1GHRA

The three-dimensional structures of two plant beta-glucan endohydrolases with distinct substrate specificities
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
306
structure length
306
Chain Sequence
IGVCYGMSANNLPAASTVVSMFKSNGIKSMRLYAPNQAALQAVGGTGINVVVGAPNDVLSNLAASPAAAASWVKSNIQAYPKVSFRYVCVGNEVAGGATRNLVPAMKNVHGALVAAGLGHIKVTTSVSQAILGVFSPPSAGSFTGEAAAFMGPVVQFLARTNAPLMANIYPYLAWAYNPSAMDMGYALFNASGTVVRDGAYGYQNLFDTTVDAFYTAMGKHGGSSVKLVVSESGWPSGGGTAATPANARFYNQHLINHVGRGTPRHPGAIETYIFAMFNENQKDSGVEQNWGLFYPNMQHVYPINF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structures of two plant beta-glucan endohydrolases with distinct substrate specificities.
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
molecule keywords 1,3-1,4-BETA-GLUCANASE
total genus 95
structure length 306
sequence length 306
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 1993-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00332 Glyco_hydro_17 Glycosyl hydrolases family 17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ghrA00
2GJPA 2X09A 1HJQA 1W3LA 5A6KA 2G3IA 4CD7A 4J7RA 1BPLB 1W1PA 1XH1A 4P7NA 1JZ7A 4TX8A 2VC9A 2CBVA 1TUXA 3FXYA 2CCRA 3B9DA 5I23A 4AD4A 5M3WA 1BSIA 3AXHA 1UH3A 4D6CA 4UFJA 2Y8KA 1E5JA 3W25A 4C7GA 2OWCA 1K9TA 3RIKA 1GHRA 2EPMX 3UETA 2DGAA 1UKQA 1QW9A 1GOWA 5EMYA 3OGSA 1CDGA 4UCFA 1VBRA 1E0VA 3EYPA 1CENA 4HA4A 4OUEA 2FDMA 1JYXA 4Z2IA 4HTYA 1O7AA 2WMJA 1Q6EA 3WH9A 1LLOA 4WIWA 1MXDA 3FN9A 7CGTA 2OWWA 1B9ZA 1GOIA 4UZSA 3G6MA 4RE2A 3SUWA 4A3HA 3DHUA 4JKLA 4ZFMA 2XG9A 4A3YA 1CXKA 1H0IA 3GDBA 3VIIA 4GI8A 3ZSSA 4AZGA 1H09A 1XYFA 2BVTA 3OLEA 4W88A 3CTTA 1H1NA 3SCSA 1CEOA 5ABHA 5BXRA 1RP8A 3BGAA 2ZXBA 3K4DA 2VVSA 3ZOAA 1C8XA 3ZO9A 3W6LA 2DSZA 4BZYA 4DWSA 1JZ3A 2WZIA 1M7XA 1V6WA 3WMSA 5JBFA 1UOKA 1C7TA 4P7QA 1I75A 1B2YA 5CZKA 1UH2A 4M82A 2WMHA 3TTYA 1PPIA 4AD5A 5D8WA 3VD3A 1W2PA 3VIJA 1X6LA 5A6LA 2BY1A 2C0HA 3ZJ6A 1V0MA 5CGTA 1JXKA 4FLOA 1FHLA 1KCKA 2FGLA 5IFTA 4MNJA 2YDRA 1WCGA 2C7FA 3NJ3A 2V3GA 4HMDA 1E9LA 2CPUA 3DECA 2WNWA 2YBTA 1C92A 1DP0A 1E0XA 4CUCA 2CBJA 5A8MA 2PWFA 1G0CA 3WH7A 3I3BA 3WUBA 2EBNA 2VR5A 3DC0A 4MADA 2J78A 2VL4A 1PZ2A 1WDQA 3O9NA 2VUYA 4PUDA 4PSRA 4XX6A 4M29A 1BQCA 4RL3A 1VF8A 3QR3A 1ISWA 3AOFA 4HZ7A 2FH8A 2XTKA 3ARRA 2CESA 2Q8XA 1FHDA 1OGSA 4OIFA 4PMUA 2D0FA 4EE9A 4UQ9A 3VDBA 3T2QA 4PMQA 1CYGA 3CIVA 1CXIA 4AWEA 4AY1A 5I78A 2EEXA 3WNLA 5A8QA 1GJWA 5FOOA 2DQXA 4TTGA 1W2VA 3PBGA 2JEPA 1E6NA 2WHMA 1EXPA 1TG7A 3WBEA 4PUEA 2E0PA 1TVPA 3AFBA 1EDGA 1E70M 3A4WA 1MFUA 1QI4A 2WWDA 3IJ9A 3VIGA 1HNYA 1E6QM 1CGTA 4B9YA 3WQ6A 1OBAA 3BAKA 4NRSA 1YHTA 4P8XA 3PZMA 1CXLA 1V0NA 2V3DA 4AXNA 1UR2A 3PN8A 4AIOA 1BHGA 1HL8A 4Q22A 2X8RA 2WM0A 2WVSA 1ZU8A 1ZS2A 2J47A 1BVZA 3OA5A 1L0PA 1R7OA 4GPNA 1PAMA 3KEHA 3OZPA 2PC8A 3LPGA 3CMGA 5HPCA 2CBIA 4MJ2A 4H41A 5IXEA 4W8AA 2ZIDA 3I3EA 4PTXA 3WQWA 5LA2A 2G3NA 4PMZA 3IJ8A 3WBAA 4JL1A 3VDHA 3MANA 2E9MA 2AOSA 4KRTA 1CBGA 2PB1A 2XIBA 1GQJA 3A4XA 2G4FA 3OLIA 4PMNA 1MVYA 3WNOA 2Y8VA 4GO8A 1GOQA 1W3HA 2GUYA 3KL5A 3SURA 4X0NA 1PX3A 5I3DA 1JAEA 4N42A 1JZ8A 3AS1A 2QF8A 5A8OA 4BQ2A 4Z2GA 3W38A 3GH5A 2WVUA 2BFGA 4AIEA 3NSXA 5A3HA 1C91A 4GQRA 1RH9A 2D3NA 4KGLA 4EK7A 2VZTA 5TD4A 4ATDA 2B31A 3W24A 1FP9A 3VMOA 3WEMA 1KBBA 1MXGA 1B3VA 1ZL1A 1GOOA 4GKLA 2VR4A 1XRVA 2WANA 1DWIM 1CGXA 1V3LA 4D1IA 2EO7A 3M07A 2W62A 1EIBA 4GIAA 2VURA 3W26A 5CLWA 1FA2A 2JALA 3KWXA 1E6SM 2EPOA 3WN6A 3GBDA 1QNOA 3N17A 2WAGA 4DWSD 2CKRA 5EFDA 3W0KA 1NWTA 4HOWA 1UKSA 3WNPA 3GNRA 1VB9A 1WB0A 1CXFA 5BYWA 1CNVA 1HKKA 1ZBVA 3N13A 2E4TA 1V6UA 3GYCA 4LYPA 3GXIA 4D1JA 1GZJA 3N11A 1GONA 3E1F1 4OBSA 2XWDA 3TTQA 4PBGA 3MMDA 4GI9A 4AD1A 1SMAA 3NDZA 1JD9A 4HMEA 4UQEA 1HVQA 3VNZA 4TVUA 1ITCA 2DSWA 5A6BD 2WK2A 4GZIA 2A3CA 1GOMA 1E4LA 1BF2A 1MW2A 2YA0A 1GHSA 2PWHA 1V6YA 2GK1A 1S46A 1FP8A 1JNDA 4DWSB 4PMYA 2XJ7A 2ZE0A 3OZOA 3TTSA 3AIEA 1UD3A 4N0RA 4ACZB 3WDPP 4MDPA 3K1DA 4JZ5A 4JCLA 2O9RA 5C71A 5ABEA 4JHZA 5JIWA 4QLJA 3L4VA 4W7WA 3D3AA 1QNRA 1TE1A 3ZJKA 1D3CA 1UD4A 1QI0A 3ZR5A 3MSDA 5LYRA 1W3KA 4JL2A 4PMVA 5CGMA 4JKKA 3OBAA 1HT6A 3AIBA 4E8DA 1RP9A 4TVDA 4AZ7A 2HISA 4QLKA 2WMIA 3WDJA 4M80A 5HPOA 3CZJA 1C8QA 4MB4A 3EBVA 4AZIA 4QP0A 2HVMA 4WK9A 3WF1A 4MB3A 4X9YA 3B9AA 2VTFA 1U2YA 1EOKA 3APGA 3AHVA 2Y4SA 3TP4A 1JFHA 1A3HA 1IT0A 2X2YA 1NM9A 4K68A 3CO4A 1UD8A 1AQMA 4EKJA 3ARSA 2QPUA 1LL7A 2YOCA 1W1VA 4C7FA 2WMFA 2NT1A 1EA9C 2BY3A 1QHOA 1VEOA 3VKKA 1TVNA 2W91A 1RD6A 2X0HA 1R7AA 2WYSA 3AXXA 4AZBA 3PTMA 4HOXA 4BQ5A 5GNZA 2WCAA 4F8XA 2O9OA 4ZENA 1QBAA 1E15A 1Z32X 3L2LA 1M03A 3PZOA 2O9PA 1XGZA 2EXOA 3MUIA 4DUVA 1MQPA 3ARXA 3TA9A 2FHBA 2YA1A 3F5LA 1M53A 3WD1A 5AY7A 3AZRA 1NP2A 1EHNA 1DHKA 4AD3A 4AC1X 1SFSA 5IHRA 1C93A 3GBEA 3LPFA 2WB5A 1BLIA 1HP5A 1SMDA 3GNPA 2WVVB 2ZOXA 1HJWA 2EQDA 3UERA 2D3LA 1HF6A 1WPCA 3VIMA 5CSUA 2J7HA 1H0GA 2RGMA 2YL9A 2DIJA 2VX7A 3IJ7A 1GQIA 2BNJA 3MMWA 4JHOA 2YJQA 3BH4A 2TAAA 2OYKA 3WD0A 1E6XM 5A6AA 1HJXA 4W84A 3LPOA 3AZSA 1UG6A 3AROA 4CU7A 2J7DA 2E3ZA 2GJRA 3GXMA 3BAYA 2VNCA 3WD2A 4V2XA 7TAAA 1PJ9A 4PMOA 1R87A 5AC4A 5CJ5A 2JEQA 3EMQA 5F7UA 5JIPA 1NWUA 3CZKA 2D20A 1FH7A 1LWJA 1Q6FA 5KEZA 5IDIA 1VENA 1VJZA 3U7VA 3UR7A 3O6AA 4WSJA 2J8FA 2WW5A 1HXJA 5GNXA 1G5AA 1E6RA 1HP4A 4HP5A 1E71M 2OLHA 4CCDA 3WQVA 4AD0A 3VTRA 4UFMA 5I79A 3WNNA 4RE3A 1BYDA 1NWRA 5D9NA 5A2BA 2DEPA 4AISA 5IHSA 3ARTA 3W82A 1HVXA 2J74A 5A6BA 2G3JA 2ZUUA 3T0BA 4D6IA 1W9UA 1MW3A 2PWDA 4ATLA 5GPRA 2DH3A 4PYSA 1JL8A 1DWAM 2V3EA 5D9PA 4B16A 4GZEA 3FY1A 2BVYA 4MNMA 4UOZA 3VIKA 2VCBA 1C3FA 4V27A 5ABFA 1PX4A 3BC9A 4FLRA 1V02E 3CZLA 3SEPA 3AMKA 2ZUSA 3RILA 3PZVA 2XSBA 1XSKA 5BXSA 2GJXA 1ZBCA 4KRUA 4ZE4A 1W1TA 2ZUWA 1US3A 1HN1A 2EJ1A 4PN2A 5C8BB 3QGVA 4S3KA 2OWXA 1G01A 3POHA 3WQ4A 4UOQA 4UOJA 3KE0A 3OLDA 4IPNB 1QPKA 5A94A 4JKMA 3RCNA 3O2LA 2YBUA 1CGUA 2GJXB 1YQ2A 2W67A 2ZICA 4JCMA 4WF7A 3FNDA 2XGBA 4V28A 3AMDA 4CD4A 3LPPA 3CUIA 2W63A 3THCA 2W92A 4ATWA 2WPGA 1W9XA 2WXDM 4HA3A 1FFQA 2YA2A 4GXPA 4QCEA 4AD2A 4U33A 4IUGA 1FH8A 4QLLA 5DMYA 3PZIA 4MDOA 2YKKA 3AS0A 4D6EA 1DWGM 1W9PA 6TAAA 2XM2A 1GW1A 2J8GA 4BQ4A 2Y5EA 4PCSA 4DUXA 5A1AA 1DWHM 4PTWA 2W4XA 1BVNP 3AXIA 4BCEA 3AHTA 5D9OA 3AYRA 3SCVA 4Z2HA 3WDHA 3KL3A 1H11A 2ZX5A 3NCOA 3VVGA 1BTCA 1I1WA 4KGJA 4AZ6A 2ZX6A 3VIFA 9CGTA 1US2A 4LYQA 1GNXA 4IISA 3VPLA 5A6JA 3VINA 3RM8A 5A8PA 2V3FA 3AQUA 3POCA 4H7VA 4Y7EA 1XV8A 3VX1A 3AJ7A 3A4AA 2YL5A 1JI2A 1K6AA 3MUAA 4AZCB 3ALFA 4D6JA 4QAWA 2W5FA 4UQDA 3MUY1 3WUEA 2VMFA 4PTVA 3ZMRA 2WSKA 1EO7A 2J7CA 1IZJA 3GTNA 5CXPA 4AEEA 1J0ZA 3HJEA 3RM9A 3WQ5A 2D23A 4CD8A 3BXWA 3AISA 5DFAA 4JFSA 4CGTA 2PF0A 3PZGA 4TVCA 3MUZ1 1J0JA 1H3GA 1FH9A 2WZEA 3PTKA 4L4PA 3ZM8A 4WJXA 5A2AA 1AQHA 4CN1A 2WHKA 1W3JA 3MV01 4UZUA 3VDCA 4UQBA 1V6VA 1I1XA 5HXMA 2FH6A 1MYRA 1H5VA 3W81A 3BCDA 1X1NA 4JFUA 1AVAA 5A2CA 3FAWA 1AMYA 3TTOA 1MQRA 1R85A 2YDSA 3CZ8A 4UQCA 3WF4A 1LQ0A 1OB0A 4LYRA 1WZMA 3AHYA 2VJXA 4CKQA 4CCCA 2JIWA 4M8UA 4RE4A 5GNYA 1GOKA 2WLZA 3MKKA 1F4HA 5CPTA 2JF7A 1OINA 3QHNA 3LMYA 2C8NA 4J3XA 3BAXA 3WEZA 4CN6A 1M01A 5E0FA 3CUFA 4PSPA 1LG1A 5A69A 1WZKA 2YDQA 1HJVA 5BRPA 1W9BM 4W7UA 1HX0A 4S3JA 3VDAA 1BYCA 1TZ7A 2J7GA 1Q6DA 1ZJAA 3OB8A 2J79A 4XZBA 3L4WA 1XC6A 4J28A 1L8NA 2WHJA 1TMQA 3WH5A 4FLSA 4WKHA 1E6ZA 3NYDA 2BS9A 4U3AA 5C70A 2XFRA 4CD6A 4PMXA 1C7SA 5AYIA 1KQYA 1JG9A 3L2MA 1UD2A 3AI0A 4AEFA 4WKFA 1UZ1A 3CZGA 3F5KA 3ARQA 4CN4A 2FHFA 2F61A 4X0VA 4AW7A 2W61A 5AYBA 3DYPA 1ISYA 4M56A 3VIPA 1UKPA 2ZXQA 3RDKA 3W53A 4CVWA 8CGTA 1JZ2A 1IZKA 4D72A 1NOUA 1KWGA 4W87A 1G94A 1SR0A 1WAWA 2PBGA 4TTUA 5BCAA 3AIWA 3QHOA 5LA0A 1OT1A 1D7FA 1BFNA 3VD5A 1B1YA 1GJUA 2VO5A 3II1A 2VX4A 1DTUA 4AIUA 1JF6A 1M04A 2ZUMA 2IUZA 1EDQA 3BAJA 1OD8A 3MMUA 1JAKA 1JZ5A 2BXYA 3NUKA 3PZUA 3MV11 3UESA 1QVBA 1B3ZA 1CECA 1G9HA 4WLCA 3WL0A 5BXTA 4P7RA 2IXUA 1UD5A 1UHVA 2QLYA 3ARWA 3K8KA 2WMIB 3SCOA 4CU6A 3QOMA 4JFWA 2YL8A 4ZXLA 2JE8A 5DT5A 2YIHA 2ZX9A 8A3HA 1B0IA 5D4YA 2F8QA 1E5NA 1QOXA 2Y2WA 1KFWA 1CGVA 3CHFA 3ZT5A 2BHUA 2YL6A 4JFVA 1TCMA 1O6IA 1J18A 5I5RA 2XVKA 1VAHA 1UWTA 4DWSC 4R27A 2QPSA 1IV8A 1Q4NX 3WUGA 5M03A 1UR4A 3K8MA 4BS0A 3T0DA 3WNMA 2DDXA 2VZUA 3WUFA 3WF0A 4MNLA 3OGRA 3BAIA 4UQAA 3U5UA 3WH6A 1WO2A 4NF7A 1KGUA 2D0HA 5A6SA 1B31A 2VZSA 3U57A 1CPUA 4PCTA 3L4YA 1UWSA 2MANA 3SUUA 2Z1SA 2JIEA 1KXTA 1LL4A 2VCAA 3CZEA 5EFFA 3CPUA 4W86A 3VD4A 4HA1A 2A3HA 3AICA 3OGVA 5FL1A 3EMCA 2OSXA 1E73M 1WDSA 1KBKA 2A3AA 3B8SA 3M46A 5ECUA 1PBGA 5FKYA 2DT2A 2ZUVA 1GQKA 2XGIA 3F4VA 1WE5A 3VIOA 4EAMA 2WMGA 3N1AA 1J11A 2VRJA 3VIHA 3SIMA 1BAGA 1SYTA 4OOUA 4LPCA 4GQQA 5A95A 3VGHA 2UY4A 1VEMA 2WZHA 5CPSA 1EH9A 1VBUA 1WZAA 1ITXA 3WF3A 1BG4A 3CH9A 3D5HA 5EBAA 3T2OA 4OBRA 5E0CA 1G1YA 3VM5A 3RO8A 1CGWA 1J12A 2VZVA 4D6FA 3BAWA 1J0HA 3PZQA 3VGGA 5FCZA 1UA3A 3J7HA 2ZXAA 1JDAA 5DF0A 2VX6A 1C90A 1HJUA 2V38A 3N04A 2VQUA 3IAQA 3W37A 1OM0A 3IANA 4P7OA 1CGYA 1GVYA 4PEEA 2W66A 4E8CA 4ACZA 1Q6GA 3WL1A 2PBOA 3OIHA 3MSGA 1KB3A 4MB1A 3AIQA 2CETA 4AZCA 3ZT6A 2GDVA 2WBGA 2Z1KA 1OD0A 2D1ZA 3FAXA 1WZLA 2OSYA 1K9DA 4XZWA 3U7BA 1OIMA 4L4OA 2XVGA 3GM8A 3EDFA 1K9EA 2WBKA 2QMJA 1V6XA 4U2YA 3PTQA 1H4PA 3VD9A 1EO5A 2WVVA 3RJYA 4MTVA 4HU0A 2WWCA 4TXEA 2OYLA 6CGTA 2J7FA 4E4PA 3AMLA 5D8ZA 1HJSA 5JUVA 1J10A 2XIIA 4R5EA 2ZWZA 2FGZA 1XHGA 1H41A 2J7EA 3THDA 3EDKA 2XYLA 1JYNA 3RM4A 4HZ8A 1BYBA 5FD0A 1K9FA 3DYOA 1LJYA 3L4TA 3WDRA 2YLLA 3ZIZA 3CUGA 1ZBWA 3GNOA 3ZJ8A 2PWEA 3VGEA 3WMCA 1JNEA 3AMGA 4FMVA 4WKAA 1LG2A 4NSBA 1W9DM 2CBUA 1UQYA 4CCEA 4P7LA 3AIUA 3SUTA 2GSJA 4CVUA 2UY2A 4B3KA 3NSNA 4FF5A 1XCWA 4UTFA 4J3SA 1UYQA 1JZ6A 2NSXA 1KQZA 1EQPA 1WDPA 3PZ9A 1UR9A 5CLTA 3B9EA 3W4RA 4MAZA 2X05A 3AYSA 4YN5A 1AQ0A 4NRRA 3GH7A 1HKIA 1VIWA 3T08A 3S2CA 1WKYA 2ZWYA 1VFUA 1J0KA 1JF5A 1ZJBA 4P8WA 5BRQA 1B90A 1DEDA 2AMGA 1E1FA 1W91A 3FHQA 1UUQA 1XSIA 3ZJ7A 4KWUA 3HN3A 1TA3A 2VQTA 1VFFA 2WC3A 4CD5A 3W27A 2D24A 3WD4A 3AHZA 3ARYA 5BROA 4M1RA 4HMCA 2CERA 1W9VA 4AZHA 2Y24A 1BG9A 1VFMA 2WCGA 1HL9A 2DT3A 4C7DA 4MNKA 1E6PA 1TFVA 3DYMA 1WP6A 4ZEPA 5CSYA 1MW1A 1R86A 4J27A 2ESCA 3WKZA 1JD7A 1NWSA 1V3IA 2XHYA 4W8BA 1CIUA 1QNQA 2QMKA 2O92A 2J7BA 3ARZA 4D6DA 1W32A 2BHZA 4UFIA 4U5IA 1KXVA 3L4XA 4F9JA 2AAAA 4OJYA 4DM2A 3VGDA 1MWOA 3VGBA 2DH2A 3MS8A 3WSUA 2BHYA 4GI6A 2G3MA 2A3BA 3FHAA 5FL0A 1BYAA 4HU8A 3M7SA 4ZXOA 1JFXA 1UD6A 4TX6A 2XWEA 1QNPA 5E6YA 1WDRA 3AHXA 4DUWA 2UY5A 1CZ1A 4H8VA 2F2HA 3ECQA 3VO0A 1TR1A 2CNCA 1XH0A 3N12A 2GDUA 2DSVA 2CHNA 1VJSA 4Z2JA 4Q7NA 1E4MM 1H2JA 4YPJA 1JYWA 1KR0A 2BVDA 2WMKA 2BY0A 2IXVA 1KXHA 1PIFA 4KMQA 4BF7A 1CWYA 1FFRA 3QOKA 4HOZA 2DSKA 3GH4A 5DO8A 2OSWA 1B3XA 3SCRA 2WC7A 1LL6A 4U31A 4UFKA 4H8HA 2J25A 1JI1A 3MU7A 3UG5A 5E09A 3WDQA 1J9YA 1ISXA 4W7VA 4B15A 1XSJA 1JZ4A 1UWRA 1E3XA 2J62A 3AS3A 4XB3A 4W5ZA 1E4IA 5JBEA 2WCSA 1A47A 4KH2A 2BV9A 4BQ3A 4U2ZA 2DT1A 4BA0A 2UY3A 1QI2A 3W28A 3FW6A 2BXZA 2OYMA 3SCWA 3CBWA 1VFOA 1QI5A 2D0GA 5I0DA 1J0IA 2VRQA 1CLXA 3OG2A 3EDEA 4HZ6A 2PI6A 1R8LA 4PRWA 4U5KA 3SUSA 5I24A 2JFEX 4J3WA 1PX8A 3RJXA 1GPFA 3ALGA 4URIA 1V02A 1DWFM 1B3YA 1E4NA 2DIEA 4EANA 1ISZA 3VNYA 4QCFA 3BMVA 7A3HA 4ZE5A 3W29A 1EOMA 3TOPA 3BLKA 1KWKA 1HIZA 4CU8A 1BGAA 2EPKX 3VU2A 2QHAA 3T2PA 3UCQA 3W6MA 2XVPA 1E1EA 1VRXA 3WENA 3PZTA 3VMPA 3VILA 1UH4A 3PZNA 3S6TA 4F79A 4JIEA 1HKMA 5HOSA 3WEOA 2WC4A 1OGGA 2VI0A 4MAVA 2GK1B 1UA7A 2DPEA 3WY1A 4LGXA 4PTMA 4J3VA 4OOZA 2D22A 2WLYA 4LQ1A 4IPLA 5EB8A 4AMCA 3AZTA 1OWQA 1PIGA 1JDDA 1ODUA 2J75A 1UKTA 1ESWA 4LX4A 4UR9A 1UR0A 5I2UA 1ODZA 1DWJM 3CGTA 1NH6A 3GZAA 1V0KA 4MB5A 3WH8A 3VUPA 1UR1A 2O9TA 3A3HA 4B3LA 4Z2KA 5E70A 2EPNA 1UWQA 2XM1A 5M17A 2PWGA 4OZOA 1C8YA 3UG4A 1MFVA 3AIRA 2VZOA 4GO9A 4MJ4A 1XH2A 1UR8A 3IAPA 1QBBA 1QHPA 4QDMA 3ZQ9A 1RPKA 3BCFA 3DHPA 3N18A 3N9KA 5ABGA 4J3UA 4QFUA 1CTNA 4UFHA 2VOTA 3UG3A 2CKSA 1ZB5A 5AC5A 4W8LA 4GINA 3I3DA 3BLPX 3CMJA 1EGZA 2GVYA 1D2KA 5HDRA 4XV0A 3JUGA 1UWIA 3M6DA 1KR1A 4P8UA 1WNOA 5E6ZA 1V03A 3WFZA 4XUYA 3WELA 2RGLA 1XYZA 5KZ6A 4J3TA 3SCQA 3K4AA 1XD0A 2VVNA 5LA1A 4AYSA 3EDJA 3NSMA 3GXDA 4F66A 4F9DA 3HU7A 4Z2LA 2WHLA 3A6OA 2XFFA 1V3JA 2WKGA 4GZJA 2E8ZA 1E72M 4H8UA 1CLVA 2CITA 2WVTA 4YHGA 3VGFA 1B3WA 3EMZA 3GXFA 4B9ZA 1KGXA 2VCCA 3T0AA 1JIBA 2XPKA 1QW8A 4MPKA 1NP0A 4TUFA 2VT0A 1E43A 1NOWA 3WDIA 1BGGA 1GCYA 4W85A 2ZUTA 3SCTA 3WQ8A 1XCXA 3ZSTA 3L4UA 2XFYA 3OLGA 1UZ4A 3G6LA 2NT0A 3SCPA 4PMDA 2DSUA 1V08A 3WFLA 1MQQA 4UNIA 5JBDA 2G41A 3SCNA 1FOBA 5GQBA 1LWHA 1QI3A 2BY2A 1TA3B 5IFPA 4NI3A 1MW0A 3CHCA 3ARUA 5CG0A 1V3HA 2J4GA 2A3EA 2VRKA 1EDTA 3VOCA 1OCQA 2JF6A 4U3CA 1OGBA 3SUVA 3WMBA 1J01A 1P6WA 4W93A 4FK9A 1J0YA 1KGWA 4D6GA 3ARPA 4H2CA 4HPHA 4M24A 2ZXDA 4D71A 5E9AA 2V5CA 3WD3A 3NIYA 4D6HA 4IM4A 4M81A 1UKOA 2NW0A 2XUCA 3ARVA 2GFTA 1E55A 3TONA 3KZSA 1Y7VA 3AS2A 3CLWA 5HNNA 1KCLA 4P8VA 3AIVA 3ZR6A 5A6MA 1QHZA 2V5DA 5BXPA 3SCUA 3L4ZA 1B30A 1EQCA 4W5UA 3BMWA 3IK2A 5DEZA 1U30A 1JGIA 1XD1A 5M5DA 4LXFA 5ABFB 2G8ZA 2ZX7A 1VEPA 5I77A 1NOFA 3CHEA 5DT7A 4WSKA 1OT2A 1JDCA 2UWFA 3N15A 3PHAA 1E3ZA 3NDYA 1GQLA 3CUJA 1U33A 2XSAA 5CQ1A 3CUHA 4ML4A 2E9LA 2D2OA 1NARA 4YHEA 1E0WA 1W1YA 4H04A 2WSPA 1ECEA 1GUVA 2CYGA 3VX0A 1Q6CA 1ZBKA 3VM7A 2ZX8A 5BWFA 3QHMA 3RPMA 1UQZA 1KXQA 1V0LA 2X1IA 3MO4A 4UFLA 1GVIA 3UEQA 5HBFA 4ACYA 4FLQA 3WIJA 2XVNA 5FIPA 5A8NA 3T09A 1OIFA 6A3HA 2E40A 5D9MA 3F5JA 1N82A 3VMNA 5CPQA 3BSGA 3KL0A 1V3MA 2CIPA 4AZ5A 1GORA 3K46A 1LF1A 1ISVA 4A4AA 1HKJA 3HMCA 1F4AA 1JXJA 3UR8A 2XVLA 1QNSA 2EPLX 1PZ3A 2J77A 3VD7A 2CEQA 3EDDA 1X6NA 1CXEA 1CXHA 4JFTA 1V3KA 1JYVA 3A47A 4DM1A 3AMCA 1EHAA 2VX5A 2X0YA 4JAWA 2DT0A 2E9BA 3CHDA 3BSHA 4PMRA 4OKDA 3RMEA 2ZUNA 3ZT7A 3U5YA 3K8LA 1OSEA 2QV4A 2CHOA 1NQ6A 4HPGA 1H49A 2YLAA 3WNKA 4TOQA 1PEZA 3WF2A 1UWUA 1E56A 4NZCA 4E2OA 1E40A 2E8YA 4W89A 2WKLA 5I6SA 2CXGA 2FHCA
chains in the Genus database with same CATH superfamily
2VUNA 5A6KA 3W2UA 4J7RA 3WJWA 4P7NA 3GFXA 1P6BA 3C6CA 3BL3A 3JZEA 4NNCA 3W1LA 5I23A 1J6PA 3H2FA 4AD4A 3AXHA 4LV9A 4S2BA 4D6CA 3SZ8A 2V9DA 4YTSA 8XIAA 1K9TA 5BOEA 2NVAA 3UETA 1LBFA 1UKQA 1GOWA 1EFZA 3W7JA 1CDGA 4UCFA 1HKWA 1RBAA 3QF0A 4ZGYA 5D03A 4HA4A 4FNTA 4JQ3A 1H51A 1EZWA 1LCOA 4HTYA 1O66A 4KERA 2WMJA 1OC6A 1LLOA 1MXDA 3OIXA 1OCBA 7CGTA 2ZFAA 1XQLA 5CAKA 3LUTA 5CZ0A 4EPEC 5IDZA 5HMFA 4RE2A 1BRLB 3DHUA 1P5BA 4ZFMA 1SW7A 4A3YA 4BWLC 3M0IA 1R46A 1NDYA 2PDJA 2HPIA 3DESA 2PDLA 3ZLFA 2ZRWA 4W88A 3GDRA 2X7VA 1L6WA 1XJBA 3S2NA 4A05A 5K9XA 1ICSA 3G3DA 2CLFA 3ZO9A 3W6LA 1W1B1 4DWSA 4NYYA 3WMSA 2DVUA 4EXAA 4O1FA 1C7TA 2I5QA 4HSOA 4Q8PA 3TFXA 1F5ZA 5L6UA 1W5NA 3W02A 2QAFA 5AB3A 3P61A 1FWDC 3LLXA 3DKLA 4M82A 2WMHA 4IJCA 4S3DA 3LN3A 1O12A 1MEIA 2GQ9A 1BWLA 2E09A 5FF3A 3TN6A 3ANVA 1V0MA 2DZAA 4FLOA 1XR2A 1KCKA 2GQ8A 4E0CA 4Z1CA 2YCJA 2H90A 2YFNA 2YDRA 1DJYA 1WCGA 3WLHA 3WQPA 5JQ9A 2DIKA 4BHYA 1R3QA 3RGTA 4NJJA 5D2WA 5B7YA 3PUEA 3LK6A 5AYYA 1G0CA 3DBPA 2B7PA 3UXIA 2VR5A 3DC0A 4O53A 1WDQA 5KITA 3NAVA 4M29A 4RNHA 1OJXA 1AA1B 1F3TA 1BWKA 3NQFA 4GCXA 3AOFA 3F2CA 3ELFA 4N2YA 1A0CA 4H1ZA 3TKFA 2CESA 1C9WA 4MZ1A 4I8DA 3URBA 4O1DA 4B5UA 2D0FA 4DBEA 2DUAA 3SRDA 3TUUA 3VDBA 1CYGA 4MPQA 1CXIA 3TLQA 1XG3A 4AWEA 5TAOA 5A8QA 1GJWA 5HANA 1ZJIA 2FIQA 7REQA 1W2VA 3PBGA 4LCRA 2V6AA 4AU0A 2WHMA 4LWWA 4RK8A 2W79A 3WBEA 3OJGA 2E0PA 5G1TA 3NOYA 3ITLA 3IVSA 1UIPA 2WWDA 1VYSX 3WQ6A 2KAUC 1EB3A 1A80A 2TPSA 3P74A 4P8XA 3PZMA 3RPTA 1CXLA 2ZRXA 2VKZG 5BZAA 3NURA 4AEOA 5AC8A 1SR9A 4ZBCA 1T0OA 2X8RA 4IIBA 4MUZA 2WVSA 2ZBTA 3CIWA 1ZS2A 3EWYA 3B0UX 5LZLA 4A6GA 2E1DA 1R7OA 1RHCA 1N55A 2ABBA 3EX4A 3QQ1A 4GPNA 3DI1A 5RUBA 3KTCA 3OZPA 2CBIA 3REQB 4MJ2A 4W8AA 4TQTA 3THQA 2BLEA 1XYBA 2PAJA 4WY0F 2YCLA 3PBWA 5LA2A 2G3NA 3CQKA 3SGZA 4JL1A 4PE8A 3MANA 4LCQA 2DZSA 1LORA 3L66A 1GQJA 2PLMA 4RDWA 4G1NA 4YL2A 1KRAC 3YPIA 4OBTA 4GO8A 3SURA 1PX3A 1XQKA 3OHMB 3GHUA 1R47A 3UBPC 2QCMA 1X1OA 3BLEA 2R8WA 2ZRVA 3LENA 2QDDA 2BFGA 1X98A 3P6LA 4A8LA 3HFTA 4IMGA 2DY3A 2VR2A 3I4KA 5HUPA 1RH9A 4IPIA 2CZEA 2OQLA 1JCYA 4DF0A 2RAGA 3M7WA 5KMYA 3TN3A 3DFNA 1QWGA 1FDZA 5CPMA 2EG7A 1GOOA 2VR4A 1XRVA 3G0XA 3H6OA 3UXKA 1XFCA 3TYZA 4D1IA 1FRBA 4LJ3A 1EIBA 4GYFA 2VURA 3W26A 3N2OA 4WOQA 1FA2A 2PC4A 2JALA 4BR1A 3TA6A 3QRHA 1AG1O 1QNOA 3KM8A 1QPQA 1UKSA 2PRHA 3BWWA 3H2EA 1WB0A 5I06A 2H8XA 4QM1A 3F4WA 1CNVA 1HKKA 3N13A 3PAOA 2YXXA 3NNTA 3N11A 3SFWA 2CLMA 3FLUA 2DUXA 3E1F1 3TTQA 4LUTA 2PDFA 1THFD 3NDZA 4O13A 4TVUA 2V63A 5A6BD 2O55A 1GOMA 4WDUA 1ZLPA 4YTTA 3N3MA 2QVHA 2GK1A 1DJZA 5AHLA 3RLGA 4IH3A 3WLMA 2XJ7A 3GHSA 4N0RA 4ACZB 3LI0A 1TSIA 3JVAA 2WQDA 2IQDA 3THUA 2GVLA 3QTGA 4JHZA 4QLJA 4LNYA 2OT1A 1H7XA 1QWKA 4ES4A 4DIAA 4WQ6A 4C90A 1KLZA 3D3AA 1QNRA 3O06A 2ISVA 1DJWA 1WOAA 4NG3A 4JL2A 2X2GA 5CGMA 3AIBA 2FPVA 3GTHA 2PTWA 4RR4A 4QLKA 2WMIA 3CZJA 3SECA 1C8QA 4A2RA 1MDLA 3PWIA 1GGOA 2ZQ0A 3KHDA 2UZ9A 1MUMA 1TV5A 3APGA 1JFHA 1TPC1 2I1OA 1NDZA 2PTYA 5HMSA 2VHLA 1AJZA 1UD8A 2I17A 4C7FA 2SFPA 1GZGA 4JXCA 1AJ2A 3TFCA 3GAKA 1QHOA 5CC5A 5F1VA 2MUCA 1LWIA 3LCFA 3QMSA 4AZBA 4HCLA 3PTMA 1L6SA 4F8XA 2O9OA 1QBAA 2C79A 1Z32X 4IT1A 3PZOA 2O9PA 3G0SA 4H7ZA 3MUIA 4DUVA 4UIOA 1IE7C 4C1KA 3TA9A 3N29A 3CQIA 2YA1A 3F5LA 3PNZA 1XBYA 1M53A 3WD1A 1PUDA 1G67A 1DHKA 4AD3A 4JX5A 4LC8A 1SFSA 4Y9PA 3H53A 4JTRA 1BLIA 5EMKA 2WVVB 3SBFA 3UERA 2WNQA 3VIMA 3PPFA 2PF8A 4IHCA 1TV2A 1H0GA 2YL9A 3LQLA 3OU8A 1OX6A 2BNJA 1YW1A 1IEVA 2OYKA 1E6XM 3STGA 5C9WA 5FJOA 4QEHA 3GDMA 4CU7A 5H8PA 1CB2A 2E3ZA 2I56A 2INZA 3XISA 2JKEA 1NFBA 3RF9A 2ZYFA 3IV3A 7TAAA 3VOJA 3WMLA 5CJ5A 2NV1A 2JEQA 3M16A 2PLCA 3CZKA 3ABZA 1LWJA 4KKXA 5IDIA 4S3FA 3C2OA 1VJZA 5J04A 2CU0A 4B3ZA 2OZ0A 5LKYA 3UJSA 2WW5A 1O5QA 4Z1YA 5GNXA 1HP4A 3FSTA 3LI1A 2BG5A 4HP5A 3W70A 3B4UA 1T99A 1W1A1 1Y5XA 2OLHA 4CCDA 2RFGA 4XBSA 2FZMA 3NQVA 4HD5A 4UFMA 2IKGA 3O16A 3LHZA 3KFTA 4KEUA 1KFLA 2DUZA 3W7QA 4AISA 1S5WA 3WO8A 1PS9A 3W82A 2REQB 3P14A 3CEPA 3T0BA 2R91A 3WBXA 1W9UA 1MW3A 1K3UA 4C6LA 3CL6A 2PWDA 4CNTA 1JL8A 4XBJA 3K2GA 4GZEA 2Z2AA 4X2PA 2ZDRA 3IGSA 1C3FA 5I7GA 3CZLA 3RILA 4JTEA 4MLJA 3A9IA 3DFSA 4A8RA 2Y88A 3QSRA 1JCNA 3ABXA 4MYXA 5CZJA 5C8BB 3CV7A 2GGJA 1UW9A 3IUDA 3OHIA 1SM9A 2X1TA 1K03A 3E2RA 4IMAA 3TOYA 4UR7A 4UOQA 3IVUA 4OT7A 3DGRA 3KE0A 3VKBA 5A94A 3IGUA 3TDFA 1UPPA 1POKA 4Q7BA 4GVIA 3EB3A 1EGVA 2IQ0A 2PZ0A 3LPPA 4A3UA 3HTWA 1ZSXA 4IL2A 2W63A 3THCA 3HQ1A 4DBUA 3T44A 2GUUA 1D3HA 2EHHA 2BTMA 4AD2A 2VEKA 4FNUA 4MDOA 4D6EA 4EPBC 1XLLA 1DWGM 4GQ0A 2NZLA 4WJEA 4DUXA 4QS6A 3K13A 1WUFA 3TV8A 4MWAC 4PTWA 1YEYA 1KV8A 1H11A 3GVQA 3NCOA 2QT3A 3VVGA 3ATYA 7ODCA 1I1WA 4LNCA 2ZX6A 3IUIA 2HS8A 4Q32A 3VIFA 1ONEA 1DE5A 1US2A 1GNXA 1GW9A 3PFRA 3VPLA 4K38A 3RM8A 3GUWA 2V3FA 3AQUA 4H7VA 1XV8A 3VX1A 2AQVA 4HYVA 3ALFA 4QAWA 3ZMRA 1A50A 3LHYA 1IZJA 4XAFA 4XIMA 4QISA 4IJBA 1OEPA 3FKRA 1J0ZA 4NU7A 1XLHA 2D23A 4YJ5A 3BXWA 3AISA 4CNUA 4ASTA 3TQVA 5C6MA 2DZVA 3PZGA 3DUGA 3WK3A 1J0JA 2AL2B 4OGZA 4L4PA 4CN1A 3CJPA 3HOJA 2PCQA 2P88A 4RDYA 4UQBA 1V6VA 2NLIA 1I1XA 4HSNA 3W81A 5KINA 4CCZA 4LRSA 1S2CA 4LANA 4ORMA 1NIUA 4I6KA 3TTOA 3APTA 1EKOA 4LRTA 1JCMP 1VD6A 1O95A 2VYOA 1ADOA 3WF4A 1LQ0A 5ECVA 3AHYA 2VJXA 4CCCA 3HPFA 4LVFA 4UNLA 4M8UA 1UROA 2Q71A 1GOKA 4GIEA 2WLZA 1KTNA 4E3TA 3B8VA 1R3YA 4MVAA 2C8NA 3HGSA 4ILSA 1P0BA 2CLKA 1M01A 3LY0A 4JN8A 5JH2A 3PUOA 4PSPA 3QPYA 3PJTA 1HJVA 2OO0A 4B91A 3TZFA 4WCJA 1HX0A 3QY7A 4C6IA 1EUNA 4LS0A 4WJ8A 3VDAA 3GG0A 1F2JA 3SRKA 4RX0A 5FEZA 2C1IA 4XZBA 1S2AA 5T9CE 4Q8MA 3SJ3A 5CSRA 5MKGB 1YXDA 1Y8BA 5FAGA 3NYDA 2BS9A 4FB7A 3H24A 5C70A 2XFRA 4CD6A 1XI3A 3RX3A 1VR6A 4GY7A 5HNUA 3OQEA 2NQ5A 1XDLA 3CZGA 3ARQA 4XKYB 3TAKA 3NQMA 4IIEA 2FHFA 2F61A 4AY7A 4X0VA 3ITVA 5AYBA 1PZ1A 1QW7A 3B8TA 1UKPA 3LGEA 4CVWA 4ZO6A 2W27A 3LSBA 1NOUA 3RCMA 1IWPA 4W87A 1G94A 1WAWA 2PBGA 3OG3A 3AIWA 4DXVA 2AQWA 1ME8A 1KBIA 1JUKA 2O4MA 2VO5A 2VX4A 4LY8A 2ADAA 5EL1A 2IUZA 1OD8A 5CPLA 4WX2A 2QDEA 4OTKA 1QVBA 4DF1A 1B3ZA 2X0SA 2YB1A 1XKJA 4P7RA 1IIHA 3B0VC 4RDVA 5DT5A 3V0SA 1B4KA 4GOAA 3DG3A 4LVAA 2Y2WA 4DJDA 4ZMGA 3CHVA 2BHUA 2NQJA 4RDZA 3RCYA 4DWSC 2QPSA 3N14A 3QYSA 5J5DA 4O19A 1AH4A 4BS0A 3TYEA 2H3BA 4C65A 4KCWA 2DDXA 4PCFA 4RZ4A 1KTCA 3WF0A 4MNLA 3QV7A 1SGJA 3LNMA 1I0BA 3QW3A 4DJFD 4NZ5A 1QCWA 1B31A 2FZ8A 3U57A 5AHNA 1FCBA 1TX2A 4BEUA 3NEVA 1UWSA 2MANA 4R3UA 3LM7A 2WZMA 2JIEA 4XZ9A 3V1HA 3CZEA 4NZ1A 5EFFA 5SWUA 4JTIA 1LRTA 3SGGA 4M3PA 1QPRA 2FJUB 5I3FA 4F0KA 2A3AA 3M46A 5ECUA 4Q7IA 4JHMA 1WE5A 1FVPA 8TIMA 3SIMA 1RVKA 2ZDSA 2YGYA 2GPTA 4LPCA 5A95A 3WG6A 1GVEA 2WZHA 1KC7A 1EH9A 1ITXA 1BG4A 3H2OA 3D5HA 4L56A 2Z0IA 3T2OA 2Y6ZA 4UTHA 3A9BA 1VHNA 2I5IA 1J12A 2VZVA 4D6FA 2ACRA 2XGZA 1TJPA 5C55A 1CX9A 1C90A 4P61A 2LLEA 2VQUA 3SO7A 3KHJA 3IAQA 6REQA 2RKXA 1OM0A 3IANA 3BLLA 3BTNA 4UTJA 1Q6GA 4NZ3A 1IXPA 1WYIA 1W3NA 3MSGA 4MB1A 5D33A 1IEXA 1R3SA 3ZT6A 1EIXA 2WBGA 1WV2A 1TB3A 4JTCA 2PRLA 1V93A 4KWOA 1WZLA 3TU9A 4XD3A 4N6EA 1A5SA 3PVFA 2WBKA 3TYBA 1V6XA 2C0AA 4MUPA 4O4WA 1H4PA 3ZWSA 1EO5A 5EMJA 2OYLA 4Y9OA 3IIXA 1TZZA 3JR2A 5G2WA 1MDRA 1FDYA 1RY0A 4C6NA 1HJSA 5JUVA 1J10A 2XIIA 4RCXA 4ZODA 4PODA 2ZWZA 3ANUA 3M0LA 1ME7A 2FJKA 3IVTA 1H41A 3THDA 1W3TA 5BMXA 3MUCA 4L6OA 4RV3A 5H2ZA 4KPLA 1FWRA 3NQEA 2I9EA 3DYOA 3WDRA 5JH1A 4AXKA 4US5D 3SFKA 3GNOA 3ZJ8A 2PWEA 5H8MA 4ZOAA 4EPKA 5H8UA 3NL5A 4NAFB 1W9DM 3RMJA 2CBUA 4CCEA 3VNIA 4YYFA 2QIIA 3I4EA 3KOYA 4UTUA 2R1KA 3P62A 3GTFA 4ADSA 2CLEA 2X1RA 3KS5A 2QYGA 2VFIA 1GVQA 1I2OA 4DXXA 4LC6A 2I5GA 1QK2A 1VLWA 1XRFA 5CLTA 4MAZA 4S39A 2X05A 4AVOA 4V15A 3WLSA 4NRRA 5DBTA 1HKIA 4O1CA 1Q3NA 3ISIX 3NQAA 3S2CA 2TODA 3USZA 2YZRA 1NY1A 1WXYA 4FX6M 3S5OA 1P43A 1DEDA 3OVPA 1E1FA 1UUQA 1XSIA 4FXRA 3HN3A 3DENA 4CD5A 1OCJA 3W27A 1ZAHA 3CAQA 3RAOA 1EJRC 4HMCA 2Y24A 2RDWA 1GJPA 1VFMA 4J3ZA 2WCGA 3N4FA 2WPBA 3DYMA 1F05A 1WP6A 2BSLA 4N6FA 4ZEPA 4LFYA 4PUNA 1R86A 3IJQA 3GIQA 2Z29A 4IF2A 4LCSA 2C14A 4GVGA 2X42A 4W8BA 2QMKA 2O92A 3T6CA 1Q65A 1W32A 3PBYA 3TNBA 3HV8A 3M43A 1TWIA 2H9AB 1O5XA 4HTBA 1O4UA 2XDFA 3CS2A 5AECA 4BWLA 3L9CA 3VGDA 1MWOA 5DELA 4REQB 3LLFA 4LSBA 4XTIA 3D0CA 3C0JA 4XVEA 4WGXA 1AD1A 3C2YA 2G3MA 4XAYA 1LTDA 3NDOA 5FL0A 5C2XA 3AU6A 3KW3A 2XWEA 3N2XA 2AGTA 9RUBA 1WDRA 5LNSA 3S2MA 4AF0A 4N9EA 3ECQA 1X1ZA 1TWSA 3N12A 4J1OA 1VJSA 2CHNA 2E5BA 4H3DA 3GDKA 1JYWA 4BF7A 3PUDA 4ZO7A 4JS3A 2DSKA 5AHEA 3RHGA 3M4HA 1X39A 3LTSA 2PS2A 2PGWA 1TJ0A 3BCJA 4KQNA 3MU7A 2FMOA 4G5DA 5E09A 3TJIA 2JGQA 3TJ4A 1XSJA 1P7TA 3GXPA 1E3XA 2BASA 1DJQA 3U6WA 2A2IA 3BK0A 1ALDA 2WCSA 1A47A 4RNJA 2DT1A 2QCGA 3V16A 3UWZA 3LB0A 1SFLA 5E1QA 1NF0A 1XIHA 2OYMA 3CBWA 4HN8A 1I60A 4AH7A 4DX3A 1FX6A 4JOMA 3UWWA 3EDEA 2ABAA 2PI6A 4IGSA 5JXQA 3GAYA 4J3WA 3NFUA 3ALGA 3W84A 1DWFM 3G0UA 4S38A 1B3YA 2HTMA 5IM51 3SY5A 1ISZA 4E2DA 4QCFA 4HHMA 1YPFA 3PWGA 4ZE5A 3TOPA 3BLKA 4CU8A 1BGAA 2XVPA 4PL1A 4PCPA 3CMFA 3M5VA 4IQJA 3E12A 3SRFA 3PBVA 2YCEA 3FA3A 2L5HA 4JIEA 4EXQA 3W76A 5HATA 1OGGA 4MAVA 4MFDA 3PPHA 4S3BA 1UA7A 2XN1A 4FIQA 6REQB 3S1WA 4MSSA 3WY1A 1QXLA 3CH0A 3O1NA 4J3VA 4PEKA 2GDQA 3L68A 4LQ1A 4IPLA 4LVBA 3HPZA 1JDDA 1UKTA 3K5XA 4LX4A 1IYXA 1GWJA 1UR0A 4EX4A 5I2UA 1LOLA 2A3LA 1VCGA 3WH8A 1UR1A 4CQ9A 1K4HA 3HG3A 3HG4A 4B3LA 3N6JA 1YTKA 4L1GA 1DXEA 5CH9A 3H7RA 1RV8A 2VZOA 3EB4A 3O6YX 4GO9A 3R13A 1QBBA 1EBGA 4QDMA 3ZQ9A 3S6DA 2OLSA 3KBNA 3KLKA 2RJGA 4QFUA 4UFHA 2VOTA 3UG3A 2CKSA 2CZFA 5AC5A 1SJBA 4GINA 4YCPA 3V18A 3GSMA 3V7PA 3NZPA 1EGZA 3L67A 1D2KA 5HDRA 2HZGA 1PWLA 1V79A 4P8UA 1V03A 1OYAA 3WELA 1FWEC 1TO3A 2JKAA 4DQWA 4J3TA 1XD0A 1EF3A 1FWFC 4AYSA 3EDJA 1Y5WA 4OU1A 1GTHA 1GEHA 3W73A 2TMDA 4E38A 2WHLA 3BLFA 4NP7A 5LIXX 2A6LA 4HK6A 4GZJA 4QG9A 3ZZ1A 4O18A 4IX2A 3B04A 4FOJA 4KESA 1KGXA 1QW8A 2GZXA 4PUMA 4TUFA 4PA8A 4GACA 4D8AA 2RUSA 2ZUTA 4J35A 1I2RA 3NXFA 1PTAA 1FWAC 1LT7A 4KF1A 4LUYA 5GJMA 4F2UA 3SCPA 1RA5A 4KBXA 4E5TA 5BMWA 2DSUA 3A22A 4O8AA 4PUJA 3MVTA 3SCNA 1FOBA 5GQBA 1Q5MA 4MKVA 5K2ZA 2PMQA 4ENLA 4NI3A 3CHCA 4PRRA 4QG6A 4LS2A 3WQFA 4PBEA 1MXSA 3QR1A 1V4YA 1EDTA 2B81A 1OGBA 3SUVA 1J01A 1SO5A 1J0YA 1DJHA 3P82A 3CL7A 3ARPA 4HPHA 1EGMA 3IIVA 1EYWA 2BOEX 3A23A 3MWCA 4D71A 3TW6A 3B0XA 3DERA 4D6HA 4IM4A 3UWYA 3HJZA 2V2HA 1EC9A 3FSUA 3EWCA 1Y7VA 2ZZ4A 3QYQA 3R4IA 3AS2A 3GYEA 1KCLA 3IWPA 3L4ZA 3NM1A 4A3QA 3HF3A 5J5RA 2KX9A 2RJHA 4HIBA 5A5WA 3O3RA 3V5OA 2NWRA 2JKPA 3MBDA 9XIMA 3CHEA 1R30A 1OT2A 2G4JA 4MWAA 1E3ZA 4O10A 3PNUA 1XUUA 3MKVA 1NARA 1HW6A 1S3TC 4C6FA 2WSPA 4AMAA 1OYCA 1Q6CA 3SSZA 2ZX8A 1F3EA 2PDKA 4O1BA 1KXQA 5FI8A 1GTEA 3OVRA 2X1IA 3MO4A 1PL9A 3P84A 1GVIA 2IKJA 4DEFA 2XVNA 4UMAA 1QOQA 3GNDA 1AJ0A 1OIFA 3TSMA 5D9MA 1OFPA 3MI2A 2J6XA 2E6DA 1M5WA 3VMNA 2PLKA 4KFPA 3NPXA 4KRZA 1YXYA 4FP1A 2FKPA 3HQPA 3FOKA 3EA3A 3NWRA 1K7XA 2OX4A 4U4MA 2IW0A 3CT2A 1CXEA 1CXHA 1JYVA 2I9UA 3BW3A 4LUSA 4DPQA 2BOGX 1TR9A 3QV9A 4PMRA 5REQA 1Z7AA 3KAOA 3EOOA 3ZT7A 4HPGA 1FWGC 3P0XA 3WNKA 2W3ZA 1LQ2A 1PEZA 1VYRA 4TOQA 3ITTA 4ERGA 4NZCA 1E40A 1QR7A 4W89A 5I6SA 2VWSA 3AU2A 3WFAA 2G3IA 1C9DA 2F38A 1BPLB 1HZYA 4EVZA 1JZ7A 1ZP3A 4TX8A 3FXYA 2CCRA 2I57A 3E2SA 1VFHA 5M3WA 4TV6A 1A5MC 4I3GA 2NX9A 5HA7A 4FALA 3W25A 3GG1A 3DOPA 2EPMX 5F4SA 5EMYA 2QVNA 3WLNA 1VBRA 3EYPA 3M5YA 4OUEA 4Z2IA 3I6TA 2OZTA 2QQ6A 2Q3OA 2DP3A 4WIWA 3RO6A 1Q7QA 4ICMA 5AFDA 2QJJA 2P0OA 1GOIA 1QRQA 4JKLA 4M7SA 4QQ3A 5C9RA 3GDBA 3U0HA 4XBKA 4REQA 3EXSA 4GI8A 4AHQA 1H09A 3OLEA 2B7NA 3CTTA 1H1NA 1CEOA 4IMFA 4BF5A 3W07A 3TN4A 2ZXBA 3B9NA 4BZYA 1JZ3A 1FXPA 3STFA 3DFHA 4RXFA 1M7XA 3G8RA 3S4TA 4UC5A 2HPMA 3KS6A 4GYPA 5JBFA 4L9YA 3UJFA 3PG9A 3CASA 3TWBA 1I75A 5FESA 3AUJA 5CZKA 5LIYX 5HNTA 2HRWA 3TQKA 1UH2A 3TTYA 2V81A 2RDTA 3W7KA 5HNRA 3VD3A 3QEZA 1JPMA 4F48A 5F2GA 4C6KA 2BY1A 1KM1A 3CQHA 5I02A 5CGTA 4AX6A 2QJGA 1FHLA 1J5TA 2FQIA 3RU8X 3RYSA 1A5AA 2V3GA 5XIMA 1DHPA 2WNWA 2WV8A 3BJFA 1C92A 2Y0FA 1E0XA 4Z08A 3FYOA 4R88A 4XD4A 2F9RA 5A8MA 1S5MA 3WH7A 3I3BA 2HQAA 3PBMA 4C1LA 3EKLA 4MADA 2VL4A 3O9NA 3GU2A 2BOFX 4U10A 4S3CA 2GVEA 1BQCA 1VF8A 3EWDA 5HINA 4GK8A 1PHWA 2XTKA 3MBFA 3VZZA 1EJTC 2JK2A 1OGSA 2P5NA 2GGIA 4PMUA 4JNYA 1G4PA 1XW8A 5M2FX 2P53A 2ATMA 4UQ9A 3T2QA 4PMQA 2QJNA 3ENLA 2EEXA 3WNLA 5FOOA 3QY6A 4AQLA 3LHWA 3IJIA 1E6NA 3VDGA 1EXPA 4PUEA 5C7VA 3GTXA 3XIMA 3KP0A 2Q8LA 3AFBA 2V30A 3A4WA 3C56A 1MFUA 2H9AA 3S47A 1HNYA 1E6QM 3TR2A 4B9YA 1OBAA 3LCIA 1V0NA 3TC7A 2V3DA 4IIDA 1NELA 4PC8A 1DJIA 4HT3A 5HJLA 1D9EA 5FSEC 1ZU8A 4G9PA 2W0UA 2VEPA 4RW5A 2NX3A 3Q37A 3PULA 1M6JA 2PC8A 3CMGA 3LPGA 4H41A 1UR3M 2ZIDA 3S0CA 1ZJHA 1VLIA 1MEWA 3OBKA 3U4FA 4PMJA 3R58A 3IJ8A 1S5NA 3DKJA 3G18A 1W3IA 3A4XA 2Q02A 4JTGA 4PMNA 3VNMA 3WNOA 3VNDA 2G96A 2Y8VA 4Q8QA 2GUYA 4IMEA 4X0NA 4B2DD 5I3DA 1N8FA 3MW7A 4PBFA 4YWIA 4JIIX 4H2HA 4Z2GA 3GH5A 4GUGA 2WVUA 3NSXA 5A3HA 4GQRA 3RG6A 1EP3A 2D3NA 3P7YA 4X63A 2PCEA 4DZIA 3DG7A 3SN1A 3LZ5A 3NVTA 2WJFA 5D04C 1NFGA 3RLUA 3W22A 1ZL1A 3BZGA 3M5XA 2ZCGA 4QE4A 1CGXA 1I2PA 4MZYA 4Z0JA 1HGWA 4GIAA 3HQNA 3C0LA 2F84A 3KWXA 3KCJA 4MFEA 4JBRA 3WN6A 3GBDA 2CKRA 3W0KA 4R53A 3W7PA 1CXFA 1T6MA 5BYWA 4ZO9A 2AAMA 3B40A 1V6UA 3W2NA 3VOFA 1GZJA 5K4ZA 5CJNA 4OBSA 3L12A 3F2DA 3GXNA 2J27A 3MMDA 1OQFA 1WOBA 2Z00A 1ITCA 3G1AA 3UP8A 4GUFA 2WK2A 4LAMA 3TE9A 1R5YA 4GZIA 4L1XA 4F40A 3WJZA 2YA0A 3QSTA 1YE4A 1S46A 3U8GA 4PMYA 3OZOA 2ZE0A 3TTSA 4H83A 4IPPA 2UV8G 2VM8A 4HKPA 1SZFA 3K1DA 1B4EA 1UBSA 3L5MA 4LEFA 4JCLA 2O9RA 4TX9A 1ICQA 2R1LA 2G3FA 1JPKA 5EPDA 3L4VA 1DPMA 1XS2A 4L5ZA 4WHBA 3GHRA 1TWDA 4IP4A 4K39A 4Y8FA 4WXZA 3GK0A 5LYRA 2ALRA 2NXIA 3IJ6A 3OBAA 1HT6A 4E8DA 4NKCA 1RP9A 4O28A 1EC8A 5CPNA 2V82A 1BKHA 1P0EA 1XYLA 4X2RA 1R3TA 2IKIA 3AALA 2VTFA 4GJJA 1IXQA 2PU0A 5FJJA 4JIQA 4K68A 3CO4A 2XIJA 2CC0A 3ARSA 4LUSB 4NX5A 3G1HA 1W1VA 4DJED 1I8JA 3GW0A 3STEA 1PTDA 1TVNA 1RD6A 3GLCA 1LOSA 1J5SA 4DAFA 3PG8A 4PCNA 1WXJA 3AXXA 1CW2A 4HOXA 2NQ9A 4BQ5A 5I03A 3TIMA 5GNZA 2WCAA 3WLRA 2PEVA 4ZENA 7XIMA 3UY7A 1M7PA 1V6TA 4N7QA 2QDHA 3ARXA 3O8AA 3LBMA 4HQVA 1FWIC 2FHBA 2VXNA 3VNLA 3V75A 1OY0A 2P50A 1OABA 4XZNX 1EHNA 3NQ8A 3NZRA 1KM0A 4HNUA 3GVRA 2WB5A 3LPFA 2R1PA 3HURA 4YIWA 3GNPA 3CT7A 2ZOXA 2EQDA 2D3LA 3KVKA 4DWDA 4D8LA 5BOOA 3EOUA 2VX7A 3UW6A 3IJ7A 4RXGA 3MMWA 1AQFA 2WSQA 3UWEA 4FX7A 2TAAA 3EX3A 4IIHA 1PKLA 2V68A 3UFYA 3AZSA 3P60A 1BEUA 3EX2A 3W1RA 4GXWA 4KCTA 1HKVA 2E1WA 3T8LA 2O56A 3NOEA 1R87A 5AC4A 1NWUA 1DIKA 1FH7A 3F7JA 4JTSA 3CM4A 3U7VA 1MSSA 4WSJA 2J9YA 2J8FA 3IJLA 4CEUC 5PTDA 1G5AA 3DN5A 4RLIA 1E71M 1YBQA 4GD0A 2OLAA 4AD0A 3ITCA 3B9OA 1DJGA 1BYDA 5D9NA 3W00A 3IIZA 2DEPA 5IHSA 4S3GA 3ARTA 2Y5JA 3MHGA 1HVXA 5DBUA 4O17A 3PFMA 4ICCX 4D6IA 4LAUA 3F4CA 5GPRA 8XIMA 4PYSA 1KFBA 4ZA0A 1EJWC 3D6NA 3A3WA 1DWAM 4B16A 5D9PA 3TCEA 3A64A 5I3JA 4MNMA 1H7NA 2VCBA 5ABFA 3PZVA 3U9IA 2QCFA 1EJXC 3SDOA 3H22A 3UNTA 5D32A 3SSJA 1IT7A 2WKJA 1ZBCA 3DH7A 4ZE4A 2FMNA 2EJ1A 3KVLA 2Y7GA 4A2SA 1XBVA 2V5JA 4S3KA 2OWXA 3A12A 1LT8A 3RUBL 3BZJA 5FF4A 1H50A 1SJCA 4Z17A 3OLDA 3RCNA 4EWND 3O2LA 1Y5VA 1CGUA 1YQ2A 3AYVA 1F07A 3BV4A 2QULA 2Z1WA 1MMFA 5HWMA 1POJA 4JIPA 4V28A 2PDCA 3AMDA 1BTMA 2QCNA 4CD4A 3NPVA 1D3GA 3WK0A 1TX0A 2W92A 3I65A 2R1MA 3ONCA 6TIMA 4HA3A 2BDQA 3T1GA 4QCEA 4GYJA 2BMBA 3S5SA 3CL8A 2E77A 3AS0A 1VFSA 1W9PA 6TAAA 2XM2A 1GW1A 2J8GA 4L6HA 1Z41A 2IKHA 5DMNA 2CLPA 3S1GA 4CNSA 1N7KA 2QJIA 3P67A 2DZTA 2W4XA 4LAKA 2YZ5A 4Z2HA 1XIEA 4XSMA 1BTCA 4KGJA 4N9DA 1JVNA 4JTTA 3VA8A 1NJJA 2B4GA 3U2OA 1RCQA 2PDPA 3TX9A 2VGIA 1TYGA 3M0ZA 1JI2A 3QQ0A 1K6AA 4IIFA 3UR2A 3MUAA 2HMCA 4AZCB 1D8CA 3GFYA 3DFQA 2VMFA 4I7WA 1AW2A 2CLIA 3H2MA 4FNPA 1EO7A 5CXPA 4ZQPA 2Y89A 3U48A 2A21A 4AEEA 3DDMA 3HJEA 2C13A 3TW9A 3KDOA 4CD8A 1J8VA 4WEVX 4JFSA 2VFEA 4GVFA 2OO6A 3HPAA 3K30A 3KOWA 1JRCA 1FH9A 4TU1A 3MSRA 4RW3A 3PTKA 1IZCA 1QFEA 2PDQA 3PSVA 4B5WA 2FTPA 4AHPA 4WJXA 1AQHA 2WHKA 5B80A 4UZUA 2Y61A 3FJLA 2FH6A 3BCDA 1E9YB 4FI4A 4JFUA 2V2DA 5A2CA 1MQRA 2Z7GA 3ITOA 2ZRZA 1TV7A 4UQCA 4A3RA 2PE4A 4ML9A 1P1XA 1OB0A 3VNKA 1F73A 1Q63A 3BG9A 4RE4A 3SQMA 5ABTA 3MKKA 1XLGA 1F4HA 3W74A 2JQXA 3BAXA 3HIJA 4CN6A 1QT1A 5A69A 1LG1A 1VYPX 3OBEA 5G4WA 3QBUA 3LCGA 2EPHA 2NUYA 4R9OA 4C1NB 1QNVA 4LB4A 1LDCA 1AZ2A 1B57A 4L6DA 2WHJA 3WH5A 2XN0A 2NXHA 4M6PA 5LIUX 4WKHA 4B4FA 2YW4A 4LF2A 3QPZA 1S5TA 3LRKA 4PMXA 5AYIA 1KQYA 3NYZA 3L2MA 1UD2A 1BWVA 3NZ1A 4O57A 2WO5A 3AI0A 3MKCA 4R7JA 1UZ1A 1Z48A 3F5KA 1VIZA 1P6CA 4AY8A 4AW7A 3UZZA 4NXSA 2A7PA 1QTWA 3KRBA 4NJIA 4EPDC 2ZXQA 8CGTA 4HYRA 1EXBA 4LH8A 4OUIA 4XAPA 3QHOA 1T7LA 1R3WA 3LHTA 1O1ZA 5IOBA 4HB7A 7ENLA 1RZMA 3II1A 2PPGA 4QE1A 1M04A 3P5YA 1R2RA 3MMUA 3TWAA 4V1YA 2BXYA 3BURA 1I4NA 2HXUA 1GG1A 2VD8A 3UESA 3LERA 1GPWA 1R9YA 1ZRQA 4GCAA 3WL0A 3E0VA 5REQB 1UD5A 1PV8A 2QLYA 3FGCB 4ZXLA 1AH0A 2JE8A 1OG0A 3R7MA 4QSHA 8A3HA 1B0IA 1LP6A 1EPVA 4JEJA 5D4YA 4DNMA 1RCXB 1KFWA 1SUXA 3CHFA 4QRNA 4Q8VA 1ML1A 1J18A 4HU4A 1VAHA 3DFPA 1Q4NX 5B7ZA 5M03A 4ORIA 1UR4A 2Q3RA 3CV2A 3T0DA 3R8RA 5EY5A 1DQUA 4H00A 3WNMA 3WUFA 1JULA 1H60A 2HBVA 3OGRA 1SSGA 1UMYA 1S1RA 3QN3A 4ADTA 2ZA1A 1FY6A 4NF7A 2VP8A 1C29A 4H9XA 2ZVIA 2VEGA 1E51A 2QZRA 1X8FA 4WR3A 3SUUA 4XIAA 4BY3A 1Q8AA 3WQGA 4L65A 1P0KA 2INEA 3OGVA 3F2BA 3AWOA 4FHAA 4B4HA 5AYXA 4NAEB 3VCCA 1PBGA 2DT2A 1DQWA 1GQKA 2XGIA 3F4VA 4D2JA 4DJDD 3Q67A 3OYZA 2H6RA 2DVTA 1J11A 3GU9A 2VRJA 2XH2A 4LBRA 4HNNA 4GQQA 2UY4A 3WF3A 4MMWA 3I6EA 3CH9A 2ZTKA 4OBRA 1RQBA 3VM5A 3LQGA 4WUIA 3RO8A 3BAWA 3G1SA 1EX1A 4ZTXA 1ADSA 1WKFA 5FCZA 3PC0A 3SRHA 3NQGA 4PB3A 3O6DA 3W75A 3GC5A 3HPXA 5HQEA 2GJLA 2VX6A 3RRAA 1HJUA 5LIWX 3N04A 1PHQA 4KIEA 2OXNA 4R7WA 1F8MA 3BOXA 1GVYA 4ACZA 4DZHA 3SGUA 2PBOA 3OIHA 4M6QA 1F6PA 4JY8A 3KOZA 2CETA 2GDVA 4DBWA 4A22A 2D1ZA 1Z69A 1XUZA 5DLCA 2V5BA 3FAXA 1TWZA 3LX9A 1K9DA 1EF2A 4XZWA 3VE7A 4L4OA 3BPWA 1V51A 2XVGA 2P3ZA 1DJXA 4ZZ9A 1K9EA 4AAJA 2QMJA 1A3XA 5TQLA 4U2YA 3W9ZA 4TXEA 6CGTA 1EC7A 1FCUA 1XLJA 3R11A 3CWNA 3L0GA 3VE9A 5DXYA 3EA2A 3FDKA 4DB7A 5F2MA 4DI9A 3VCNA 3MUXA 2XYLA 3P2VA 5H6HA 1LLZA 3RM4A 1YMYA 3GKAA 1XIIA 5G1YA 1T8QA 4HCDA 1BYBA 5FD0A 3ZXWA 3W87A 5BW6A 4JQ1A 3AO0A 4XKMA 2YLLA 2GGHA 4L80A 4KEZA 1LBLA 2FFCA 3WMCA 2XU2A 1TPUA 3UJ2A 1R9ZA 5I09A 2YXGA 2ZZ2A 3AIUA 1BD0A 3SUTA 3JW7A 3NVDA 4FF5A 3ONBA 1PO9A 4G6CA 3WJXA 4PTNA 4A21A 1PKYA 3AWNA 3G1VA 4JD4A 1QO5A 5D09A 4DELA 3ANYA 1ZTVA 4NNAA 1UR9A 1HTIA 3S6OA 4HMNA 4YN5A 1AQ0A 3MA8A 1VIWA 1K02A 5M1TA 1S3HA 1DXFA 1JJKA 4HPXA 3W85A 2X1SA 2ZWYA 1VFUA 5G2HA 1JF5A 1ZJBA 5BRQA 2FVKA 1B90A 4M1BA 3GXTA 2AMGA 1W91A 4US5A 3SW6A 4KWUA 1TA3A 2WC3A 1NQKA 1VZWA 3WD4A 4S3AA 4X60A 2CERA 5G5IA 2FDSA 2W6RA 1HL9A 2DT3A 4NAEA 1U1HA 4LBSA 1L2UA 3P5ZA 2ESCA 3WKZA 2XHYA 1V3IA 2VGBA 4KFNA 3IARA 5I07A 4CQ8A 1Q2RA 2J7BA 2Y85A 4D6DA 1UUMA 3GFZA 3PS7A 5FSDC 2WJEA 4UFIA 4U5IA 1ZPTA 3M0YA 3UQNA 5GVJA 4OJYA 3S8HA 4JIRA 2Z1XA 4IP5A 5LXXA 3EWWA 2Y7DA 2BHYA 3L7RA 1BYAA 3M7SA 4ZXOA 1UD6A 4TX6A 1XLEA 3B97A 4AUBA 1OFOA 4M6VA 4Q4QA 5E6YA 1JCJA 3Q45A 2OQHA 5GJNA 1KRCC 3B03A 5E5CA 1H7RA 1XDJA 2GWGA 1XH0A 3CQJA 2DSVA 2GDUA 3KOFA 3REQA 3BJTA 1E4MM 1H2JA 1KR0A 3T40A 2BVDA 4JDBA 2BY0A 3FXGA 3I7QA 4KMQA 2PP0A 1LRQA 3KRZA 1J93A 3NO3A 4HOZA 3TMQA 1BF6A 1OK6A 5DO8A 1SZNA 1B3XA 1M1BA 4I9TA 3SCRA 2B7OA 3W7EA 4PH6A 1LL6A 3AUOA 3BANA 4H8HA 2J25A 4X3ZA 3UG5A 3B8DA 1J9YA 1IXNA 4W7VA 4K8GA 1XIFA 2KZHA 1JZ4A 1UWRA 3DU0A 1SU5A 3AS3A 4PTDA 1REQB 4W5ZA 2NSOA 3I6RA 2W9MA 2HROA 3M41A 3W1NA 1KFKA 4KH2A 4A35A 4BA0A 2E7FA 2UY3A 1TQJA 4M6UA 4IP7A 3WLTA 1QI2A 2ZZ6A 3FW6A 2BXZA 3UR5A 1VFOA 1QI5A 3QV8A 4E4FA 3V5CA 1J0IA 3H8AA 1CLXA 3KP1A 3OG2A 3P8IA 4WVXA 3QKZA 4IGHA 4U5KA 3SUSA 3VOHA 1O68A 2JFEX 3MO7A 1RD5A 3RJXA 2IPJA 1US0A 1Q66A 4EANA 1FKWA 3BMVA 4WDTA 3OVGA 1ZY9A 3U2ZA 7A3HA 1EOMA 4Q8WA 1E1CA 4KEVA 1KWKA 1HIZA 2YCKX 1W8SA 2QHAA 3A5FA 1OZMA 3OOQA 3T2PA 3W6MA 1Q45A 3W1AA 1VRXA 1Q2SA 3VMPA 3VILA 3WLPA 5H1WA 1UH4A 4F79A 3WK1A 2OZ8A 4FXSA 1HKMA 4KWWA 4LVDA 4BI6A 5HOSA 1MUCA 3PJXA 3UCCA 4LTSA 2GYIA 1XIBA 5FJIA 2GK1B 1W56A 1L6FA 5EA9A 2BBFA 3VOIA 4W4QA 3W7HA 4LGXA 4ZQOA 3DAQA 4OOZA 1JPIA 2D22A 1BXCA 1RUSA 2WLYA 4Q4MA 2PDNA 4G8TA 1PIGA 3OVQA 2J75A 1QUMA 5BNKA 5AC7A 1XLKA 4JTHA 5DMMA 4TO8A 2PDUA 4O0QA 3CGTA 1NH6A 3GZAA 4LUTB 4YVPA 1B3OA 3E0IA 2XM1A 1XPYA 3ID7A 1MFVA 2A1YA 3AIRA 4Q8NA 1MUWA 4F3HA 3IAPA 1RSCA 4H6EA 5ABGA 3NR0A 3BG5A 1WKEA 1ZHAA 1G7VA 3I7RA 4NZFA 1IR2A 3I3DA 3CMJA 1IWBA 4QHRA 2GVYA 3GE7A 4IQDA 2HSAA 1EX5A 1UWIA 3RK8A 3M6DA 4CQBA 3MZ2A 2RGLA 4YU1A 1XYZA 3Q2DA 5KZ6A 3S9IA 3MY9A 3SCQA 2PDHA 5LA1A 2CFFA 3WBYA 1QU4A 3QY8A 4F9DA 3QZEA 1RLDA 2WQPA 3A6OA 2XFFA 1TRIA 3UA3A 1I45A 4CNPA 1IIGA 2E8ZA 1E72M 4H8UA 3I68A 5CAHA 2CITA 2WVTA 1XRSA 3RXZA 3GXFA 2ASHA 2BODX 1SJAA 1XCFA 4RJEA 3H54A 1NP0A 1A5NC 4PUKA 4J4KA 3WDIA 2QPXA 4W85A 2X16A 3UZ5A 2G0WA 4GABA 4F0LA 1UPMB 3L4UA 3GB6A 1UZ4A 2J66A 4ZFCA 3AYTA 3WFLA 4UNIA 2G41A 3ABQA 3WYZA 2REQA 1LWHA 4LAZA 1KA9F 2Z4GA 1S5VA 3HMJG 1EP2A 4ZOBA 2J4GA 5HJXA 3C3NA 4U3CA 4GA8A 1OX5A 4M24A 4IFRA 4QNWA 1UJPA 2QGYA 3NQBA 4N4QA 3GTIA 1RXOB 3GS6A 4GJ1A 4M81A 3ZLHA 1UKOA 3QR0A 2GFTA 2YBVA 3KZSA 2OG9A 2FZDA 3Q65A 3ATZA 3W7RA 5HNNA 4P8VA 1TTPA 3FKKA 3BJSA 4WRHA 4NZ4A 3BMWA 4MOZA 1YKWA 5DEZA 4LT9A 1U30A 4ALDA 1JGIA 4F2TA 2QF7A 4YXGA 4PFMA 3HA1A 3K1GA 2ZX7A 1H7PA 5I77A 5DT7A 2FPTA 4IPJA 1JDCA 2UWFA 3N15A 3A4JA 5HAOA 3EX6A 3CUJA 2XSAA 1TPEA 2E9LA 2D2OA 1E0WA 1W1YA 3VAVA 4IGMA 1ECEA 3W71A 4JNMA 3KOXA 3LZ3A 3A3XA 4A8IA 3DXIA 2HEJA 4GH1A 4HJWA 3QHMA 1CLKA 4HGXA 1EA0A 5BRBA 2PZNA 3GC4A 3C2VA 3UEQA 1JR1A 3B06A 5HBFA 4QDWA 2XH4A 4IQEA 3DFOA 4HSHA 4L64A 6A3HA 3F5JA 2RDXA 3TQPA 1LQAA 2Z25A 3GC2A 4MY8A 3GIPA 2X40A 3PBUA 4RE0A 3W7MA 4CQAA 3PM6A 2C19A 3HMCA 4Z0SA 1JXJA 2FPYA 1PSCA 2Z28A 5T26A 3UR8A 4HBKA 3P80A 2J77A 1SO4A 5FAJA 1K77A 3EDDA 2EF9A 3FYPA 1X6NA 4JFTA 3DIPA 3AMCA 4GC3A 1B54A 2FB3A 1SFTA 4JAWA 3E2QA 3E6EA 1K8CA 3CHDA 3QW4B 2HVOA 3PY2A 3E02A 4PR4A 4EF9A 4UNKA 2YCIX 2QV4A 1X8CA 1UWUA 4MY1A 5C9XA 2FHCA 1OFRA 1HJQA 1W3LA 4GG9A 2QS8A 1I0DA 1YYAA 1W1PA 1XH1A 3BMXA 3ZR4A 2VC9A 1R6WA 4DZ5A 4IFKA 1HUVA 1XGEA 3RITA 1UH3A 4O12A 3KVMA 4UFJA 2Y8KA 2ON3A 4C7GA 4C6PA 2OWCA 5LXEA 3RIKA 2INFA 1GHRA 1DYSA 1U5JA 1XXXA 2DGAA 1QW9A 4LUJA 1E0VA 1O5RA 1CENA 5EMMA 3LXCA 1O7AA 1Q7ZA 1Q6EA 3WH9A 3FIGA 4DZAA 4ZB2A 3QLDA 2QKFA 3O0KA 4UZSA 3G6MA 3QPEA 4A3HA 5ENLA 3SUWA 1LROA 1IXOA 1H0IA 1XWYA 3NQCA 1UZHA 3C3UA 3GUGA 2OEJA 3VIIA 2C71A 2B0MA 4FR1A 4DPPA 2DW6A 3ZSSA 1R0MA 2BVTA 3M0KA 1JDFA 3VI2A 4JIHA 3URQA 5ABHA 5LSMA 1RP8A 2OTDA 2VVSA 3ZOAA 1C8XA 5HUOA 5C2CA 1A53A 4LAOA 3W1XA 2QUUA 2WZIA 1V6WA 1KM6A 3EEZA 3UZWA 1UOKA 5LHFA 4DF2A 4O50A 4P7QA 2ZZ5A 1B2YA 3SAZA 2VD9A 4S1FA 4UMCA 2EGZA 1U22A 3CIXA 2GLKA 1W2PA 3VIJA 1X6LA 3MCMA 3M0HA 2DFAA 5A6LA 2C0HA 4GIYA 4Z1AA 1JXKA 5F4WA 5IFTA 4MNJA 4GIRA 4HMDA 3S2JA 5JVLA 1E9LA 2CPUA 1R3RA 3DECA 4Q4PA 2C16A 2HXTA 2PDXA 2YBTA 4C91A 3V0TA 2VDGA 2D2HA 2PWFA 2OGJA 1SPQA 1KM4A 1NTHA 4L4LA 3WUBA 1S1PA 2EBNA 2FZ9A 2J78A 1PZ2A 3RNDA 4PGLA 2MNRA 4OQVA 1VBHA 2Z6IA 1ISWA 3N73A 5F1UA 1DIDA 3BLOA 2I7GA 1TIWA 3N3TA 1TPDA 1FHDA 4OIFA 3RX4A 4EE9A 2FVLA 1PE1A 3H26A 5LGXA 2PDMA 3SM0A 3O6CA 4AY1A 4HPJA 3O15A 3LBCA 2DQXA 3O7UA 5CC7A 2JEPA 4IICA 1YX1A 2PP3A 5XINA 2R82A 5CC3A 2ZRUA 1OFEA 4JQAA 3R79A 1U1JA 3S3GA 5TF0A 4LVGA 3W7NA 1EDGA 1E70M 5C9UA 1QI4A 1Q8JA 3PUGA 2ALDA 3VIGA 5KSWA 3M0VA 1R9XA 1CGTA 4OECA 4DO4A 3H4XA 5CZTA 4NRSA 1YHTA 3UWVA 4AXNA 2PGRA 2XH0A 4O0ZA 1UR2A 4QDPA 1XYMA 1BHGA 1HL8A 3QLLA 4J40A 1WA3A 7REQB 2AGKA 4MJMA 2WM0A 5FACA 2J47A 1BVZA 3OA5A 3WLQA 1L0PA 3FEMA 1L6GA 2OJPA 4C5ZA 5IXEA 3KCLA 2CLOA 2DZPA 4ICNA 3I3EA 3G77A 4M19A 3DGBA 4PMZA 3WBAA 3VDHA 3UZXA 2AOSA 1CBGA 2PB1A 1JUBA 2XIBA 2G4FA 1MVYA 1IGSA 3RLHA 2PWUA 4QXIA 3TYUA 3KL5A 1EJVC 5DN1A 3AS1A 2QF8A 2ACSA 1EEXA 4FNQA 4BQ2A 3O05A 4AIEA 3THAA 1C91A 3WBWA 3BW4A 4OWGA 5FJRA 4KGLA 2VZTA 4ATDA 2B31A 3W24A 2O4QA 1MXGA 1FWHC 1B3VA 1JPHA 3M1ZA 3P93A 2A79A 1VQTA 1V3LA 4AVFA 1EBHA 2EO7A 3M07A 2W62A 1Z9AA 1E6SM 2EPOA 4Z1BA 1QO2A 2WAGA 2OMAA 5EFDA 1NWTA 1ZAJA 3O07A 4HOWA 3WNPA 3GNRA 4Q8TA 5CBBA 3TJLA 3ZVHB 3UG8A 1ZBVA 2E4TA 2CZDA 2DVXA 2IQTA 4LYPA 3NGJA 1HQTA 1XIGA 5CBIA 4NX0A 1GONA 1WX0A 1VBGA 4HYWA 2XWDA 4IGNA 2DQWA 4DN1A 1QATA 4PBGA 2IS7A 4GI9A 1ZGDA 4HMEA 3M0JA 4UQEA 1HVQA 3VNZA 4PRTA 4DJDC 1CT5A 2DSWA 1JCLA 2A3CA 1E4LA 1BF2A 4UXDA 1H1YA 4Z42C 1MW2A 5CJMA 1GHSA 1V6YA 4Y2WA 1RA0A 4MWAE 1FP8A 3AIEA 1UD3A 2ISSA 3IS4A 3Q94A 3WDPP 2PTDA 3MHUA 2WJZA 4FS9A 2CLHA 1QMLA 5C71A 5ABEA 1SQ7A 1G6CA 3UT0A 3BQ6A 4Y90A 3LLDA 3C2RA 4DI8A 2E6FA 2VDHA 4NILA 1UD4A 1TTIA 1RY8A 1QI0A 1P1MA 1XLBA 3MSDA 1W3KA 4KEMA 4JKKA 3C8NA 3T7VA 1EYEA 2I14A 4TVDA 1FCQA 4AZ7A 3NO1A 2HISA 3WDJA 5HPOA 4M80A 3VKDA 5KZEA 4MB4A 3EBVA 5C7HA 1A5UA 2HVMA 4JR5A 4WK9A 3QZ6A 3QZAA 4MB3A 3B4YA 4KW2A 1PKMA 2VC5A 1EOKA 1RJPA 3LXBA 4UCGA 3AHVA 2Y4SA 1A3HA 1IT0A 4WXYA 5HK4A 1BQGA 2X2YA 3T4WA 3UD6A 1AQMA 2QPUA 1LL7A 2C1GA 2YOCA 4AIBA 2WMFA 4HNTA 4GX9A 1XRTA 4K8HA 1VHCA 2BY3A 1VEOA 3VKKA 3CEUA 3DI0A 1TUFA 2WYSA 4XZLX 1W54A 5HQMA 4L9XA 3GWQA 1E15A 3L2LA 1FWTA 3U2EA 2BXVA 2EXOA 4DHGA 1VRDA 1MQPA 3H2NA 5I3HA 3EZ4A 2Y5SA 1OYBA 4GUHA 3HQOA 5D38A 5AY7A 3AZRA 1KKOA 3L23A 1FQ0A 1NP2A 4GNVA 4EWJA 3R12A 1EL3A 1VFLA 1AZ1A 4NASA 3GBEA 5CBJA 5CG7A 1YPXA 5U7SA 1HF6A 3KDNA 4IL0A 5CSUA 2QDGA 2O7QA 1BXBA 1TJRA 2DIJA 1GQIA 4R9XA 4JHOA 3VABA 4FSAA 3BH4A 2GOUA 3UXDA 3WD0A 5A6AA 1HJXA 4W84A 4ADUA 5IBXC 3LPOA 3N4AA 3DC8A 1Z8AA 4G7FA 3LU2A 2J7DA 3E9AA 5CEWA 3GXMA 2VNCA 1Q6QA 3IV8A 3WD2A 1PJ9A 3GR7A 1IWAA 3EMQA 3G1RA 5JIPA 4IOTA 2PD9A 5KEZA 1LUCA 5CKSA 2DZBA 3TC3A 3R0KA 3EKZA 1HXJA 1UP3A 3HG5A 5EBUA 3VNJA 4FXJA 3W7DA 1W37A 4MM1A 1F61A 4HNVA 3WQVA 4F2BA 4W9TA 3HV9A 3BO9A 4YVVA 3CYJA 2ZZ3A 2FFIA 2OX1A 2XSXA 2XIQA 4L61A 3VK5A 3R6IA 1M7JA 3UZYA 1AK5A 2J74A 2G3JA 4DJEC 5CCZA 1TWWA 3UPWA 2ANUA 3GIYA 4ATLA 2J88A 2BVYA 3GHTA 1Q6LA 5EKYA 4UOZA 3BE7A 3VIKA 3BC9A 2HBXA 1GZ1A 4FLRA 3LXAA 5D05A 1J96A 3AMKA 2ZUSA 3QGKC 2RH9A 3P3BA 2XSBA 3W7LA 5BXSA 4JGDA 3AXMA 1OHLA 4KRUA 1A5OC 1W1TA 4MF4A 4H9VA 4G1KA 2ZUWA 1US3A 3QGVA 4LY4A 2V2CA 1G01A 1MI3A 3POHA 3VYLA 3UY8A 2BGQA 3SQLA 3WQ4A 4XISA 3KTSA 3C4UA 3KVJA 1PXGA 4IPNB 4JKMA 1FCVA 1K7FA 2P1FA 4QITA 1KKRA 2GJXB 4JQ4A 2W67A 4GKTA 1MZHA 4S3EA 4WF7A 3NEHA 3UJEA 4FAMA 3FNDA 1SW3A 2OPJA 2XGBA 1FHVA 4YNGA 3RPDA 5A8GA 3CUIA 1SO3A 2XZ9A 2WPGA 1W9XA 2WXDM 2IPWA 2YA2A 2F7FA 3BLIA 4C6CA 4U33A 4IUGA 1FH8A 4O1AA 2YKKA 1NVMA 4E4UA 2V8ZA 3UGVA 3R0UA 3LM3A 4BQ4A 2Y5EA 1TIMA 2NV2A 1Z89A 3VKCA 1BVNP 3AXIA 3AHTA 5D9OA 4K37A 3WDHA 4KFOA 3MYPA 2DJXA 3R1ZA 2AL1A 1TV8A 3UF9A 3VKJA 4Q8OA 9CGTA 4RPPA 3WLOA 3TZNA 4O52A 4H01A 3USBA 4ZTYA 4YYCA 3MSYA 3A4AA 5FA5A 4BEQA 3WLJA 1XINA 4GVHA 4D6JA 3M64A 2WSKA 2J7CA 2Q8ZA 3G5EA 3GTNA 2YR1A 3TN5A 1E9IA 1W31A 3G1XA 1KFJA 2OOGA 3GD6A 4C6OA 4UWMA 4GGBA 3BOLA 3T0TA 1KM3A 5DFAA 2PF0A 2NQZA 4ECLA 3LDVA 4TVCA 4Q4KA 3QGAC 1VS1A 3NQDA 3IRSA 1EEPA 1V7YA 4L9ZA 3ZM8A 5A2AA 1OK4A 3MV01 4JTFA 4JTKA 2AQOA 1EPXA 1H5VA 1ZENA 4O4VA 1RK5A 4GWEA 5LNRA 3EWZA 3G24A 4ERIA 2OCZA 3LD5A 4TMCA 1XP3A 3CZ8A 2ISDA 4XZMX 5D2YA 1WZMA 1BXNA 5HWNA 4QEEA 1DV7A 4CNNA 3GX9A 2JF7A 3LMYA 4QQUA 1TELA 1J6OA 4XAZA 3BGGA 4JX4A 5E0FA 3CUFA 1WZKA 2YDQA 2PRMA 5BRPA 3W1MA 2GVJA 3E0FA 3LTYA 3E3HA 3DEQA 2YFOA 1BYCA 3DFYA 5T8GA 3ZFHA 2J7GA 3H4GA 1NAL1 1ZJAA 3OB8A 3K4WA 1KM2A 3B3DA 3L4WA 1XC6A 4J28A 3GG8A 3ICJA 3TAOA 1L8NA 3EXRA 4C5YA 4HK5A 4JTJA 1XC4A 1E6ZA 3I7SA 4K8EA 3RFAA 1GK8A 4E6MA 5BU6A 2G97A 4OV9A 2JGYA 1JG9A 3MJMA 4F4RA 3G1YA 4M0XA 2NWSA 4YLWA 4AEFA 4XD5A 4TR9A 4YTRA 2OOFA 1OFDA 2E6AA 4UTWC 4AVNA 5DRIA 2P8CA 3W53A 4H9MA 1IZKA 3QXBA 4D72A 4LOCA 5DCDA 1SR0A 4DXKA 4YWSA 3QMTA 1FHUA 5LA0A 3M44A 1OT1A 1D7FA 1Q6RA 1Q7MA 1BFNA 3NQ2A 3VC6A 1XYCA 2ZTJA 1B1YA 3ABOA 1GJUA 1DTUA 2VC7A 4L7ZA 3QKEA 1J2WA 1FTXA 3MPGA 1EDQA 1E1CB 1JGMA 1JZ5A 1ITQA 3PZUA 1JDEA 5I3GA 1DTNA 2NX1A 2WSRA 1CECA 3G2GA 3MVIA 1FWCC 3B05A 2IXUA 1UHVA 3ARWA 3K8KA 3SCOA 2PD5A </