1GHZA

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ghzA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ghzA02
3KQCA 3U8OH 5GCHG 1K1IA 1V2ST 3EYDA 6LPRA 4IMZA 2PV9B 2FOEA 1GDNA 1F5KU 2ILNA 4AFZA 1CGJE 2RG3A 3NKKA 1VCPA 3SU6A 2A4OA 5JB8S 4WH6A 1S85A 1P12E 2ZGHA 4E05H 1VGCB 1C5LH 1GHBF 4Y0ZE 4K8BA 4IN1A 3ENSB 1SGPE 2AGIX 4Y76A 3AAVA 3CENA 1MMJN 2OD3B 2Y5GA 1AFEH 1VITF 2C4FH 1SC8U 1V2MT 1HAXB 4WMDA 1FPHH 3RXDA 1O2VA 3RXMA 2FWWA 3A8BA 1P11E 1TIOA 3P95A 1G37A 4XBCA 3O8DA 3RLYH 1F0RA 1HAHH 2TIOA 4BOHA 1FJSA 1PYTD 1C5NH 2B7DH 2TGAA 4YLQH 1WSSH 2WV4A 1QQUA 4AX9H 1XXDA 4WMFA 2F83A 1ELEE 1AVGH 3D62A 3GDUA 1LVOA 2GMTC 4BTTB 5F8XA 1YCPM 2BLVA 4X8VH 5LPEA 2QF3A 4JMYA 3M7QA 4Y8XA 1KDQA 1ARCA 4NWLA 1QHRB 1QJ1B 1TMTH 3UIRA 2F9OA 2GMTB 2A5KA 1GMCF 2VU8E 3F9EA 1C1VH 1S5SA 3VFEA 1TLDA 1TWXB 4NA7A 2PSYA 1NRNH 1KXBA 5T6GA 7KMEH 5CE1A 9ESTA 3E91A 1GBBA 2J95A 3A7ZA 1Q2WA 4O03A 3FFGA 3SUEA 1C2KA 3OY6U 4HTCH 1F0TA 4DURA 3M3SA 3RXBA 5TJXA 3UQOA 3UOUA 1K1NA 1Q31A 1BTUA 5ESTE 5FXLA 4DJZB 2W7SA 2ZQ1A 3H5CB 5GWZA 5E0HA 1ID5H 1HBTH 4MLFB 3URDA 4FUJA 1MUEB 1JIRA 1AU8A 5GIBA 1C5UA 1GBJA 3S7KB 3CS7A 1P01A 1KYNA 2A32A 4MQAA 2SFAA 1CE5A 1AKSA 2GT7A 1G36A 2XBWA 2FDAA 3SBKA 4DOQA 4KKDA 1EOLA 2ODQA 4D7GA 2HNTF 5J4QA 4OS2A 1QJ6B 2PLXA 4ZHMU 2ZHDA 1DY9A 3GY7A 3OX7U 2G52A 2FM2A 1C1SA 1B0EA 1F2SE 5A8ZA 1DLEA 3ZZCA 4ZXYH 5FAHA 1LTOA 1SGFA 4Q7YA 2AFQB 3S69A 5EW1H 4HI3A 1J17T 1OWIA 2Q6GA 1UHBA 4BAMB 1BJVA 1EX3A 4WXVA 1SGQE 3E1XB 2IPHA 1K28D 1GHBG 1G9IE 1BZXE 3TIUA 1EXFA 1SOTA 3TK6A 1Y5AT 4FUFA 5DP8A 1VITG 1GBEA 2W26A 3BTGE 1ESTA 2P8OB 1RD3B 4ABJA 2YNBA 2GGVB 3U98H 1Z8GA 2VJ1A 2A4RA 1P05A 2JH0D 1FNIA 3VB3A 1QB6A 2VGCC 4I8HA 3ZZBA 1VZQH 2A7CA 4ISNA 1NFWA 1V2JT 2BTCE 4WY3A 2ANWA 2BDHA 3V3MA 1MAYA 1O2KA 1RS0A 2OXSA 1SGFG 3PTNA 4CRDA 1VITH 1XXFA 1AIXH 4X1NU 1AB9C 2ZPQA 1BT7A 3SGBE 1BTHH 4BAHB 1C5XB 3GOVB 3BEUA 4XOJA 1HAGE 1GMCG 3LU9B 3TK9A 2BY9X 1DXWA 2BY7X 4FVDA 3SORA 1SB1H 1SLUB 1D4PB 4U01A 3PWBA 1AB9B 4XBDA 1GDUA 2W3IA 2P59A 1OP8A 2AIPA 1ACBE 4CREA 4LZ1H 4DIIH 3TGJE 4Y11E 2KAIA 1TGNA 1HAVA 1FV9A 1FY8E 1GJCB 1XVMA 1GMDF 3FVFB 5FPSA 4HGCA 1ZLRA 3S7HB 4NFFA 5JBCS 1YPLH 1Y3VA 4FUEA 2C8YB 1GL0E 3U1JB 2J34A 2VIPA 1AHTH 1GHWH 4Y7BA 1Z1IA 1FIZA 1JWTA 3DA9B 1Y3UA 3SHCH 4NIVA 2BLOA 3SNAA 3BTME 3MI4A 1SLVB 4XDEA 4RKOB 1BHXF 1NZQH 1NU7B 1BRUP 1NFUA 1O2JA 3A83A 2ZIQH 1EP5A 3SI3H 1OWKA 1W7GH 2GV6A 1FY4A 1Z6JH 1SGYE 3NPSA 1LQDB 2NU3E 3K6YA 1EAWA 4B73A 1ZHMA 2F9NA 3RC5A 2Y80A 2R2WU 4ZKRU 2XWAA 2ESTE 1KSNA 2PUQH 3A7VA 1BRCE 5EQRA 1LPKB 4KELA 5JDUB 3ZVDA 1W14U 1A2CH 1MCTA 1GL1A 1GBMA 2SGPE 2BOHB 1K9OE 4JK6A 1SLWB 2VWNA 1ELBA 1FAXA 2W5EA 3SU3A 1MTNC 2Q6DA 4GHQA 1ZR0A 4GSOA 2HOBA 1C9TA 1ZMLA 3RMOH 4AYYB 3T62A 3NUMA 2O8MA 3NCLA 1YCPK 1O3OA 4MPUA 5AFZH 1O38A 8KME2 1AUJA 4KTSA 1ARBA 1QQ4A 2TGTA 1QTFA 1NRRH 4ZH8A 1GJ7B 3TJNA 1MTNB 4D7FA 1GBKA 1CQQA 2ZU4A 3RXPA 3V7TA 3QGJA 4JK5A 3SUFA 1LKAA 5AF9H 5LH8A 2ZTYA 3AW0A 3PWCA 1O3CA 1C2JA 1QRWA 1O3NA 1BRAA 1H4WA 2BVSH 1OYQA 1EZQA 2HALA 4Y71A 4GVUA 2EA3A 3PROA 3RMLH 1PPFE 1JBUH 3BG8A 3SV7A 3RXIA 1QBNA 2AMPA 3A81A 1HLTH 4MNYA 5LGOA 1C2LA 4YZUA 4MNWA 1IQGA 1P03A 1WBGB 2XRCA 1PPBH 1H8DH 1V3XA 5IDKA 1MU6B 3TH2H 1GMDG 1UCYK 4Y10E 2P95A 2XC4A 4LOYH 3TNSA 1AO5A 3DT0H 2OC1A 3KF2A 4FVBA 5C5OA 3IG6B 4A5TS 1SGIB 2HLCA 1DE7H 1FY3A 3SNEA 1SL3A 4TWYA 5J4SA 2A1DB 3GY3A 4IBLH 2FYQA 3H7OA 3O8CA 2FODA 1ZRBA 2BQ7B 2FX6A 4X6OA 3BEFB 1UTMA 2V0BA 4CRCA 4CBNA 1SGCA 2NWNA 1ELGA 2PFEA 1O2TA 1IAUA 3UY9A 2GZ8A 3O8RA 4A6LA 2ANMH 2H9TH 1ZTJA 5CMXH 2ODYB 2ZU1A 1W10U 2CXVA 2PSXA 4H42U 1C4U2 3HATH 1OWEA 3LGTA 5FPTA 3LJJA 2A7HA 3LJOA 5DKMA 4YT6H 2SGQE 2D8WA 4E7NA 1HXEH 3SGAE 4TPYA 3SZNA 1GWAA 1GVLA 1SLXB 1QCPA 3SUGA 3TITA 4GHTA 3URCA 3A7WA 3KL6A 2O9QA 1PQ5A 1O3HA 2ZTXA 1BOQA 2HPPH 2WUCA 1W3CA 4O9VA 4VGCC 1L1GA 2WYGA 3A8CA 1AZZA 1O30A 3E0PB 4MNVA 1UTLM 1SI5H 3QUMP 1PPCE 4K60A 1C1RA 1S84A 1PQ7A 2FTLE 3FP8E 2HGTH 4VGCB 1T8OA 4X1SU 1C5QA 1WQSA 3A7TA 4YOIA 1N8OC 1GG6C 5IYTA 1P3EA 1IQEA 3PM3A 1OSSA 2LNCA 1O2HA 5EQSA 1VCQA 2OCVB 1N8OB 3ZVBA 3HGPA 1YPMH 2HPQH 3ITIA 1WU1A 1C2HA 1TYNA 2A0QB 2R3YA 3LH1A 2D26C 2H5DA 1YF4A 2BZAA 1V2KT 1LHEH 3SV9A 1AFQC 2ZP0H 2G51A 1CT4E 1V6DA 2WPLS 5GCHF 2QF0A 3I29A 2QIQA 2C8XB 2TGDA 4FUBA 1MH0A 1TQ7B 3MH7A 1FDPA 1UVOA 1GBFA 3NZIA 1OWHA 3S9AA 2QY0B 1AFQB 4MNXA 1K1OA 5FBEA 4F49A 2ZDLA 1PQ8A 3RU4T 2G81E 5DPAA 4I8KA 3UREA 1JOUB 2G5NA 4GPGA 1RTFB 2ULLA 1O3MA 5K7RA 4I31A 1G3CA 3BTHE 5A09A 4RKJB 4U30A 3TH3H 4YESB 3LONA 1BBRH 2ZU3A 2WYJA 1SQOA 1DUEA 1OWDA 2AERH 1EAXA 2BOKA 5FBIA 1EPTB 1UVUH 2ZDAH 3RXHA 4GCHG 2FXRA 4ISIH 1ESAA 4K1EA 3A8DA 1GJ8B 4WJG2 2LPRA 3PMHB 2VNTA 2ZHFH 1B0FA 2WUBA 4LK4A 4YOGA 1J16A 2BHGA 2YNAA 4NFEA 4FXGH 3BTEE 3LC5A 1DDJA 5FX6A 4I7YH 3KIDU 2VH0A 1J14A 2UUYA 2ZECA 4GUXA 1KXFA 1YPHE 1W0YH 2BVXH 3MH6A 3IITA 2BY5X 1O32A 1QBOA 3FANA 2OBOA 1A1RA 4ISHH 1WTHD 1MD8A 1P3CA 3SV2H 4UFDH 2WPKS 1J15A 3TLOA 2PHBA 1XUJA 4ZAEA 1G2MA 1EATA 1TONA 2P3FH 3GY4A 4IMQA 1TBQH 1HDTH 2DE9A 2FS8A 1T32A 1O5EH 4R0IA 1EAIA 1RIWC 4U32A 3M36A 2FESH 2FMJA 2PKAA 1THSH 3LDXH 1NY22 1P2IA 4JYUH 1ZZZA 2VIWA 1O36A 2CGAA 3SV6A 4UONA 2BZ6H 2FOBA 3TPIZ 3LH3A 3ATMA 2AMQA 1KLIH 1RIWB 1D3QB 1FY1A 5C20A 1J9CH 1GI8B 3ESTA 1DY8A 1EAUA 1P2OA 1N6YA 4ABGA 1QRZA 5DG6A 5DP3A 1FIWA 2THFB 1YLDA 4AOQA 1A5HA 1QIXB 4CH2B 1QBVH 3L33A 4RSPA 3STJA 1LVYA 1V2TT 1TNHA 1S82A 3RXOA 3SQEE 1E35B 2ZA5A 2Y7ZA 2VIOA 4B2CA 5HM2A 4ZUHA 1W7XH 1YKTA 1ZYOA 1O2QA 1VGCC 1XUIA 2DUCA 1L2EA 1GMHG 2FOGA 3E3TA 2XYAA 1GHAG 3F9HA 6GCHG 1C4Y2 1YCPH 1GHYH 1ORFA 3M5MA 5DJ7A 5EOKA 1O2LA 3MFJA 3RMMH 1QA7A 5I46H 2G55A 3BV9B 1LHFH 3ZZ6A 2XC0A 1HNEE 3KNXA 4ISOA 1IQNA 5HMAA 3IWMA 1C2MA 1QR3E 3SNDA 3MU8A 1YPGH 1ZSJA 2JKHA 3UOPA 3MTYA 1RRKA 3FZDA 3ATWA 1CO7E 1CT2E 3KCGH 2XCFA 3PV4A 1BTYA 1GJ4H 2OC0A 1C5SA 1CU1A 3WY8A 1O2GH 1O3GA 1A7SA 1MZAA 2P16A 3BEIB 1O3IA 3MH5A 1UCYE 1KLJH 1ZTKA 1O2ZA 2ZI2H 1ANBA 2GDEH 3UR9A 3ZZ4A 2QXHA 1EB2A 1TE0A 2SNVA 1HAOH 2RDLA 2V35A 1TA2A 1UCYH 4I8GA 4J2YB 2AEIH 2XBXA 2BXUH 1BHXB 2R3UA 1AN1E 1VJ9U 1XM1A 4DVAU 1EJMA 2I6QA 3DFJA 4WXIA 1SBWA 1SG8B 1C2IA 1C1UH 2BD9A 3TU7H 2XNIA 1O3AA 1FQ3A 2ZHWH 3ZV8A 1EKBB 1FPCH 2EI8A 5C1XA 1MD7A 4UFFH 4I8LA 2HRVA 2Y81A 1K21H 5L30H 2PR3A 4TYDA 1L0ZA 1BRBE 3DUXH 3QX5H 2H2ZA 3MU1A 2GCTC 3K2UA 1LPGB 5GJ4B 1O5AB 1WOFA 2ZDVH 3QO6A 5DP6A 3MNXA 5JYIA 3B9FH 2OUAA 3BN9A 5GXPA 2BXTH 2TPIZ 2XBYA 1DWBH 2STBE 4CRBA 1A5IA 3K65B 4F4OC 2GCTB 2IN2A 3M5NA 1O2IA 2AIQA 1MBMA 2GT8A 4CRAA 1O3PB 1YBWA 1UK3A 1ZSLA 3I78A 5ETXA 1RJXB 1C5VA 4AFQA 3RM2H 3RXKA 2FOMB 3A82A 1AGJA 2HVXA 4UEHH 4JYVH 1ELTA 1T8MA 2OTVA 1ABIH 1O3JA 3U8RH 3HKIB 1BCUH 1JRTA 1Z8RA 2FYRA 2P8OC 1WV7H 1O34A 3ZVCA 1IQJA 3SNCA 6ESTA 3LGWA 4X8TH 1G3EA 4ZKNU 2XCNA 3U69H 3SUDA 1MU8B 3SJKA 3SN8A 3PMJA 5A0AE 3SI4H 1MCVA 3B8JA 4JZ1A 4DW2U 3I77A 3D49H 2BQWB 1O2XA 2I6SA 1DPOA 2ZCLP 2ZWLH 2ZQ2A 1C5MD 1SHYA 4DGJA 1AD8H 1UTNA 4KTUA 1UVTH 2AGGX 3PYHA 1WTGH 1HAPH 1T7CA 3LIWA 1LHGH 3MU0A 4Y0YE 1LPZB 2FS9A 3E0NB 1YPHC 1BBRK 3ZZ7A 1SFIA 4AFSA 1FI8A 5JB9S 3KQDA 4JYTA 2QGRA 2AH4X 1JRSA 1O5CB 4UFGH 1D3PB 1THRH 2QXJA 2AS9A 1XX9A 3ZZAA 2C90B 2UUKB 4SGBE 1ELAA 2PKSC 1DOJA 1IQKA 1NM6A 1BITA 1HJAC 1BTZA 1UVSH 4B2AA 1BTWA 3UQVA 1UVPA 8GCHF 2R9PA 3RXVA 1LQEA 4Q7XA 3SJ8A 2CMYA 4BTUB 1LVBA 1F7ZA 3ZVFA 2PKSB 1DXPA 2TGPZ 1T31A 3MH4A 4U2WA 1DWDH 4GAWA 1HJAB 3RXFA 4WF8A 2BDYA 2NU2E 1NO9H 4MVNA 4A92A 5K0HA 3TVJB 3P92A 2Y7XA 4FU8A 1BJUA 7GCHG 5L2ZH 1KXAA 4KP0A 1BA8B 2GV7A 5F8ZA 3MWIU 4Y7AA 4Z6AH 1KXCA 5HM9A 5L2YH 5A0CA 2QCYA 4NWKA 1HUTH 4UE7H 2J4IA 1HIAB 4D76A 1AZ8A 4CBOA 1MTWA 3SU2A 3ATIA 1A0LA 3HGNA 2H5CA 5DGJA 2HNTE 1O2YA 5LPFA 1TPSA 5E0GA 1O2OA 4MG3A 3OU0A 1Y8TA 1RFNA 1EJAA 4INLA 4AFUA 3K6ZA 4JZIA 4BAKB 1Z8JB 1LMWB 1YPJH 4IN2A 1W0ZU 2NU1E 2QXIA 5FCKA 1K1LA 1BMMH 3L3TA 1TOCB 1ESBA 5T6DA 1NESE 1C2FA 4NIXA 3RLWH 3A85A 4I33A 1CVWH 1UK2A 1TGTA 2GD4B 3EA9A 3EAJA 1HAYB 2BLWA 2FO9A 1H8IH 2A4QA 1AY6H 2VWOA 3ZZ5A 1YGCH 1K1MA 3EE0B 1ZMNA 2G8TA 1O3EA 1ZJKA 4NSYA 2A5AA 4UD9H 1NRQH 3GYLB 1QJ7B 2GVFA 1RXPA 5LPRA 2GX4A 1OWJA 1YPEH 4R8TB 2B8OH 1PPEE 1DWCH 5FPYA 4NZLA 3SU1A 1B7XB 1GI0A 5EGMA 1GI3A 1N6XA 1O3KA 2TRMA 1INCA 2ODPA 8GCHG 1C1PA 3FP6E 1C9PA 1ELCA 1CT0E 4CH8B 1GHXH 1UMAH 1DUAA 3Q77A 2BDGA 1S6FA 4NSVA 1C5OH 1GBTA 4Y8ZA 1C2GA 1ZTLA 2Z9KA 4JZEH 2UWOA 2BY6X 2Q1JA 1YYY1 1BQYA 2FEQH 1NU9A 1TRYA 1CA8B 4AB9A 2R2MB 2H9HA 1L1NA 2OQUA 1SGEE 3ELAH 1C5YB 4NA9H 3RU4E 1XVOA 1ELDE 1GJDB 3A7YA 2P93A 3BF6H 1P9UA 2ZZUH 3B23B 3GY5A 2V3OH 4XSKU 1GBIA 3STIA 1SR5C 5E2OA 3SV8A 3VB5A 1BMLA 3BG4C 1A3BH 1FZZA 1TNIA 2BD7A 8LPRA 5CHAC 4UFEH 1NRPH 2BD2A 2SGAA 4GCHF 4B76A 1PPZA 2FX4A 3NWUA 3GDVA 1P04A 3MO6A 1F0SA 1OYTH 2EC9H 4WH8A 3V12A 3BG4B 2QA9E 1CBWC 5CHAB 4TPIZ 3TNTA 2R0LA 4BANB 4Y6DA 4X8SH 1PPGE 4BAQB 1KDQB 1SMFE 2BMGB 1Z1JA 5JBBS 1GJBB 3PMBB 4A1TA 1GBLA 3PTBA 1FN6A 1WQVH 5EW2H 2WPHS 3M7TA 1CBWB 4YT7H 3U9AH 4X0WU 1M9UA 3BTTE 1ZHPA 3OSYA 2ZU5A 3M37A 1MTUA 2BDIA 5ABWA 3MNSA 1D6WA 4FUCA 2V3HH 5FCRA 5T6FA 2CV3A 1TX8A 3QZRA 2VH6A 1C5RA 3A87A 2ZFSA 4NG9H 2PGBB 2J2UA 3SU0A 3N7OA 1BB0B 1HFDA 1DVAH 2GTBA 1E0FD 3EQ0H 1HJ9A 1RTKA 1P9SA 2J38A 3RXTA 4FUHA 4LZ4B 4X1RU 4Q7ZA 2W3KA 1GJ6A 2AMDA 1AKSB 1XKBC 5DO4H 1GVKB 2A5IA 1S6HA 3M3TA 1QFKH 2RA3A 4BNRA 1PQAA 3QZQA 4K3JA 2VB0A 2Y5FA 1V2UT 1LHCH 1B5GH 1TMBH 3BTKE 5C5NA 1GMHF 4DCDA 6GCHF 1GHAF 1W11U 2F9BH 3ODDA 1Q3XA 1LVMA 1UHBB 2G4UA 4FUIA 3SJ9A 4H6SB 4X6NA 1GCTB 1MZDA 1TBZH 5L6NH 1CA0C 4DG4A 1AVWA 1GVZA 1EPTC 1HGTH 1BBRE 4M7GA 4ASHA 3TGKE 2VVCA 2FPZA 4AYVB 4K69A 1CGIE 2A7JA 4BTIB 4H4FA 1S0RA 4DIHH 1O2SA 4YTAA 4ABFA 1QNJA 3OTJE 1UK4A 1CA0B 1BTPA 1EJNA 1O39A 1O33A 3DFLA 3UTUH 2UWLA 5SGAE 2WPMS 2CN0H 4OGYA 1D3DB 2D1JA 2FI4E 3ZVAA 3SU5A 1GHZA 1CHGA 3K9XB 1GHVH 1AWHB 3VB7A 1ZGVA 7ESTE 2WPJS 1RGQA 1BUIA 2HNTC 1KTSB 2BDBA 1DFPA 1ZHRA 2BX3A 3PO1C 1EUFA 5C3NA 1XKAC 4B71A 1F92A 1SGTA 1GDQA 3RXQA 1MAXA 1HIAA 3A89A 5C1YA 1GI9B 1H9LB 3FZZA 5C1UA 3M3VA 1K1PA 1WCZA 1YPKH 5T3HA 4CHAC 1OX1A 3PO1B 4BAOB 2JH5D 3BSQA 3MU4A 1G2LA 1GJAB 4JCNA 2ZC9H 2IOTA 1TFXA 2KAIB 1FN8A 1HAVB 3D65E 5TCCA 4Y79A 1QY6A 2ZU2A 5B6OA 1DM4B 2EEKA 2OC8A 1ZSKA 1A3EH 4CHAB 3KQBA 4IS5A 3GCHB 1TNGA 3JZ2B 1MTSA 2OINA 2IJOB 3MNBA 3EGKH 2Z3EA 1LHDH 1P2MA 2J92A 3VEQB 3RXEA 2XC5A 4IC5A 1GI7B 1Z6EA 4YOJA 2P94A 1SPJA 5EXMA 3ZVEA 1UO6A 3LPRA 1W2KH 2GCHF 2Z7FE 2ZTZA 1G3DA 1NS3A 1GI4A 4K5ZA 1Y5UT 1D6RA 3P70B 3BIUH 4ZHLU 2Y5HA 1NPMA 4B2BA 4CRFA 4WMEA 1FMGA 4I8JA 3DD2H 2B5TB 1K1JA 1TNLA 1W13U 1GI6A 2VWMA 5DP4A 4FUGA 1TABE 1TMUH 5GDSH 1ETSH 2CJIA 1QL7A 4QT8C 7LPRA 1SQAA 1UTKA 1KLTA 4HZHA 2GZ9A 2FOCA 1EB1H 4TWWA 2RCEA 1MKWK 2ANYA 4NGAH 1V2VT 2F9PA 4B75A 5AFYH 3Q3KA 1J8AA 2PW8H 2ZO3H 3VXFH 2EI6A 3T2NA 3LOXA 3E16B 1MKXK 1C5PA 1YC0A 3A84A 1O31A 3T26A 1EOJA 2AYWA 2QC2A 1ZGIA 4CR5A 4Y8YA 5A0BA 5DP7A 3P8FA 1SHHB 1TPAE 3VGCC 1IHTH 2Q6FA 3LGYA 1EP6A 4A1VA 1O3LA 1A46H 3RM0H 1VCWA 3W94A 2BQ6B 1KTTB 1AMHA 1LDTT 4DT7B 3GICB 3OY5U 1EZXC 1QRXA 2PTCE 3LGIA 2ZGCA 4I32A 3QWCH 3ZZ9A 1AWFH 1UTOA 3VGCB 1V2OT 3GCNA 1TGCA 1NFYA 1UTJA 2C8ZB 2ZPRA 5AVDA 2XW9A 3Q76A 2BDAA 3UNSA 3UPEA 1O2UA 3W95A 3TH4H 3ZYDA 3LGUA 1XMNB 5TCAA 4AZ2B 4KTCA 1DT2A 4IW4E 3F9FA 4B1TA 3RP2A 1E34B 2XWBI 1GBHA 4JZDH 2VVVA 3E90B 3EA7A 1HYLA 2GP9B 3RXSA 1BDAA 2VIDA 4WWYA 5E0JA 2FOHA 2DE8A 1UTQA 2XXLA 4MTBA 2EI7A 2ZGJA 1P0SH 4J1YA 3RXLA 3TGIE 2XBVA 2GCHG 4GLYA 1A0JA 3UUZA 5JBAS 2G4TA 1EZSC 2ZGBH 1KIGH 3SHAH 3G01A 1TGSZ 3ZVGA 1K2I1 7GCHF 5HYOA 1O2RA 1JXPA 3VPKA 5EU8A 1T8NA 1DWEH 2D2DA 2C3SA 2ZEBA 1TRMA 4ZXXH 1DANH 3QDZB 2ZFPH 1YLCA 3QK1A 3S9BA 3RXAA 1LCYA 3KQEA 3M61U 4ABAA 1Y3WA 1P09A 1IQFA 4MPXA 4LXBH 1IQIA 1HAIH 1O2PA 4TY6A 4X2WA 5HGGA 1EQ9A 2A2QH 2ZFTA 2H9EH 2WV5A 1G30B 5AHGH 1GBDA 2W7UA 1XUGA 3M5LA 2AGEX 1GJ5H 2Z3DA 2ZCHP 1P02A 3T29A 1AQ7A 1OS8A 2F3CE 3KHVA 4AG1A 3GCOA 1O5DH 2ZKSA 1O37A 5C67A 3R3GB 1YM0A 2P3TB 3MO9A 3TJVA 4BXSA 5G4BA 2P3UB 1NC6A 2O8WA 3RC6A 4ABEA 1WUNH 5EPNA 1P06A 2UWPA 1FY5A 5GPIB 1LO6A 3HK6B 3P8GA 1H9IE 1DSUA 4O3UA 3A7XA 1N1LA 1NRSH 1HXFH 2FLRH 2FTMA 3S0NA 1GCDA 1V2RT 1NROH 1OXGA 1FAKH 3GCTF 1WYKA 1EPTA 2ZDKA 1O35A 1TPPA 2BD4A 1CSOE 4AORA 4ABIA 2YOLA 1TALA 4IGDA 5F8TA 2VINA 1C1NA 4THNH 4YO9A 3F1SB 1CGHA 1A5GH 1O5GH 1SGDE 1GGDC 1QA0A 3E6PH 2FOFA 2STAE 1HAZB 4ZROA 2G5VA 1C2EA 2VGCB 1SQTA 1S83A 5A8XA 2ZDNA 1TOMH 4OS7A 3CS0A 1WAYB 2J94A 4AGKA 1GGDB 2O8UA 3ATKA 1F5LA 4XBBA 2CF9H 1MTVA 1TAWA 3QTVH 1JMOH 3BIVH 1Y3XA 3F6UH 3RU4D 2RA0A 3M5OA 3UWJH 2SGDE 3VB6A 4X2YA 2HWLB 3TK5A 1HCGA 4FU9A 4ZKSU 3E8LA 4PROA 1GI1A 2FI3E 1JIMA 1QB9A 1C1OA 3SO3A 2O8LA 1O2WA 1ANDA 4CRGA 3QN7A 2Z94A 2C8WB 1P8VC 3AW1A 2V6NA 3P17H 5FX5A 1NN6A 4D8NA 3QLPH 1H1BA 2G00A 3SW2B 2ANKH 2Y6TA 4H6TA 4AG2A 2H6MA 4Q80A 1OP0A 2FZZA 5EXNA 1PFXC 3OYPA 2ALPA 3SJOA 1H9HE 3V13A 4YM9A 3F68H 1TX6A 2ZFRH 2B0FA 1GJ9B 3RXJA 1HRTH 3PB1E 1DX5M 4D9RA 4FUDA 4K1TA 3SQHE 3HKJB 3LGVA 3O8BA 2A45B 2K1QA 1XUKA 3RXRA 3M35A 3T28A 1DICA 3C1KA 2WINI 4OS6A 1GI5A 2OBQA 3ZZDA 1TPOA 2ZDMA 2BY8X 4ESTE 1QL8A 3DHKH 2SGEE 3NXPA 1C4V2 2OC7A 3HK3B 9LPRA 2PKAB 3EDXB 1O5BB 4ZKOU 3U1IB 1RTLA 2ZPSA 3BTQE 2FP7B 5F03A 3PMAB 2M5TA 2VVUA 3MOCA 1C5TA 3GCTG 4AN7A 1NTPA 3HPTB 4ABBA 3Q00A 3PLKA 1Z71A 4JZFH 1V2LT 1EZUC 3F9GA 2F9VA 1G3BA 4X1PU 1A61H 1HB0B 3GISB 5E2PA 1TB6H 1L1JA 2Z3CA 1VR1H 4ZMAH 2ASUB 2PUXB 4X6MA 4AGJA 1MKWH 1EASA 2ZFFH 4OGXA 3TJOA 2BD8A 1Y59T 1FLEE 1TNKA 2WPIS 4MPWA 2FI5E 1MKXH 2ZG0H 1E38B 1C1QA 1O3FA 1XUFA 3UR6A 1IQLA 1T8LA 4OS1A 1MBQA 4MDSA 1QGFA 3VB4A 2VIQA 5EG4A 1Y5BT 1CHOF 2FOAA 4K1SA 1LKBA 1P2NA 3RMNH 1GPZA 4NA8A 3SGQE 2R0KA 3SU4A 4BXWA 1TX7A 3RUOA 2VWLA 2BDCA 4FU7A 1ELVA 1NT1A 3MO3A 4SGAE 2QYIA 2OP9A 3ZZ3A 2A31A 2ZNKH 2ZFQH 1P10A 1W8BH 2O8TA 3S9CA 4XFQA 4NCYA 5DP5A 1PJPA 3GDSA 3FP7E 1VJAU 1P2JA 3A8AA 3NK8A 1SGNE 5BRRE 2BM2A 3GY8A 3ZV9A 1OOKB 1ZPZA 1OP2A 3L6PA 2BD5A 1O5FH 3P8OA 2QN5T 3A80A 5A8YA 2Z9LA 1SFQB 3EA8A 5JPMH 1SOZA 4INHA 2J9NA 4MPVA 4UDWH 4A7IB 5A2MH 1D9IA 1AE5A 2BYAX 2CF8H 1ETRH 5PTPA 3UWIA 3H7TA 4WVPE 2OLGA 3BTFE 3Q3YA 1BTXA 1FUJA 1THPB 1F5RA 1L4ZA 1QL9A 4ABHA 2NU0E 2PWXA 2F91A 3UNQA 3SJIA 1AE8H 4X8UH 1IQMA 2Z6BD 1O2NA 2XTTB 4E06H 1F0UA 3KGPA 1OPHB 1TQ0B 3SNBA 5H4IB 3UNRA 2QV1A 5E8EH 4CR9A 1V2QT 4B74A 5JBTA 3MHWU 4AB8A 5C2ZA 4ABDA 2UUFB 4X2VA 4NZQA 1KXDA 5FHTA 3V0XA 4ISLA 4XE4A 5BPEA 3AVZA 1ZPCA 3A86A 2BD3A 1YP9A 3LT3A 3LKWA 3GY6A 2Y82A 1O3BA 3RDZA 4TY7A 1PYTC 1P2QA 2QAAA 1IHSH 1HPGA 3M7UA 1MQ5A 3C27B 3TJUA 1SSXA 3BTDE 1C2DA 1Y3YA 2BVRH 4D9QA 2JETC 2ALVA 1OKXA 1O2MA 4INKA 1GG6B 3MU5A 1GCTC 3PLPA 1PPHE 2Z9GA 2A4GA 1BIOA 4E7RG 1CHOG 1Z7KA 1BMNH 3AASA 2GZ7A 5DP9A 2B9LA 2H1UA 3MNCA 3UFAA 2F9UA 5EXLA 2JETB 2ZGXH 2ZHEH 1DITH 3MMGA 1ABJH 2GKVE 2ZCKP 4A1XA 1QURH 1ANEA 2A2XH 3P6ZB 1A4WH 3KN2A 1V2PT 5ESBA 3U8TH 1ELFA 5EODA 3BTWE 4Q2KA 1O3DA 3PLBA 5DK1A 3CP7A 1W12U 1K22H 3GYMA 5EPYA 2FLBH 4KGAA 8ESTE 1S81A 3SOSA 2PGQB 1UJ1A 1P57B 1E36B 3KEEA 2JH6D 3ZZ8A 1C1WH 1FXYA 3R0FA 1IOEA 2Z9JA 3JZ1B 4X1QU 1AVXA 4RN6A 2BLQA 3ODFA 1O0DH 3ATLA 4IC6A 1U6QA 1MQ6A 1ZJDA 3GY2A 3T25A 2BX4A 2TBSA 4K8YA 1BMAA 1GI2A 2PTNA 2C93B 1HJ8A 1TA6A 1ANCA 4YLUA 3RXUA 1SGRE 1DS2E 3T27A 1AI8H 2ZF0H 4OS5A 3ZYEA 3AAUA 1X7AC 1A0HB 1C1TA 1KXEA 2NU4E 1L4DA 1ETTH 2BB4A 1XUHA 4K2YA 1T4VH 2Z9IA 1ZOMA 3GCHC 4O97A 1C1MA 2SGFE 1IQHA 1HV7A 2UUJB 3FAOA 1KY9A 1V2NT 3RC4A 1C5WB 1G32B 2FIRH 1TNJA 1C5ZB 1NFXA 1SVPA 3MYWA 1E37B 4DY7B 1AUTC 1FONA 1S0QA 2GDDA 3P8NA 4O3TA 2SNWA 1ZPBA 4X2XA 4X6PA 3QGNB 1ZRKA 1V2WT 3Q3XA 6CHAC 2QXGA 3T5FH 1P2KA 1DLKB 3RXCA 5EQQA 3D23A 1GBAA 3QTOH 4OS4A 1TBRH 2OQ5A 2VIVA 1UTPA 4NIYA 3VXEH 3RXGA 4HFPB 4Z0KA 1T4UH 2CHAC 2ZHQH 4NIWA 1ZMJA 5I25A 6CHAB 1TGBA 1D3TB 1QB1A 5F6MA 1Z8IB 3A88A 4ZHAA 1DSTA 5HXFA 3LC3A 1GBCA 1TRNA 2CHAB
chains in the Genus database with same CATH superfamily
3KQCA 3U8OH 5GCHG 1K1IA 1V2ST 3EYDA 6LPRA 3PV5A 4IMZA 5EJ1A 2PV9B 2FOEA 1GDNA 1F5KU 2ILNA 4AFZA 1CGJE 2RG3A 2M2AA 3NKKA 1VCPA 3SU6A 2A4OA 5JB8S 4WH6A 1S85A 1P12E 2ZGHA 4E05H 1VGCB 1C5LH 1GHBF 4Y0ZE 4K8BA 4IN1A 3ENSB 1SGPE 2AGIX 4Y76A 3AAVA 3CENA 1MMJN 2OD3B 2Y5GA 1AFEH 1VITF 2C4FH 1SC8U 1V2MT 1HAXB 4WMDA 1FPHH 3F0OA 3RXDA 1O2VA 3RXMA 2FWWA 3A8BA 1P11E 1TIOA 3P95A 1G37A 4XBCA 4Q4LA 3O8DA 3RLYH 1F0RA 1HAHH 2TIOA 4BOHA 1FJSA 1PYTD 1C5NH 2B7DH 2TGAA 4YLQH 3PV2A 1WSSH 2WV4A 1QQUA 2QF5A 4AX9H 1XXDA 4WMFA 2F83A 1ELEE 1AVGH 3D62A 3GDUA 1LVOA 2GMTC 4BTTB 5F8XA 1YCPM 1UW7A 2BLVA 4X8VH 5LPEA 2QF3A 4JMYA 3M7QA 4Y8XA 1KDQA 1ARCA 4NWLA 1QHRB 1QJ1B 1TMTH 3UIRA 2F9OA 2GMTB 2A5KA 1GMCF 2VU8E 3F9EA 1C1VH 1S5SA 3VFEA 1TLDA 1TWXB 4NA7A 3WWFA 2PSYA 1NRNH 1KXBA 5T6GA 7KMEH 5CE1A 9ESTA 3E91A 1GBBA 2J95A 3A7ZA 1Q2WA 4O03A 3FFGA 3SUEA 1C2KA 3OY6U 4HTCH 1F0TA 4DURA 3M3SA 3RXBA 5TJXA 3UQOA 3UOUA 1K1NA 1Q31A 1BTUA 5ESTE 5FXLA 4DJZB 2W7SA 2ZQ1A 3H5CB 5GWZA 5E0HA 1ID5H 1HBTH 4MLFB 3URDA 4FUJA 1MUEB 1JIRA 1AU8A 5GIBA 1C5UA 1GBJA 3S7KB 3CS7A 1P01A 1KYNA 2A32A 4MQAA 2SFAA 1WXRA 1CE5A 1AKSA 1E79D 2GT7A 1G36A 2XBWA 2FDAA 3SBKA 4DOQA 4KKDA 1EOLA 4RT1A 2ODQA 4D7GA 2HNTF 5J4QA 4OS2A 1QJ6B 1WDIA 2PLXA 4ZHMU 2ZHDA 1DY9A 3GY7A 3OX7U 2G52A 2FM2A 1C1SA 1B0EA 1F2SE 5A8ZA 1DLEA 3ZZCA 4ZXYH 5FAHA 1LTOA 1SGFA 4Q7YA 2AFQB 3S69A 5EW1H 4HI3A 1J17T 1OWIA 2Q6GA 1UHBA 4BAMB 1BJVA 1EX3A 4WXVA 4YXWD 1SGQE 3E1XB 2IPHA 1K28D 1GHBG 1G9IE 1BZXE 3TIUA 1EXFA 1SOTA 3TK6A 1Y5AT 4FUFA 5DP8A 2KR7A 1VITG 1GBEA 2W26A 3BTGE 1ESTA 2WSSD 2P8OB 1RD3B 4ABJA 2YNBA 2GGVB 3U98H 1Z8GA 2VJ1A 2A4RA 4OM9A 1P05A 2JH0D 1FNIA 3VB3A 1QB6A 2VGCC 4I8HA 3ZZBA 1VZQH 2A7CA 4ISNA 1NFWA 1V2JT 2BTCE 4WY3A 2ANWA 2BDHA 3V3MA 1MAYA 1O2KA 1RS0A 2OXSA 1SGFG 3PTNA 4CRDA 1VITH 1XXFA 1AIXH 4X1NU 1AB9C 2ZPQA 1BT7A 3SGBE 1BTHH 4BAHB 1C5XB 3GOVB 3BEUA 4XOJA 1HAGE 1GMCG 3LU9B 3TK9A 2BY9X 1DXWA 2V7QD 2BY7X 4FVDA 3SORA 1SB1H 1SLUB 1D4PB 4U01A 3PWBA 1AB9B 4XBDA 1GDUA 2W3IA 2P59A 1OP8A 3OE7D 2AIPA 1ACBE 4CREA 4LZ1H 4DIIH 3TGJE 4Y11E 2KAIA 2J5UA 1TGNA 1HAVA 1FV9A 1FY8E 1GJCB 1XVMA 1GMDF 3FVFB 5FPSA 2JIZD 4HGCA 2OK5A 1ZLRA 3S7HB 4NFFA 5JBCS 1YPLH 1Y3VA 4FUEA 2C8YB 1GL0E 3U1JB 2J34A 2VIPA 2QE7D 1AHTH 1GHWH 4Y7BA 1Z1IA 1FIZA 1JWTA 3DA9B 1Y3UA 3KYGA 3SHCH 4NIVA 2BLOA 3SNAA 3BTME 3MI4A 1SLVB 4XDEA 4RKOB 1BHXF 1NZQH 1NU7B 1BRUP 1NFUA 1O2JA 3A83A 2ZIQH 1EP5A 3SI3H 1OWKA 1W7GH 2GV6A 2PP6A 1FY4A 1Z6JH 1SGYE 3NPSA 1LQDB 2NU3E 3K6YA 1EAWA 4B73A 1ZHMA 2F9NA 3RC5A 2Y80A 2R2WU 4ZKRU 2XWAA 2ESTE 1KSNA 2PUQH 3OEHD 3A7VA 1BRCE 2GJGA 5EQRA 1LPKB 4KELA 5JDUB 1YWUA 3ZVDA 1W14U 1A2CH 1MCTA 1GL1A 5IK2D 1GBMA 2SGPE 2BOHB 1K9OE 4JK6A 1SLWB 2VWNA 1ELBA 1FAXA 2W5EA 3SU3A 1MTNC 2Q6DA 4GHQA 1ZR0A 4GSOA 2HOBA 1C9TA 1ZMLA 3RMOH 4AYYB 3T62A 5HIZA 3NUMA 2O8MA 3NCLA 1YCPK 1O3OA 4MPUA 5AFZH 1O38A 8KME2 1AUJA 4KTSA 1ARBA 1QQ4A 5DN6D 2TGTA 1QTFA 1NRRH 4ZH8A 1GJ7B 3TJNA 1MTNB 4D7FA 1GBKA 1CQQA 2ZU4A 3RXPA 3V7TA 3QGJA 4JK5A 3SUFA 1LKAA 5AF9H 5LH8A 2ZTYA 3AW0A 3PWCA 1O3CA 1QZ8A 2KM0A 1C2JA 1QRWA 1O3NA 1BRAA 1H4WA 2BVSH 1OYQA 1EZQA 2HALA 4Y71A 4GVUA 4HG6A 2EA3A 3W1EA 3PROA 4XRNA 3RMLH 1PPFE 1JBUH 3BG8A 3SV7A 1H8HD 3RXIA 1QBNA 2AMPA 3A81A 1HLTH 4MNYA 5LGOA 1C2LA 3GS9A 4YZUA 4MNWA 1IQGA 1P03A 1WBGB 2XRCA 1PPBH 1H8DH 1V3XA 5IDKA 1MU6B 3TH2H 2VBCA 1GMDG 1UCYK 4Y10E 2P95A 3F2HA 2XC4A 4LOYH 3TNSA 1AO5A 3DT0H 2OC1A 3KF2A 4FVBA 5C5OA 3IG6B 4A5TS 1SGIB 2HLCA 1DE7H 1FY3A 3SNEA 1SL3A 4TWYA 5J4SA 2A1DB 3GY3A 1NBME 4IBLH 2FYQA 3H7OA 3O8CA 2FODA 1ZRBA 2BQ7B 2FX6A 4X6OA 3BEFB 1UTMA 2V0BA 4CRCA 4CBNA 1SGCA 2NWNA 1ELGA 2PFEA 1O2TA 4Z1MD 1IAUA 3UY9A 2GZ8A 3O8RA 4A6LA 2ANMH 2H9TH 1ZTJA 5CMXH 2ODYB 2ZU1A 1W10U 2CXVA 2PSXA 4H42U 3AK5A 1C4U2 3HATH 1OWEA 3LGTA 5FPTA 3LJJA 2A7HA 3LJOA 5DKMA 4YT6H 2SGQE 2D8WA 4E7NA 5HKKD 2LELA 1HXEH 3SGAE 4TPYA 3SZNA 1GWAA 1GVLA 1SLXB 1QCPA 3SUGA 3TITA 4GHTA 3URCA 3A7WA 3KL6A 2O9QA 1PQ5A 1O3HA 2ZTXA 1BOQA 2HPPH 2WUCA 1W3CA 4O9VA 4VGCC 1L1GA 2WYGA 3A8CA 1AZZA 1O30A 3E0PB 4MNVA 1UTLM 1SI5H 3QUMP 1PPCE 4K60A 1C1RA 1S84A 1PQ7A 2FTLE 3FP8E 2HGTH 4VGCB 1T8OA 2L6OA 4X1SU 1C5QA 1WQSA 3A7TA 4YOIA 1N8OC 3F2GA 1COWD 1GG6C 5IYTA 3F3BA 1P3EA 5KEDA 1IQEA 3PM3A 1OSSA 2LNCA 1O2HA 5EQSA 1VCQA 2OCVB 2KCOA 1N8OB 3ZVBA 3HGPA 1YPMH 2HPQH 3ITIA 2K8IA 4P00A 1WU1A 3N7DA 1C2HA 1TYNA 2A0QB 2R3YA 3LH1A 2D26C 2H5DA 1YF4A 2BZAA 1V2KT 1LHEH 3SV9A 1AFQC 2ZP0H 2G51A 1CT4E 4ACBA 1V6DA 2WPLS 5GCHF 2QF0A 3I29A 2QIQA 2C8XB 2TGDA 4FUBA 1MH0A 1TQ7B 3MH7A 1FDPA 1UVOA 1GBFA 3NZIA 1OWHA 4RT0A 3S9AA 3WW7A 2QY0B 1AFQB 4MNXA 1K1OA 5FBEA 5C17A 4F49A 2ZDLA 1PQ8A 3RU4T 2G81E 5DPAA 4I8KA 3UREA 4P02A 3PRDA 1JOUB 2G5NA 4GPGA 1RTFB 2ULLA 1O3MA 5K7RA 4I31A 1G3CA 3BTHE 5A09A 2EY4C 1K0HA 5EJLA 4RKJB 4U30A 3TH3H 4YESB 3LONA 1KMHB 1BBRH 2ZU3A 2WYJA 1SQOA 1DUEA 1OWDA 2AERH 1EAXA 2BOKA 5FBIA 1EPTB 3EE7A 1UVUH 2ZDAH 3RXHA 4GCHG 2FXRA 4ISIH 1ESAA 1SQRA 4K1EA 3A8DA 1GJ8B 4WJG2 2LPRA 3PMHB 2VNTA 2ZHFH 1B0FA 2WUBA 4LK4A 4YOGA 1J16A 2BHGA 2YNAA 4NFEA 4FXGH 1W0KD 3BTEE 3LC5A 1DDJA 5FX6A 4I7YH 3KIDU 2VH0A 1J14A 2UUYA 2ZECA 4GUXA 2RDEA 2HVYB 1KXFA 1YPHE 1W0YH 2BVXH 3MH6A 3IITA 2BY5X 1O32A 1QBOA 3FANA 2OBOA 1A1RA 4ISHH 1WTHD 1MD8A 1P3CA 3SV2H 4UFDH 2WPKS 1J15A 3TLOA 2PHBA 1XUJA 4ZAEA 1G2MA 1EATA 1TONA 2P3FH 3GY4A 3KQ5A 4IMQA 1TBQH 2KCPA 1HDTH 2DE9A 2FS8A 1T32A 1O5EH 4R0IA 3MQKC 1EAIA 1RIWC 2KFWA 4U32A 3M36A 2FESH 2FMJA 2PKAA 1THSH 3LDXH 1NY22 1P2IA 4JYUH 3N99A 1ZZZA 2VIWA 1O36A 2CGAA 3SV6A 4UONA 2BZ6H 2FOBA 3TPIZ 3LH3A 3ATMA 2AMQA 1KLIH 1RIWB 1D3QB 1FY1A 5C20A 1J9CH 1GI8B 2AHME 3ESTA 1DY8A 1EAUA 1P2OA 1N6YA 4ABGA 1QRZA 5DG6A 5DP3A 1FIWA 2THFB 1YLDA 4AOQA 1A5HA 1QIXB 4CH2B 5C0TA 1QBVH 3L33A 4RSPA 2RFKC 3STJA 1LVYA 1V2TT 1TNHA 1S82A 3RXOA 3SQEE 1E35B 2ZA5A 2Y7ZA 2VIOA 4B2CA 5HM2A 4ZUHA 1W7XH 1YKTA 1ZYOA 1O2QA 1VGCC 1XUIA 2DUCA 1L2EA 1GMHG 2FOGA 3E3TA 2XYAA 1GHAG 3F9HA 6GCHG 1C4Y2 1YCPH 1GHYH 1ORFA 3DCLA 3M5MA 5DJ7A 5EOKA 1O2LA 3MFJA 3RMMH 4ASUD 1QA7A 5I46H 2G55A 3BV9B 1LHFH 3ZZ6A 2XC0A 1HNEE 3KNXA 4ISOA 1IQNA 5HMAA 3IWMA 4DT4A 1C2MA 1QR3E 3SNDA 3MU8A 1YPGH 1ZSJA 2JKHA 3UOPA 3MTYA 1RRKA 3FZDA 3ATWA 1CO7E 1CT2E 3KCGH 2XCFA 3PV4A 1BTYA 1GJ4H 2OC0A 1C5SA 1CU1A 3WY8A 1O2GH 1O3GA 1A7SA 1MZAA 3OAAD 2P16A 3BEIB 1O3IA 3MH5A 1UCYE 1KLJH 1ZTKA 1O2ZA 2ZI2H 1ANBA 2GDEH 3UR9A 3ZZ4A 2QXHA 1EB2A 1TE0A 2SNVA 1HAOH 2RDLA 2V35A 1TA2A 1UCYH 4I8GA 4J2YB 2AEIH 2XBXA 2BXUH 1BHXB 2R3UA 1MABB 1AN1E 3F0PA 1VJ9U 1XM1A 4DVAU 1EJMA 2I6QA 1H8ED 3DFJA 4WXIA 1SBWA 1SG8B 1C2IA 1C1UH 2BD9A 3TU7H 2XNIA 1O3AA 1FQ3A 2ZHWH 3ZV8A 1EKBB 1FPCH 2EI8A 5C1XA 3DSGA 1MD7A 4UFFH 4I8LA 2HRVA 2Y81A 1K21H 5L30H 2PR3A 4TYDA 1L0ZA 1BRBE 3DUXH 3QX5H 2H2ZA 5KGOA 3MU1A 2GCTC 3K2UA 1LPGB 5GJ4B 1O5AB 1WOFA 2ZDVH 3QO6A 5DP6A 3MNXA 5JYIA 3B9FH 2OUAA 3BN9A 5GXPA 2BXTH 2TPIZ 2XBYA 1DWBH 2STBE 4CRBA 1A5IA 3K65B 4F4OC 2GCTB 2IN2A 3M5NA 1O2IA 2AIQA 1MBMA 2GT8A 4CRAA 1O3PB 1YBWA 1UK3A 1ZSLA 3I78A 5ETXA 1RJXB 1C5VA 4AFQA 3RM2H 3RXKA 2FOMB 3A82A 1AGJA 2HVXA 4UEHH 4JYVH 1ELTA 1T8MA 2OTVA 1ABIH 1O3JA 3U8RH 3HKIB 1BCUH 1JRTA 1Z8RA 2FYRA 2P8OC 1WV7H 3PRBA 1O34A 3ZVCA 1IQJA 3SNCA 6ESTA 3LGWA 4X8TH 1G3EA 4ZKNU 2XCNA 3U69H 3SUDA 1MU8B 3OFND 3SJKA 3SN8A 2J97A 3PMJA 5A0AE 3SI4H 1MCVA 3B8JA 4JZ1A 4DW2U 3OEED 3I77A 3D49H 2BQWB 1O2XA 2W6JD 2I6SA 1DPOA 2ZCLP 3FKSD 2ZWLH 2ZQ2A 1C5MD 1SHYA 4Q63A 1AD8H 1UTNA 4KTUA 4DGJA 1UVTH 2AGGX 3PYHA 1WTGH 1HAPH 1T7CA 3LIWA 1LHGH 3MU0A 4Y0YE 1LPZB 2FS9A 3E0NB 1YPHC 1BBRK 3UB0A 3ZZ7A 1SFIA 4AFSA 1FI8A 5JB9S 3KQDA 4JYTA 2QGRA 2AH4X 1JRSA 1O5CB 4UFGH 1D3PB 1THRH 2QXJA 2AS9A 1XX9A 3ZZAA 2C90B 2UUKB 4SGBE 1ELAA 2PKSC 1DOJA 1IQKA 1NM6A 1BITA 1HJAC 1BTZA 1UVSH 4B2AA 1BTWA 3UQVA 1UVPA 8GCHF 1NBMD 2R9PA 3RXVA 1LQEA 4Q7XA 3SJ8A 2CMYA 4BTUB 1LVBA 1F7ZA 3ZVFA 4M9FA 2PKSB 1DXPA 2TGPZ 1T31A 3MH4A 4U2WA 1DWDH 4GAWA 1HJAB 3RXFA 1VKYA 3KYFA 4WF8A 2BDYA 2NU2E 1NO9H 4MVNA 4A92A 5K0HA 3TVJB 3P92A 2Y7XA 4FU8A 1BJUA 2J98B 7GCHG 5L2ZH 1KXAA 4KP0A 1BA8B 2GV7A 5F8ZA 3MWIU 4Y7AA 4Z6AH 1KXCA 2KCAA 5HM9A 5L2YH 5A0CA 1W0JD 2QCYA 4NWKA 1HUTH 4UE7H 2J4IA 1HIAB 4D76A 1AZ8A 4CBOA 1MTWA 3SU2A 3ATIA 1A0LA 3HGNA 2H5CA 5DGJA 2HNTE 1O2YA 2W6ID 5LPFA 1TPSA 5E0GA 1O2OA 4MG3A 3OU0A 1Y8TA 1RFNA 1EJAA 4INLA 4AFUA 3K6ZA 4JZIA 4BAKB 1Z8JB 1LMWB 1YPJH 4IN2A 1W0ZU 2NU1E 2QXIA 5FCKA 1K1LA 1BMMH 3L3TA 1TOCB 1ESBA 5T6DA 1NESE 1C2FA 4NIXA 3RLWH 3A85A 4I33A 1CVWH 3FN8A 1UK2A 1TGTA 2GD4B 3EA9A 3EAJA 1HAYB 2BLWA 2FO9A 1H8IH 2A4QA 1AY6H 2VWOA 3ZZ5A 1YGCH 1K1MA 3EE0B 1ZMNA 2G8TA 1O3EA 1ZJKA 4NSYA 5DSFA 2A5AA 4UD9H 1NRQH 3GYLB 1QJ7B 2GVFA 1RXPA 5LPRA 3SZEA 2GX4A 1OWJA 1YPEH 4R8TB 2B8OH 1PPEE 1DWCH 5FPYA 4NZLA 3SU1A 1B7XB 1GI0A 5EGMA 1GI3A 1N6XA 1O3KA 2TRMA 1INCA 2ODPA 2WHXA 8GCHG 1C1PA 3FP6E 1C9PA 1ELCA 1CT0E 4CH8B 1GHXH 1UMAH 1DUAA 3Q77A 2BDGA 1S6FA 4NSVA 1C5OH 1GBTA 4Y8ZA 1C2GA 1ZTLA 2Z9KA 4JZEH 2UWOA 2BY6X 2Q1JA 1YYY1 1BQYA 2FEQH 1NU9A 1TRYA 1CA8B 4AB9A 2R2MB 2H9HA 1L1NA 2OQUA 1SGEE 3ELAH 1C5YB 4NA9H 3RU4E 1XVOA 1ELDE 1GJDB 3A7YA 2P93A 3BF6H 1P9UA 2ZZUH 3B23B 3FO8D 3GY5A 2V3OH 4XSKU 1GBIA 3STIA 1SR5C 5E2OA 3SV8A 3VB5A 1BMLA 3BG4C 1A3BH 1FZZA 1TNIA 2BD7A 8LPRA 5CHAC 4UFEH 1NRPH 2BD2A 2SGAA 4GCHF 4B76A 1PPZA 2FX4A 3NWUA 3GDVA 1P04A 3MO6A 1F0SA 1OYTH 2EC9H 1S6LA 4WH8A 3BG4B 3V12A 2QA9E 1CBWC 5CHAB 4TPIZ 3TNTA 2R0LA 4BANB 4Y6DA 4X8SH 1PPGE 4BAQB 1KDQB 1SMFE 2BMGB 1Z1JA 5JBBS 1GJBB 3PMBB 4A1TA 1GBLA 3PTBA 1FN6A 1WQVH 5EW2H 2WPHS 3M7TA 1CBWB 4YT7H 3U9AH 4X0WU 1M9UA 3BTTE 1ZHPA 3OSYA 2IJD1 2ZU5A 3M37A 1MTUA 2BDIA 5ABWA 3MNSA 1D6WA 2XNDD 4FUCA 3VG8A 2V3HH 5FCRA 5T6FA 2CV3A 1TX8A 3QZRA 2VH6A 1C5RA 3A87A 2ZFSA 4NG9H 2PGBB 2J2UA 3SU0A 3N7OA 1BB0B 1HFDA 1DVAH 2GTBA 1E0FD 3EQ0H 1HJ9A 1RTKA 1P9SA 2J38A 3RXTA 4FUHA 4LZ4B 4X1RU 4Q7ZA 2W3KA 1GJ6A 2AMDA 1AKSB 1XKBC 5DO4H 1GVKB 2A5IA 1S6HA 3M3TA 1QFKH 2RA3A 4BNRA 2CK3D 1PQAA 3QZQA 4K3JA 2VB0A 2Y5FA 1V2UT 1LHCH 1B5GH 1TMBH 3BTKE 5C5NA 1GMHF 4DCDA 6GCHF 1GHAF 1W11U 2F9BH 3ODDA 1Q3XA 1LVMA 1UHBB 2G4UA 4FUIA 5C94A 3SJ9A 4H6SB 4X6NA 1GCTB 1MZDA 1TBZH 5L6NH 1CA0C 4DG4A 2V3MA 1AVWA 1GVZA 1EPTC 1HGTH 1BBRE 4M7GA 4ASHA 3TGKE 2VVCA 2FPZA 4AYVB 4K69A 1CGIE 2A7JA 4BTIB 4H4FA 1S0RA 4DIHH 1O2SA 4YTAA 4ABFA 1QNJA 3OTJE 1UK4A 1CA0B 1BTPA 1EJNA 1O39A 1O33A 3DFLA 3UTUH 2UWLA 5SGAE 2WPMS 3OTPA 2CN0H 4OGYA 1D3DB 2D1JA 2FI4E 3ZVAA 3SU5A 1GHZA 1CHGA 3K9XB 1GHVH 1AWHB 3VB7A 1ZGVA 7ESTE 2WPJS 1RGQA 1BUIA 2HNTC 1KTSB 2BDBA 1DFPA 1ZHRA 2BX3A 3PO1C 1EUFA 5C3NA 1XKAC 5C0UA 4B71A 1F92A 1SGTA 1GDQA 3RXQA 1MAXA 1HIAA 3A89A 5C1YA 1GI9B 1H9LB 3FZZA 4FOUC 5C1UA 3M3VA 4AC9A 1K1PA 1WCZA 1YPKH 5T3HA 4CHAC 1OX1A 3PO1B 4BAOB 2JH5D 3BSQA 3MU4A 1G2LA 1GJAB 4JCNA 2ZC9H 2IOTA 1TFXA 2KAIB 1FN8A 1HAVB 3D65E 5TCCA 4Y79A 1QY6A 2ZU2A 5B6OA 1DM4B 2EEKA 2OC8A 1ZSKA 1A3EH 4CHAB 3KQBA 4IS5A 3GCHB 1TNGA 3JZ2B 5FL7D 1MTSA 2OINA 2IJOB 1YY3A 3MNBA 3EGKH 2Z3EA 1LHDH 1P2MA 2J92A 3VEQB 3RXEA 2XC5A 4IC5A 1GI7B 1Z6EA 4YOJA 2P94A 1SPJA 5EXMA 3ZVEA 1UO6A 3LPRA 1W2KH 2GCHF 2Z7FE 2ZTZA 1G3DA 1NS3A 1GI4A 4K5ZA 4B6EA 1Y5UT 1D6RA 3P70B 3BIUH 4ZHLU 2Y5HA 1NPMA 4B2BA 4CRFA 4WMEA 1FMGA 4I8JA 3DD2H 2B5TB 1K1JA 1TNLA 1W13U 1GI6A 2VWMA 5DP4A 4FUGA 1TABE 1TMUH 5GDSH 1ETSH 2CJIA 1QL7A 4QT8C 7LPRA 1SQAA 1UTKA 1KLTA 4HZHA 2GZ9A 2FOCA 1EB1H 2IPQX 2RCEA 4TWWA 1MKWK 2ANYA 4NGAH 1V2VT 2F9PA 4B75A 5AFYH 3Q3KA 1J8AA 2PW8H 2ZO3H 3VXFH 2EI6A 3T2NA 3LOXA 3E16B 1MKXK 1C5PA 1YC0A 3A84A 1O31A 3T26A 1EOJA 2AYWA 2QC2A 1ZGIA 5CDFE 4CR5A 4Y8YA 5A0BA 5DP7A 3P8FA 1SHHB 1TPAE 3VGCC 1IHTH 2Q6FA 3LGYA 1EP6A 2F4LA 4A1VA 1O3LA 2L74A 1A46H 3RM0H 1VCWA 3W94A 2BQ6B 1KTTB 1AMHA 1LDTT 4DT7B 3GICB 3OY5U 1EZXC 1QRXA 2PTCE 3LGIA 2ZGCA 2JJ2D 3QWCH 4I32A 3ZZ9A 1AWFH 1UTOA 3VGCB 1V2OT 3GCNA 1TGCA 1NFYA 4F55A 1UTJA 2C8ZB 2QF4A 2ZPRA 5AVDA 2XW9A 3Q76A 2BDAA 3UNSA 3UPEA 1O2UA 3W95A 3TH4H 3ZYDA 3LGUA 1XMNB 5TCAA 4AZ2B 4KTCA 1DT2A 4IW4E 3F9FA 4B1TA 3RP2A 1E34B 2XWBI 1GBHA 4JZDH 2VVVA 3E90B 1E1QD 3EA7A 1HYLA 2GP9B 3RXSA 1BDAA 2VIDA 4WWYA 5E0JA 2FOHA 2DE8A 1UTQA 2XXLA 4MTBA 2EI7A 2ZGJA 1P0SH 4J1YA 3RXLA 3TGIE 2XBVA 2GCHG 4GLYA 1A0JA 3UUZA 5JBAS 2G4TA 1EZSC 2ZGBH 1KIGH 3SHAH 3G01A 1TGSZ 3ZVGA 1K2I1 3U28C 7GCHF 5HYOA 1O2RA 1JXPA 3VPKA 5EU8A 1T8NA 1DWEH 2D2DA 2C3SA 2ZEBA 1TRMA 4ZXXH 1DANH 3QDZB 2ZFPH 1YLCA 3QK1A 3S9BA 4F48B 3RXAA 1LCYA 3KQEA 3M61U 4ABAA 1Y3WA 1P09A 1IQFA 4MPXA 4LXBH 1IQIA 1HAIH 1O2PA 4TY6A 4X2WA 5HGGA 1EQ9A 2A2QH 2ZFTA 2H9EH 2WV5A 4ZCNA 1G30B 5AHGH 1GBDA 2W7UA 1XUGA 3M5LA 2AGEX 1GJ5H 2Z3DA 2ZCHP 1P02A 2F43B 3T29A 1AQ7A 1OS8A 2K0QA 2F3CE 3KHVA 4AG1A 3GCOA 1O5DH 2ZKSA 1O37A 5C67A 3R3GB 1YM0A 2P3TB 3MO9A 3TJVA 4BXSA 5G4BA 2P3UB 1NC6A 2O8WA 3RC6A 4ABEA 1WUNH 5EPNA 1P06A 2UWPA 1FY5A 5GPIB 1LO6A 3HK6B 3P8GA 1H9IE 1DSUA 4O3UA 3A7XA 1N1LA 1NRSH 1HXFH 2FLRH 2FTMA 3S0NA 1GCDA 1V2RT 1NROH 1OXGA 1FAKH 3GCTF 1WYKA 1EPTA 2ZDKA 1O35A 1TPPA 2BD4A 1CSOE 4AORA 4ABIA 2YOLA 1TALA 4IGDA 5F8TA 2VINA 1C1NA 4TT3D 2JJ1D 4THNH 4YO9A 3F1SB 1CGHA 1A5GH 1O5GH 1SGDE 2WPDD 1GGDC 1QA0A 3E6PH 2FOFA 2KX4A 1HAZB 2STAE 3CNRA 4ZROA 2G5VA 1C2EA 2VGCB 1SQTA 1S83A 5A8XA 2ZDNA 1TOMH 4OS7A 3CS0A 1WAYB 2J94A 4AGKA 1GGDB 2O8UA 3ATKA 1F5LA 4XBBA 2CF9H 1MTVA 1TAWA 3QTVH 1JMOH 3BIVH 3H09A 1Y3XA 3F6UH 3RU4D 2RA0A 3M5OA 3UWJH 2SGDE 3VB6A 4X2YA 2HWLB 3TK5A 1HCGA 4FU9A 4ZKSU 3E8LA 4PROA 1GI1A 2FI3E 1JIMA 1QB9A 1C1OA 3SO3A 2O8LA 1O2WA 1ANDA 4CRGA 3QN7A 2Z94A 2C8WB 1P8VC 3AW1A 1FX0B 2V6NA 3P17H 5FX5A 1NN6A 4D8NA 3QLPH 1H1BA 2G00A 3SW2B 2ANKH 2Y6TA 4H6TA 4AG2A 2H6MA 4Q80A 1OP0A 2FZZA 3F2FA 5EXNA 1PFXC 3OYPA 2KZ4A 5EJZA 2ALPA 3SJOA 1H9HE 3V13A 2WZQA 4YM9A 3UAIC 3F68H 1TX6A 2ZFRH 2B0FA 3NRLA 1GJ9B 3RXJA 1HRTH 3PB1E 1DX5M 4D9RA 4FUDA 4K1TA 3SQHE 3HKJB 3LGVA 3O8BA 2A45B 2K1QA 1XUKA 3RXRA 3M35A 3T28A 1DICA 3C1KA 2WINI 4OS6A 1GI5A 2OBQA 3ZZDA 1TPOA 2ZDMA 2BY8X 4ESTE 1QL8A 3DHKH 2SGEE 3NXPA 1C4V2 2OC7A 3HK3B 9LPRA 2PKAB 3EDXB 1O5BB 4ZKOU 5HIYA 3U1IB 1RTLA 2ZPSA 3BTQE 2FP7B 5F03A 3PMAB 2M5TA 2VVUA 3MOCA 1C5TA 3GCTG 4AN7A 1NTPA 3HPTB 4ABBA 3Q00A 3PLKA 1Z71A 4JZFH 1V2LT 5F53A 1EZUC 3F9GA 2F9VA 1G3BA 4X1PU 1A61H 1HB0B 3GISB 5E2PA 1TB6H 1L1JA 2Z3CA 1VR1H 4ZMAH 2ASUB 2PUXB 4X6MA 4AGJA 1MKWH 1EASA 4XD7D 2ZFFH 4OGXA 3TJOA 2BD8A 1Y59T 3WWBA 1FLEE 1TNKA 2WPIS 4MPWA 2FI5E 1MKXH 2ZG0H 1E38B 3ZIAD 1C1QA 1O3FA 1XUFA 3UR6A 1IQLA 1T8LA 4OS1A 1MBQA 4MDSA 1QGFA 3VB4A 2VIQA 5EG4A 1Y5BT 1CHOF 2HLDD 2FOAA 4K1SA 1LKBA 1P2NA 3RMNH 1GPZA 4NA8A 3SGQE 2R0KA 3SU4A 4BXWA 1TX7A 3FOAA 2VWLA 3RUOA 2BDCA 4FU7A 1ELVA 1NT1A 3MO3A 4SGAE 2QYIA 2OP9A 3ZZ3A 2A31A 2ZNKH 2ZFQH 1P10A 1W8BH 2O8TA 3S9CA 3SYJA 4XFQA 4NCYA 5DP5A 1EFRD 4B6FA 1PJPA 3GDSA 3FP7E 1VJAU 1P2JA 3A8AA 3NK8A 1SGNE 2YMSC 5BRRE 2BM2A 2EQNA 3GY8A 3ZV9A 1OOKB 1ZPZA 1OP2A 3L6PA 2BD5A 1O5FH 3P8OA 2QN5T 3A80A 5A8YA 2Z9LA 1SFQB 3EA8A 5JPMH 1SOZA 4INHA 2J9NA 4MPVA 2YMSB 4UDWH 4A7IB 5A2MH 1D9IA 4ACAA 1AE5A 2BYAX 2CF8H 1ETRH 5PTPA 3UWIA 3H7TA 4WVPE 2OLGA 3BTFE 3Q3YA 1BTXA 1FUJA 1THPB 1F5RA 1L4ZA 1QL9A 4ABHA 2NU0E 2PWXA 2F91A 3UNQA 3SJIA 1AE8H 4X8UH 1IQMA 2Z6BD 1O2NA 2XTTB 4E06H 1F0UA 3KGPA 1OPHB 1TQ0B 2LP6A 3SNBA 5H4IB 3UNRA 2QV1A 5E8EH 4CR9A 1V2QT 4B74A 5JBTA 3MHWU 4AB8A 1YLNA 4I86A 5C2ZA 4ABDA 2UUFB 4X2VA 4NZQA 1KXDA 5FHTA 3V0XA 4ISLA 4XE4A 5BPEA 3DSPA 3AVZA 1ZPCA 3A86A 2BD3A 1YP9A 3LT3A 5B6LA 3LKWA 3GY6A 2Y82A 1O3BA 1SKYE 3RDZA 2XOKD 4TY7A 1PYTC 1P2QA 2QAAA 1IHSH 1HPGA 3M7UA 1MQ5A 3C27B 3TJUA 1SSXA 3BTDE 1C2DA 1Y3YA 2BVRH 4D9QA 2JETC 2ALVA 1OKXA 1O2MA 4INKA 1GG6B 3MU5A 1GCTC 3PLPA 1PPHE 2Z9GA 2A4GA 1BIOA 4E7RG 1CHOG 1Z7KA 1BMNH 3AASA 2GZ7A 5DP9A 2B9LA 2H1UA 3MNCA 3UFAA 2F9UA 5EXLA 2JETB 2ZGXH 2ZHEH 1DITH 3MMGA 1ABJH 2GKVE 2ZCKP 4A1XA 1QURH 1ANEA 2A2XH 3P6ZB 1A4WH 3KN2A 1V2PT 5ESBA 3U8TH 1ELFA 5EODA 3BTWE 4Q2KA 1O3DA 3PLBA 1BMFD 5DK1A 3CP7A 1W12U 1K22H 3GYMA 5EPYA 2FLBH 4KGAA 8ESTE 1S81A 3SOSA 2PGQB 1UJ1A 1P57B 5GNDA 1E36B 3KEEA 2JH6D 3ZZ8A 4FETA 1C1WH 1FXYA 3R0FA 1IOEA 5T1VA 2Z9JA 1OHHD 3JZ1B 4X1QU 2J98A 1AVXA 4RN6A 2BLQA 3ODFA 1O0DH 3ATLA 4IC6A 1U6QA 1MQ6A 1ZJDA 3GY2A 3T25A 2BX4A 2TBSA 4K8YA 1BMAA 1GI2A 2PTNA 2C93B 1HJ8A 1TA6A 1ANCA 4YLUA 3RXUA 1SGRE 1DS2E 3T27A 1AI8H 2ZF0H 4OS5A 3ZYEA 3AAUA 1X7AC 4TSFD 1A0HB 1C1TA 1KXEA 2NU4E 2KCYA 5EIYA 1L4DA 1ETTH 2BB4A 1XUHA 4K2YA 5CHBA 1T4VH 2JDID 1ZOMA 2Z9IA 3GCHC 4O97A 1C1MA 2SGFE 1IQHA 1HV7A 2UUJB 3FAOA 1KY9A 1V2NT 3RC4A 1C5WB 1G32B 2FIRH 1E1RD 1TNJA 1C5ZB 1NFXA 1SVPA 2WV9A 3MYWA 1E37B 4RI0A 4DY7B 1AUTC 1FONA 1S0QA 2GDDA 3P8NA 4O3TA 2SNWA 1ZPBA 4X2XA 4X6PA 3QGNB 1ZRKA 1V2WT 3DSOA 3Q3XA 6CHAC 2QXGA 3T5FH 1P2KA 1DLKB 3RXCA 5EQQA 3D23A 1GBAA 3QTOH 3N7EA 4OS4A 1TBRH 2OQ5A 2VIVA 1UTPA 4NIYA 3VXEH 3RXGA 4HFPB 4Z0KA 1T4UH 2CHAC 2YMSD 2ZHQH 4NIWA 1ZMJA 5I25A 6CHAB 1TGBA 1D3TB 1QB1A 5F6MA 5KECA 1Z8IB 3A88A 4ZHAA 1DSTA 5HXFA 3LC3A 1GBCA 1TRNA 2CHAB
chains in the Genus database with same CATH topology
3KQCA 3U8OH 5GCHG 1K1IA 1V2ST 3EYDA 6LPRA 4IMZA 2PV9B 2FOEA 1GDNA 1F5KU 2ILNA 4AFZA 1CGJE 2RG3A 3NKKA 1VCPA 3SU6A 2A4OA 5JB8S 4WH6A 1S85A 1P12E 2ZGHA 4E05H 1VGCB 1C5LH 1GHBF 4Y0ZE 4K8BA 4IN1A 3ENSB 1SGPE 2AGIX 4Y76A 3AAVA 3CENA 1MMJN 2OD3B 2Y5GA 1AFEH 1VITF 2C4FH 1SC8U 1V2MT 1HAXB 4WMDA 1FPHH 3RXDA 1O2VA 3RXMA 2FWWA 3A8BA 1P11E 1TIOA 3P95A 1G37A 4XBCA 3O8DA 3RLYH 1F0RA 1HAHH 2TIOA 4BOHA 1FJSA 1PYTD 1C5NH 2B7DH 2TGAA 4YLQH 1WSSH 2WV4A 1QQUA 4AX9H 1XXDA 4WMFA 2F83A 1ELEE 1AVGH 3D62A 3GDUA 1LVOA 2GMTC 4BTTB 5F8XA 1YCPM 2BLVA 4X8VH 5LPEA 2QF3A 4JMYA 3M7QA 4Y8XA 1KDQA 1ARCA 4NWLA 1QHRB 1QJ1B 1TMTH 3UIRA 2F9OA 2GMTB 2A5KA 1GMCF 2VU8E 3F9EA 1C1VH 1S5SA 3VFEA 1TLDA 1TWXB 4NA7A 2PSYA 1NRNH 1KXBA 5T6GA 7KMEH 5CE1A 9ESTA 3E91A 1GBBA 2J95A 3A7ZA 1Q2WA 4O03A 3FFGA 3SUEA 1C2KA 3OY6U 4HTCH 1F0TA 4DURA 3M3SA 3RXBA 5TJXA 3UQOA 3UOUA 1K1NA 1Q31A 1BTUA 5ESTE 5FXLA 4DJZB 2W7SA 2ZQ1A 3H5CB 5GWZA 5E0HA 1ID5H 1HBTH 4MLFB 3URDA 4FUJA 1MUEB 1JIRA 1AU8A 5GIBA 1C5UA 1GBJA 3S7KB 3CS7A 1P01A 1KYNA 2A32A 4MQAA 2SFAA 1CE5A 1AKSA 2GT7A 1G36A 2XBWA 2FDAA 3SBKA 4DOQA 4KKDA 1EOLA 2ODQA 4D7GA 2HNTF 5J4QA 4OS2A 1QJ6B 2PLXA 4ZHMU 2ZHDA 1DY9A 3GY7A 3OX7U 2G52A 2FM2A 1C1SA 1B0EA 1F2SE 5A8ZA 1DLEA 3ZZCA 4ZXYH 5FAHA 1LTOA 1SGFA 4Q7YA 2AFQB 3S69A 5EW1H 4HI3A 1J17T 1OWIA 2Q6GA 1UHBA 4BAMB 1BJVA 1EX3A 4WXVA 1SGQE 3E1XB 2IPHA 1K28D 1GHBG 1G9IE 1BZXE 3TIUA 1EXFA 1SOTA 3TK6A 1Y5AT 4FUFA 5DP8A 1VITG 1GBEA 2W26A 3BTGE 1ESTA 2P8OB 1RD3B 4ABJA 2YNBA 2GGVB 3U98H 1Z8GA 2VJ1A 2A4RA 1P05A 2JH0D 1FNIA 3VB3A 1QB6A 2VGCC 4I8HA 3ZZBA 1VZQH 2A7CA 4ISNA 1NFWA 1V2JT 2BTCE 4WY3A 2ANWA 2BDHA 3V3MA 1MAYA 1O2KA 1RS0A 2OXSA 1SGFG 3PTNA 4CRDA 1VITH 1XXFA 1AIXH 4X1NU 1AB9C 2ZPQA 1BT7A 3SGBE 1BTHH 4BAHB 1C5XB 3GOVB 3BEUA 4XOJA 1HAGE 1GMCG 3LU9B 3TK9A 2BY9X 1DXWA 2BY7X 4FVDA 3SORA 1SB1H 1SLUB 1D4PB 4U01A 3PWBA 1AB9B 4XBDA 1GDUA 2W3IA 2P59A 1OP8A 2AIPA 1ACBE 4CREA 4LZ1H 4DIIH 3TGJE 4Y11E 2KAIA 1TGNA 1HAVA 1FV9A 1FY8E 1GJCB 1XVMA 1GMDF 3FVFB 5FPSA 4HGCA 1ZLRA 3S7HB 4NFFA 5JBCS 1YPLH 1Y3VA 4FUEA 2C8YB 1GL0E 3U1JB 2J34A 2VIPA 1AHTH 1GHWH 4Y7BA 1Z1IA 1FIZA 1JWTA 3DA9B 1Y3UA 3SHCH 4NIVA 2BLOA 3SNAA 3BTME 3MI4A 1SLVB 4XDEA 4RKOB 1BHXF 1NZQH 1NU7B 1BRUP 1NFUA 1O2JA 3A83A 2ZIQH 1EP5A 3SI3H 1OWKA 1W7GH 2GV6A 1FY4A 1Z6JH 1SGYE 3NPSA 1LQDB 2NU3E 3K6YA 1EAWA 4B73A 1ZHMA 2F9NA 3RC5A 2Y80A 2R2WU 4ZKRU 2XWAA 2ESTE 1KSNA 2PUQH 3A7VA 1BRCE 5EQRA 1LPKB 4KELA 5JDUB 3ZVDA 1W14U 1A2CH 1MCTA 1GL1A 1GBMA 2SGPE 2BOHB 1K9OE 4JK6A 1SLWB 2VWNA 1ELBA 1FAXA 2W5EA 3SU3A 1MTNC 2Q6DA 4GHQA 1ZR0A 4GSOA 2HOBA 1C9TA 1ZMLA 3RMOH 4AYYB 3T62A 3NUMA 2O8MA 3NCLA 1YCPK 1O3OA 4MPUA 5AFZH 1O38A 8KME2 1AUJA 4KTSA 1ARBA 1QQ4A 2TGTA 1QTFA 1NRRH 4ZH8A 1GJ7B 3TJNA 1MTNB 4D7FA 1GBKA 1CQQA 2ZU4A 3RXPA 3V7TA 3QGJA 4JK5A 3SUFA 1LKAA 5AF9H 5LH8A 2ZTYA 3AW0A 3PWCA 1O3CA 1C2JA 1QRWA 1O3NA 1BRAA 1H4WA 2BVSH 1OYQA 1EZQA 2HALA 4Y71A 4GVUA 2EA3A 3PROA 3RMLH 1PPFE 1JBUH 3BG8A 3SV7A 3RXIA 1QBNA 2AMPA 3A81A 1HLTH 4MNYA 5LGOA 1C2LA 4YZUA 4MNWA 1IQGA 1P03A 1WBGB 2XRCA 1PPBH 1H8DH 1V3XA 5IDKA 1MU6B 3TH2H 1GMDG 1UCYK 4Y10E 2P95A 2XC4A 4LOYH 3TNSA 1AO5A 3DT0H 2OC1A 3KF2A 4FVBA 5C5OA 3IG6B 4A5TS 1SGIB 2HLCA 1DE7H 1FY3A 3SNEA 1SL3A 4TWYA 5J4SA 2A1DB 3GY3A 4IBLH 2FYQA 3H7OA 3O8CA 2FODA 1ZRBA 2BQ7B 2FX6A 4X6OA 3BEFB 1UTMA 2V0BA 4CRCA 4CBNA 1SGCA 2NWNA 1ELGA 2PFEA 1O2TA 1IAUA 3UY9A 2GZ8A 3O8RA 4A6LA 2ANMH 2H9TH 1ZTJA 5CMXH 2ODYB 2ZU1A 1W10U 2CXVA 2PSXA 4H42U 1C4U2 3HATH 1OWEA 3LGTA 5FPTA 3LJJA 2A7HA 3LJOA 5DKMA 4YT6H 2SGQE 2D8WA 4E7NA 1HXEH 3SGAE 4TPYA 3SZNA 1GWAA 1GVLA 1SLXB 1QCPA 3SUGA 3TITA 4GHTA 3URCA 3A7WA 3KL6A 2O9QA 1PQ5A 1O3HA 2ZTXA 1BOQA 2HPPH 2WUCA 1W3CA 4O9VA 4VGCC 1L1GA 2WYGA 3A8CA 1AZZA 1O30A 3E0PB 4MNVA 1UTLM 1SI5H 3QUMP 1PPCE 4K60A 1C1RA 1S84A 1PQ7A 2FTLE 3FP8E 2HGTH 4VGCB 1T8OA 4X1SU 1C5QA 1WQSA 3A7TA 4YOIA 1N8OC 1GG6C 5IYTA 1P3EA 1IQEA 3PM3A 1OSSA 2LNCA 1O2HA 5EQSA 1VCQA 2OCVB 1N8OB 3ZVBA 3HGPA 1YPMH 2HPQH 3ITIA 1WU1A 1C2HA 1TYNA 2A0QB 2R3YA 3LH1A 2D26C 2H5DA 1YF4A 2BZAA 1V2KT 1LHEH 3SV9A 1AFQC 2ZP0H 2G51A 1CT4E 1V6DA 2WPLS 5GCHF 2QF0A 3I29A 2QIQA 2C8XB 2TGDA 4FUBA 1MH0A 1TQ7B 3MH7A 1FDPA 1UVOA 1GBFA 3NZIA 1OWHA 3S9AA 2QY0B 1AFQB 4MNXA 1K1OA 5FBEA 4F49A 2ZDLA 1PQ8A 3RU4T 2G81E 5DPAA 4I8KA 3UREA 1JOUB 2G5NA 4GPGA 1RTFB 2ULLA 1O3MA 5K7RA 4I31A 1G3CA 3BTHE 5A09A 4RKJB 4U30A 3TH3H 4YESB 3LONA 1BBRH 2ZU3A 2WYJA 1SQOA 1DUEA 1OWDA 2AERH 1EAXA 2BOKA 5FBIA 1EPTB 1UVUH 2ZDAH 3RXHA 4GCHG 2FXRA 4ISIH 1ESAA 4K1EA 3A8DA 1GJ8B 4WJG2 2LPRA 3PMHB 2VNTA 2ZHFH 1B0FA 2WUBA 4LK4A 4YOGA 1J16A 2BHGA 2YNAA 4NFEA 4FXGH 3BTEE 3LC5A 1DDJA 5FX6A 4I7YH 3KIDU 2VH0A 1J14A 2UUYA 2ZECA 4GUXA 1KXFA 1YPHE 1W0YH 2BVXH 3MH6A 3IITA 2BY5X 1O32A 1QBOA 3FANA 2OBOA 1A1RA 4ISHH 1WTHD 1MD8A 1P3CA 3SV2H 4UFDH 2WPKS 1J15A 3TLOA 2PHBA 1XUJA 4ZAEA 1G2MA 1EATA 1TONA 2P3FH 3GY4A 4IMQA 1TBQH 1HDTH 2DE9A 2FS8A 1T32A 1O5EH 4R0IA 1EAIA 1RIWC 4U32A 3M36A 2FESH 2FMJA 2PKAA 1THSH 3LDXH 1NY22 1P2IA 4JYUH 1ZZZA 2VIWA 1O36A 2CGAA 3SV6A 4UONA 2BZ6H 2FOBA 3TPIZ 3LH3A 3ATMA 2AMQA 1KLIH 1RIWB 1D3QB 1FY1A 5C20A 1J9CH 1GI8B 3ESTA 1DY8A 1EAUA 1P2OA 1N6YA 4ABGA 1QRZA 5DG6A 5DP3A 1FIWA 2THFB 1YLDA 4AOQA 1A5HA 1QIXB 4CH2B 1QBVH 3L33A 4RSPA 3STJA 1LVYA 1V2TT 1TNHA 1S82A 3RXOA 3SQEE 1E35B 2ZA5A 2Y7ZA 2VIOA 4B2CA 5HM2A 4ZUHA 1W7XH 1YKTA 1ZYOA 1O2QA 1VGCC 1XUIA 2DUCA 1L2EA 1GMHG 2FOGA 3E3TA 2XYAA 1GHAG 3F9HA 6GCHG 1C4Y2 1YCPH 1GHYH 1ORFA 3M5MA 5DJ7A 5EOKA 1O2LA 3MFJA 3RMMH 1QA7A 5I46H 2G55A 3BV9B 1LHFH 3ZZ6A 2XC0A 1HNEE 3KNXA 4ISOA 1IQNA 5HMAA 3IWMA 1C2MA 1QR3E 3SNDA 3MU8A 1YPGH 1ZSJA 2JKHA 3UOPA 3MTYA 1RRKA 3FZDA 3ATWA 1CO7E 1CT2E 3KCGH 2XCFA 3PV4A 1BTYA 1GJ4H 2OC0A 1C5SA 1CU1A 3WY8A 1O2GH 1O3GA 1A7SA 1MZAA 2P16A 3BEIB 1O3IA 3MH5A 1UCYE 1KLJH 1ZTKA 1O2ZA 2ZI2H 1ANBA 2GDEH 3UR9A 3ZZ4A 2QXHA 1EB2A 1TE0A 2SNVA 1HAOH 2RDLA 2V35A 1TA2A 1UCYH 4I8GA 4J2YB 2AEIH 2XBXA 2BXUH 1BHXB 2R3UA 1AN1E 1VJ9U 1XM1A 4DVAU 1EJMA 2I6QA 3DFJA 4WXIA 1SBWA 1SG8B 1C2IA 1C1UH 2BD9A 3TU7H 2XNIA 1O3AA 1FQ3A 2ZHWH 3ZV8A 1EKBB 1FPCH 2EI8A 5C1XA 1MD7A 4UFFH 4I8LA 2HRVA 2Y81A 1K21H 5L30H 2PR3A 4TYDA 1L0ZA 1BRBE 3DUXH 3QX5H 2H2ZA 3MU1A 2GCTC 3K2UA 1LPGB 5GJ4B 1O5AB 1WOFA 2ZDVH 3QO6A 5DP6A 3MNXA 5JYIA 3B9FH 2OUAA 3BN9A 5GXPA 2BXTH 2TPIZ 2XBYA 1DWBH 2STBE 4CRBA 1A5IA 3K65B 4F4OC 2GCTB 2IN2A 3M5NA 1O2IA 2AIQA 1MBMA 2GT8A 4CRAA 1O3PB 1YBWA 1UK3A 1ZSLA 3I78A 5ETXA 1RJXB 1C5VA 4AFQA 3RM2H 3RXKA 2FOMB 3A82A 1AGJA 2HVXA 4UEHH 4JYVH 1ELTA 1T8MA 2OTVA 1ABIH 1O3JA 3U8RH 3HKIB 1BCUH 1JRTA 1Z8RA 2FYRA 2P8OC 1WV7H 1O34A 3ZVCA 1IQJA 3SNCA 6ESTA 3LGWA 4X8TH 1G3EA 4ZKNU 2XCNA 3U69H 3SUDA 1MU8B 3SJKA 3SN8A 3PMJA 5A0AE 3SI4H 1MCVA 3B8JA 4JZ1A 4DW2U 3I77A 3D49H 2BQWB 1O2XA 2I6SA 1DPOA 2ZCLP 2ZWLH 2ZQ2A 1C5MD 1SHYA 4DGJA 1AD8H 1UTNA 4KTUA 1UVTH 2AGGX 3PYHA 1WTGH 1HAPH 1T7CA 3LIWA 1LHGH 3MU0A 4Y0YE 1LPZB 2FS9A 3E0NB 1YPHC 1BBRK 3ZZ7A 1SFIA 4AFSA 1FI8A 5JB9S 3KQDA 4JYTA 2QGRA 2AH4X 1JRSA 1O5CB 4UFGH 1D3PB 1THRH 2QXJA 2AS9A 1XX9A 3ZZAA 2C90B 2UUKB 4SGBE 1ELAA 2PKSC 1DOJA 1IQKA 1NM6A 1BITA 1HJAC 1BTZA 1UVSH 4B2AA 1BTWA 3UQVA 1UVPA 8GCHF 2R9PA 3RXVA 1LQEA 4Q7XA 3SJ8A 2CMYA 4BTUB 1LVBA 1F7ZA 3ZVFA 2PKSB 1DXPA 2TGPZ 1T31A 3MH4A 4U2WA 1DWDH 4GAWA 1HJAB 3RXFA 4WF8A 2BDYA 2NU2E 1NO9H 4MVNA 4A92A 5K0HA 3TVJB 3P92A 2Y7XA 4FU8A 1BJUA 7GCHG 5L2ZH 1KXAA 4KP0A 1BA8B 2GV7A 5F8ZA 3MWIU 4Y7AA 4Z6AH 1KXCA 5HM9A 5L2YH 5A0CA 2QCYA 4NWKA 1HUTH 4UE7H 2J4IA 1HIAB 4D76A 1AZ8A 4CBOA 1MTWA 3SU2A 3ATIA 1A0LA 3HGNA 2H5CA 5DGJA 2HNTE 1O2YA 5LPFA 1TPSA 5E0GA 1O2OA 4MG3A 3OU0A 1Y8TA 1RFNA 1EJAA 4INLA 4AFUA 3K6ZA 4JZIA 4BAKB 1Z8JB 1LMWB 1YPJH 4IN2A 1W0ZU 2NU1E 2QXIA 5FCKA 1K1LA 1BMMH 3L3TA 1TOCB 1ESBA 5T6DA 1NESE 1C2FA 4NIXA 3RLWH 3A85A 4I33A 1CVWH 1UK2A 1TGTA 2GD4B 3EA9A 3EAJA 1HAYB 2BLWA 2FO9A 1H8IH 2A4QA 1AY6H 2VWOA 3ZZ5A 1YGCH 1K1MA 3EE0B 1ZMNA 2G8TA 1O3EA 1ZJKA 4NSYA 2A5AA 4UD9H 1NRQH 3GYLB 1QJ7B 2GVFA 1RXPA 5LPRA 2GX4A 1OWJA 1YPEH 4R8TB 2B8OH