA 3UZZA 2YCJA 5XIAA 5A5WA 3GR4A 4Z0SA 1VBUA 4I9AA 5H8MA 1QOPA 1Q7ZA 2OEKA 4A8LA 1QK2A 5K2ZA 7REQA 3I4KA 4XBSA 1LG1A 3EX6A 4KEUA 6ENLA 2A3LA 5HR6A 3W75A 1P43A 2BFGA 1FWRA 3GIYA 1BVWA 2PD9A 2ZUVA 4IJCA 4LS1A 5GNXA 1VBGA 5J8LA 2V63A 4XKYA 3S9IA 5CBIA 1R7OA 3QRHA 4N6FA 2W4XA 1PDZA 4X0NA 1RVGA 2V3DA 4LU0A 2E9BA 1BLIA 3W1MA 4KRTA 3PJUA 5GNYA 2L5HA 2FHFA 4IF2A 3H53A 5DCEA 3I7SA 1LJYA 2A3CA 3E2SA 4AFYA 2AL1A 1U5VA 4HTYA 4JGDA 1JG9A 3PFMA 3L4ZA 2IXUA 4JFWA 3PG9A 1GW9A 3TQKA 1NWUA 3TK7A 3T0TA 1VLWA 4FOKA 3C56A 3VIJA 3SM0A 2QEZA 2QDDA 4U31A 1EFZA 4KWUA 3AOFA 3A4JA 2PWUA 3LMYA 4CD7A 4AXNA 1ENUA 1XKJA 2VHLA 1HKKA 5H91A 3FHQA 4CCZA 4LAUA 3WMLA 4NSBA 1JPHA 3GIQA 4O14A 1EYEA 3LNMA 4CNSA 4RUBA 4HK6A 4PEEA 3F2DA 3ES7A 4XD3A 4JL2A 3D6NA 4CQDA 1Q45A 4PBFA 3ELFA 3TROA 4ENLA 4WF7A 6REQA 3PTDA 4Q4PA 4J3VA 3O06A 6XIAA 1RP8A 4J2PA 3SIMA 3DHFA 3SEPA 4Q4RA 3GG0A 1GVYA 3DFSA 3IAPA 1QDSA 5FEZA 3O8AA 2HDJA 1YNYA 5K3VA 5CSYA 3OEXA 3F1QA 3QV7A 3N25A 3ZT5A 1YDOA 1H0IA 2HMCA 1HF6A 2FKPA 1XC6A 2IQ0A 4V2XA 4GBUA 3C52A 3WNOA 4JCMA 3L5MA 1EP1A 3AYTA 4UFMA 3E0VA 1RQBA 4GY1A 4WK9A 4DBUA 1VENA 5SWUA 3WENA 2HJPA 3NL6A 1E4IA 1R3TA 2E0PA 2FB3A 2V82A 3B0PA 4EPBC 3LMZA 4B9YA 3TSMA 5G2IA 3MY9A 2H8ZA 1GW1A 3GXFA 1AODA 1MWOA 2X8RA 4DO4A 3VXGA 5LHEA 1UP2A 1JCLA 2O4MA 3AS3A 5M1TA 2G97A 4K1WA 4KBXA 1XBVA 3LRKA 1HKWA 4AG0A 1JNEA 4B5TA 2VX7A 2F38A 1MO0A 3MVTA 1XLAA 5C9WA 1WXJA 3RX3A 3BLPX 3SN4A 1KCZA 3AXMA 1AMKA 3HG3A 3PF3A 3B40A 1CBGA 2FZMA 4MWAD 3TSDA 3PHAA 2SFPA 1T5AA 2EGZA 1XQLA 1POKA 2OO6A 2PDNA 2DSUA 4O13A 4NYYA 1M41A 5H1WA 1SUXA 3P84A 2R9RA 4WDTA 1E6NA 2VVSA 1TR9A 3STCA 4RE4A 3M41A 1TPUA 2XZ9A 4ZSTA 2A3BA 4QS6A 3LZ3A 1RY0A 3TVAA 4IMFA 1Z9AA 2BHYA 3AJXA 1NDVA 2QGYA 3QGAC 1TPEA 2VMFA 2YZRA 1EJUC 2DGAA 1FWFC 2I9EA 3VU2A 5D37A 2ZA3A 3H2AA 1MSSA 3QMSA 5BXPA 3R12A 4PMJA 4I3GA 3O7UA 4H6EA 1GQLA 4JKLA 4JTGA 2PDHA 1K9EA 3VI2A 2J9XA 1Y8BA 2X42A 4FNPA 5TQLA 1XBYA 4D2JA 3W0KA 1UPPA 1XM3A 2PTZA 4L9ZA 4F0RA 4RKAA 2XH4A 3WLJA 4F2BA 2R1KA 2XGIA 4C6KA 2YX0A 2A5HA 3ECQA 2DIEA 1WBHA 1OGBA 2G41A 1EJRC 1Z8AA 1LP6A 3FNDA 1TWIA 4D8AA 1ODZA 3VINA 4I5XA 4F3HA 5JBDA 2VC6A 3EB4A 2UZ9A 1BPLB 2VURA 4UQBA 4U4MA 2O9TA 2J25A 4KW2A 4JTSA 1K8XA 1J0IA 6ALDA 3R8RA 1ZNNA 3PJXA 3NQFA 3U3HA 2P3ZA 1DE5A 1I6NA 1TE6A 5BRQA 1IEWA 3P7YA 3PTKA 3WL0A 3WFLA 3UETA 4WXYA 1PTAA 4S3JA 3LK6A 3W7DA 5HJLA 1ALDA 3NWRA 2BZNA 3U5YA 1XYFA 3ABZA 3UCQA 3MV01 3PPHA 1EX5A 2CKRA 4X61A 1Y5VA 4Q3MA 5G5IA 3MUXA 3KL5A 2WV8A 1P0BA 4XD6A 4P5UA 3HMJG 1E0VA 5I3IA 1DPMA 1WUFA 1GVQA 1H1NA 2EF9A 3B8UA 3PUOA 2B31A 3BQ6A 2YXXA 2ZRXA 3FOKA 1UR3M 1T8QA 1PUDA 3CL7A 2CW6A 2XIIA 3HJZA 5LIUX 3CUJA 2A7RA 5FEWA 3LLDA 5KEZA 1UPMB 5AOUA 4TVCA 1MQQA 1GZGA 2VNCA 2Y7GA 5A6MA 3RJYA 1UUOA 1RXOB 1DIOA 4YXGA 3E0LA 4ORMA 1B54A 3HG2A 1LTDA 4YL2A 1TX2A 3LY0A 5CGQA 5HA7A 3E5BA 4XO7A 4AMCA 2EJAA 3BAIA 2H8XA 3RO8A 3UPBA 3S6DA 3OIHA 1O1ZA 5IM51 4H7ZA 5EKYA 3T8LA 2YL8A 3UCDA 4OIFA 2O7SA 1EP3A 5J04A 2HXTA 5ABFA 1ITXA 1XLDA 1BYAA 4ZE5A 4JFVA 1MUWA 1S1RA 3VUPA 2V0TA 4JNMA 1VCGA 3PJTA 2DUAA 3WQPA 2PZ0A 3WQCA 1TV3A 3ZXWA 1M7JA 1LQ0A 4GLEA 4PRWA 4NAFA 3VIPA 1I0BA 4W7VA 1VPXA 1LT8A 4B2DA 2J62A 1C93A 6TAAA 1GZ1A 2EPKX 4PTDA 4X0VA 2PGEA 1W31A 2FIQA 2DZSA 3Q94A 3H4XA 1HVXA 2B7NA 5M5DA 4MTVA 4UBPC 3WH9A 3GG1A 2AMGA 1ZU8A 5C9ZA 4GVGA 2G3JA 1UWTA 2GDQA 1G67A 5CAKA 4QE5A 3ZJKA 3DDMA 2QCLA 3BDKA 4CKQA 3WNPA 3HOJA 3WJZA 1WXYA 5D09A 4PC8A 1S2CA 3TOPA 5BZAA 4XAPA 3I6TA 2JIEA 4GUFA 4J3XA 4JX6A 4LRTA 4XZNX 2ZTKA 1E9ZB 1KWKA 3EOUA 3HG4A 1W9BM 3MI2A 1W1YA 4I9TA 3P93A 2Y7FA 1MNSA 3ZSSA 2HSAA 4YCOA 4GI6A 1J10A 2C7FA 1C7TA 3QYQA 3V5FA 3WY1A 4ZB0A 4EF9A 3PC0A 3NZPA 2Y8VA 4MWAC 1BSIA 1HO4A 1XJBA 3I68A 4PCNA 1Q65A 1UR9A 1ZL1A 1Y5XA 1H1ZA 2BASA 4JDYA 9RUBA 3AIRA 4WLCA 2FMOA 3UR8A 2RKXA 4J4KA 1E9YB 1R3QA 3WQWA 3IV3A 4L56A 1UD5A 1QW8A 1VFUA 5GJPA 5BXSA 1TREA 4U2YA 4IP5A 4UTLA 3ZR4A 3GXPA 4YWIA 1HUVA 1GKQA 4IPLA 1NDWA 1TZZA 1IEXA 4HQVA 1GKPA 4QG8A 4GC3A 4QJ3B 5AC6A 4Q8TA 1EGMA 1E15A 4KGJA 2Q02A 1W6TA 1X97A 2DZAA 2YA2A 3W81A 4Q33A 3W2UA 3WBYA 3VGBA 3OA3A 3HQOA 1P5BA 3EWBX 4KETA 1KGWA 3ALGA 2QJNA 3VKAA 2VD9A 3CUZA 3ARQA 4C7GA 4E8GA 2J7BA 4UCFA 2Y6ZA 2W61A 4X60A 4HA3A 1SR0A 4XD4A 3MCNA 5HNRA 1GVSA 4L64A 4AC1X 3QC0A 5F4XA 3QV8A 5ABHA 2E5DA 3ID7A 3G1AA 3CMFA 2WSKA 4B5UA 3E74A 2R1PA 4R34A 3KP0A 3MKKA 2CLKA 2XFFA 2V3GA 4R9OA 3BMXA 1UA7A 3EOOA 2QR6A 3OZYA 3L65A 1NDZA 4P7OA 1VJZA 3F2CA 1F76A 1GOXA 3W37A 1VCVA 2DZTA 2YDRA 5BROA 3L0NA 3TXVA 3P14A 1K77A 2YDSA 4UZSA 1MUMA 3TWAA 1V3KA 4JHMA 3JUGA 3O05A 1E0TA 3C3NA 2QF7A 5AECA 3GHUA 2OMAA 3NO1A 1K7EA 1LF1A 1R2TA 4XAYA 3R13A 3QFEA 1SM9A 1SFTA 4A05A 5ABGA 3LTSA 5FAGA 2FVKA 3CMGA 2WMIB 5AVNA 1XYLA 5LGXA 4MWAE 3WF0A 2OYLA 4MIMA 1W2PA 2OGJA 3C61A 4M19A 3IJQA 2D22A 4PMXA 3FN9A 3QY7A 2G95A 4RE3A 3THQA 1AA1B 1VFOA 4H6KA 5BMXA 4IIDA 1E40A 1H7XA 4GVIA 3R43A 3ITYA 4LYPA 1OB0A 4XZIA 1W56A 1IXPA 2CCRA 3DFPA 1L2QA 3RRXA 2P5NA 2PCQA 4A29A 1I2QA 1KQYA 1B3XA 2QIWA 4O1AA 4S2CA 3VD9A 4WIWA 1QNPA 3B05A 3ATYA 3QH2A 5HJXA 1C29A 3G5EA 4WJXA 2GJRA 2Q71A 3GFZA 4DZAA 3DH7A 2WHLA 1JYVA 3V1PA 3ANYA 5BWFA 4O1FA 1UR1A 3XINA 4IMAA 1F6YA 2WBKA 4JS3A 1DXFA 1RHCA 3NUKA 3P74A 3REQB 3UJSA 1REQB 3BAXA 4IMCA 5C7HA 3UERA 1QCWA 1OJXA 5BCAA 3LHUA 1NVMA 4Y9MA 3CO4A 3B8WA 3P80A 1XS2A 4MKVA 3TU9A 4HNLA 1JD9A 5D33A 4CVWA 3AIVA 1K7FA 4C7FA 3K8MA 5DF0A 3TXZA 4GINA 2FPVA 4GYPC 5TAOA 1RZMA 4RXFA 2ZYFA 3BLEA 1XYCA 2R6OA 1PZ2A 1AFSA 3FS2A 1AUSL 2FVLA 4HPHA 3WMBA 5F1VA 3URBA 3TFCA 3E0FA 1JRCA 1JPMA 1VYPX 4LUSB 3CIXA 4X63A 5F2LA 4AIOA 5JIWA 5DMMA 1A3WA 3S1WA 1TPH1 4N4PA 3H24A 4JTFA 1GORA 1UWAA 5TF0A 1RJPA 2W9MA 3W1RA 2EPNA 2ZX9A 2DSVA 1MW3A 1SFSA 4M7TA 1XIIA 3SDOA 2J8GA 1X7FA 3GDMA 2Z1SA 2CXGA 2JQXA 5JVLA 1AK5A 4JYFA 2WB5A 1UBSA 3TV8A 3LZ5A 3LOTA 3M0XA 2V5KA 4GUHA 3THCA 1CENA 2BDQA 3W7HA 3RAOA 2NX1A 2Q09A 4Y8FA 3QZ6A 1XLKA 1OG0A 7XIMA 2Z7GA 3TJIA 1O6IA 1S5VA 3KBNA 4ZTYA 1EJWC 5L9FA 1OD0A 3S1XA 1P6CA 4MLRA 1WAUA 2ZFAA 1EOKA 3R58A 5JXQA 1O60A 3KEHA 4ZO6A 3WZ0E 2QMJA 1NU5A 4JR5A 1ICSA 2V6AA 2ZWZA 5G1TA 3N19B 4O52A 5A6SA 2V3FA 3BWWA 4K2SA 4GGBA 4ZCWA 1LOLA 1W1TA 3PBGA 3VD4A 5D8WA 1VH7A 4EACA 4QE4A 3M47A 2NXGA 1BWLA 3E2QA 4GPNA 5I77A 2NVCA 1KFKA 4JIHA 3EDJA 5LXEA 3ZMRA 1E1EA 4BHYA 3C86A 3OBEA 1DWIM 1FCVA 5C2CA 4W93A 5CZSA 4Z17A 2ZRWA 2XGBA 5REQA 4M24A 4KWOA 2Q3OA 2Q3RA 3C0JA 4MJ4A 4PUWA 4ZQNA 7REQB 1UD6A 1E9IA 4JTQA 3LI1A 1MW2A 5A6BD 1XYAA 2DPEA 2QYGA 2HV5A 3SN0A 3W6YA 1XLHA 4TVUA 4ML9A 2ZZ7A 3WD1A 3IPWA 1E5NA 2V5DA 4UTUA 1ZBVA 4CNTA 2Q01A 2ZBTA 3II1A 3PUDA 1OFAA 3MDUA 3RILA 4E38A 3VIIA 3P81A 1DHPA 1XLGA 3NQ2A 3N6HA 3LB0A 3M0LA 3WUGA 5AYXA 2J88A 3TA9A 4PBEA 1TJ2A 3M0YA 2DJXA 2XPKA 1G01A 3K4WA 2ISSA 3OLEA 1NP0A 4JIIX 4HPXA 5LKYA 3KDOA 2V67A 2FJKA 4AEEA 4HPGA 3RU6A 3M0MA 3EXTA 1PEZA 4PCSA 1TSIA 3TNOA 4RCXA 2GK1B 1BSLA 1E70M 1RD6A 1V6YA 2PSNA 1IXQA 2EG6A 4CNUA 1TCDA 3LDVA 3R11A 4PB3A 5FJOA 4TVDA 5HOSA 4CQBA 1I0DA 4UTIA 4G5DA 4I90A 3PWIA 5E0CA 3LPFA 3K8LA 5JQ9A 2C91A 4PFMA 3K30A 3FYYA 3L2MA 5AKQA 2NQZA 2XINA 4ZOBA 1EHAA 1VAHA 4K36A 1TJ0A 4W89A 4TTUA 1FWIC 1XI3A 2INZA 1AQ0A 3S6OA 1PV8A 2J4GA 4G1KA 1MQPA 3WD2A 5IHRA 1RD5A 1Z32X 3EMQA 3TUUA 2GUUA 1GNXA 2AQVA 4RZ6A 3SCOA 3ICJA 4Z1AA 3KBJA 1O5XA 1C9DA 2W5FA 2P1FA 2VVNA 4WSKA 3MYOA 1UR0A 4KCVA 5ABEA 4ICMA 2HPIA 4XZLX 2TPSA 1UWQA 5JH1A 2YDQA 1FOBA 1O68A 2CWNA 4P7QA 1A49A 4DJDA 3CMJA 1H0GA 2IKIA 3T1GA 4G8TA 4JTIA 2PBGA 3E02A 4PR4A 2ATSA 1CGVA 1J2WA 3JS3A 5BOEA 4UIOA 2OJPA 4QEEA 4E3VA 3PZIA 3O16A 2WBGA 3W38A 4LUIA 5D30A 2XG9A 2WKGA 3SY8A 4J9JA 3NJ3A 2J6XA 1Z6KA 4JEQA 2D2OA 5HJYA 1PWMA 3GBEA 3VK5A 1SMDA 3R2GA 4NRRA 3POCA 1JZ4A 2I17A 3MKVA 3W72A 1VIZA 1VPYA 5CPTA 4UUIA 4B16A 3GX9A 3VD3A 3BUVA 1JPIA 3GNXA 4BF7A 4D6EA 2QMKA 3CV2A 4FXSA 1JZ5A 1EDQA 4INFA 4UFHA 1VEOA 4FNUA 4IIHA 1H2JA 1UIOA 3DGBA 5A8NA 2V38A 4PL2A 4RPPA 2IKJA 5EMYA 4RE2A 2ZXBA 1Q2RA 8RUCA 1JVNA 4UOJA 6CGTA 5FEPA 3ORWA 4H8UA 3OZOA 3S8HA 1SSDA 1T0OA 4HCHA 1LBLA 4D72A 4FZIA 2J9ZA 1LRNA 4XZMX 3S5NA 4ACZB 1S38A 2A0NA 3S83A 2WQPA 1MVYA 4X2PA 2DORA 5J5RA 1BTCA 4F0KA 2YOCA 3P61A 4Q4MA 5AHFA 1DOSA 3K13A 4AB4A 1DV7A 4DXKA 3AIWA 3FXYA 3WX7A 2J27A 1HJXA 4LAZA 2DSKA 3UWUA 1GQIA 4PRRA 1D7KA 3BLDA 2EG8A 4AZBA 3E12A 1MW1A 3PANA 4JQ1A 1GPWA 2F6KA 4MFEA 4C1NB 1S3HA 1EYWA 3CHCA 1V6XA 2BY2A 2QIIA 2VEIA 2ABAA 1NJJA 4NJIA 1F74A 4YTTA 1HJQA 4GXPA 1WKDA 3LV5A 4E0CA 2PDQA 1IZKA 2X05A 1OWQA 3P5ZA 1UP3A 1J0YA 3QSRA 3KUMA 1PCKA 5CJMA 5EPDA 2WWCA 3HPXA 1QJWA 2C71A 3EX2A 3MO7A 4KEMA 3CM4A 2I56A 5BU6A 1XIEA 1Z44A 1VFLA 3W7IA 4R7WA 2PTYA 1P7TA 2AGTA 4K7VA 1KM2A 3ERPA 4YHGA 2J6VA 1ZZMA 4ILSA 3K4DA 1CXIA 1IT7A 2FZ8A 2ZX7A 4NIRA 2J13A 1M7OA 3M43A 5HNTA 5M17A 4C6PA 3WLOA 3VCCA 3LQGA 1UWUA 2ZE0A 3DFYA 1JF6A 1PKLA 3DENA 1G4EA 1E3ZA 1NWSA 4IP4A 1W5MA 4C90A 1R2RA 1C8YA 4PGLA 3W7JA 4O53A 1R9YA 4H83A 4PMRA 1NOFA 1C7SA 1XC4A 2PA6A 4RK8A 1R46A 4GIEA 4FS9A 3AHXA 2JALA 3QPZA 4IGNA 4CEXC 1YTDA 3UWEA 1KFCA 3VPLA 3KE0A 4V28A 4XZHA 4PL1A 3STFA 3MC5A 3W1UA 1PIIA 2QCNA 3IUIA 3GG8A 1R3VA 2WC4A 2WSQA 1XLEA 3GZAA 1DJQA 4GG9A 3VGHA 4RDVA 1LQAA 2QDEA 5EMLA 2EO7A 5BRPA 2Z4GA 3VKCA 1ZALA 1ZP4A 2INFA 3BW3A 1U22A 3W2NA 4HNNA 1J0KA 3OJGA 3GDTA 3MA8A 1JI2A 4OVXA 5A94A 1Q8JA 1DJNA 1QT1A 1V93A 4FOUA 3QHNA 2OEJA 1A53A 5HQLA 5EL1A 4UQEA 4W5UA 5F7UA 1C8VA 1IXOA 1GQNA 3QBUA 3QGVA 3KBWA 2VZOA 1HO1A 4C5ZA 4NX5A 4FLQA 4QM1A 1FDYA 2HCVA 4UOZA 1CPUA 3MMDA 4IIBA 4HA0A 4KIRA 3SCSA 3UZ5A 2FH6A 4QFUA 1WV2A 4AH7A 4L80A 2XSXA 5DMLA 1VD6A 5AYZA 2VI0A 3HPAA 1NELA 1XCXA 5ECUA 1XIMA 3NO3A 4N9EA 2P53A 3FVDA 1GVIA 2E09A 5DN1A 2C13A 4AIEA 2X09A 3N73A 4C6JA 3UW6A 4Q7IA 5AHEA 3W1LA 5CC7A 5I24A 1V7YA 3GE7A 3UNDA 4GZJA 3HQPA 5I02A 1HN1A 3D47A 1OC7A 3AMLA 4E2OA 8XIMA 1TV7A 2Y2WA 5DCDA 4DUWA 1XWYA 3LQLA 2W3ZA 1VCFA 1PIFA 1BTMA 2YFOA 4C65A 4AQLA 2EXOA 3N2XA 3GUWA 3TN4A 4XTIA 3G18A 4WOZA 3UESA 3CQ0A 3RGTA 3DIPA 1X7IA 4PMDA 1AH0A 4OBTA 4PMQA 3WLIA 1PTDA 2DT2A 5IBXA 3MS8A 2BGNE 1CLVA 3L67A 2NXIA 2XVPA 1RBLA 2Y8KA 2W0UA 2NLIA 1VIWA 2DFAA 3KBMA 4JIRA 2GDVA 4O57A 3A24A 3LHZA 4A8IA 3H2FA 4LCSA 3VD7A 4YWSA 2XH0A 5CPQA 1DIKA 4O1BA 3G8EA 4N2YA 4LANA 1YIXA 5B80A 4I6VA 3UR2A 1TRDA 3WBWA 2AKZA 3J7HA 2D73A 3CYJA 3DYPA 4KFNA 1YADA 7ODCA 5A8PA 3WMCA 3UEQA 3GO2A 5FJUA 3HBLA 2BY0A 2P8BA 3D46A 5LIWX 5LZLA 4F40A 5LNWA 3HFTA 3TJXA 3P67A 5DT7A 2RH9A 5TD4A 3WK3A 1TA3A 1ONEA 1FA2A 3C4UA 1R3SA 4E2DA 3CASA 3NM3A 4Z2IA 2YA0A 5CG0A 3ANUA 3OW1A 5CZKA 3T44A 3APGA 4GCXA 3GTXA 1PXGA 3WNKA 3HM7A 1TO3A 1AD1A 2X0HA 3WLMA 4HP5A 3I7QA 4JNZA 9XIAA 4GJJA 1E4NA 1R5YA 1GWJA 3NZ1A 3PNZA 3O6YX 5FF4A 3IANA 3QM3A 4BA0A 1JZ3A 4LW7A 3KOXA 4IPNB 3UF9A 4OE7A 5HMDA 3NTYA 3SJNA 3ZJ7A 4UB9A 1JCJA 2XFWA 2XISA 4K37A 4LAOA 1R3WA 3SSZA 1YLVA 2FPTA 4A35A 1JXKA 1UIPA 1BRLA 2FB2A 3RRAA 5LNVA 3TYBA 3QMRA 1V02E 2D2HA 4WY0B 3EEZA 3M46A 4GBDA 3AISA 2PWEA 4NX0A 3E0WA 1YXCA 1CI1A 3IJ9A 4LX4A 3KLLA 1H51A 1WKEA 2Y63A 2ICSA 3S4TA 1K70A 4LAKA 4ICCX 2WHJA 1WPCA 1ZGDA 2F84A 2OSXA 2E77A 1EA0A 1QAPA 4DBEA 1XYZA 4RE0A 3BSHA 4HYWA 4PUJA 1EC8A 3USZA 4GXMA 3ENLA 2FH8A 3TCSA 2OODA 3WEZA 4HU4A 3GNNA 1E1CB 1JF5A 3W6MA 5HMFA 4DZ5A 4FIQA 4IFOA 2NZLA 3VIMA 3CPUA 3VZZA 1A80A 1X1NA 3TQVA 5LIKX 4PBGA 2KAUC 3GR8A 4L4PA 3W71A 1D3GA 3FSTA 2OWXA 3ABOA 2BXZA 3M07A 3B8SA 3UXAA 1P0DA 2RFGA 1QVBA 3AAMA 2GFTA 2R94A 3QY8A 1GGOA 1KBLA 3VNJA 3UVIA 2C0AA 5D9OA 3DFOA 3ONBA 2FTPA 4RDWA 3R5EA 4JFTA 2PDWA 3PZUA 5AC7A 2W6RA 1HJWA 4DWSA 2WMFA 1KBJA 2BBFA 3P0XA 1K7XA 1CGWA 4QROA 3L9CA 3U6WA 2ABBA 4FLOA 4NG3A 1HL2A 4L4LA 2OZTA 3A9IA 3AHTA 1RP9A 4PB5A 4F0LA 1TTQA 3GXDA 4Y9AA 2PRMA 4XB3A 4GIRA 3L0GA 3GH4A 4X22A 2QZRA 4MVAA 3EB3A 2FVMA 5FJRA 5FACA 2XU2A 4W8BA 4GK8A 4EXAA 2X0SA 2XHYA 3G0XA 4RJEA 4Y8EA 4D9PA 2ADAA 3RN6A 3U2OA 3G3DA 3Q58A 3ISIX 3MDWA 3UJRA 2ASHA 2PZNA 3EWXA 5E9AA 3UWQA 4BS0A 3W85A 3TC7A 3B9NA 4LUTB 1ZAHA 1SW0A 3IIPA 2D23A 1NSJA 2QS8A 1UH4A 3SBFA 3G1FA 4GABA 5C5YA 3TJ4A 3PPGA 1UA3A 3OHIA 5E93A 1Q8AA 1FWBC 3B9OA 2WMJA 3M7SA 4EANA 4ZA0A 5C9XA 2CLFA 3ITXA 3O07A 4JX5A 4B15A 3AZSA 1PAMA 2GWGA 1Y65A 4GHRA 4ACYA 2E5BA 4J5NA 4DJED 1IF2A 2WAGA 4AVFA 3CWHA 4HPJA 1U1HA 2Z1XA 4P8XA 3CPGA 3SO7A 3B0XA 1K3UA 3MMWA 3HQ1A 3EDDA 2GVLA 2FTYA 5HXMA 2FMNA 3WEMA 4GNVA 3KTSA 4H3DA 1ZS2A 1XLIA 1EWDA 4L4MA 2CC0A 5DBTA 4MNJA 3UGRA 3VIHA 5HNUA 4MWAB 2IQTA 4DAIA 3BLKA 4TMCA 3LPPA 1XP3A 3SSJA 2R82A 2WVVA 2QCDB 5G1YA 3AXXA 3VZXA 2XWEA 2DUXA 1F6PA 1CDGA 1FX6A 2TYSA 3DBNA 1RCQA 4C6IA 4MKNA 5FL1A 4S39A 4PZVA 4F79A 3W29A 4KESA 1DBTA 1AJ2A 1EJTC 3K4AA 1Z89A 3H70A 4Z1YA 3OVPA 1R85A 5A8MA 3SCPA 2JGYA 3O15A 1R47A 1A47A 4URIA 1TMLA 2Q6ZA 4GWEA 3B97A 1ZLPA 4K8EA 3NPWA 1U5HA 4R53A 2WSPA 1KXQA 1J18A 4WHBA 3ZLHA 1F3WA 4D8ZA 4I9MA 1XHGA 4ZR8A 2NXHA 4PTVA 3IJ8A 4HVXA 1GQJA 3DESA 1WX0A 1GTEA 1W5PA 3N34A 4NKCA 1O7AA 2A1YA 2X0YA 2BXVA 1ZJBA 3FLUA 3NQMA 1DWGM 3F2BA 3S2LA 2P10A 4WXZA 3VIOA 1P1XA 2JKEA 2PTXA 1ZJAA 3DKJA 1AW2A 4UFKA 3CZGA 4QSHA 2OQYA 4UTTC 2VDHA 1R86A 4M6QA 3UP8A 3AHYA 3PZMA 3L4YA 4FO4A 1KV8A 2YDAA 4QJ4B 3TQPA 2NUYA 1H60A 3WF4A 4DJFA 4RV3A 3T6CA 2GWNA 1SFJA 3K46A 1L2UA 4O54A 2R1LA 4X9SA 1TJPA 2QCFA 4PMUA 1DHKA 1UOKA 1UBPC 2QGHA 1UZHA 2X40A 2PE4A 2Y0FA 4FHAA 1Z7AA 1FP8A 2WO5A 4BWLA 1SJAA 2Y8UA 2QCGA 1ZSXA 1QFEA 3IVSA 1RH9A 4H7CA 3QFWA 3SRFA 1W1ZA 1US2A 5DCBA 3AUOA 1LZOA 1EUNA 3M5VA 1NQKA 3A4WA 4GYKA 1LT7A 5AHMA 2QAFA 2Z7KA 1KNWA 1RBAA 3L7RA 2PODA 1QO2A 3BZJA 5K9CA 1MMFA 5CH9A 3G1RA 1Z48A 4I7UA 1EO5A 1WA3A 1FFQA 3TCEA 3UJ2A 1QI2A 2DIJA 1LBFA 3TOYA 3S6TA 2WKLA 2JKPA 4L9XA 1FH8A 4O50A 1SSGA 4REQB 1TX0A 3FIGA 2DH2A 4UWMA 1SYTA 4ZO8A 1IYXA 4CN6A 1D7FA 1OC6A 1TWZA 4Z2HA 1XSIA 4YVVA 4AD0A 3FJ4A 3PSWA 3SIZA 3UWYA 1UASA 2ZOXA 1JCNA 3IUDA 1KGUA 2ZUWA 2IPJA 3CV7A 1F3XA 1V0KA 3NL5A 2OXNA 1W5OA 4MUPA 4QDMA 2VDIA 3S2NA 3BPWA 1QHZA 1I4NA 4NI8A 2YLAA 1YDVA 2V5JA 2PF8A 1V77A 1GYMA 3M0VA 4QE1A 3V4BA 3RO6A 2BP1A 3H4GA 5A95A 3VIFA 3DCPA 1A5BA 3AALA 5I06A 5C2XA 4O8RA 1J8VA 3THUA 1V6TA 1A5KC 2Z2BA 3VO0A 1KD0A 1JDDA 1C91A 3TTYA 2WMHA 2OB3A 3W7MA 2PF0A 4EPDC 4UQAA 1E6PA 4F0MA 3D3AA 3GAYA 2BVDA 4OZOA 3GFXA 3IK4A 3SGUA 2DEPA 2HXUA 1R2SA 3EWCA 2DT1A 1ZFJA 3IIOA 1EL3A 5D4YA 3U9IA 5MKGB 2PD5A 2QCHA 2AAMA 3EWUA 4LYQA 3OBAA 2WVUA 2ZE3A 3B8VA 4PTMA 1GVFA 4NY2A 2WCGA 2WZMA 1MEHA 2VZUA 3VDBA 3LGGA 3HO8A 2JIWA 4AD4A 1GJPA 3DFQA 3Q4DA 3NSXA 2PGFA 4OU1A 1AQFA 2Q8ZA 1Q6EA 2R91A 1K9FA 1E6RA 1IV8A 2DZXA 4QAWA 1AH3A 2WZIA 4GVFA 4AUBA 1QBBA 2XN2A 2Y5JA 1SJBA 4GKTA 4DJEC 3UJFA 2CXEA 3DECA 4O15A 1BQGA 3NVDA 3W87A 3VNZA 3VOFA 4GO8A 3LXAA 4B91A 4DZHA 3WK0A 1GOMA 4QLKA 1B3YA 3N6QA 1F8MA 2BOFX 2BTMA 3GKAA 3W2MA 2CLHA 3RLHA 1JD7A 2VJXA 3EX4A 1EC7A 5D9NA 5XINA 4XUGA 1FHUA 3OB8A 5LA1A 5GQBA 3UJEA 1W1VA 1NFGA 1EF3A 2PDGA 1EO7A 4JTAA 5KMYA 4F48A 4XBJA 1IIGA 4CNOA 2ZTJA 3S3GA 1FFRA 3AMKA 4O8AA 5LIYX 1E3XA 4WKHA 2DSWA 4ZOEA 1K02A 3MWCA 4R9XA 1M65A 1VPQA 1QTWA 3MSYA 4FLSA 4YCPA 2ZZ3A 1GHRA 3SN1A 3G1SA 3NYDA 3B03A 2Q8XA 3LX9A 3THDA 2OEMA 4GNJA 4AWUA 5KETA 3NFUA 1ITUA 3PY2A 1NFBA 4J35A 5CCZA 4PUNA 3AROA 3S5OA 1FHDA 5AN7A 3A47A 1BD0A 1KA9F 1QNRA 4KQNA 1YE6A 1K8CA 1CXLA 3KRSA 1G94A 1JFHA 3PUEA 3HIJA 4PB4A 5LNUA 1A0EA 4LRSA 4LVBA 4L1WA 2VOTA 3EPMA 4M8UA 2MNRA 3OU8A 1XUUA 2WK2A 3UYCA 1GOOA 4E2VA 1JRBA 4GRSA 4BY3A 4FEZA 1V3IA 1WOBA 4NILA 3RPMA 3ARWA 3E6EA 1SR9A 4W85A 3NEHA 2O92A 2ZICA 2HISA 3WN6A 1G1YA 5EFDA 3F5LA 2JF7A 3TC3A 3IJ6A 5I3DA 4Y90A 2JE8A 4YYFA 3TONA 4RDZA 3UQNA 4R27A 2VP8A 4QRNA 2Y89A 1YPFA 3UXIA 3B06A 2WJFA 4ONVA 2A79A 1UCWA 2AGKA 5G1MA 1PCWA 4BFAA 1QASA 1W3HA 2PTWA 3NZQA 3MMTA 3QHMA 1QNOA 4TX8A 4NZ5A 4QSFA 3ARYA 3ZLGA 3ARSA 4C6MA 1BVZA 2A3HA 2Y62A 4AIUA 3KVMA 3N4EA 3W02A 3T42A 3VMPA 3AJ7A 3RDKA 1EJVC 3LI0A 3VUSA 3GNDA 4NZJA 3OGVA 1XLBA 3ME3A 1F6KA 1E6QM 4H8VA 1ISZA 3W1NA 3WQDA 3AIEA 1NQ6A 3PB0A 2ZUTA 3WH5A 4Z0JA 4WEVX 3HPSA 1N8IA 2YSWA 5FEXA 4K68A 4UQ9A 3WLRA 3V0SA 4BR1A 3KZPA 3JZEA 4UFIA 4KCWA 3UZXA 1YNPA 3MV11 5CPMA 3W53A 1MI3A 3U2ZA 3LG3A 3SFKA 1R9XA 3NO5A 4IX0A 3F4VA 2J47A 2QVNA 3H8AA 3EWZA 5FSEC 1WBJA 3WDIA 1WZMA 1AQMA 2ZKMX 2WJDA 2VZVA 3BMVA 3CAWA 2D24A 3HGOA 1A5UA 3CZKA 4UFLA 1I8JA 1ZAIA 1EJ7L 3F5JA 2OZ8A 3DZ1A 3R94A 1NY1A 4A6GA 1W37A 1H63A 3RUBL 1WUEA 3CZLA 3W82A 3G0SA 5C55A 1FCBA 3HA1A 3TR9A 5FF0A 1PKMA 1X38A 4EP8C 2QJMA 2J7HA 3NQGA 1XSKA 3LU2A 1G4TA 2VKZG 1EPVA 1C3FA 4GFSA 2W79A 2O9RA 1BHGA 4C5YA 3G24A 4TMBA 3H2NA 5BXTA 3DOPA 4AY7A 4WX2A 4QTGA 1GZJA 1XIBA 5E70A 4X2RA 4M7SA 3KVJA 2J8TA 3PZQA 4KH2A 3QEZA 5GPRA 1TKKA 4Y2WA 2D0HA 1E9LA 1Q6QA 1O94A 3CT7A 4MY9A 1BXBA 3E49A 3B8IA 1GJWA 4CD4A 1A5NC 4DF2A 1QPNA 3OVGA 3NSNA 3W1PA 3KWSA 2WXDM 1S2WA 4UTWC 4WGXA 1MNZA 1WZAA 2OLAA 2PU0A 3TW7A 2DDXA 3CPRA 5KITA 4OOZA 3F4DA 3V36A 4LYRA 3GSMA 5CJ5A 4RNIA 3FV9A 1E71M 5HMEA 1XF0A 4H41A 3R7MA 5A6LA 3AWOA 1BFNA 4BK9A 2C0HA 1AMYA 5F2MA 2R1MA 3LSBA 3T40A 1J93A 1Z42A 3EDKA 2CEQA 1HKJA 1B3VA 1QO5A 2Z2AA 2YW3A 1K03A 4TOQA 3IGXA 4K7YA 1U83A 2D3NA 3EDEA 1R9ZA 2XN1A 3E0IA 2AL2B 3ZWTA 1X6LA 1PDYA 3SCQA 1DL3A 2ZUSA 4YU1A 3IGSA 4C6LA 5T8GA 1H61A 3G1XA 4IJBA 4ZO9A 3MBDA 4YTSA 3ZVHA 4PCTA 2VX5A 3EA1A 4C91A 1JNDA 1NP2A 4H9XA 2VQUA 2XDFA 3T4CA 4B2DD 2DP3A 3AXIA 3NQVA 1TPVA 1EHNA 1OGGA 3JZUA 2C15A 3AMCA 1PE1A 4R7OA 5ECVA 5DXXA 3K1DA 1PX3A 4JFUA 1CTNA 2VYOA 1FWTA 5LA2A 3I3BA 1VEMA 3U2CA 4IFKA 1W3KA 3NL2A 1TB3A 4MNKA 2D0GA 1YHTA 5DRIA 4M0XA 3WNLA 1YBQB 1EXBA 3CL6A 3P82A 1GVRA 3MYPA 2NX3A 1NF7A 3EPOA 2IS7A 4O17A 1LWJA 3G1DA 1E73M 4Q4SA 2C1HA 4ROPA 1UWRA 5A2BA 8CGTA 3FSUA 3TWBA 2ZUUA 4R7JA 3URNA 5EMJA 3CUXA 3RLVA 1XR2A 2ATMA 3UZJA 4GCAA 1ZQ5A 1LM1A 4IPIA 2NQ5A 2Z27A 4CU6A 1T99A 3EMCA 3BLLA 4J27A 3VM7A 1GJUA 4E8CA 1JDCA 3D3FA 3KTXA 3LBCA 1F5ZA 4D6FA 4H9UA 4DBSA 1RR2A 3GRIA 3W1AA 1XLLA 3P8JA 4DPQA 3MTWA 2NWRA 1LUCB 1CYGA 1J9YA 1B1YA 4JQAA 4O19A 3P3BA 1DQUA 2ALRA 3OTRA 1T40A 4NJKA 1OQFA 4IL2A 5LGZA 4DNHA 3PZTA 2ZX8A 5FKYA 2VRQA 4NAEB 3SUSA 1KTNA 1WP6A 1DTUA 1G4SA 3CJPA 1FWAC 2ZXDA 3B3DA 5KZ6A 4GD0A 5CXPA 1WO2A 3H55A 4IFRA 1LWIA 4O28A 4DVOA 4R88A 3BXWA 4CD6A 3N9KA 4E4FA 4GYFA 4QISA 4EF8A 1YPXA 2XIMA 3PPCA 1I2NA 1M9HA 3ZIZA 1FCQA 4GUJA 5C70A 5F1UA 3RCMA 2KZHA 3FGCA 1RAKA 1Z69A 4GUIA 3T2OA 1AL7A 5CSRA 1X1ZA 4PFHA 4S38A 4CQ9A 4KEVA 5A69A 3PBUA 1BXNA 4TTGA 2D3LA 3ARUA 3B0YA 1S5NA 1UZ1A 3MUZ1 5ENLA 1LLWA 2HWGA 5EMMA 3O0KA 1FWJC 2ZVIA 3GU1A 1V0NA 4QCEA 5MHBA 4PA8A 3W88A 3BLIA 1W32A 1WDWA 3MCMA 4DWDA 3W2LA 1D9EA 3PUGA 2FHCA 2HVNA 3MT1A 3PVFA 4LWWA 1TWWA 3QJAA 1TPB1 4C6NA 3DFHA 3W22A 5IXEA 1TMHA 3WSUA 1V4YA 2ACSA 3S2JA 2BODX 2FDSA 1I60A 2DY3A 3WLLA 2I7GA 5CEWA 1Q7MA 4RNFA 5DELA 1WDDA 2OELA 1KWGA 3A12A 4GYJA 3CHDA 3SAZA 4EWND 2VUYA 3O6DA 1U1UA 1WKFA 4EOUA 5KINA 4JX4A 4UTKA 3PZ9A 3FEMA 4LC8A 1XH1A 3QTGA 2Y85A 2PPGA 2A21A 2J77A 2I16A 1HXJA 3VA8A 2YBTA 1OSEA 1OABA 3NQCA 3OQEA 3L0KA 1NIUA 4CD5A 1C8QA 1TTPA 2CZFA 2ISVA 2XSAA 3NSMA 1V02A 4R33A 2WM1A 3EKZA 2A2IA 1K8ZA 4AZ7A 3PWAA 2CPUA 3KRUA 3WJXA 3BG5A 4LSBA 5BU9A 3QSTA 1LOSA 3U7BA 1U5JA 3U2EA 2ANUA 3ABXA 4HBKA 4E4UA 4PTXA 4IIGA 1W1B1 4U2ZA 3R8HA 4OBRA 3UXDA 2Y24A 4HSOA 4IT1A 1X8CA 1OX4A 2WNNA 4KT2A 4MPQA 2VEMA 2ZRZA 3LSCA 4GMEA 3W74A 2BVYA 3A21A 3L4TA 1B9BA 3OOQA 4JN7A 4AZIA 3PULA 1DJXA 4AZ6A 3SECA 5HMSA 4HU0A 5GJNA 1ECEA 3LCGA 1EUAA 4H19A 2I9UA 3WF3A 4WUIA 3EKGA 3F4WA 4C60A 3QY6A 1QPQA 1IT0A 5I7GA 3UPWA 3OYXA 3BLFA 4IXXA 3H4WA 2DU2A 3GVWA 2YL5A 3VYLA 4HZ6A 4W7WA 2ODOA 3SURA 1H7RA 3M64A 4F0HA 1EQCA 2YB4A 3A5FA 1M68A 2EPMX 3ZYZA 2CU0A 4PCFA 4IIFA 5I0DA 1TPC1 3R0UA 1NWRA 3GNPA 2H9AB 5JIPA 4OQVA 1H09A 1KXVA 3PBVA 1UZDA 4OV4A 4PMVA 3BH4A 3W24A 5E6ZA 4W84A 1OIFA 3W26A 4B92A 1A5AA 2E67A 3ZOAA 2X1SA 4MZ1A 2NVDA 2F6UA 1LG2A 3QMTA 1L6GA 1GVEA 5CG7A 1Y7VA 2XVLA 4I5UA 2HE8A 4FF5A 1LLZA 2F61A 1NEYA 3ARVA 5HAOA 2Y1HA 4ECLA 4ALDA 4J1OA 2Z1WA 1YXDA 1BGGA 1FDZA 4HT3A 2C6QA 3PZVA 3QOMA 2O0TA 3KAOA 4M56A 1W54A 3WKZA 3ZQ9A 3GU2A 4HNUA 3IGUA 3MP5A 2ZX6A 1MXSA 2GQ9A 1US0A 5DANA 1CXHA 2PC4A 3VX1A 4PRTA 4XSLA 3GTHA 5EU9A 4ZXOA 1TMQA 4Z1BA 4DIAA 3WLNA 2OU4A 4BF9A 4QHRA 3FYPA 3KOFA 1FP9A 3VMOA 1H1YA 3O9NA 1EGZA 2DUZA 3KS6A 4FK9A 4AZCB 1KFJA 1UP0A 2GSHA 3H21A 3EXRA 4L4OA 1QI5A 3BV4A 1THFD 2G4JA 1I1WA 4HCDA 1T8XA 4ZXLA 3DX5A 5HPCA 2H6RA 1BG4A 1JJKA 1KBIA 4KGLA 4A2RA 2XUCA 2HS6A 2GGJA 1H7OA 5CZTA 3TYZA 3PZNA 1VFTA 4MB5A 3WG6A 5A8QA 5CGTA 2X1RA 3QTPA 1AW1A 2EAWA 4HSNA 3A3XA 4I9JA 2QDHA 4H9MA 1VQTA 3GLCA 1TUXA 3LENA 4E5TA 1NF0A 1ZTVA 4LBSA 1RBOB 1O1HA 2WC3A 1NOUA 2HK0A 4PTWA 1MFVA 4D6IA 1C9WA 3SZ8A 6XIMA 2DJLA 4RNHA 4Y9OA 4L6DA 3UU0A 4YTRA 3ZR5A 1V6UA 1QOQA 4DLMA 3FJLA 1AW5A 2EPHA 2YBVA 4GY7A 1OFBA 2A7PA 3GC2A 1OD8A 1DTNA 4QGCA 4LPCA 1M1BA 2QDGA 1HFBA 3SRDA 3PAJA 2BNJA 1RJQA 3H6OA 5AYYA 4ZENA 3DHDA 2GGHA 5AVHA 2P0IA 1VFHA 3QR0A 3RFAA 3S0CA 2E40A 2E3ZA 5PTDA 2MANA 3W7PA 3NURA 4XUYA 2GJPA 4H6QA 5D32A 4MZYA 1FDJA 4Q8WA 3KOZA 3TTQA 1D2KA 2ZADA 1BYBA 1KV5A 3MI6A 4GXWA 1BGAA 1WXZA 2Z1VA 2OT1A 2BWGA 1DP0A 1QWGA 1TE1A 4B5XA 4YN5A 3M6YA 2CKSA 4JQ4A 4NI3A 3UA3A 1VHNA 4NASA 3CUIA 5F4SA 3WL1A 4Z2GA 1OFQA 2V9DA 1VYRA 2AOSA 3UBPC 1FRBA 4R3UA 4JOMA 1LBMA 3N04A 3GK0A 4IH3A 1F4AA 3VNDA 2G8ZA 1RLCL 3DYOA 4J28A 3HQNA 4S3FA 1HG3A 2WLZA 2A7NA 1XUZA 1UR4A 2QXWA 4QIUA 1CCWB 5I3FA 4JQ2A 2QJGA 4Q8VA 4N0RA 3NA8A 4XO6A 2IKGA 2PGRA 4HMNA 3UNTA 2FZBA 4HMCA 2P50A 5HUPA 1TWDA 4HD5A 2X1UA 1EXPA 1E1FA 1FWCC 1CZ1A 4ATWA 1TRIA 1CXKA 3N3MA 3RLUA 4W87A 1E0XA 1E4MM 5HANA 4LT9A 4ERGA 1A5LC 1LDCA 1OYCA 1JULA 3NXFA 2Y5EA 2BOGX 2PEVA 3R0DA 1OX5A 2E6DA 1WCGA 4G7EB 2PDBA 4M6UA 3KCJA 1N8FA 1XLMA 3G6MA 1VJIA 1G6CA 3GVQA 5KTLA 3CV6A 5LHFA 4WR3A 4TV6A 3RM4A 4OJYA 1EBHA 1BQCA 3RG6A 3QV6A 4PUMA 3L23A 1KM1A 2E9MA 2ZXQA 3NOEA 3GDKA 1CECA 2V2CA 2VO5A 4GACA 5DFAA 1SO5A 2ZRYA 4FB7A 4DJDD 3XISA 3QZEA 2FGBA 3PBMA 3N9RA 1JCTA 4K3ZA 4ZQMA 5LA0A 5EBUA 1A5CA 3O3RA 2GL5A