1GHZA

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ghzA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ghzA02
2D1JA 2QYIA 1C1VH 5FPYA 3FZDA 4BXWA 1P57B 2GT7A 1HAVB 1QURH 4A1TA 1KTSB 4K1SA 1A3BH 2XC4A 3PYHA 5JBBS 4DVAU 1UHBB 3O8DA 5A8ZA 3RC6A 3O8BA 1DS2E 4Q7XA 3UPEA 1TIOA 1TNHA 2UWLA 3M3VA 3P92A 1ZGVA 3MO6A 2BD2A 1OWKA 3A8BA 2BD8A 1LVMA 2PR3A 1YF4A 5FBIA 4BANB 3H5CB 1P2OA 3ATWA 1QB6A 5DKMA 1GVZA 1DUAA 1V2JT 4I8GA 3GYMA 2Z3DA 2TGDA 5AFYH 3S9AA 3SV8A 5T6FA 3GISB 2RA0A 1A5IA 4NWLA 1FJSA 2Y82A 1HAXB 1NN6A 1C4U2 2XYAA 1Z71A 2GT8A 2ZU5A 4ZKRU 5EQQA 1W10U 1NRRH 1GBJA 2ODQA 2V35A 4MNXA 1BMMH 1FN6A 1PFXC 4Q80A 1UTNA 2R3YA 1Q3XA 5TJXA 1O39A 1YGCH 2DUCA 2VIDA 4Y71A 1CQQA 1VITH 1LHCH 3QGJA 5K7RA 2FX6A 1TFXA 5C1YA 1W3CA 2ANWA 3M5MA 1GL0E 1Z6EA 3STIA 3BTKE 1TPPA 2C8WB 3A87A 1SGRE 1SLVB 3K6YA 3D65E 3T2NA 1TMTH 5FX5A 1FZZA 1P2NA 1KLTA 1K1JA 2ZPRA 5C5NA 4UFGH 3EQ0H 1FY5A 1T31A 1O2XA 1QJ1B 3RUOA 1HIAB 3MU8A 4AB8A 3BTHE 1E38B 2K1QA 2I6SA 4B2AA 1VJAU 4Q2KA 3ZZ4A 5L2YH 1GBEA 3F9FA 4SGBE 1V2TT 5GCHG 1JRSA 4X1NU 1KXCA 2Q6GA 3V13A 1V2ST 2H6MA 2FLBH 3SOSA 3HPTB 4J2YB 3F9HA 4YT7H 2W3KA 1MTUA 1THSH 4TWYA 1QIXB 4TPYA 3SQHE 4YLQH 1JRTA 1FAKH 4AZ2B 4TYDA 3L3TA 1AVGH 4DT7B 3HATH 3GY7A 4NSYA 1K1MA 2NU4E 1UCYH 3MU0A 5H4IB 3M5LA 1C5ZB 1C2DA 1HAVA 2ZDAH 5F6MA 1T8OA 1C2HA 2ZGJA 3QWCH 1EXFA 3TITA 1TAWA 1Y5BT 2PHBA 3VFEA 4TY7A 1W13U 2ZDMA 3V0XA 3MNBA 4A92A 2OCVB 2OC1A 3I77A 4NA9H 1LKBA 1EASA 3SV9A 5GIBA 9ESTA 4I32A 1ZTKA 1F0SA 3TJUA 3MU4A 1ESTA 1E34B 1KXDA 4X6MA 1Z8IB 2XNIA 2VH0A 1MAYA 4AGJA 3HK3B 5EOKA 2ZCLP 1K2I1 4XDEA 4DJZB 2C8YB 3UY9A 8ESTE 1QHRB 2R2MB 1WOFA 3UQVA 1Z6JH 2BDIA 3RXGA 3BF6H 3LC3A 1NRNH 1AN1E 3VEQB 3TJNA 1QJ7B 2G5NA 4GPGA 1A5GH 2JKHA 1QL7A 3DA9B 2O8WA 2OC8A 2GCHG 2QF3A 4PROA 3EDXB 4JYUH 1SMFE 2FI3E 2P3FH 4OS5A 4IBLH 1ELDE 5EG4A 3BV9B 2GCTB 3CS0A 5ESTE 1C2EA 1GPZA 3S7KB 2VIVA 3MMGA 5AFZH 3T27A 2Y5GA 3QO6A 4YESB 3ZVDA 1UCYE 3LGTA 4FUCA 5LPEA 1CT0E 1N8OB 4YOIA 1ZPCA 1F5LA 2GKVE 3A7TA 5FPSA 1TMUH 1OPHB 1DE7H 2R3UA 1E35B 2BY6X 2HPQH 4OS4A 2UUJB 5FCKA 4ABEA 1TYNA 2CHAB 5I46H 3EYDA 3SNBA 5LGOA 4CRBA 3HKIB 4H4FA 1C1PA 1HNEE 1SR5C 1J17T 2LPRA 1L4DA 2ESTE 5DK1A 3SV7A 3PLKA 1MCVA 1TBZH 3PV4A 4BTIB 3QZRA 2Y5FA 3RXJA 3SGBE 4E7NA 2C90B 1YPJH 4D7FA 4IC6A 1KXEA 2FOGA 1YPHC 3KQEA 1DFPA 2CJIA 1EAUA 1BQYA 1O3HA 1P8VC 4WWYA 1A46H 1SI5H 4RN6A 5EXNA 4FUEA 4H6TA 2VGCB 5F8ZA 1SGDE 4XOJA 4TWWA 2YNAA 3ZZAA 1T8LA 3A8AA 1EB1H 4Q7YA 4Y76A 2W7UA 3ZYDA 1CGHA 4ABIA 2XC5A 3KQCA 5EQSA 1AI8H 2C93B 1HCGA 4ZHLU 5GXPA 1W0ZU 1LTOA 1SSXA 3M36A 1CA0B 1P9SA 4XBBA 1PPCE 5DO4H 2AGEX 1TPSA 3F6UH 3PLPA 4J1YA 4MPUA 3M7TA 3TU7H 2WUBA 1GJBB 4IW4E 1CBWB 3LPRA 1CA8B 1NFUA 1P10A 1BHXB 1O38A 1DM4B 2QAAA 1GJ5H 2XWAA 2VH6A 2BVSH 2UWOA 1DXPA 2GD4B 3PMHB 4GLYA 4Z0KA 1C1QA 2V0BA 3UOUA 1O32A 4A1VA 2AEIH 3HGNA 3UNQA 3ZVGA 1GHAF 2ANYA 1N6XA 1YPHE 1EZSC 1Y5AT 2FMJA 3RMLH 1S83A 3GCTF 3ZVEA 3A7YA 2J9NA 1EAWA 2GTBA 5LPRA 2SFAA 2F9PA 2ZU1A 3LT3A 3ATLA 3BTME 1G37A 3SUFA 1O5FH 1C9PA 1GI1A 2QC2A 1EPTB 1YPLH 2TGPZ 6CHAC 4TPIZ 3E0PB 1MQ6A 1O5CB 5FX6A 1P12E 3RXTA 1W2KH 1P3EA 1GJCB 1TBQH 3VB7A 4OS7A 3K2UA 2BHGA 1DSUA 4NCYA 1ESAA 6ESTA 1BMLA 1HAHH 2O8TA 2ZFFH 4X1PU 1ETSH 1HAZB 1QGFA 5E2PA 4X6NA 1EATA 3Q3XA 2W7SA 4AFQA 5E8EH 3MNXA 3SHCH 2RG3A 2UUFB 2FOEA 1SOZA 2SGFE 4RKJB 3VXFH 2HALA 1F92A 2O8UA 3BTQE 5A2MH 3IITA 1C2KA 1FDPA 1DPOA 1YKTA 4GAWA 1C2JA 1GI5A 5A8XA 1GL1A 2BB4A 4VGCB 2TPIZ 2FDAA 1FPCH 1K1IA 4UD9H 3BEFB 2UUYA 3U8RH 1MZAA 2ZHFH 1O5AB 3GYLB 3RXAA 1GDUA 4I8HA 1SGQE 3ATIA 1BMNH 1GCTC 2H2ZA 3GDUA 1IQHA 3L6PA 2I6QA 1O3AA 1NM6A 5GWZA 4KTSA 3LU9B 1SQTA 3V12A 4Y10E 1O2ZA 3TIUA 1ACBE 3HK6B 1H9IE 2Z94A 7ESTE 3A7VA 1FONA 4NIYA 1KLIH 3GOVB 2ZCHP 4K5ZA 4U2WA 4I8KA 2FO9A 1O2NA 2XC0A 1AVXA 2ZNKH 3HGPA 1BTWA 1C5RA 1O3NA 3GCOA 1MTWA 1KDQA 2BM2A 1HJ9A 4B76A 1FNIA 4CRDA 3R3GB 1NFYA 1TX7A 4JYTA 1P05A 3TGJE 3ZZ6A 1TNLA 1XUKA 1PQAA 1A0LA 2C4FH 3M3TA 3ENSB 3GCHC 1AD8H 2EA3A 1KY9A 1VCQA 9LPRA 3LKWA 5A09A 1GVKB 1P2QA 3M61U 5E0HA 2F91A 3RXFA 1BTHH 1XUHA 1IQNA 1ESBA 1AE8H 2ZHDA 1WTGH 2XCNA 2FI5E 1EB2A 2FP7B 1DT2A 2F9BH 1TNGA 4X6PA 1W0YH 2FIRH 4BAQB 5A0CA 2QXGA 1UK2A 1W14U 4IC5A 1UVOA 1C1WH 4YLUA 1BRBE 2CF8H 2QXIA 1H8IH 1HXFH 1O2SA 3U8TH 2OUAA 2C8XB 4IS5A 3TPIZ 2JETC 3TVJB 4ABFA 3EE0B 1O2JA 1V2VT 4BTTB 1CO7E 4D9RA 1RFNA 1CHGA 1HAOH 2FYRA 1CGJE 2ANMH 1BTUA 4ISIH 2QXHA 1HAIH 1P9UA 1ELEE 2BDBA 2R9PA 3V7TA 1O2HA 3QZQA 4Y11E 1V2MT 2RDLA 1DLKB 1O3PB 3ATKA 1TRNA 1UTPA 3SJOA 1SGNE 3SQEE 1E0FD 3W94A 5CHAB 3ELAH 1G32B 1FI8A 3T5FH 4AN7A 4XBDA 1TA2A 3LGYA 5EQRA 4X2XA 1GJAB 1XX9A 2W26A 3A7XA 3VPKA 3MO9A 1ZR0A 2BZAA 1QJ6B 1C2IA 2ZFRH 4DCDA 2ZGXH 2G5VA 4LXBH 1LHDH 1SOTA 2ZO3H 4Y0YE 1ZSLA 1O3CA 2PKAB 1DWDH 1GBFA 3M7QA 1MU8B 5DPAA 4ABAA 4GVUA 3URCA 1KDQB 4CH8B 1CBWC 5CMXH 5ESBA 4ESTE 5JYIA 1UHBA 2IJOB 2AFQB 1J9CH 2ZPQA 2J94A 1GHYH 3GY8A 3AASA 3K65B 3RXVA 3KQBA 3QTOH 4RSPA 1P2MA 5G4BA 1O3EA 1HJ8A 4NWKA 1Y3WA 2PWXA 1TGTA 2ZGCA 2GZ8A 3OYPA 1GI3A 4X2VA 1O3OA 1ARBA 1C4Y2 1MKXH 3FP6E 1Z8JB 4DGJA 2ZIQH 1AO5A 1O3IA 4VGCC 6CHAB 1GMDF 1G3BA 3NZIA 3EGKH 1OWDA 4OS6A 2VVCA 2G52A 2B7DH 2BD4A 3SW2B 1B0EA 1AMHA 1SL3A 1J8AA 4ZMAH 3BIVH 2ZHWH 1V6DA 1E37B 1ZHPA 1QCPA 1C5PA 3ZV9A 1RTKA 1SGFA 2NWNA 2H9EH 5C2ZA 1QRWA 4FVBA 4YT6H 3NWUA 1BRCE 2B0FA 2Z3EA 3B8JA 3RU4D 2A7JA 1QBOA 1IQLA 3BTEE 2TGTA 1O2TA 3T29A 1YPMH 1T7CA 2D26C 1LPZB 3P6ZB 4LZ1H 1FY8E 1YLDA 4B1TA 4XSKU 5FXLA 1EJAA 3SU5A 2XBWA 4INHA 1LVOA 1HIAA 3GDSA 2D8WA 1YCPM 4H6SB 1BRUP 1C1NA 2OP9A 3LC5A 4UE7H 2A4RA 2P59A 4NFEA 3Q00A 1BZXE 4UFEH 3RM0H 4YTAA 3FAOA 4DURA 1SLUB 1QB1A 5F8TA 4O9VA 2W3IA 5BRRE 3N7OA 4X1RU 1A0JA 1P09A 1F2SE 2DE8A 3DD2H 1GWAA 3NPSA 1ANEA 5ETXA 5HGGA 3LGVA 3PM3A 1Z1JA 3SI4H 3UR9A 1UTQA 1D3PB 3TGKE 1V2WT 1HAGE 4D7GA 4INKA 3VB6A 5BPEA 3TH3H 3UTUH 5FAHA 2IN2A 1GHAG 1EKBB 1T4UH 2F3CE 2PKSB 4GHTA 6GCHG 2A1DB 2WYGA 3DUXH 5F8XA 1AB9B 1DSTA 1Q2WA 2G00A 1GJ4H 4ZXXH 1C5YB 3A8DA 1KXAA 2WYJA 4A7IB 2ODYB 1SGIB 1SGFG 2IPHA 1V3XA 2JH0D 2Q6FA 1ABJH 2PLXA 3SBKA 2FPZA 3RMMH 1Y59T 1SHYA 1O2IA 4ZROA 4YM9A 2XW9A 1RTFB 2J4IA 2XBYA 4DW2U 5LH8A 2WINI 4YOJA 1CE5A 1FUJA 1Y3XA 3FZZA 2Z9JA 3ZZCA 1EJNA 1ZJDA 3SUEA 1K1NA 3TH2H 1H4WA 1CHOF 1C5MD 4IMZA 5C67A 1OXGA 4KELA 2KAIA 1MTNB 1A1RA 4Y8ZA 1S85A 1BBRK 2F9VA 3E91A 3I78A 3ODFA 1GBHA 3UUZA 1IAUA 5I25A 2BXUH 2FTLE 1O2GH 1SGEE 1FY4A 2P3TB 1QB9A 1SFIA 1THPB 1GHVH 1BIOA 1DLEA 4OS2A 2HRVA 3CS7A 1Y5UT 3A86A 1K1OA 1UK3A 4LK4A 2FEQH 1DY9A 5C5OA 3U1JB 2OBOA 3BTFE 5IDKA 5EGMA 3RXCA 1TOMH 3S9CA 1GJDB 2BMGB 1DANH 1V2NT 3RXDA 2VJ1A 1ELBA 4AFUA 2BOKA 3KNXA 1W8BH 1YYY1 1O34A 4H42U 2A4QA 3A81A 4THNH 1AIXH 1UTOA 2ZHEH 1GMDG 2PV9B 3FVFB 2FOFA 3UFAA 5AHGH 4ISOA 2A2QH 2QN5T 2SGDE 2ZU3A 3RXUA 2FWWA 2DE9A 2ZDNA 4KGAA 2AIPA 4FUGA 1KIGH 1BMAA 1PPEE 1O3LA 3U1IB 1AFEH 2FS9A 2GDDA 2PUQH 2F9UA 2GZ7A 4B73A 1EP5A 3NUMA 1V2RT 3VGCC 4DY7B 5GPIB 4AFSA 2HNTF 1AZZA 5GJ4B 7KMEH 5JDUB 3SV6A 1EUFA 3A88A 1HUTH 4UFDH 2HNTE 2XWBI 3IG6B 1G2MA 1J14A 2BDGA 2OXSA 4MG3A 3UOPA 4FVDA 2QY0B 5HYOA 1VJ9U 3F9EA 2BVXH 4A1XA 3AAVA 3K9XB 4MPXA 2IOTA 2AMPA 5TCAA 4IN1A 1YLCA 5L30H 5FBEA 4I31A 1WSSH 5DP7A 3L33A 1A0HB 2BD5A 4K8BA 1SC8U 1BB0B 2BQ6B 2Y7ZA 3RM2H 2EI6A 8GCHF 2P94A 2ZC9H 1IQEA 2LNCA 1EX3A 1UTJA 4XFQA 3BIUH 3WY8A 3V3MA 3SNCA 3KEEA 1YPKH 4AOQA 1EQ9A 1WAYB 1P0SH 4MLFB 1O2KA 5EU8A 1QRZA 1OS8A 1P11E 1ETRH 1J16A 2ZHQH 4QT8C 2P8OB 3ZVFA 2BQWB 2BZ6H 1ZLRA 1K22H 1BOQA 1OOKB 2NU3E 1P04A 4O97A 1O2OA 4JCNA 1L1GA 1BTPA 1AB9C 4OGXA 1C5UA 2M5TA 2Z9GA 1IQIA 4GCHG 5E2OA 1S0QA 1GG6C 1CHOG 1HRTH 1RIWC 2SGPE 1O2RA 1F0RA 1BA8B 3S0NA 1T8MA 4CBNA 4JZIA 2AGGX 2ZFQH 3NXPA 1GI2A 1C5SA 3E8LA 3SU4A 2QGRA 4FU9A 1WQSA 1EZXC 2VWLA 3M3SA 1P03A 3BG4B 4K1EA 1GJ8B 1O2UA 2A32A 1AUJA 3ZZDA 2Y7XA 4JK5A 1EZUC 4MQAA 4Y8YA 4WY3A 1W11U 1FLEE 1W7XH 3SU3A 4JZDH 1JIMA 2O8LA 1HGTH 5PTPA 2AS9A 1GMHG 1BJVA 1Z8GA 2Z3CA 2FOCA 2GMTC 3TNSA 2AMQA 3SJIA 1OWHA 6GCHF 3U98H 2OINA 1HLTH 4HGCA 4NA7A 5DP5A 2SNVA 2HOBA 1G36A 3E6PH 1GI8B 1C1MA 1M9UA 3LDXH 3H7OA 1NRSH 3SU6A 2BY9X 3D23A 2VIQA 1QA7A 1JIRA 2R2WU 2A2XH 3C27B 3RC5A 2BD9A 7GCHF 4D8NA 4D9QA 4WF8A 4E06H 4ISNA 2VINA 2PW8H 1UVSH 2BYAX 2R0KA 1O5EH 1XVMA 3RLWH 4K2YA 3F68H 1SGPE 2B5TB 3ZVCA 1LVBA 4FXGH 4WMEA 4HTCH 1GG6B 3PMBB 1OX1A 4CR5A 5HXFA 2Y5HA 3FP7E 1MAXA 1MU6B 2ASUB 3SN8A 1DX5M 3GICB 3KGPA 1Y3VA 1RJXB 2ILNA 2ZI2H 4I33A 1FY1A 3OU0A 1P2JA 2ZG0H 2XXLA 1V2PT 3KIDU 1O2MA 1ANCA 3A80A 1S82A 3NKKA 4NZLA 1WTHD 1T4VH 5DP4A 1UJ1A 4AFZA 2B9LA 1O3DA 4BTUB 4CR9A 2ZDKA 4CRCA 1GMCF 2P95A 1GMCG 4ZHMU 4RKOB 3W95A 2ZF0H 3SJ9A 7LPRA 3PWCA 3GCHB 1LPKB 4CH2B 2WV5A 1NO9H 4Y79A 1C5WB 1Z7KA 2J95A 3TK6A 2OLGA 1GHXH 1EOLA 3GY5A 1P3CA 2EEKA 1A5HA 2UUKB 2AERH 4B2CA 2FOBA 1G3EA 3RXBA 5DP6A 1CVWH 3RU4E 2ZECA 5SGAE 1QY6A 3AVZA 1OYTH 3CENA 3ITIA 1HJAC 4JYVH 1TX6A 4NIVA 4ZKOU 2BD7A 5DJ7A 2ZQ2A 3U8OH 3UQOA 3BSQA 2BDHA 4MTBA 1KLJH 1SBWA 1QR3E 2A0QB 1UMAH 2RA3A 1MCTA 2B8OH 3KN2A 4WXVA 1L1NA 1RIWB 3ZYEA 5A0BA 5FHTA 2FS8A 1K1PA 1GI0A 1V2UT 1YBWA 3O8CA 1ZYOA 3PROA 1MBQA 1ZTJA 2Q6DA 1AE5A 1TQ0B 1XUFA 3T25A 5B6OA 1YPEH 2Y6TA 1FAXA 1DWEH 1ZHMA 3SUDA 5F03A 5JPMH 3T62A 4UFFH 1D3TB 2A31A 3QX5H 3ZZ8A 3PO1C 5DP3A 4NGAH 1LO6A 2PSXA 1TGSZ 4GSOA 1HJAB 1IQMA 3ZZBA 2CHAC 2A4GA 3P95A 2GGVB 1BHXF 1QA0A 4WH8A 4ABHA 2BDAA 1FV9A 5TCCA 2HGTH 2TIOA 3AW1A 2XRCA 3DHKH 4BOHA 2AH4X 2HWLB 1L1JA 1QRXA 3OSYA 2FI4E 3GY3A 1ZMNA 5L2ZH 1ARCA 1VCPA 3QTVH 4U32A 1BT7A 1VCWA 2PUXB 4ZXYH 1OWIA 3T28A 2JH5D 1T32A 1C5LH 2XCFA 5L6NH 3ZVAA 1YCPK 1C5TA 4E05H 2ZPSA 1UVPA 4IMQA 3B23B 3B9FH 5CHAC 1V2OT 5C1UA 1IQGA 1GI6A 2C8ZB 2VU8E 4ZKNU 2G55A 2PGBB 2ZWLH 3R0FA 3GY2A 4HZHA 4Y0ZE 1MD7A 1BCUH 3SNAA 2ZA5A 4OGYA 1FXYA 1MKXK 1SGYE 2A45B 2VB0A 1AY6H 1GHBG 1O2QA 3URDA 2ZU4A 1F7ZA 1TBRH 2ZP0H 4KTUA 3T26A 3VGCB 4K60A 3SGQE 2EI8A 3H7TA 2STBE 2BVRH 2FODA 4LOYH 3GY4A 2GMTB 3UR6A 4O03A 1TPAE 4FU8A 3ZVBA 1AWFH 1AUTC 3PTNA 4R0IA 3EAJA 1QTFA 3E0NB 1AVWA 3A82A 2PTCE 1PPFE 7GCHG 2FYQA 1HBTH 1MKWH 1BBRE 1ZHRA 3MOCA 2WV4A 1UTMA 1O3FA 1ANDA 2NU1E 4CBOA 1DITH 1L4ZA 3RXOA 3BTTE 1O3JA 1S6FA 1ZOMA 4JZFH 1TNIA 1G9IE 4SGAE 3QN7A 5IYTA 1GMHF 1PQ7A 1NROH 1C5XB 2TGAA 2PGQB 1EAIA 1H1BA 3RXPA 3SNDA 2G4UA 1B7XB 1FIZA 1Y3UA 2CF9H 4ISLA 1MD8A 1C4V2 1EJMA 5JBCS 3QGNB 4NIWA 1F0UA 4LZ4B 4A6LA 1VITG 1AKSA 2TBSA 3EA7A 1WV7H 1F5KU 4FUDA 4JMYA 3UWJH 1NRQH 1ORFA 1ELFA 1VZQH 4UEHH 1PPZA 1TMBH 2HVXA 1OYQA 1K21H 5HMAA 2ZFSA 1GBLA 2ODPA 2BX3A 4ZH8A 2HLCA 2GV7A 2GP9B 1G30B 3MWIU 2BX4A 2H5DA 2J2UA 4DIIH 5DG6A 1L0ZA 2ZFPH 1GBIA 2ZDVH 4CHAC 1OKXA 1EPTC 4I8LA 1GJ6A 2BY7X 3HKJB 2Z9IA 4YZUA 4B75A 4AGKA 2AMDA 1TLDA 1C2GA 3TK9A 2GV6A 2THFB 3Q3KA 4X6OA 4ABJA 5J4QA 2WPLS 4AYVB 2XBVA 2ZZUH 1GGDC 1IQFA 4I7YH 1DWBH 1Q31A 3U9AH 8GCHG 1YC0A 2OC7A 3S69A 4NZQA 2SGEE 1ZRKA 3G01A 1DWCH 1PPHE 1LHEH 1RS0A 2Z6BD 1O5GH 3FANA 4ISHH 1SPJA 2NU0E 1MZDA 1D6WA 1TX8A 3STJA 3AAUA 1OWJA 4MNVA 1B5GH 1GDNA 4F4OC 1NC6A 2CV3A 2WUCA 3A7ZA 4F49A 5EXLA 1XKBC 4AG2A 5JB8S 2ZTZA 1WQVH 3BEUA 1JWTA 2A7HA 2FX4A 3KHVA 4HFPB 3SU0A 1GVLA 1SQOA 1SG8B 4Y7BA 1THRH 3C1KA 1WYKA 3O8RA 1TOCB 2XBXA 1V2KT 1JMOH 3UIRA 4DOQA 2VNTA 1DDJA 2G4TA 1HXEH 4WMDA 1RD3B 3QLPH 1QQUA 3M7UA 2FOAA 1XVOA 4K69A 3ATMA 1LVYA 2H9HA 4U30A 3RXQA 4FUHA 3S7HB 3ESTA 3M5NA 3SUGA 4O3TA 3SJKA 3SNEA 2QIQA 3LGUA 5DP8A 3BTGE 3VB4A 1XMNB 4IGDA 1TRYA 4WXIA 1ZSKA 1ZZZA 4A5TS 1C1OA 1N6YA 3AW0A 3KF2A 1ETTH 1G3DA 1DXWA 1K28D 3A7WA 2ZDLA 1GHBF 2BLQA 1JOUB 2D2DA 4CHAB 2XTTB 3U69H 1NTPA 1QBNA 3DFLA 3LONA 1NY22 5JB9S 3A85A 3EA8A 5T6DA 3SJ8A 4IN2A 1GBMA 1WBGB 1MH0A 4B2BA 2GCHF 1O36A 3FP8E 3SZNA 2P8OC 5A8YA 3M37A 1WUNH 1GJ9B 2PSYA 4BAKB 1TE0A 1TRMA 1ELGA 1HDTH 5A0AE 1DICA 1TA6A 2ZGHA 2WPJS 1O3GA 1PPGE 3E1XB 3E16B 2CXVA 2ALPA 2BTCE 1YM0A 4BAHB 4CRAA 1AFQC 1E36B 4NFFA 2FOHA 1V2QT 5DGJA 2WPIS 2ZTXA 4B71A 1EP6A 4D76A 3RDZA 1Y8TA 2FZZA 1VR1H 2OBQA 3CP7A 1FQ3A 3QDZB 1GBAA 3UNSA 1CT4E 1MKWK 4M7GA 1T8NA 1BBRH 3OY5U 1CSOE 4INLA 4NSVA 4AX9H 4JZEH 2QCYA 1P01A 2VIWA 1P02A 1PYTC 1FMGA 1P2IA 1O2YA 1OP2A 4FU7A 5GCHF 5EW2H 1LCYA 2AIQA 1KSNA 4MPVA 2FESH 1GBDA 2VWNA 1CGIE 5EODA 8LPRA 1TABE 1CU1A 1A7SA 2ZU2A 3TNTA 1IQKA 2SNWA 1ZRBA 2C3SA 3ODDA 1FPHH 4KP0A 1UVUH 1S6HA 3RXIA 2GDEH 2HNTC 4O3UA 2Y80A 3DT0H 4WMFA 1VGCB 1TGBA 2EC9H 3OTJE 2WPMS 3EA9A 1SFQB 1IHTH 1UK4A 3KL6A 4MNWA 4X1SU 3LJOA 1LPGB 1XUIA 1S81A 2A7CA 2A4OA 3MTYA 1ZGIA 4FUBA 2YNBA 4BNRA 5J4SA 1A2CH 3ZZ5A 3BEIB 1KXFA 5C20A 3RMOH 1ZMLA 4GCHF 1C1SA 3ZZ9A 1C5OH 2GCTC 1AWHB 4X1QU 1S5SA 2BDCA 1XXFA 2O9QA 4X2YA 5HM2A 3MH5A 4HI3A 4ZHAA 1JBUH 5EXMA 3KQDA 2SGAA 4K8YA 2RCEA 1U6QA 1DOJA 1D3DB 2J38A 3P8GA 1Z8RA 4B74A 1HPGA 3GY6A 1CA0C 1PJPA 1V2LT 3LJJA 1O3KA 2BLVA 5C3NA 5AVDA 3TLOA 3I29A 1FIWA 2PTNA 1ZPBA 1O5BB 3E3TA 2PKSC 3KCGH 3TJOA 2H1UA 2VVUA 2H9TH 2ZFTA 1QL8A 3GDVA 1NPMA 3VB3A 1LKAA 4KTCA 1SVPA 1HB0B 1O3BA 3K6ZA 3RLYH 1RTLA 2F9NA 2ULLA 1ZJKA 1G3CA 1O2WA 1W7GH 5CE1A 4FUIA 1GCDA 1H8DH 3RXEA 3UNRA 3SORA 4X8VH 1TALA 1WCZA 1DY8A 2BY5X 2R0LA 2STAE 3NK8A 1BTZA 3FFGA 3VXEH 1TGCA 3MHWU 1XKAC 3Q77A 1C5VA 2OD3B 3BTWE 1IHSH 2F9OA 2Z7FE 2HPPH 1S0RA 2FTMA 1MTVA 1PQ5A 1SLXB 1BITA 4FUJA 3BN9A 1ELVA 3MU5A 4K1TA 1TONA 1SLWB 4Y7AA 2JH6D 1BJUA 3PB1E 4BAMB 5C1XA 3NCLA 2PFEA 3SU2A 3LGWA 2JETB 1MMJN 1GBCA 4I8JA 1S84A 5FCRA 2OTVA 1TB6H 2Z9LA 1YP9A 1P2KA 2ALVA 2VWOA 3RXKA 1D9IA 2CMYA 4XE4A 1SHHB 4NIXA 2FM2A 2VVVA 3MH7A 1XXDA 3RMNH 1GHZA 1O37A 4BXSA 5JBAS 1MUEB 2V6NA 4UDWH 1AGJA 3TH4H 1ZTLA 2ZEBA 1ELAA 1VITF 2F83A 4X8TH 4GHQA 3A83A 1H9LB 4X8SH 1MBMA 2ANKH 1SGCA 3SHAH 4DG4A 1NZQH 1N8OC 1GHWH 3A8CA 3M5OA 1EOJA 4YO9A 1QNJA 3PO1B 2V3OH 1PYTD 1BDAA 1O31A 2P3UB 2BLOA 3LH3A 1PQ8A 1TQ7B 1ANBA 4JK6A 4CREA 4Y6DA 3RXSA 1OWEA 1O3MA 4ASHA 1UVTH 1QFKH 2V3HH 1F0TA 2W5EA 4ZUHA 4JZ1A 3TJVA 2BQ7B 4MVNA 3RC4A 4MNYA 5EPYA 3RP2A 1GI7B 1WU1A 1C9TA 1NT1A 5FPTA 2CGAA 1EZQA 2ZTYA 3MNCA 3GCTG 1TGNA 2BY8X 4X8UH 4K3JA 1LQEA 1TPOA 3BG4C 2J34A 4ABBA 3GCNA 1GJ7B 2G8TA 1ZSJA 1AKSB 1CT2E 1XUJA 4OS1A 1C5QA 3ZZ7A 2SGQE 3SU1A 1KYNA 1LDTT 2AYWA 2OQ5A 3ZV8A 3LGIA 1O2VA 2G81E 4Z6AH 1FN8A 3RXHA 4X2WA 1KTTB 3RXRA 3SGAE 2VIOA 1IQJA 5E0GA 1PPBH 2OQUA 1UCYK 4YOGA 2GX4A 2ZKSA 2P93A 2A5IA 3QK1A 1MTSA 3BTDE 4UONA 4AORA 4AYYB 2O8MA 1TNKA 1H9HE 2BD3A 2FOMB 4Q7ZA 1NRPH 1A61H 1YPGH 1O35A 3LIWA 3PMAB 1C1TA 3P8NA 1Z1IA 1AU8A 5JBTA 1C1UH 5AF9H 2YOLA 5GDSH 2BXTH 2AGIX 1ZPZA 1NFWA 1SGTA 2NU2E 1ID5H 1X7AC 2ZGBH 5HM9A 3RU4T 1LHFH 2UWPA 4TY6A 1AHTH 1P06A 5DP9A 1GBBA 4E7RG 1UO6A 1ELTA 3MU1A 1DVAH 3BG8A 3OY6U 2A5AA 4ABGA 3P8FA 1QBVH 5LPFA 3ZZ3A 3SV2H 1C2FA 3TGIE 1O5DH 3M35A 5E0JA 3F9GA 3MH4A 4NA8A 4X0WU 5T3HA 3MFJA 5EPNA 1SB1H 1O30A 3A89A 3LH1A 1NFXA 3MI4A 1W12U 2Q1JA 4WH6A 1BTYA 4MPWA 3VB5A 1AFQB 1RXPA 6LPRA 4DIHH 2P16A 1GI4A 1Y3YA 3MNSA 4R8TB 3SO3A 2GZ9A 3DFJA 4WVPE 1VGCC 1UTKA 2J92A 2QXJA 4XBCA 3MH6A 1O2LA 3LOXA 1K1LA 4AB9A 4ABDA 1LHGH 2G51A 1MQ5A 3RXMA 1C5NH 4Y8XA 8KME2 5K0HA 2KAIB 1RRKA 1HV7A 3PMJA 1HAYB 3SI3H 3Q3YA 5ABWA 1UTLM 2VGCC 1INCA 1FY3A 1C2LA 3P8OA 1RGQA 1A3EH 4ZKSU 1NU9A 2BDYA 3RXLA 1O0DH 3A84A 4BAOB 3P70B 4CRGA 1D6RA 3UWIA 1HYLA 2VIPA 1D4PB 1HFDA 1C1RA 1OP0A 5EW1H 1ZMJA 1ABIH 1BRAA 2WPKS 1A4WH 1TWXB 2VWMA 3Q76A 1LQDB 2QA9E 1O2PA 1EPTA 2Z9KA 2ZQ1A 2GVFA 3OX7U 4MDSA 4ZAEA 3PWBA 2WPHS 2CN0H 2Y81A 1JXPA 1IOEA 1GGDB 1QL9A 1GBTA 2A5KA 3F1SB 1N1LA 1DUEA 2TRMA 1L2EA 1AQ7A 1J15A 1GDQA 1KXBA 1NESE 1G2LA 2FXRA 1XM1A 1ELCA 1F5RA 3JZ2B 3PTBA 1C2MA 1HAPH 1GI9B 1B0FA 1BTXA 1YCPH 2BLWA 1EAXA 4GUXA 4KKDA 4FUFA 3MO3A 2H5CA 4WJG2 3TK5A 3MYWA 1MTNC 1QQ4A 1XUGA 2FLRH 3IWMA 2PKAA 1O33A 3JZ1B 4AG1A 1GBKA 1BUIA 2QF0A 1AZ8A 3D62A 1NS3A 5T6GA 1D3QB 1GCTB 2QV1A 2BOHB 4NG9H 3E90B 3UREA 4CRFA 1SQAA 1TNJA 2EI7A 1NU7B 3PLBA 3S9BA 1LMWB 2ZCKP 1OP8A 1K9OE 3P17H 4U01A 1OSSA 3QUMP 3D49H 2OC0A
chains in the Genus database with same CATH superfamily
5C94A 2D1JA 2QYIA 1C1VH 5FPYA 3FZDA 4BXWA 1P57B 2GT7A 1HAVB 1QURH 4A1TA 1KTSB 2W6ID 4K1SA 1A3BH 2XC4A 3PYHA 5JBBS 4DVAU 1UHBB 3O8DA 5A8ZA 3RC6A 3O8BA 1DS2E 5EJ1A 4Q7XA 3UPEA 1TIOA 1TNHA 2UWLA 3M3VA 3P92A 1ZGVA 4XRNA 3MO6A 2BD2A 1OWKA 3A8BA 2BD8A 1LVMA 2PR3A 1YF4A 5FBIA 4BANB 1OHHD 3H5CB 1P2OA 3ATWA 1EFRD 1QB6A 4RI0A 5DKMA 1FX0B 1GVZA 1DUAA 1V2JT 4I8GA 3GYMA 2Z3DA 2TGDA 5AFYH 3S9AA 3SV8A 2LELA 5T6FA 3GISB 2RA0A 1A5IA 4NWLA 2QF5A 1FJSA 2Y82A 1HAXB 1NN6A 1C4U2 2XYAA 1Z71A 2GT8A 2ZU5A 4ZKRU 5EQQA 1W10U 1NRRH 1GBJA 2ODQA 4DT4A 2V35A 4MNXA 1BMMH 1E1RD 1FN6A 2K0QA 1PFXC 4Q80A 4FETA 1UTNA 2R3YA 1Q3XA 5TJXA 1O39A 1YGCH 3OTPA 2DUCA 2VIDA 4Y71A 1CQQA 1VITH 1LHCH 3QGJA 5K7RA 2FX6A 1TFXA 5C1YA 1W3CA 2IJD1 2ANWA 3M5MA 1GL0E 1Z6EA 3STIA 3BTKE 1TPPA 2C8WB 3A87A 1SGRE 1SLVB 3DSGA 3D65E 3K6YA 3T2NA 1TMTH 5FX5A 1FZZA 1P2NA 1KLTA 1K1JA 2ZPRA 5C5NA 4UFGH 3EQ0H 1FY5A 1T31A 1O2XA 1QJ1B 3RUOA 1HIAB 3MU8A 4AB8A 3BTHE 5IK2D 1E38B 2K1QA 2I6SA 4B2AA 1VJAU 4Q2KA 3ZZ4A 5C0TA 5L2YH 1GBEA 3F9FA 4SGBE 1V2TT 5GCHG 1JRSA 4X1NU 1KXCA 2Q6GA 3V13A 2VBCA 1V2ST 2H6MA 2FLBH 3SOSA 3HPTB 2WV9A 4J2YB 3F9HA 4YT7H 2W3KA 1MTUA 1THSH 4TWYA 1QIXB 4TPYA 3SQHE 4YLQH 1JRTA 1FAKH 4AZ2B 4TYDA 3L3TA 1AVGH 4DT7B 3HATH 3GY7A 4NSYA 1K1MA 3W1EA 2NU4E 1UCYH 3MU0A 5H4IB 3M5LA 1C5ZB 1C2DA 1HAVA 2ZDAH 5F6MA 1T8OA 1C2HA 2ZGJA 3QWCH 3OFND 1EXFA 3TITA 1TAWA 1Y5BT 2V3MA 2PHBA 3VFEA 4TY7A 1W13U 2ZDMA 3V0XA 3MNBA 4A92A 2OCVB 2OC1A 3I77A 4NA9H 1LKBA 1EASA 3SV9A 5GIBA 9ESTA 4I32A 1ZTKA 1F0SA 3TJUA 3MU4A 1ESTA 1E34B 1KXDA 4X6MA 1Z8IB 2XNIA 2VH0A 1MAYA 4AGJA 3HK3B 5EOKA 2ZCLP 1K2I1 4XDEA 4DJZB 2C8YB 3UY9A 8ESTE 1QHRB 2R2MB 1WOFA 3UQVA 1Z6JH 2BDIA 3RXGA 3BF6H 3LC3A 1NRNH 1AN1E 3VEQB 3TJNA 1QJ7B 2G5NA 4GPGA 1A5GH 2JKHA 1QL7A 3DA9B 2O8WA 2OC8A 2GCHG 2QF3A 4PROA 3EDXB 4JYUH 1SMFE 2FI3E 4B6FA 2P3FH 4OS5A 3N99A 4IBLH 1ELDE 5EG4A 3BV9B 2GCTB 3CS0A 5ESTE 2J98B 1C2EA 1GPZA 2KR7A 3S7KB 2VIVA 2KX4A 3MMGA 5AFZH 3T27A 2Y5GA 3N7DA 3QO6A 4YESB 1UCYE 3LGTA 4FUCA 3ZVDA 5LPEA 1CT0E 1N8OB 4YOIA 1ZPCA 1F5LA 2GKVE 3A7TA 2J98A 1TMUH 1OPHB 1DE7H 2R3UA 1E35B 5FPSA 2BY6X 2HPQH 4OS4A 2UUJB 5FCKA 4ABEA 1TYNA 2CHAB 5I46H 3EYDA 3SNBA 2WZQA 5LGOA 4CRBA 3HKIB 3F2FA 4H4FA 1C1PA 1HNEE 1SR5C 1J17T 2LPRA 1L4DA 2ESTE 5DK1A 3SV7A 3PLKA 1MCVA 1TBZH 3PV4A 4BTIB 3QZRA 2Y5FA 3RXJA 3SGBE 4E7NA 2C90B 3MQKC 1YPJH 4D7FA 3DCLA 4IC6A 1KXEA 2FOGA 1YPHC 1S6LA 1DFPA 3KQEA 4TSFD 2CJIA 1EAUA 1BQYA 1O3HA 1P8VC 4WWYA 1A46H 1SI5H 4RN6A 5EXNA 4FUEA 4H6TA 2VGCB 5F8ZA 1SGDE 4XOJA 4TWWA 2YNAA 3ZZAA 1T8LA 3A8AA 1EB1H 4Q7YA 4Y76A 2W7UA 3ZYDA 1CGHA 4ABIA 2XC5A 3KQCA 5EQSA 1AI8H 2C93B 1HCGA 4ZHLU 5GXPA 1W0ZU 1LTOA 1SSXA 3N7EA 3M36A 1CA0B 1P9SA 4XBBA 1PPCE 5DO4H 2AGEX 1TPSA 3F6UH 3PLPA 4J1YA 4MPUA 3M7TA 3TU7H 4Z1MD 2WUBA 1GJBB 4IW4E 1CBWB 3LPRA 1CA8B 4YXWD 1NFUA 1P10A 1BHXB 1O38A 1DM4B 2QAAA 1GJ5H 2XWAA 2VH6A 2BVSH 5KGOA 2UWOA 1WDIA 1DXPA 2GD4B 3PMHB 4GLYA 4Z0KA 1C1QA 2V0BA 3UOUA 1O32A 4A1VA 2AEIH 3HGNA 3UNQA 3ZVGA 1GHAF 2ANYA 1N6XA 1YPHE 1EZSC 1Y5AT 2FMJA 3RMLH 1S83A 3GCTF 4Q4LA 3ZVEA 3A7YA 2J9NA 3VG8A 1EAWA 2GTBA 5LPRA 2SFAA 2F9PA 2JDID 2ZU1A 3LT3A 3ATLA 3BTME 1G37A 3SUFA 1O5FH 1C9PA 1GI1A 2QC2A 1EPTB 1YPLH 2TGPZ 6CHAC 4TPIZ 3E0PB 1MQ6A 1O5CB 5FX6A 1P12E 3RXTA 1W2KH 1P3EA 1GJCB 1TBQH 3VB7A 4OS7A 3K2UA 2BHGA 3PRBA 1DSUA 3FO8D 4NCYA 1ESAA 6ESTA 1BMLA 1HAHH 2O8TA 2ZFFH 4X1PU 1ETSH 1HAZB 1QGFA 5DN6D 4ASUD 2W6JD 5E2PA 4X6NA 1EATA 3Q3XA 2W7SA 4AFQA 5E8EH 2F4LA 3MNXA 3SHCH 2RG3A 2UUFB 2FOEA 1SOZA 2SGFE 4RKJB 3VXFH 2HALA 1F92A 2O8UA 2YMSB 3BTQE 5A2MH 3IITA 1C2KA 1FDPA 1DPOA 1YKTA 4GAWA 1C2JA 1GI5A 5A8XA 1GL1A 2BB4A 4VGCB 2TPIZ 2FDAA 1FPCH 1K1IA 4UD9H 3BEFB 2UUYA 3U8RH 1MZAA 2ZHFH 1O5AB 2PP6A 3GYLB 3RXAA 1GDUA 4I8HA 1SGQE 3ATIA 1BMNH 1GCTC 2H2ZA 3GDUA 1IQHA 1YY3A 3L6PA 2I6QA 1O3AA 1NM6A 5GWZA 4KTSA 3LU9B 1SQTA 3V12A 4Y10E 1O2ZA 3TIUA 1MABB 3ZIAD 1ACBE 3HK6B 1H9IE 2Z94A 7ESTE 3A7VA 1FONA 4NIYA 1KLIH 3GOVB 2ZCHP 4K5ZA 4U2WA 4I8KA 2FO9A 1O2NA 2XC0A 1AVXA 2ZNKH 3HGPA 1BTWA 1C5RA 1O3NA 3GCOA 1MTWA 1KDQA 2BM2A 1HJ9A 4B76A 4AC9A 2KCOA 1FNIA 3R3GB 4CRDA 1NFYA 1TX7A 4JYTA 1P05A 3TGJE 3ZZ6A 1TNLA 1XUKA 1PQAA 1A0LA 2C4FH 3M3TA 3ENSB 3GCHC 1AD8H 2EA3A 1KY9A 1VCQA 5HIYA 9LPRA 3LKWA 5A09A 1GVKB 1P2QA 3M61U 5E0HA 2F91A 3RXFA 1BTHH 1XUHA 1IQNA 1ESBA 1AE8H 2ZHDA 1WTGH 2XCNA 2FI5E 1EB2A 2FP7B 1DT2A 2F9BH 1TNGA 4X6PA 1W0YH 2FIRH 4BAQB 5A0CA 2QXGA 1UK2A 1W14U 2M2AA 4IC5A 1UVOA 1C1WH 4YLUA 1BRBE 2CF8H 2QXIA 3UB0A 1H8IH 1HXFH 1O2SA 3U8TH 2OUAA 2C8XB 4IS5A 3TPIZ 2JETC 3TVJB 4ABFA 3EE0B 1O2JA 1V2VT 4BTTB 1CO7E 4D9RA 1RFNA 1CHGA 1HAOH 2FYRA 1CGJE 2ANMH 1BTUA 4ISIH 2QXHA 1HAIH 1P9UA 1ELEE 2BDBA 2R9PA 3V7TA 1O2HA 3QZQA 4Y11E 1V2MT 2RDLA 1DLKB 1O3PB 3ATKA 1TRNA 1UTPA 3SJOA 1SGNE 3SQEE 1E0FD 3W94A 5CHAB 3ELAH 1G32B 1FI8A 2XNDD 3T5FH 4AN7A 4XBDA 1TA2A 3LGYA 5EQRA 4X2XA 1GJAB 1XX9A 2W26A 3A7XA 5DSFA 3VPKA 4F48B 3MO9A 1ZR0A 2BZAA 1QJ6B 1C2IA 2ZFRH 4DCDA 2ZGXH 2G5VA 4LXBH 1LHDH 1SOTA 5EJLA 2ZO3H 4Y0YE 1ZSLA 1O3CA 2PKAB 1GBFA 1DWDH 2KZ4A 3M7QA 2YMSD 1MU8B 5DPAA 4ABAA 4GVUA 3URCA 1KDQB 4CH8B 1CBWC 5CMXH 5ESBA 4ESTE 5JYIA 1UHBA 2IJOB 2AFQB 1J9CH 3H09A 2ZPQA 2J94A 1GHYH 3GY8A 3AASA 3K65B 3RXVA 3KQBA 3QTOH 4RSPA 1P2MA 5G4BA 1O3EA 1HJ8A 2RDEA 4NWKA 1Y3WA 2PWXA 1TGTA 2ZGCA 2GZ8A 1E79D 3OYPA 1GI3A 4X2VA 1O3OA 1ARBA 1C4Y2 1MKXH 3FP6E 1Z8JB 4DGJA 2ZIQH 1AO5A 1O3IA 4VGCC 6CHAB 1GMDF 1G3BA 3NZIA 3EGKH 1OWDA 2YMSC 4OS6A 2BD4A 2G52A 2B7DH 2VVCA 3SW2B 1B0EA 1AMHA 1SL3A 1J8AA 4ZMAH 3BIVH 2ZHWH 1V6DA 2WPDD 1E37B 1ZHPA 1QCPA 1C5PA 3ZV9A 1RTKA 1SGFA 2NWNA 2H9EH 5C2ZA 1QRWA 4FVBA 4YT6H 3NWUA 1BRCE 2JJ1D 2B0FA 2Z3EA 3B8JA 3RU4D 2A7JA 1QBOA 5F53A 1IQLA 3BTEE 2TGTA 1O2TA 3T29A 1YPMH 1T7CA 2D26C 1LPZB 3P6ZB 4LZ1H 1FY8E 1YLDA 4B1TA 4XSKU 5FXLA 1EJAA 3SU5A 2XBWA 4INHA 1LVOA 1HIAA 3GDSA 2D8WA 1YCPM 4H6SB 1BRUP 1C1NA 2OP9A 3LC5A 4UE7H 2A4RA 2P59A 4NFEA 3Q00A 1BZXE 4UFEH 3RM0H 4YTAA 3FAOA 4DURA 1SLUB 1QB1A 5F8TA 4O9VA 2W3IA 5BRRE 3N7OA 4X1RU 1A0JA 1P09A 1F2SE 2DE8A 3DD2H 1GWAA 4RT1A 3NPSA 1ANEA 5ETXA 5HGGA 3LGVA 3PM3A 1Z1JA 3SI4H 3UR9A 1UTQA 1D3PB 3TGKE 1V2WT 1HAGE 4D7GA 4INKA 3VB6A 5BPEA 3TH3H 3UTUH 5FAHA 2IN2A 1GHAG 1EKBB 1T4UH 2F3CE 2PKSB 4GHTA 6GCHG 2A1DB 2WYGA 3DUXH 5F8XA 1WXRA 1AB9B 1DSTA 1Q2WA 2G00A 1GJ4H 4ZXXH 1C5YB 3A8DA 1KXAA 2WYJA 4A7IB 2ODYB 1SGIB 1SGFG 2IPHA 1V3XA 2JH0D 2Q6FA 3KYFA 1ABJH 2PLXA 3SBKA 2FPZA 3RMMH 1Y59T 1SHYA 1O2IA 4ZROA 3DSOA 4YM9A 2XW9A 1RTFB 2J4IA 2XBYA 4DW2U 5LH8A 3KYGA 2WINI 4YOJA 1CE5A 1FUJA 1Y3XA 3FZZA 2Z9JA 3ZZCA 1EJNA 1ZJDA 3SUEA 1K1NA 3TH2H 1H4WA 1CHOF 1C5MD 4IMZA 5C67A 1OXGA 4KELA 2KAIA 1MTNB 1A1RA 4Y8ZA 1S85A 1BBRK 2F9VA 3E91A 3I78A 3ODFA 1GBHA 3UUZA 1IAUA 5I25A 2BXUH 2FTLE 1O2GH 1SGEE 1FY4A 2P3TB 2LP6A 1QB9A 1SFIA 1THPB 1GHVH 1BIOA 1DLEA 4OS2A 2KCAA 3OEHD 2HRVA 3CS7A 1Y5UT 3A86A 1K1OA 1UK3A 4LK4A 2FEQH 1DY9A 5C5OA 3U1JB 2OBOA 3BTFE 5IDKA 5EGMA 3RXCA 1TOMH 3S9CA 1GJDB 2BMGB 1DANH 1V2NT 3RXDA 2VJ1A 1ELBA 4AFUA 2BOKA 3KNXA 1W8BH 1YYY1 1O34A 4H42U 2A4QA 3A81A 4THNH 1AIXH 1UTOA 2ZHEH 1GMDG 2PV9B 3FVFB 2FOFA 3UFAA 5AHGH 4ISOA 2A2QH 2QN5T 2SGDE 2ZU3A 3RXUA 2FWWA 2DE9A 2ZDNA 4KGAA 2AIPA 4FUGA 1KIGH 1BMAA 1PPEE 1O3LA 3U1IB 1AFEH 2FS9A 2GDDA 2PUQH 2F9UA 2HVYB 2GZ7A 4B73A 1EP5A 4I86A 3NUMA 1V2RT 3VGCC 4DY7B 5GPIB 4AFSA 2HNTF 1AZZA 5GJ4B 7KMEH 5JDUB 3SV6A 1EUFA 3A88A 1HUTH 4UFDH 2HNTE 2XWBI 3IG6B 5CHBA 3NRLA 1G2MA 1J14A 2BDGA 2OXSA 4MG3A 3UOPA 4FVDA 2QY0B 5HYOA 1VJ9U 3F9EA 2BVXH 4A1XA 3AAVA 3K9XB 4MPXA 2IOTA 2AMPA 5TCAA 4IN1A 1YLCA 3EE7A 5L30H 5FBEA 4I31A 1WSSH 5DP7A 3L33A 1A0HB 2BD5A 4K8BA 1SC8U 1BB0B 2BQ6B 2Y7ZA 3RM2H 2EI6A 8GCHF 2P94A 2ZC9H 1IQEA 2LNCA 1EX3A 1UTJA 4XFQA 3BIUH 3WY8A 3V3MA 3SNCA 3KEEA 1YPKH 4AOQA 4B6EA 1EQ9A 3WW7A 1WAYB 1P0SH 4MLFB 1O2KA 5EU8A 2CK3D 1QRZA 1OS8A 1P11E 1ETRH 1J16A 2ZHQH 4QT8C 5GNDA 2P8OB 3ZVFA 2BQWB 2BZ6H 1ZLRA 1K22H 1BOQA 1OOKB 2NU3E 1P04A 3PV2A 4O97A 1O2OA 4JCNA 1L1GA 4M9FA 1BTPA 1AB9C 4OGXA 1C5UA 2M5TA 2Z9GA 1IQIA 4GCHG 5E2OA 1S0QA 1GG6C 1CHOG 1HRTH 1RIWC 2SGPE 1O2RA 1F0RA 1BA8B 3S0NA 1T8MA 4CBNA 4JZIA 2AGGX 2ZFQH 3NXPA 1GI2A 1C5SA 3E8LA 3SU4A 3DSPA 2QGRA 4FU9A 1WQSA 1EZXC 2VWLA 3M3SA 1P03A 3BG4B 4K1EA 1GJ8B 5T1VA 2WSSD 3GS9A 1O2UA 2A32A 1AUJA 3ZZDA 2Y7XA 4JK5A 1EZUC 4MQAA 4Y8YA 4WY3A 1W11U 1FLEE 1W7XH 3SU3A 4JZDH 1JIMA 2O8LA 5EJZA 1HGTH 5PTPA 2AS9A 1GMHG 1BJVA 1Z8GA 2Z3CA 2FOCA 2GMTC 3TNSA 2AMQA 2V7QD 3SJIA 1OWHA 6GCHF 3U98H 2OINA 1HLTH 4HGCA 4NA7A 5DP5A 2SNVA 2HOBA 1G36A 3E6PH 1GI8B 1C1MA 1M9UA 3LDXH 3H7OA 1NRSH 1UW7A 3SU6A 2BY9X 3D23A 2VIQA 1QA7A 3SYJA 4P00A 1JIRA 2R2WU 2A2XH 3C27B 3RC5A 2BD9A 7GCHF 4D8NA 4D9QA 4WF8A 4E06H 4ISNA 2VINA 2PW8H 1UVSH 2BYAX 2R0KA 1O5EH 1XVMA 3RLWH 4K2YA 3F68H 1SGPE 2B5TB 3ZVCA 1LVBA 4FXGH 4WMEA 4HTCH 1GG6B 3PMBB 1OX1A 4CR5A 5HXFA 2Y5HA 3FP7E 1MAXA 1MU6B 2ASUB 3SN8A 1DX5M 3GICB 3KGPA 1Y3VA 1RJXB 2ILNA 2ZI2H 4I33A 1FY1A 3OU0A 1P2JA 2ZG0H 2XXLA 3F3BA 1V2PT 3KIDU 4F55A 3WWFA 1O2MA 1ANCA 3A80A 1S82A 3NKKA 4NZLA 1WTHD 1T4VH 5DP4A 1UJ1A 4AFZA 2B9LA 1O3DA 4BTUB 4CR9A 2ZDKA 4CRCA 1GMCF 2P95A 1GMCG 4ZHMU 4RKOB 3W95A 2ZF0H 3SJ9A 7LPRA 3PWCA 3GCHB 1LPKB 4CH2B 2WV5A 1NO9H 4Y79A 1C5WB 1Z7KA 2J95A 3TK6A 2OLGA 1GHXH 1EOLA 3GY5A 1P3CA 2EEKA 1A5HA 2UUKB 2AERH 4B2CA 2FOBA 1G3EA 3RXBA 5DP6A 1CVWH 3RU4E 2ZECA 5SGAE 1QY6A 3AVZA 1OYTH 3CENA 3ITIA 1HJAC 4JYVH 2KM0A 4OM9A 1TX6A 4NIVA 4ZKOU 2BD7A 5DJ7A 2ZQ2A 3U8OH 3UQOA 3BSQA 2BDHA 4MTBA 1KLJH 1SBWA 1QR3E 2A0QB 1UMAH 2RA3A 1MCTA 2B8OH 3KN2A 2L74A 4WXVA 1L1NA 1RIWB 3ZYEA 5KEDA 5A0BA 5FHTA 2FS8A 1K1PA 1GI0A 1V2UT 1YBWA 3O8CA 1ZYOA 3PROA 1MBQA 1ZTJA 2Q6DA 1AE5A 1TQ0B 1XUFA 3T25A 5B6OA 1YPEH 2Y6TA 1FAXA 1DWEH 1ZHMA 3SUDA 5F03A 5JPMH 3T62A 4UFFH 1D3TB 2A31A 3QX5H 3ZZ8A 3PO1C 5DP3A 4NGAH 1LO6A 2PSXA 1TGSZ 4GSOA 1HJAB 1IQMA 3ZZBA 2CHAC 2A4GA 3P95A 2GGVB 1BHXF 1QA0A 4WH8A 4ABHA 2BDAA 1FV9A 5TCCA 2HGTH 2TIOA 3AW1A 2XRCA 3DHKH 4BOHA 2AH4X 2HWLB 1L1JA 1QRXA 3OSYA 2FI4E 3GY3A 1ZMNA 5L2ZH 1ARCA 1VCPA 3QTVH 4U32A 1BT7A 1VCWA 2PUXB 4ZXYH 2EQNA 1OWIA 3T28A 2JH5D 1T32A 1C5LH 2XCFA 5L6NH 3ZVAA 1YCPK 1C5TA 4E05H 2ZPSA 1UVPA 4IMQA 3B23B 3B9FH 5CHAC 1V2OT 5C1UA 1IQGA 1GI6A 2C8ZB 2VU8E 4ZKNU 2G55A 2PGBB 2ZWLH 3R0FA 3GY2A 3SZEA 4HZHA 4Y0ZE 1MD7A 1BCUH 3SNAA 2ZA5A 4OGYA 1FXYA 1MKXK 1SGYE 2A45B 2VB0A 2QF4A 3KQ5A 1AY6H 1GHBG 1O2QA 3URDA 2ZU4A 1F7ZA 1TBRH 2ZP0H 4KTUA 3T26A 3VGCB 4K60A 3SGQE 2EI8A 3H7TA 2STBE 2BVRH 2FODA 4LOYH 3GY4A 2GMTB 3UR6A 4O03A 1TPAE 4FU8A 3ZVBA 1AWFH 1AUTC 3PTNA 4R0IA 3EAJA 4FOUC 1QTFA 3E0NB 1AVWA 3A82A 2PTCE 1PPFE 7GCHG 2FYQA 1HBTH 1MKWH 1BBRE 1ZHRA 3MOCA 2WV4A 1UTMA 1O3FA 1ANDA 2NU1E 4CBOA 1DITH 1L4ZA 3RXOA 3BTTE 1O3JA 1S6FA 1ZOMA 4JZFH 1TNIA 1G9IE 4SGAE 3QN7A 5IYTA 1GMHF 1PQ7A 1NROH 1QZ8A 1C5XB 2TGAA 2PGQB 1EAIA 1H1BA 3RXPA 3SNDA 2G4UA 1B7XB 1FIZA 1Y3UA 2CF9H 4ISLA 1MD8A 1C4V2 1EJMA 1YWUA 5JBCS 3QGNB 4NIWA 1F0UA 4LZ4B 4A6LA 1VITG 1AKSA 2TBSA 3EA7A 1WV7H 1W0JD 1F5KU 4FUDA 4JMYA 3UWJH 1NRQH 1ORFA 1ELFA 1VZQH 4UEHH 1PPZA 1TMBH 2HVXA 2KCPA 1OYQA 1K21H 5HMAA 2ZFSA 1GBLA 2ODPA 2BX3A 4ZH8A 2HLCA 2GV7A 2GP9B 2K8IA 1G30B 3MWIU 2BX4A 2H5DA 2J2UA 4DIIH 5DG6A 1L0ZA 2ZFPH 1GBIA 2ZDVH 4CHAC 1OKXA 1EPTC 4I8LA 1GJ6A 2BY7X 3HKJB 2Z9IA 4YZUA 4B75A 4AGKA 2AMDA 1TLDA 1C2GA 3TK9A 2GV6A 2THFB 3Q3KA 4X6OA 4ABJA 5J4QA 2WPLS 4AYVB 2XBVA 2ZZUH 1GGDC 1E1QD 1IQFA 4I7YH 1DWBH 1Q31A 3U9AH 8GCHG 1YC0A 2OC7A 3S69A 4NZQA 2SGEE 1ZRKA 3G01A 1DWCH 1PPHE 1LHEH 1RS0A 2Z6BD 1O5GH 3FANA 1H8ED 4ISHH 1SPJA 2NU0E 1MZDA 2AHME 1D6WA 1TX8A 3STJA 1H8HD 3AAUA 1OWJA 4MNVA 1B5GH 1GDNA 4F4OC 1BMFD 1NC6A 2CV3A 2WUCA 3A7ZA 4F49A 5EXLA 1XKBC 4AG2A 5JB8S 2ZTZA 1WQVH 3BEUA 1JWTA 2A7HA 2FX4A 3KHVA 2KFWA 4HFPB 3SU0A 1GVLA 1SQOA 1SG8B 5B6LA 4Y7BA 1THRH 3C1KA 1WYKA 3O8RA 4HG6A 1TOCB 2XBXA 1V2KT 1JMOH 3UIRA 4DOQA 2VNTA 1DDJA 2G4TA 1HXEH 4WMDA 1RD3B 3QLPH 1QQUA 3M7UA 2FOAA 1XVOA 4K69A 3ATMA 1LVYA 2H9HA 4U30A 3RXQA 4FUHA 3S7HB 3ESTA 3M5NA 3SUGA 4O3TA 2JJ2D 3SJKA 3SNEA 2QIQA 3LGUA 5DP8A 3BTGE 3VB4A 1XMNB 4IGDA 1TRYA 4WXIA 1ZSKA 1ZZZA 4A5TS 4Q63A 1C1OA 1N6YA 3AW0A 3KF2A 2J97A 1ETTH 1G3DA 1DXWA 1K28D 3A7WA 2ZDLA 1GHBF 2BLQA 1JOUB 2D2DA 4CHAB 2XTTB 3U69H 1NTPA 1QBNA 3DFLA 3LONA 1NY22 5JB9S 3A85A 3EA8A 5T6DA 3SJ8A 4IN2A 1GBMA 1WBGB 1MH0A 4B2BA 2GCHF 1O36A 3FP8E 3SZNA 4RT0A 2P8OC 5A8YA 3M37A 1WUNH 1GJ9B 3WWBA 2PSYA 4BAKB 1TE0A 2WHXA 1TRMA 1ELGA 1HDTH 5A0AE 1DICA 1TA6A 2ZGHA 2WPJS 1O3GA 1PPGE 3E1XB 3E16B 2CXVA 2ALPA 2BTCE 1YM0A 4BAHB 4CRAA 1AFQC 1E36B 4NFFA 2HLDD 2FOHA 1V2QT 5DGJA 2WPIS 2ZTXA 4B71A 1EP6A 4D76A 3RDZA 1Y8TA 2FZZA 1VR1H 2OBQA 3CP7A 1FQ3A 3QDZB 5KECA 1GBAA 3UNSA 2EY4C 1CT4E 1MKWK 4M7GA 1T8NA 1BBRH 3OY5U 1CSOE 4INLA 4NSVA 4AX9H 4JZEH 2QCYA 1P01A 2VIWA 1P02A 1PYTC 1FMGA 1P2IA 5C17A 1O2YA 1OP2A 4FU7A 5GCHF 5EW2H 1LCYA 2AIQA 1KMHB 1KSNA 4MPVA 2FESH 1GBDA 2VWNA 1CGIE 5EODA 8LPRA 1TABE 1CU1A 1A7SA 2ZU2A 3TNTA 1IQKA 2SNWA 1ZRBA 2C3SA 3ODDA 1FPHH 4KP0A 1UVUH 1S6HA 4TT3D 3RXIA 2GDEH 2HNTC 4O3UA 2Y80A 3DT0H 4WMFA 1VGCB 1TGBA 2EC9H 3OTJE 2WPMS 3EA9A 1SFQB 1IHTH 1UK4A 3KL6A 4MNWA 4X1SU 3LJOA 2KCYA 1LPGB 1XUIA 1S81A 2A7CA 2A4OA 3MTYA 1ZGIA 4FUBA 2YNBA 4BNRA 5J4SA 1A2CH 3ZZ5A 3BEIB 1KXFA 5C20A 3RMOH 1ZMLA 4GCHF 1C1SA 3ZZ9A 1C5OH 2GCTC 1AWHB 4X1QU 1S5SA 2BDCA 1XXFA 2O9QA 4X2YA 2GJGA 5HM2A 3MH5A 4HI3A 4ZHAA 1JBUH 5EXMA 3KQDA 2SGAA 4K8YA 2RCEA 1U6QA 1DOJA 1D3DB 2J38A 3P8GA 1Z8RA 4B74A 1HPGA 3GY6A 1CA0C 1PJPA 1V2LT 3LJJA 1O3KA 2BLVA 5C3NA 5AVDA 3TLOA 3I29A 1FIWA 2PTNA 1ZPBA 1O5BB 3E3TA 2PKSC 3KCGH 3TJOA 3PV5A 2H1UA 2VVUA 2H9TH 1W0KD 2ZFTA 1QL8A 3FOAA 3GDVA 1NPMA 1NBMD 3VB3A 1LKAA 4KTCA 1SVPA 1HB0B 1O3BA 3K6ZA 3RLYH 1RTLA 2F9NA 2ULLA 1ZJKA 1G3CA 1O2WA 1W7GH 5CE1A 4FUIA 1GCDA 1H8DH 3RXEA 3UNRA 3SORA 4X8VH 1TALA 1WCZA 1DY8A 4P02A 2BY5X 2R0LA 2STAE 3NK8A 1BTZA 3FFGA 3F0PA 3VXEH 1TGCA 3MHWU 4ZCNA 1XKAC 3Q77A 1C5VA 2OD3B 3BTWE 1IHSH 2F9OA 3UAIC 2Z7FE 2HPPH 1S0RA 2FTMA 1MTVA 1PQ5A 1SLXB 1BITA 4FUJA 3BN9A 1ELVA 2JIZD 3MU5A 4K1TA 1TONA 1SLWB 4Y7AA 2JH6D 1BJUA 3PB1E 4BAMB 5C1XA 3NCLA 2PFEA 3SU2A 3LGWA 2JETB 1MMJN 1GBCA 4I8JA 1S84A 5FCRA 2OTVA 1TB6H 2Z9LA 1YP9A 1P2KA 2ALVA 2VWOA 3RXKA 1D9IA 2CMYA 4XE4A 1SHHB 4NIXA 2FM2A 2VVVA 3MH7A 1XXDA 3RMNH 5HKKD 1GHZA 1O37A 3F2HA 4BXSA 5JBAS 1MUEB 2V6NA 4UDWH 1AGJA 3TH4H 1ZTLA 2ZEBA 1ELAA 1VITF 2F83A 4X8TH 4GHQA 3A83A 3AK5A 1H9LB 4X8SH 1MBMA 2ANKH 1SGCA 1VKYA 3SHAH 4DG4A 1NZQH 1N8OC 1GHWH 3A8CA 3M5OA 1EOJA 4YO9A 3OEED 3U28C 1QNJA 3PO1B 2V3OH 1PYTD 1BDAA 1O31A 2P3UB 2BLOA 3LH3A 1PQ8A 1TQ7B 1ANBA 4JK6A 4CREA 4Y6DA 3RXSA 1OWEA 1O3MA 4ASHA 1UVTH 1QFKH 1NBME 2V3HH 1F0TA 2W5EA 4ZUHA 4JZ1A 3TJVA 2BQ7B 4MVNA 3RC4A 4MNYA 5EPYA 3RP2A 1GI7B 1WU1A 1C9TA 1NT1A 5FPTA 2CGAA 1EZQA 2ZTYA 3MNCA 3GCTG 1TGNA 2BY8X 4XD7D 4X8UH 2XOKD 4K3JA 1LQEA 1TPOA 3BG4C 2J34A 4ABBA 3GCNA 1GJ7B 2OK5A 2G8TA 1ZSJA 1AKSB 1CT2E 1XUJA 4OS1A 1C5QA 3ZZ7A 2SGQE 3SU1A 1KYNA 1LDTT 2AYWA 2OQ5A 3ZV8A 3LGIA 1O2VA 2G81E 4Z6AH 1FN8A 3RXHA 4X2WA 1KTTB 3OAAD 3RXRA 3SGAE 2VIOA 1IQJA 5E0GA 1PPBH 2OQUA 1UCYK 4YOGA 2QE7D 2F43B 2GX4A 2ZKSA 2P93A 2A5IA 3QK1A 1MTSA 3BTDE 3PRDA 4UONA 4AORA 4AYYB 2O8MA 1TNKA 1H9HE 2BD3A 2FOMB 4Q7ZA 1NRPH 1A61H 1YPGH 1O35A 3LIWA 3PMAB 1C1TA 3P8NA 1SQRA 1Z1IA 1AU8A 5JBTA 1C1UH 5AF9H 2YOLA 5GDSH 2BXTH 2AGIX 1ZPZA 1NFWA 1SGTA 2NU2E 1ID5H 1X7AC 2ZGBH 5HM9A 3RU4T 1LHFH 2UWPA 4TY6A 1AHTH 1P06A 5DP9A 1GBBA 4E7RG 1UO6A 3CNRA 1ELTA 3MU1A 1DVAH 3BG8A 3OY6U 2A5AA 3F0OA 4ABGA 3P8FA 1QBVH 4ACAA 5LPFA 5CDFE 3ZZ3A 3SV2H 1C2FA 3TGIE 1O5DH 3M35A 5E0JA 3F9GA 3MH4A 4NA8A 4X0WU 5HIZA 5T3HA 3MFJA 5EPNA 1SB1H 1O30A 3A89A 3LH1A 1NFXA 3MI4A 1W12U 2Q1JA 4WH6A 1BTYA 4MPWA 3VB5A 1AFQB 1RXPA 6LPRA 4DIHH 2P16A 1GI4A 1Y3YA 3MNSA 4R8TB 3SO3A 2GZ9A 3DFJA 4WVPE 1VGCC 1UTKA 2J92A 2QXJA 4XBCA 3MH6A 1O2LA 3LOXA 1K1LA 4AB9A 4ABDA 1LHGH 2G51A 1MQ5A 1YLNA 3RXMA 1C5NH 4Y8XA 8KME2 5K0HA 2KAIB 1RRKA 1HV7A 3PMJA 1HAYB 3SI3H 3OE7D 3Q3YA 5ABWA 1UTLM 2VGCC 1INCA 5EIYA 1SKYE 1FY3A 1C2LA 3P8OA 1RGQA 1A3EH 4ZKSU 1NU9A 2BDYA 3RXLA 1O0DH 5C0UA 3A84A 4BAOB 3P70B 4CRGA 1D6RA 3UWIA 1HYLA 2VIPA 1D4PB 1HFDA 1C1RA 1OP0A 5EW1H 1ZMJA 1ABIH 1BRAA 1A4WH 2WPKS 1TWXB 1COWD 2VWMA 3Q76A 1LQDB 2QA9E 1O2PA 1EPTA 2Z9KA 2ZQ1A 2GVFA 3OX7U 4MDSA 4ZAEA 3FN8A 3PWBA 2WPHS 2CN0H 2Y81A 1JXPA 1IOEA 1GGDB 1QL9A 1GBTA 2A5KA 3F1SB 1N1LA 1DUEA 2J5UA 2TRMA 1L2EA 1AQ7A 1J15A 1GDQA 1KXBA 1NESE 1G2LA 2FXRA 1XM1A 1ELCA 1F5RA 3JZ2B 3PTBA 1C2MA 1HAPH 1GI9B 1B0FA 1BTXA 1YCPH 2BLWA 1EAXA 4GUXA 4KKDA 4FUFA 3MO3A 4ACBA 2H5CA 4WJG2 3TK5A 3MYWA 1MTNC 1QQ4A 1XUGA 2FLRH 3IWMA 2PKAA 5FL7D 1O33A 3JZ1B 4AG1A 2RFKC 3F2GA 1GBKA 1BUIA 2QF0A 1AZ8A 3D62A 1NS3A 5T6GA 1D3QB 3FKSD 1K0HA 1GCTB 2QV1A 2BOHB 4NG9H 3E90B 3UREA 4CRFA 1SQAA 1TNJA 2EI7A 1NU7B 3PLBA 3S9BA 1LMWB 2IPQX 2ZCKP 1OP8A 1K9OE 3P17H 4U01A 1OSSA 3QUMP 3D49H 2OC0A 2L6OA
chains in the Genus database with same CATH topology
2D1JA 2QYIA 1C1VH 5FPYA 3FZDA 4BXWA 1P57B 2GT7A 1HAVB 1QURH 4A1TA 1KTSB 4K1SA 1A3BH 2XC4A 3PYHA 5JBBS 4DVAU 1UHBB 3O8DA 5A8ZA 3RC6A 3O8BA 1DS2E 4Q7XA 3UPEA 1TIOA 1TNHA 2UWLA 3M3VA 3P92A 1ZGVA 3MO6A 2BD2A 1OWKA 3A8BA 2BD8A 1LVMA 2PR3A 1YF4A 5FBIA 4BANB 3H5CB 1P2OA 3ATWA 1QB6A 5DKMA 1GVZA 1DUAA 1V2JT 4I8GA 3GYMA 2Z3DA 2TGDA 5AFYH 3S9AA 3SV8A 5T6FA 3GISB 2RA0A 1A5IA 4NWLA 1FJSA 2Y82A 1HAXB 1NN6A 1C4U2 2XYAA 1Z71A 2GT8A 2ZU5A 4ZKRU 5EQQA 1W10U 1NRRH 1GBJA 2ODQA 2V35A 4MNXA 1BMMH 1FN6A 1PFXC 4Q80A 1UTNA 2R3YA 1Q3XA 5TJXA 1O39A 1YGCH 2DUCA 2VIDA 4Y71A 1CQQA 1VITH 1LHCH 3QGJA 5K7RA 2FX6A 1TFXA 5C1YA 1W3CA 2ANWA 3M5MA 1GL0E 1Z6EA 3STIA 3BTKE 1TPPA 2C8WB 3A87A 1SGRE 1SLVB 3K6YA 3D65E 3T2NA 1TMTH 5FX5A 1FZZA 1P2NA 1KLTA 1K1JA 2ZPRA 5C5NA 4UFGH 3EQ0H 1FY5A 1T31A 1O2XA 1QJ1B 3RUOA 1HIAB 3MU8A 4AB8A 3BTHE 1E38B 2K1QA 2I6SA 4B2AA 1VJAU 4Q2KA 3ZZ4A 5L2YH 1GBEA 3F9FA 4SGBE 1V2TT 5GCHG 1JRSA 4X1NU 1KXCA 2Q6GA 3V13A 1V2ST 2H6MA 2FLBH 3SOSA 3HPTB 4J2YB 3F9HA 4YT7H 2W3KA 1MTUA 1THSH 4TWYA 1QIXB 4TPYA 3SQHE 4YLQH 1JRTA 1FAKH 4AZ2B 4TYDA 3L3TA 1AVGH 4DT7B 3HATH 3GY7A 4NSYA 1K1MA 2NU4E 1UCYH 3MU0A 5H4IB 3M5LA 1C5ZB 1C2DA 1HAVA 2ZDAH 5F6MA 1T8OA 1C2HA 2ZGJA 3QWCH 1EXFA 3TITA 1TAWA 1Y5BT 2PHBA 3VFEA 4TY7A 1W13U 2ZDMA 3V0XA 3MNBA 4A92A 2OCVB 2OC1A 3I77A 4NA9H 1LKBA 1EASA 3SV9A 5GIBA 9ESTA 4I32A 1ZTKA 1F0SA 3TJUA 3MU4A 1ESTA 1E34B 1KXDA 4X6MA 1Z8IB 2XNIA 2VH0A 1MAYA 4AGJA 3HK3B 5EOKA 2ZCLP 1K2I1 4XDEA 4DJZB 2C8YB 3UY9A 8ESTE 1QHRB 2R2MB 1WOFA 3UQVA 1Z6JH 2BDIA 3RXGA 3BF6H 3LC3A 1NRNH 1AN1E 3VEQB 3TJNA 1QJ7B 2G5NA 4GPGA 1A5GH 2JKHA 1QL7A 3DA9B 2O8WA 2OC8A 2GCHG 2QF3A 4PROA 3EDXB 4JYUH 1SMFE 2FI3E 2P3FH 4OS5A 4IBLH 1ELDE 5EG4A 3BV9B 2GCTB 3CS0A 5ESTE 1C2EA 1GPZA 3S7KB 2VIVA 3MMGA 5AFZH 3T27A 2Y5GA 3QO6A 4YESB 3ZVDA 1UCYE 3LGTA 4FUCA 5LPEA 1CT0E 1N8OB 4YOIA 1ZPCA 1F5LA 2GKVE 3A7TA 5FPSA 1TMUH 1OPHB 1DE7H 2R3UA 1E35B 2BY6X 2HPQH 4OS4A 2UUJB 5FCKA 4ABEA 1TYNA 2CHAB 5I46H 3EYDA 3SNBA 5LGOA 4CRBA 3HKIB 4H4FA 1C1PA 1HNEE 1SR5C 1J17T 2LPRA 1L4DA 2ESTE 5DK1A 3SV7A 3PLKA 1MCVA 1TBZH 3PV4A 4BTIB 3QZRA 2Y5FA 3RXJA 3SGBE 4E7NA 2C90B 1YPJH 4D7FA 4IC6A 1KXEA 2FOGA 1YPHC 3KQEA 1DFPA 2CJIA 1EAUA 1BQYA 1O3HA 1P8VC 4WWYA 1A46H 1SI5H 4RN6A 5EXNA 4FUEA 4H6TA 2VGCB 5F8ZA 1SGDE 4XOJA 4TWWA 2YNAA 3ZZAA 1T8LA 3A8AA 1EB1H 4Q7YA 4Y76A 2W7UA 3ZYDA 1CGHA 4ABIA 2XC5A 3KQCA 5EQSA 1AI8H 2C93B 1HCGA 4ZHLU 5GXPA 1W0ZU 1LTOA 1SSXA 3M36A 1CA0B 1P9SA 4XBBA 1PPCE 5DO4H 2AGEX 1TPSA 3F6UH 3PLPA 4J1YA 4MPUA 3M7TA 3TU7H 2WUBA 1GJBB 4IW4E 1CBWB 3LPRA 1CA8B 1NFUA 1P10A 1BHXB 1O38A 1DM4B 2QAAA 1GJ5H 2XWAA 2VH6A 2BVSH 2UWOA 1DXPA 2GD4B 3PMHB 4GLYA 4Z0KA 1C1QA 2V0BA 3UOUA 1O32A 4A1VA 2AEIH 3HGNA 3UNQA 3ZVGA 1GHAF 2ANYA 1N6XA 1YPHE 1EZSC 1Y5AT 2FMJA 3RMLH 1S83A 3GCTF 3ZVEA 3A7YA 2J9NA 1EAWA 2GTBA 5LPRA 2SFAA 2F9PA 2ZU1A 3LT3A 3ATLA 3BTME 1G37A 3SUFA 1O5FH 1C9PA 1GI1A 2QC2A 1EPTB 1YPLH 2TGPZ 6CHAC 4TPIZ 3E0PB 1MQ6A 1O5CB 5FX6A 1P12E 3RXTA 1W2KH 1P3EA 1GJCB 1TBQH 3VB7A 4OS7A 3K2UA 2BHGA 1DSUA 4NCYA 1ESAA 6ESTA 1BMLA 1HAHH 2O8TA 2ZFFH 4X1PU 1ETSH 1HAZB 1QGFA 5E2PA 4X6NA 1EATA 3Q3XA 2W7SA 4AFQA 5E8EH 3MNXA 3SHCH 2RG3A 2UUFB 2FOEA 1SOZA 2SGFE 4RKJB 3VXFH 2HALA 1F92A 2O8UA 3BTQE 5A2MH 3IITA 1C2KA 1FDPA 1DPOA 1YKTA 4GAWA 1C2JA 1GI5A 5A8XA 1GL1A 2BB4A 4VGCB 2TPIZ 2FDAA 1FPCH 1K1IA 4UD9H 3BEFB 2UUYA 3U8RH 1MZAA 2ZHFH 1O5AB 3GYLB 3RXAA 1GDUA 4I8HA 1SGQE 3ATIA 1BMNH 1GCTC 2H2ZA 3GDUA 1IQHA 3L6PA 2I6QA 1O3AA 1NM6A 5GWZA 4KTSA 3LU9B 1SQTA 3V12A 4Y10E 1O2ZA 3TIUA 1ACBE 3HK6B 1H9IE 2Z94A 7ESTE 3A7VA 1FONA 4NIYA 1KLIH 3GOVB 2ZCHP 4K5ZA 4U2WA 4I8KA 2FO9A 1O2NA 2XC0A 1AVXA 2ZNKH 3HGPA 1BTWA 1C5RA 1O3NA 3GCOA 1MTWA 1KDQA 2BM2A 1HJ9A 4B76A 1FNIA 4CRDA 3R3GB 1NFYA 1TX7A 4JYTA 1P05A 3TGJE 3ZZ6A 1TNLA 1XUKA 1PQAA 1A0LA 2C4FH 3M3TA 3ENSB 3GCHC 1AD8H 2EA3A 1KY9A 1VCQA 9LPRA 3LKWA 5A09A 1GVKB 1P2QA 3M61U 5E0HA 2F91A 3RXFA 1BTHH 1XUHA 1IQNA 1ESBA 1AE8H 2ZHDA 1WTGH 2XCNA 2FI5E 1EB2A 2FP7B 1DT2A 2F9BH 1TNGA 4X6PA 1W0YH 2FIRH 4BAQB 5A0CA 2QXGA 1UK2A 1W14U 4IC5A 1UVOA 1C1WH 4YLUA 1BRBE 2CF8H 2QXIA 1H8IH 1HXFH 1O2SA 3U8TH 2OUAA 2C8XB 4IS5A 3TPIZ 2JETC 3TVJB 4ABFA 3EE0B 1O2JA 1V2VT 4BTTB 1CO7E 4D9RA 1RFNA 1CHGA 1HAOH 2FYRA 1CGJE 2ANMH 1BTUA 4ISIH 2QXHA 1HAIH 1P9UA 1ELEE 2BDBA 2R9PA 3V7TA 1O2HA 3QZQA 4Y11E 1V2MT 2RDLA 1DLKB 1O3PB 3ATKA 1TRNA 1UTPA 3SJOA 1SGNE 3SQEE 1E0FD 3W94A 5CHAB 3ELAH 1G32B 1FI8A 3T5FH 4AN7A 4XBDA 1TA2A 3LGYA 5EQRA 4X2XA 1GJAB 1XX9A 2W26A 3A7XA 3VPKA 3MO9A 1ZR0A 2BZAA 1QJ6B 1C2IA 2ZFRH 4DCDA 2ZGXH 2G5VA 4LXBH 1LHDH 1SOTA 2ZO3H 4Y0YE 1ZSLA 1O3CA 2PKAB 1DWDH 1GBFA 3M7QA 1MU8B 5DPAA 4ABAA 4GVUA 3URCA 1KDQB 4CH8B 1CBWC 5CMXH 5ESBA 4ESTE 5JYIA 1UHBA 2IJOB 2AFQB 1J9CH 2ZPQA 2J94A 1GHYH 3GY8A 3AASA 3K65B 3RXVA 3KQBA 3QTOH 4RSPA 1P2MA 5G4BA 1O3EA 1HJ8A 4NWKA 1Y3WA 2PWXA 1TGTA 2ZGCA 2GZ8A 3OYPA 1GI3A 4X2VA 1O3OA 1ARBA 1C4Y2 1MKXH 3FP6E 1Z8JB 4DGJA 2ZIQH 1AO5A 1O3IA 4VGCC 6CHAB 1GMDF 1G3BA 3NZIA 3EGKH 1OWDA 4OS6A 2VVCA 2G52A 2B7DH 2BD4A 3SW2B 1B0EA 1AMHA 1SL3A 1J8AA 4ZMAH 3BIVH 2ZHWH 1V6DA 1E37B 1ZHPA 1QCPA 1C5PA 3ZV9A 1RTKA 1SGFA 2NWNA 2H9EH 5C2ZA 1QRWA 4FVBA 4YT6H 3NWUA 1BRCE 2B0FA 2Z3EA 3B8JA 3RU4D 2A7JA 1QBOA 1IQLA 3BTEE 2TGTA 1O2TA 3T29A 1YPMH 1T7CA 2D26C 1LPZB 3P6ZB 4LZ1H 1FY8E 1YLDA 4B1TA 4XSKU 5FXLA 1EJAA 3SU5A 2XBWA 4INHA 1LVOA 1HIAA 3GDSA 2D8WA 1YCPM 4H6SB 1BRUP 1C1NA 2OP9A 3LC5A 4UE7H 2A4RA 2P59A 4NFEA 3Q00A 1BZXE 4UFEH 3RM0H 4YTAA 3FAOA 4DURA 1SLUB 1QB1A 5F8TA 4O9VA 2W3IA 5BRRE 3N7OA 4X1RU 1A0JA 1P09A 1F2SE 2DE8A 3DD2H 1GWAA 3NPSA 1ANEA 5ETXA 5HGGA 3LGVA 3PM3A 1Z1JA 3SI4H 3UR9A 1UTQA 1D3PB 3TGKE 1V2WT 1HAGE 4D7GA 4INKA 3VB6A 5BPEA 3TH3H 3UTUH 5FAHA 2IN2A 1GHAG 1EKBB 1T4UH 2F3CE 2PKSB 4GHTA 6GCHG 2A1DB 2WYGA 3DUXH 5F8XA 1AB9B 1DSTA 1Q2WA 2G00A 1GJ4H 4ZXXH 1C5YB 3A8DA 1KXAA 2WYJA 4A7IB 2ODYB 1SGIB 1SGFG 2IPHA 1V3XA 2JH0D 2Q6FA 1ABJH 2PLXA 3SBKA 2FPZA 3RMMH 1Y59T 1SHYA 1O2IA 4ZROA 4YM9A 2XW9A 1RTFB 2J4IA 2XBYA 4DW2U 5LH8A 2WINI 4YOJA 1CE5A 1FUJA 1Y3XA 3FZZA 2Z9JA 3ZZCA 1EJNA 1ZJDA 3SUEA 1K1NA 3TH2H 1H4WA 1CHOF 1C5MD 4IMZA 5C67A 1OXGA 4KELA 2KAIA 1MTNB 1A1RA 4Y8ZA 1S85A 1BBRK 2F9VA 3E91A 3I78A 3ODFA 1GBHA 3UUZA 1IAUA 5I25A 2BXUH 2FTLE 1O2GH 1SGEE 1FY4A 2P3TB 1QB9A 1SFIA 1THPB 1GHVH 1BIOA 1DLEA 4OS2A 2HRVA 3CS7A 1Y5UT 3A86A 1K1OA 1UK3A 4LK4A 2FEQH 1DY9A 5C5OA 3U1JB 2OBOA 3BTFE 5IDKA 5EGMA 3RXCA 1TOMH 3S9CA 1GJDB 2BMGB 1DANH 1V2NT 3RXDA 2VJ1A 1ELBA 4AFUA 2BOKA 3KNXA 1W8BH 1YYY1 1O34A 4H42U 2A4QA 3A81A 4THNH 1AIXH 1UTOA 2ZHEH 1GMDG 2PV9B 3FVFB 2FOFA 3UFAA 5AHGH 4ISOA 2A2QH 2QN5T 2SGDE 2ZU3A 3RXUA 2FWWA 2DE9A 2ZDNA 4KGAA 2AIPA 4FUGA 1KIGH 1BMAA 1PPEE 1O3LA 3U1IB 1AFEH 2FS9A 2GDDA 2PUQH 2F9UA 2GZ7A 4B73A 1EP5A 3NUMA 1V2RT 3VGCC 4DY7B 5GPIB 4AFSA 2HNTF 1AZZA 5GJ4B 7KMEH 5JDUB 3SV6A 1EUFA 3A88A 1HUTH 4UFDH 2HNTE 2XWBI 3IG6B 1G2MA 1J14A 2BDGA 2OXSA 4MG3A 3UOPA 4FVDA 2QY0B 5HYOA 1VJ9U 3F9EA 2BVXH 4A1XA 3AAVA 3K9XB 4MPXA 2IOTA 2AMPA 5TCAA 4IN1A 1YLCA 5L30H 5FBEA 4I31A 1WSSH 5DP7A 3L33A 1A0HB 2BD5A 4K8BA 1SC8U 1BB0B 2BQ6B 2Y7ZA 3RM2H 2EI6A 8GCHF 2P94A 2ZC9H 1IQEA 2LNCA 1EX3A 1UTJA 4XFQA 3BIUH 3WY8A 3V3MA 3SNCA 3KEEA 1YPKH 4AOQA 1EQ9A 1WAYB 1P0SH 4MLFB 1O2KA 5EU8A 1QRZA 1OS8A 1P11E 1ETRH 1J16A 2ZHQH 4QT8C 2P8OB 3ZVFA 2BQWB 2BZ6H 1ZLRA 1K22H 1BOQA 1OOKB 2NU3E 1P04A 4O97A 1O2OA 4JCNA 1L1GA 1BTPA 1AB9C 4OGXA 1C5UA 2M5TA 2Z9GA 1IQIA 4GCHG 5E2OA 1S0QA 1GG6C 1CHOG 1HRTH 1RIWC 2SGPE 1O2RA 1F0RA 1BA8B 3S0NA 1T8MA 4CBNA 4JZIA 2AGGX 2ZFQH 3NXPA 1GI2A 1C5SA 3E8LA 3SU4A 2QGRA 4FU9A 1WQSA 1EZXC 2VWLA 3M3SA 1P03A 3BG4B 4K1EA 1GJ8B 1O2UA 2A32A 1AUJA 3ZZDA 2Y7XA 4JK5A 1EZUC 4MQAA 4Y8YA 4WY3A 1W11U 1FLEE 1W7XH 3SU3A 4JZDH 1JIMA 2O8LA 1HGTH 5PTPA 2AS9A 1GMHG 1BJVA 1Z8GA 2Z3CA 2FOCA 2GMTC 3TNSA 2AMQA 3SJIA 1OWHA 6GCHF 3U98H 2OINA 1HLTH 4HGCA 4NA7A 5DP5A 2SNVA 2HOBA 1G36A 3E6PH 1GI8B 1C1MA 1M9UA 3LDXH 3H7OA 1NRSH 3SU6A 2BY9X 3D23A 2VIQA 1QA7A 1JIRA 2R2WU 2A2XH 3C27B 3RC5A 2BD9A 7GCHF