1GHZA

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ghzA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ghzA02
1YYY1 3RUOA 2NU2E 3RLYH 3ZZ7A 4NWLA 1GBTA 4CRDA 1J8AA 4AX9H 1V2MT 1DWEH 1HJAB 4NIWA 1H9HE 4BNRA 4Y7BA 2XBVA 3EA8A 2GVFA 2ZTXA 1P9UA 5AVDA 2P8OC 1XMNB 2AS9A 4X1SU 1ZHMA 1N8OC 2VJ1A 2EI8A 1W0YH 3ZVEA 1DOJA 1BTZA 3UOPA 1Z6JH 5HMAA 2ZQ2A 3A84A 1TBRH 1K22H 2Z9GA 1WSSH 3RXUA 1QA7A 1SOTA 1DY8A 1NFXA 3SI3H 1ELDE 1QJ6B 4I7YH 1GBAA 4RKOB 2DE9A 2HWLB 1SG8B 4A5TS 2ZWLH 1NRSH 1SMFE 2FOFA 1ID5H 1GHBF 2AH4X 1THPB 3ZVBA 2BLOA 2FM2A 2XTTB 1BRCE 1AN1E 1ELVA 1M9UA 2FS8A 1LVBA 2F3CE 2GX4A 1V3XA 1CU1A 1SPJA 3GY2A 2ZQ1A 4GCHF 4FUJA 5CHAC 1GHZA 5E8EH 1ETRH 1HV7A 3H7OA 2R0LA 3RC5A 3UREA 2VIOA 2ZU2A 4ZKSU 3QTOH 4JZEH 4I8HA 1P05A 4OS2A 1JRTA 3S0NA 1DT2A 2UUYA 1HCGA 1G32B 1T4UH 4GSOA 1X7AC 1XUGA 3ATKA 3U8TH 3KHVA 2BOKA 2PW8H 1HGTH 2ZDKA 2H9EH 1BJUA 1O3FA 5F8XA 4AN7A 1GI3A 1L1JA 1GCDA 2ZHFH 3RXIA 1O33A 1IOEA 4IC6A 4DIHH 1ZTLA 3WY8A 3P92A 3OX7U 1TMBH 5GPIB 5K0HA 1GMCF 1QY6A 3U9AH 5HM9A 1O3HA 1U6QA 3LGTA 5C5NA 1ZOMA 2ZU4A 2BXTH 5EPNA 1UJ1A 2IPHA 1LPZB 3A86A 1GMCG 2Y80A 3A7WA 1NU9A 3SNEA 5DO4H 1ZZZA 5C2ZA 4MNYA 2P16A 3URDA 4JZ1A 3RXVA 5JDUB 3SQEE 3BTME 4RN6A 1N8OB 4Y8YA 1Z6EA 1SGEE 2A32A 1XXDA 1WBGB 2ZHQH 4ISOA 5DP4A 1Z8GA 1IHTH 1TRMA 3RU4E 1C5TA 4JMYA 1EOJA 3A85A 1UTLM 5A0AE 2A7JA 1LPGB 5FPSA 1OWIA 2FZZA 5AFYH 3MHWU 1XUFA 4KTSA 1TGBA 2Z7FE 1MMJN 3LGIA 5CHAB 4RKJB 1NS3A 3I77A 1VR1H 1DM4B 1GBFA 4O3TA 1G2MA 3GY4A 1HAYB 3SU3A 1KLTA 1KXCA 3RXEA 3RXPA 6GCHF 2PGQB 2WV4A 3RM2H 1WQVH 3KCGH 3EGKH 2BQ6B 4YLUA 6CHAC 2A5AA 2LNCA 4ABDA 2BQ7B 3FP7E 1OPHB 4ABEA 1MZDA 2V35A 1AVXA 3E0PB 1GBCA 1GHAG 5DP9A 4ZXYH 3SW2B 2TGAA 1AB9B 2JETC 1FJSA 4NGAH 1NM6A 2GCHF 1DVAH 1EP5A 1H9LB 1Y5AT 4DY7B 1YPKH 4D7FA 3UNQA 4KGAA 1BIOA 1W8BH 1C5QA 3RMOH 5DP5A 1YLCA 2PUQH 3K6YA 1O5FH 1F2SE 4NWKA 1CT4E 1OP2A 1ZJDA 1TPAE 3A7YA 4NFEA 3TVJB 2FODA 1MBQA 2QGRA 4FUDA 1MTSA 1UTKA 1P2JA 3VGCB 1THSH 1ELAA 2Q6FA 1E35B 4INKA 2A4OA 2FOBA 3RXLA 4X2YA 2A2QH 2P59A 1OP8A 2G4TA 3P8GA 1DXWA 1ELFA 3RM0H 2J38A 4E7RG 3IG6B 2J4IA 5J4SA 2VVCA 1ZSJA 4YT6H 2FEQH 4GVUA 5C1YA 1K1MA 5EXMA 5EGMA 4DOQA 3BTGE 2OTVA 1MU6B 1BTWA 1QNJA 3W94A 1RGQA 1FMGA 1Y3XA 3QTVH 2BD4A 1BTUA 1C5WB 1ZHPA 1ZHRA 1MAYA 2BOHB 2BMGB 1MBMA 3A88A 4WXVA 4NCYA 4FVDA 1TALA 1B0EA 5C1XA 3BTDE 3V12A 2TGTA 4ZMAH 9ESTA 3RXSA 1SGQE 1NN6A 4FXGH 2WUCA 3NK8A 4JYUH 2G5VA 1HAHH 4WMEA 1HJ8A 1KTSB 2CGAA 1CT0E 1ZGIA 3Q77A 1O3LA 1L0ZA 1D6RA 2W5EA 1C5VA 1GHXH 4NA8A 2J9NA 5T3HA 6CHAB 4AZ2B 3RXCA 4AORA 4U32A 1BT7A 1C4Y2 3U1IB 1BQYA 3T27A 1EPTB 3SV9A 5E2OA 1P10A 4K1TA 5FX5A 1P2IA 3DHKH 1AO5A 4D7GA 5C1UA 1HB0B 2FDAA 1MKWK 3RXDA 1YPEH 4NG9H 1WYKA 3TLOA 1O2OA 3RXJA 1BHXB 1EZSC 4K5ZA 2UUFB 1FPHH 1O5EH 1ELBA 1OOKB 2ZDAH 1YC0A 1Z1JA 3GYLB 4U30A 3S9CA 3AW0A 2BDBA 4IW4E 4NIVA 4ZROA 1QRZA 3ATLA 1HAXB 1IQIA 1NFYA 2FI4E 3RDZA 4JYTA 4I8KA 4LK4A 1MH0A 2FOHA 4Y0ZE 3PMAB 2P95A 2P93A 3NKKA 1CA0C 1INCA 2A4QA 1O0DH 1HRTH 3NZIA 1Q2WA 3UQVA 3A7VA 3H7TA 2BYAX 2RG3A 2IN2A 2BZAA 3ZVFA 2GDDA 1RTFB 4ISNA 3SU4A 2ZDVH 1NO9H 1C1VH 1GMHG 4H42U 3UWIA 1AY6H 3MU1A 2Z9JA 3UQOA 2FWWA 2XNIA 1BRBE 1GHWH 3UNRA 2AMQA 2OC7A 5DP8A 4WWYA 1QRWA 2ZEBA 2FI5E 3M7QA 4OS1A 1GBHA 2OINA 3SQHE 1C5SA 1GDQA 2AFQB 2CN0H 3P8FA 2G55A 3TJNA 1TNIA 4CHAC 1P06A 2VWOA 4OS4A 1TB6H 4NZLA 2I6SA 1AUTC 1DY9A 1YBWA 1GL0E 1O2GH 1Q31A 2HPQH 2PKSC 1P3CA 2M5TA 3SNAA 1C5LH 3MO9A 3T62A 3RXKA 2F9BH 3A7ZA 3LU9B 2GMTC 4WY3A 5AFZH 1S84A 2ZDMA 1HAGE 1F0RA 1V2NT 1W3CA 2FOMB 2BHGA 1H8IH 1SGRE 3EDXB 3E91A 3RC6A 1V2VT 1WTGH 1H1BA 2P3UB 5F6MA 2BVRH 2QXJA 1AGJA 1DE7H 1MCTA 3ZZDA 3FZDA 2AERH 1A0LA 3SUGA 2A1DB 4D9RA 4MPWA 1GJ8B 1EAUA 5EOKA 4K3JA 1LHCH 2BD9A 5HXFA 2FP7B 3RXTA 1RTLA 3L6PA 1ESTA 1Q3XA 5F03A 1DXPA 1GI6A 5JBBS 2ZF0H 1ZMJA 3ATWA 4HTCH 4DG4A 1C2HA 1O2YA 1GBBA 1YCPH 3PMHB 1QBNA 1O2KA 3S7HB 2O9QA 1GG6C 5I25A 3E3TA 3M35A 4JYVH 1BJVA 2D2DA 5FX6A 1UCYH 3RXOA 2QC2A 2BB4A 1LHEH 1E36B 1QBVH 2P94A 1SLXB 2BY9X 2ZGCA 2QF3A 4I32A 1GJCB 1NRNH 3U98H 4MG3A 1P3EA 5A8YA 1VZQH 1AQ7A 2ZP0H 1SQOA 1O2WA 2THFB 9LPRA 4VGCB 3O8BA 1KXBA 5EQQA 1XXFA 3P17H 2BZ6H 2OLGA 1YPHE 3MOCA 1K21H 4Y10E 1TGCA 2BDAA 1G3BA 2WV5A 4LOYH 4A7IB 4Q2KA 4K69A 1G30B 1V2JT 3O8RA 1AWHB 3ENSB 3TJVA 1ZTJA 2BD2A 3ZZ5A 3GY6A 3KQBA 3W95A 3RU4D 2SGFE 2XYAA 2OD3B 4KTUA 1IQLA 1RRKA 1ANCA 1K28D 2W3IA 1A0JA 1TNGA 4O03A 1UHBA 2J2UA 1O3NA 1HJ9A 1Z71A 3LGWA 3PWCA 1C2IA 1A4WH 1D3DB 4LXBH 1OKXA 2Z9IA 1W0ZU 5GIBA 1DSTA 4JZFH 5EPYA 3M5MA 3ATIA 2PSYA 3F1SB 5HGGA 5DG6A 4AG1A 2ZFRH 8GCHF 4E06H 1RFNA 2G8TA 3M5LA 2ZU1A 1YLDA 1O3BA 4AFSA 3QGJA 4UFDH 5E0HA 3BTFE 5A09A 4BANB 4H4FA 1P02A 3ZVGA 3SJ8A 5HYOA 1EJAA 1BMNH 2W7UA 4U2WA 1QURH 4BTIB 3ESTA 4NIYA 2OCVB 1TRNA 3MMGA 2GV7A 2ZGBH 1FAXA 4B71A 2OC0A 2PTNA 1QHRB 3GCOA 2TPIZ 2ULLA 5L2YH 1VCWA 4FUHA 1UVSH 2ZHWH 1K2I1 2FPZA 5BRRE 4CR5A 4I31A 1A5GH 1TE0A 1DS2E 1TPSA 2AYWA 2GGVB 1O3JA 4SGAE 1Z8IB 4XFQA 3CENA 3M36A 4OS7A 1RJXB 1ZRKA 1SGFA 5L2ZH 1GI9B 2STAE 1C4V2 4TPYA 3SUDA 1KY9A 1J17T 2EI6A 3AAVA 5LGOA 1MZAA 2Y7XA 2XWAA 1C1TA 2A2XH 2A7CA 3DD2H 3TITA 4A92A 3BTKE 1TNKA 3M3VA 5A0BA 4WJG2 1SFQB 2CF8H 1EATA 1TYNA 2O8WA 2FS9A 2G00A 2FESH 1DDJA 1EZQA 2ALPA 1O3MA 5FHTA 5ESBA 1MD8A 3SGQE 3QN7A 3RXBA 1EUFA 4ZKNU 1ARCA 1DITH 4FU8A 4YOGA 1SQTA 1NU7B 2TIOA 1GHVH 5TJXA 1HXEH 2UWPA 1YKTA 2JKHA 3VB5A 2GKVE 3GY8A 3QUMP 3L33A 3GDSA 2HPPH 3LT3A 4WXIA 5IYTA 2ZCLP 3D23A 3RXGA 2CJIA 3M61U 3A80A 2VWMA 1C9PA 1EZUC 4XOJA 2BD7A 1ZTKA 2PFEA 3UPEA 3DFJA 4FU7A 1W10U 1GI0A 3RMNH 3UIRA 1E37B 1NPMA 2GZ9A 4BOHA 1C5UA 4MTBA 4B2AA 3UFAA 4D8NA 4ABHA 1GBMA 3KQDA 2YNBA 3BEFB 2VIQA 3SV8A 4BXWA 2GT7A 1O5GH 1UMAH 1O3GA 1O3DA 4UONA 4K8BA 4ABAA 2ANKH 3SUFA 1GHBG 3KGPA 1OWKA 2VH0A 1NFUA 1CGJE 3MFJA 1ARBA 1SHYA 3MH4A 2HRVA 3ZZCA 1AVWA 1UK2A 2FLRH 4GCHG 1O3IA 2QY0B 2FLBH 4A6LA 1OS8A 1L4DA 2Q1JA 2ZPRA 4X2VA 4YOIA 2A5IA 2STBE 3Q3YA 1YGCH 3GCNA 3KQEA 1F0UA 2H6MA 1AB9C 1C1NA 5GCHF 2B7DH 1UO6A 4Z0KA 2EC9H 5I46H 1WTHD 5GDSH 5E0JA 1IQNA 3U8OH 5JB8S 3PMJA 1DLEA 1UTOA 2ZCHP 2D26C 5EW2H 1O3OA 3C27B 4X2WA 5GCHG 5J4QA 1VITF 4AOQA 2HGTH 2F9UA 2WPIS 1GGDC 3M3SA 4GHTA 1BZXE 1TMUH 4X6OA 1GJ6A 3STJA 2O8MA 2ODYB 4MPXA 1K1OA 3VGCC 5B6OA 3ODFA 2ZDNA 3ZZ3A 1VITG 3OY6U 2FYQA 1LVYA 4B1TA 2Y5GA 1OWJA 2TGPZ 1SSXA 2R3YA 3ZVAA 3BTQE 5T6GA 5C3NA 1Y3YA 1BMLA 4AB8A 4YT7H 2NU4E 2ZDLA 3QDZB 1LQEA 4JK6A 5LH8A 4UFFH 5TCCA 1C2EA 4FUEA 4IMZA 1Y3VA 4FUGA 1G9IE 3SHAH 4ABJA 2GDEH 5K7RA 1D4PB 1QB6A 3NCLA 3A8CA 1GMDF 3L3TA 4B74A 1EQ9A 1CBWC 4M7GA 1NRQH 1HAVB 2VINA 3NUMA 5FCKA 1YF4A 1O37A 2ALVA 3GICB 4TY6A 3RXQA 4HFPB 5DP6A 1O2XA 1NFWA 2FOAA 2SGEE 3VFEA 2OBOA 3T25A 2IJOB 4X1NU 2UUJB 1P12E 3SN8A 2BDCA 2Z94A 1GJ5H 1P2MA 1TABE 2OXSA 2WPMS 2VIDA 1ZSLA 2H2ZA 1RIWB 5FAHA 2BY5X 4Y71A 2UWLA 2VIVA 2SNWA 1GJ9B 3FZZA 1EP6A 3ITIA 2R0KA 3U8RH 3SV2H 1EPTC 2ZZUH 2TGDA 3A89A 3C1KA 3LDXH 2W7SA 6GCHG 3MNCA 1C2MA 1AZZA 4B73A 3ZZ9A 2GT8A 4CRAA 7LPRA 4FUIA 3ZZ4A 1MCVA 2SGAA 2AIQA 3EAJA 3F9FA 1T4VH 3H5CB 4CR9A 2B0FA 2IOTA 2J94A 2XC5A 3BEUA 1MTUA 3LGYA 1LO6A 4ESTE 1QGFA 5E0GA 1FONA 2PSXA 2GCHG 1N1LA 4CRFA 1ETSH 2G51A 1GGDB 1C4U2 4NIXA 4Z6AH 4H6SB 5ETXA 3U69H 5GJ4B 1ZJKA 1ZMNA 2BDHA 2BDYA 1HAVA 2PHBA 1EZXC 1QL7A 1GDNA 4H6TA 1TNHA 2RA0A 1CHGA 2PTCE 3OTJE 1O31A 3BTWE 3K2UA 3MNSA 4WF8A 2WPKS 3RXAA 2Z6BD 1A3BH 3O8CA 4CRBA 1XKAC 2QCYA 2F83A 3CP7A 3FVFB 1YPGH 1P9SA 3EA9A 4YESB 1AFQB 2GV6A 3ODDA 4O3UA 1VGCB 4YO9A 1GJBB 2YOLA 3OY5U 3SOSA 2RDLA 3KIDU 2FMJA 2SNVA 2BTCE 4R8TB 1CBWB 1C9TA 1T8OA 1F0TA 1BBRK 3E1XB 3IITA 5GWZA 4AYYB 1LHDH 3QK1A 1EJNA 3BG8A 4GAWA 4LZ1H 3T2NA 2BDGA 1XUJA 3VB4A 3ZVCA 1FY1A 1L4ZA 1DUEA 4IC5A 5TCAA 2ANWA 3B23B 4MDSA 3Q00A 4ISLA 2QAAA 3R3GB 2VGCC 1XUIA 2V3HH 5LPFA 3G01A 1BMMH 2FIRH 2BLWA 3T5FH 1PYTC 2J92A 2GD4B 1AIXH 1P57B 1W13U 2Z3DA 1C1UH 7ESTE 3F6UH 1C2LA 4I8GA 4IMQA 2SGPE 2SGQE 1O38A 4TWWA 1LCYA 3SI4H 1BOQA 2F9VA 4ZHLU 3MO6A 3SNCA 4NSYA 4UD9H 1W14U 1GJ7B 1A1RA 1S6HA 1P8VC 2OQUA 2ZPQA 1BTPA 4MNWA 1IQKA 5JB9S 3O8DA 1C1PA 2C93B 2G81E 3MH6A 1YPMH 4QT8C 4X1PU 5L30H 3TH2H 7GCHF 1O5AB 1P2OA 1T32A 1ESAA 1BB0B 1TWXB 4X6PA 2VVVA 3MO3A 3FAOA 1JIRA 1QRXA 2VB0A 7GCHG 2NU3E 3TH3H 3DUXH 4Y0YE 1MU8B 1EX3A 1GHYH 1CT2E 4E7NA 1JWTA 3LJOA 4X1QU 1NTPA 1S83A 2WYGA 2A5KA 1TA6A 1MKXK 1GBDA 1C5NH 1S0RA 2D1JA 1ELEE 1ELTA 3AAUA 1LTOA 1BTXA 4DIIH 3UNSA 4CREA 1C2DA 4VGCC 2ZFFH 1A2CH 3ZYDA 2D8WA 2J34A 4AFUA 3RMMH 1EPTA 4K8YA 1TPPA 1IHSH 1VCPA 1V6DA 1KTTB 1LQDB 2XCFA 1XX9A 3PO1B 1SGTA 1FN8A 2AMPA 2VGCB 2F9OA 2Z3EA 1C2KA 1FPCH 3RXHA 1O2PA 2WPHS 4XBBA 1LVOA 3A83A 1NROH 1CSOE 2DUCA 5A2MH 1K1LA 1GI1A 1IQHA 2FOCA 1IQJA 5L6NH 2ZG0H 1BMAA 5AHGH 4TYDA 2Y7ZA 1LDTT 1FNIA 1THRH 1JIMA 2ZU3A 3SO3A 2OQ5A 1QTFA 3R0FA 3F68H 4O97A 1JRSA 2PUXB 3KN2A 1YCPM 2ZCKP 1BBRE 1OX1A 2RA3A 3M3TA 5FPTA 1PQ8A 1V2PT 4YLQH 1OXGA 1O2LA 2DE8A 1E34B 2ZFSA 3SU0A 1AI8H 1PQAA 1FAKH 1Z8RA 3GDUA 2HOBA 2OC8A 1G3CA 2A0QB 2PLXA 1GWAA 3MNXA 4D76A 5C67A 4K1SA 3HATH 1AKSB 1C5MD 1UTJA 3URCA 3KNXA 1JOUB 2BVSH 1PPGE 1TOMH 1HNEE 1OWEA 2RCEA 4DW2U 2A7HA 1Z7KA 3ZZAA 4MPUA 4YTAA 5FBEA 1V2LT 1MTNB 1BRUP 3CS0A 1KXFA 3P6ZB 2GCTC 8ESTE 3A8DA 1QQUA 3A82A 2H9HA 1FIWA 5DPAA 2FXRA 5G4BA 2GZ8A 3RLWH 1QA0A 4DT7B 1JBUH 1H9IE 2JH5D 4CRGA 1HAPH 1SR5C 2Z3CA 3GCTF 2OUAA 4AGJA 1S0QA 4KTCA 4OGXA 4DVAU 1GI7B 3PROA 3A7TA 1Z1IA 1UVOA 2FOGA 1D9IA 2FYRA 4ISIH 2PKAB 1T8LA 2AEIH 1AUJA 3UTUH 1CQQA 1XVMA 2H5CA 1F5RA 1Y5UT 4B2BA 1FV9A 1KSNA 3T28A 2QV1A 2BY7X 1ZGVA 3QZRA 4X1RU 1CHOF 1Y3UA 2VVUA 5F8ZA 1FQ3A 4XSKU 1NZQH 7KMEH 4U01A 1K9OE 1BDAA 1L1GA 3VPKA 5H4IB 1A5HA 1SGPE 3KQCA 3UOUA 1CHOG 2ZU5A 8GCHG 2ODPA 1BTHH 1O2IA 1AD8H 3TGKE 1DFPA 1TX8A 1V2TT 5A8XA 1TNLA 2V6NA 1L2EA 3GY3A 1YM0A 3PYHA 6LPRA 1S81A 2JH6D 4WMDA 1BRAA 3UR9A 1DSUA 3FP8E 3GY5A 4X2XA 4UEHH 4WMFA 1C1RA 1OP0A 4BAKB 8KME2 1BA8B 3BTEE 1ABJH 2AIPA 1MKWH 2BD3A 3LC3A 3LH3A 3GYMA 1RXPA 4BXSA 5T6FA 4FU9A 2PKAA 4Q80A 4Y8XA 4F49A 3LGVA 1G37A 1ANEA 5BPEA 3AW1A 2XW9A 1LMWB 1ZPBA 2AGEX 2GCTB 1N6XA 1YPLH 1HUTH 4OS6A 4UFGH 2BY6X 2QXIA 1A46H 3DFLA 4NFFA 1EAWA 3CS7A 1D3TB 1ZSKA 1AFEH 1GJAB 4CBOA 4JK5A 3HKJB 4B2CA 1DX5M 2BX3A 3OSYA 1PFXC 2LPRA 3JZ2B 1EOLA 2CF9H 2XWBI 4ZHMU 1CVWH 1O3EA 4MNXA 3S69A 1GBIA 1SQAA 1LKBA 1V2UT 1O39A 2ANMH 1FLEE 3D49H 2SGDE 1BTYA 3SU1A 1KDQB 4DURA 4UFEH 2P3FH 4MNVA 1BHXF 3EE0B 1GJ4H 1GL1A 1F7ZA 1GBJA 4ZKRU 4Y11E 3GCHB 3LKWA 2HVXA 2GZ7A 1YPJH 3UUZA 3RC4A 1DWDH 3D62A 1V2OT 2HNTC 1NRRH 3FFGA 1G2LA 1B7XB 1V2KT 1DANH 3VB6A 4IN1A 1ZPCA 2BD8A 3U1JB 3V3MA 1LHFH 2AMDA 1XVOA 1KXDA 2C8XB 3LOXA 3B8JA 1IAUA 3MH7A 3OU0A 4Q7ZA 4INHA 3AASA 4YM9A 1DLKB 5LPEA 2C8ZB 2Y5FA 4TPIZ 2YNAA 1G3DA 6ESTA 2XBWA 3MTYA 3SORA 2ZIQH 2A4RA 4B75A 2Q6DA 1AE8H 4KKDA 2EA3A 5DGJA 3TK9A 3HPTB 2TBSA 2NWNA 3TNTA 2I6QA 1C5RA 5EXNA 3A8AA 1TMTH 3F9GA 1TX7A 1PPCE 1PPHE 4I8JA 1O35A 1O2QA 1PQ5A 4RSPA 1SHHB 2BX4A 1EB2A 1ESBA 4WH8A 1UVTH 3ATMA 4JZDH 3TK5A 2C4FH 3SNBA 1JMOH 4SGBE 1C5PA 5EU8A 4BAHB 3TH4H 1ANDA 1ACBE 1C5OH 1DICA 1SI5H 2R2MB 1WU1A 1KDQA 3P8NA 1LKAA 3UY9A 1AZ8A 1V2QT 4CH8B 1HAOH 1C5YB 3GISB 3E0NB 2BLQA 1ABIH 2OBQA 3S9AA 4Y7AA 2ZI2H 2ASUB 1RIWC 3SGBE 3AVZA 1QQ4A 1NRPH 2R9PA 3ZV9A 4BTUB 2CHAB 4CBNA 1K1IA 1HYLA 2FI3E 1IQGA 1QR3E 1BITA 3KL6A 4PROA 2Y6TA 3N7OA 2ZTZA 3M5NA 4GHQA 1T8MA 1XM1A 4AG2A 1W12U 1FI8A 1UTMA 3UWJH 1MUEB 1CE5A 2SFAA 1PQ7A 3PLKA 1O3AA 2FX6A 1XUKA 1GI2A 2WPLS 4FUCA 5ESTE 2ILNA 1SFIA 4ISHH 3SNDA 1P2NA 3LIWA 3BIVH 2ZGHA 3VEQB 3TGJE 1A61H 1S82A 1FUJA 3BTTE 3SJKA 5JPMH 3E90B 4IS5A 5JBCS 2OC1A 2V3OH 4WVPE 1TBZH 1KLJH 2GP9B 1A7SA 3ZYEA 4ABGA 1TQ7B 5PTPA 3VB3A 1WUNH 1TPOA 1AFQC 1GI5A 4FUFA 2C90B 4AB9A 1VGCC 1VCQA 1P09A 3JZ1B 5CE1A 1EAIA 2P8OB 1DWBH 5IDKA 1TFXA 3A7XA 2A31A 1NC6A 1PPZA 4GUXA 1G36A 1TIOA 2C8YB 3RP2A 3I29A 1SVPA 2G5NA 1NY22 3ZV8A 4YZUA 2O8LA 2PV9B 4ZXXH 4YOJA 3I78A 1GMDG 4AGKA 1O2ZA 2VH6A 4XBDA 2QA9E 1PPFE 1GCTC 1Y59T 2XRCA 4K60A 1SGNE 2R2WU 1P0SH 3VXEH 2WUBA 1TGSZ 2VWLA 4BAQB 1WCZA 1C2JA 3MU0A 1P11E 1FY4A 2C3SA 5AF9H 1GI4A 4MQAA 4MVNA 1O2RA 5DKMA 1UK4A 3BTHE 1S6FA 4Y79A 1C2GA 1Y3WA 1JXPA 2NU1E 2VU8E 3A81A 4X8SH 3E16B 3MNBA 1QIXB 2BQWB 4AYVB 1EB1H 3LH1A 4ABIA 3F9HA 3BSQA 1QL8A 2ODQA 3STIA 2XXLA 1FZZA 1GHAF 2FOEA 2J95A 1YCPK 3M37A 1GI8B 2ZA5A 3SJIA 3NXPA 4DCDA 3V7TA 4UDWH 1CO7E 3SBKA 5FBIA 1O5BB 4ZH8A 2XC4A 1N6YA 1K1PA 3M7UA 4Y76A 1UCYK 1MQ6A 4NA7A 3LONA 1SGFG 2W26A 4Q7XA 3BIUH 2FX4A 1UVUH 3QGNB 1NESE 2PWXA 2H9TH 1RD3B 3BV9B 4Y8ZA 3SU2A 2A45B 1P2KA 3S7KB 1HFDA 1E0FD 3OYPA 1KXEA 1OWDA 5C20A 3MI4A 1TGTA 5CMXH 2ZGJA 3A87A 3P70B 3MH5A 1SL3A 1A0HB 2ZPSA 2ZTYA 1F5KU 3VXFH 1WV7H 1O32A 2CXVA 4ASHA 1FIZA 3PTNA 1FDPA 1EJMA 1B0FA 1RTKA 2CMYA 2ZFQH 4HGCA 2XCNA 3BEIB 1WOFA 1AHTH 2BD5A 2O8UA 1HPGA 1O2HA 1TLDA 1E38B 1ORFA 1BCUH 4JCNA 3TU7H 4A1TA 5ABWA 1FXYA 3LGUA 3B9FH 5DP3A 1ZMLA 3PMBB 4GPGA 1W7XH 1GCTB 4J2YB 2QN5T 1QCPA 3PO1C 1UTNA 1ZPZA 3LJJA 3FP6E 2BLVA 4X6MA 1O5DH 1SB1H 1ZYOA 2H1UA 4MPVA 1OYQA 4D9QA 3GOVB 4NZQA 3T29A 1GJDB 2ZKSA 3P95A 3LC5A 2C8WB 2AGIX 1J15A 3E6PH 1O3PB 1MAXA 1AWFH 1GBKA 1UVPA 1J14A 2F91A 3ZVDA 2Z9LA 2H5DA 1TAWA 3GY7A 1HBTH 1VITH 3KF2A 3RXRA 2UWOA 3QLPH 4WH6A 1J16A 1HLTH 2QXGA 2Y5HA 2HALA 3ZZBA 4INLA 1C1MA 1KXAA 3QO6A 4BAMB 2JETB 5GXPA 1QL9A 3MWIU 4Y6DA 8LPRA 1P04A 3HK6B 3MU8A 3SJ9A 3S9BA 1LHGH 1SGCA 1DWCH 3PV4A 2Z9KA 1G3EA 1V2WT 2O8TA 2Q6GA 3TPIZ 2K1QA 1PJPA 2FTMA 2R3UA 1W11U 1ZR0A 5FPYA 5JBAS 3K65B 3PLBA 1NT1A 1HIAB 1T31A 2ZO3H 3HGNA 2WYJA 1O2MA 1TNJA 3LPRA 2QF0A 3QX5H 3SZNA 5A8ZA 5HM2A 3RMLH 1A3EH 3VB7A 1MTNC 2ZHEH 1GMHF 3EA7A 1SGDE 3K9XB 1HDTH 4ZAEA 3MU4A 2BM2A 3FANA 5A0CA 1UCYE 1UTPA 2B5TB 2UUKB 1QBOA 1QB1A 1C5ZB 1D3QB 1GPZA 4Q7YA 4HZHA 3PWBA 3ZZ6A 1J9CH 1BUIA 1IQFA 2Y82A 4NSVA 3BG4C 4GLYA 3P8OA 2A4GA 2XBYA 1QJ1B 5LPRA 1SGIB 4ABFA 1ELCA 4LZ4B 3NWUA 2W3KA 1FY5A 2XBXA 1XUHA 1QFKH 1WQSA 3MU5A 3SUEA 2QYIA 3PLPA 1O2UA 1L1NA 2HNTF 3QZQA 1K1JA 4I33A 5FXLA 4HI3A 1V2RT 1C1OA 4A1XA 1HIAA 1W2KH 3ELAH 3TK6A 5T6DA 2BDIA 5DK1A 2ESTE 5EQSA 3M7TA 4ZHAA 2ZHDA 1O5CB 2ANYA 4CRCA 1SGYE 1KIGH 5F8TA 4XBCA 2VIWA 1T7CA 1DUAA 2P3TB 2PR3A 1QB9A 1SOZA 5EODA 2VIPA 3MYWA 2KAIB 3SHCH 4AFZA 1V2ST 2NU0E 1TA2A 5JYIA 1TGNA 5FCRA 4DGJA 4BAOB 1UHBB 3DA9B 1YP9A 2QIQA 2ZFTA 1EXFA 1TOCB 2WINI 2ZGXH 3EYDA 1HXFH 2B9LA 4MLFB 1CA0B 1TRYA 1O3CA 3SV7A 3SJOA 3RU4T 1LPKB 2BXUH 1C1SA 3ZZ8A 2AGGX 1QJ7B 1O30A 3TNSA 1O2JA 5JBTA 4K1EA 2G4UA 1Y5BT 1GBLA 1MTWA 3DT0H 3TIUA 1PPBH 1C1QA 1IQEA 1SBWA 1CGIE 1FN6A 2B8OH 4FVBA 4IN2A 4X6NA 1AE5A 1C2FA 1FY8E 1AVGH 1C1WH 2G52A 3E8LA 1VJ9U 1O2SA 2OP9A 3F9EA 4AFQA 2WPJS 3BG4B 3V0XA 1O34A 2TRMA 1GVKB 1TONA 3V13A 3GCTG 1CA8B 5DP7A 3PB1E 1H4WA 3BF6H 3Q76A 3TJUA 1ZLRA 2Y81A 2ZNKH 4CHAB 3GCHC 1XKBC 1AMHA 1DPOA 1AKSA 1D6WA 1RS0A 4BTTB 1MD7A 4IBLH 1BBRH 2KAIA 1Y8TA 2PKSB 2HNTE 1SLWB 1EKBB 1Z8JB 4F4OC 1O2VA 1HAZB 3QWCH 2GMTB 4TY7A 4B76A 4ZKOU 3HK3B 5EQRA 1EAXA 3PTBA 5EW1H 4A1VA 2BVXH 1LVMA 1PYTD 5EG4A 4FUBA 3HGPA 2XC0A 4XE4A 1IQMA 4K2YA 4CH2B 1EASA 1UK3A 2F9NA 1GVLA 1CGHA 4THNH 1GVZA 1KYNA 1O2TA 3HKIB 2BY8X 3NPSA 1HJAC 5DJ7A 1SLUB 3T26A 3UR6A 2EI7A 4DJZB 2ZC9H 4R0IA 1F0SA 3RXFA 1VJAU 3SV6A 1GDUA 4X8UH 4X0WU 2F9PA 2EEKA 3SU6A 3IWMA 1GBEA 4JZIA 1GG6B 1TBQH 1ETTH 2HLCA 2V0BA 5EXLA 5E2PA 4OS5A 3SU5A 1TX6A 2FTLE 1O2NA 1S85A 1TQ0B 2FO9A 1SLVB 2QXHA 4ZUHA 2PGBB 2GTBA 1ZRBA 2ZFPH 2CV3A 4E05H 3BN9A 1MTVA 1SC8U 1ELGA 1UTQA 2CHAC 1H8DH 4OGYA 4UE7H 3SGAE 1HAIH 3Q3KA 1T8NA 3M5OA 1W7GH 3GDVA 1A5IA 2JH0D 3TJOA 2VWNA 3D65E 1K1NA 4O9VA 1YPHC 1WAYB 1P01A 3EQ0H 5SGAE 4TWYA 1MKXH 1O36A 4KP0A 1OYTH 1C5XB 4XDEA 1F92A 1P03A 1ANBA 1S5SA 3K6ZA 2ZECA 1AU8A 5C5OA 3RXMA 3A8BA 3TGIE 4X8VH 1OSSA 4KELA 1MQ5A 3KEEA 1FY3A 4IGDA 4ABBA 2VNTA 4NA9H 1KLIH 3PM3A 4J1YA 4I8LA 4X8TH 1O3KA 1B5GH 1PPEE 1D3PB 1F5LA 1OWHA 3Q3XA 1P2QA
chains in the Genus database with same CATH superfamily
1YYY1 3RUOA 2NU2E 3RLYH 3ZZ7A 4NWLA 1GBTA 4CRDA 1J8AA 4AX9H 1V2MT 1DWEH 1HJAB 4NIWA 1H9HE 4BNRA 4Y7BA 2XBVA 3EA8A 2GVFA 2ZTXA 1P9UA 5AVDA 2P8OC 1XMNB 2AS9A 4X1SU 1ZHMA 1N8OC 2VJ1A 2EI8A 1W0YH 3ZVEA 1DOJA 1BTZA 3UOPA 1Z6JH 5HMAA 2ZQ2A 3A84A 1TBRH 1K22H 2Z9GA 1WSSH 3RXUA 1QA7A 1SOTA 1DY8A 1NFXA 3SI3H 1ELDE 1QJ6B 4I7YH 1GBAA 4RKOB 2DE9A 2HWLB 1SG8B 4A5TS 2ZWLH 1NRSH 1SMFE 2FOFA 1ID5H 1GHBF 2AH4X 1THPB 3ZVBA 2BLOA 2FM2A 2XTTB 1BRCE 1AN1E 1WXRA 5C94A 1ELVA 1M9UA 2FS8A 1LVBA 2F3CE 2GX4A 1V3XA 1CU1A 1SPJA 3GY2A 2ZQ1A 4GCHF 4FUJA 5CHAC 1GHZA 5E8EH 1ETRH 1HV7A 3H7OA 2R0LA 3RC5A 5DN6D 3UREA 2VIOA 2ZU2A 4ZKSU 3QTOH 4JZEH 4I8HA 1P05A 4OS2A 1JRTA 3S0NA 1DT2A 2UUYA 3MQKC 1HCGA 1G32B 1T4UH 4GSOA 4RT1A 1X7AC 1XUGA 3ATKA 3U8TH 1COWD 3KHVA 2BOKA 2PW8H 1HGTH 2ZDKA 2H9EH 1BJUA 1O3FA 5F8XA 4AN7A 1GI3A 1L1JA 1GCDA 2ZHFH 3RXIA 1O33A 1IOEA 4IC6A 4DIHH 1ZTLA 3WY8A 3P92A 3OX7U 1TMBH 5GPIB 5K0HA 1GMCF 1QY6A 3U9AH 5HM9A 1O3HA 1U6QA 5EJLA 3LGTA 5C5NA 1ZOMA 2ZU4A 2BXTH 5EPNA 1UJ1A 2IPHA 1LPZB 3A86A 1GMCG 2Y80A 3A7WA 1NU9A 3SNEA 5DO4H 1ZZZA 5C2ZA 2GJGA 4MNYA 2P16A 3URDA 4JZ1A 3RXVA 5JDUB 3SQEE 3BTME 4RN6A 1N8OB 4Y8YA 1Z6EA 1SGEE 2A32A 1XXDA 1NBME 1WBGB 2ZHQH 4ISOA 5DP4A 1Z8GA 1IHTH 1TRMA 2OK5A 3RU4E 1C5TA 4JMYA 1EOJA 3A85A 1UTLM 5A0AE 2A7JA 2AHME 1LPGB 5FPSA 1OWIA 2V7QD 2FZZA 5AFYH 3MHWU 1XUFA 4KTSA 4F48B 1TGBA 2Z7FE 1MMJN 3LGIA 5CHAB 4RKJB 1NS3A 3I77A 3KYGA 1VR1H 1DM4B 1GBFA 4O3TA 5C0UA 1G2MA 2KCYA 3GY4A 1HAYB 3SU3A 1KLTA 1KXCA 3RXEA 3RXPA 6GCHF 2PGQB 2WV4A 3RM2H 1WQVH 3KCGH 3EGKH 2BQ6B 4YLUA 6CHAC 2A5AA 2LNCA 4ABDA 2BQ7B 3FP7E 1OPHB 4ABEA 1MZDA 2V35A 1AVXA 3E0PB 1GBCA 1GHAG 5DP9A 4ZXYH 3SW2B 2TGAA 1AB9B 2JETC 1FJSA 4NGAH 2J97A 1NM6A 2GCHF 1DVAH 1EP5A 1H9LB 1Y5AT 4DY7B 1YPKH 2QF5A 4D7FA 3UNQA 4KGAA 1BIOA 1W8BH 1C5QA 3RMOH 5DP5A 1YLCA 2PUQH 3K6YA 1O5FH 1F2SE 4NWKA 1CT4E 1OP2A 1ZJDA 5CDFE 1TPAE 3A7YA 4F55A 4NFEA 3TVJB 2FODA 4Q4LA 1MBQA 2QGRA 4FUDA 2YMSD 1MTSA 1UTKA 3FN8A 1P2JA 3VGCB 1THSH 1ELAA 2Q6FA 1E35B 4INKA 2A4OA 2FOBA 3RXLA 3EE7A 4X2YA 3OFND 2A2QH 2P59A 1OP8A 2G4TA 3P8GA 1DXWA 1ELFA 1VKYA 3RM0H 2J38A 4E7RG 3IG6B 2J4IA 5J4SA 1W0JD 2VVCA 1ZSJA 4YT6H 2FEQH 4GVUA 5C1YA 1K1MA 5EXMA 5EGMA 4DOQA 3BTGE 2OTVA 1MU6B 1BTWA 1QNJA 3W94A 1RGQA 1FMGA 1Y3XA 3QTVH 2BD4A 1BTUA 1C5WB 1ZHPA 1ZHRA 1MAYA 2BOHB 2BMGB 1MBMA 3A88A 4WXVA 4NCYA 4FVDA 1TALA 3FOAA 1B0EA 5C1XA 3BTDE 3V12A 2TGTA 4ZMAH 9ESTA 3RXSA 1SGQE 1NN6A 4FXGH 2WUCA 3NK8A 3F3BA 4JYUH 2G5VA 1HAHH 4WMEA 3F0OA 1HJ8A 1KTSB 2CGAA 1CT0E 1ZGIA 3Q77A 1O3LA 1L0ZA 1D6RA 5B6LA 2W5EA 1C5VA 1GHXH 4NA8A 2J9NA 5T3HA 6CHAB 4AZ2B 3RXCA 4AORA 4U32A 1BT7A 1C4Y2 3U1IB 1BQYA 3T27A 1EPTB 3SV9A 5E2OA 1P10A 4K1TA 5FX5A 1P2IA 3DHKH 1AO5A 4D7GA 5C1UA 1HB0B 2FDAA 4RI0A 1MKWK 3RXDA 1YPEH 4NG9H 1WYKA 3TLOA 1O2OA 3RXJA 1BHXB 1EZSC 4K5ZA 2UUFB 1FPHH 1O5EH 2WHXA 1ELBA 1OOKB 2ZDAH 1YC0A 1Z1JA 3GYLB 4U30A 3S9CA 3AW0A 2BDBA 3DCLA 4IW4E 4NIVA 3AK5A 4ZROA 1QRZA 3ATLA 1HAXB 1IQIA 1NFYA 2FI4E 3RDZA 4JYTA 4I8KA 4LK4A 1MH0A 2FOHA 4Y0ZE 3PMAB 2P95A 2P93A 3N7DA 3NKKA 1CA0C 1INCA 2A4QA 1O0DH 1HRTH 3NZIA 1Q2WA 5C17A 3UQVA 3A7VA 3H7TA 2BYAX 2RG3A 2IN2A 2BZAA 3ZVFA 2GDDA 1RTFB 4ISNA 3SU4A 2ZDVH 1NO9H 1C1VH 1GMHG 4H42U 3UWIA 1AY6H 3MU1A 2Z9JA 3UQOA 2FWWA 2XNIA 1BRBE 1GHWH 3UNRA 2AMQA 2OC7A 5DP8A 4WWYA 1QRWA 2ZEBA 2FI5E 3M7QA 4OS1A 1GBHA 2OINA 3SQHE 1C5SA 1GDQA 2AFQB 2CN0H 3P8FA 2G55A 3TJNA 1TNIA 4CHAC 1P06A 2VWOA 4OS4A 1TB6H 4NZLA 2I6SA 1AUTC 1DY9A 1YBWA 2W6ID 4AC9A 1GL0E 1O2GH 1Q31A 2HPQH 2PKSC 1P3CA 2M5TA 3SNAA 1C5LH 3MO9A 3T62A 3RXKA 1E1QD 2F9BH 3A7ZA 3LU9B 2GMTC 4WY3A 5AFZH 1S84A 2ZDMA 1HAGE 1F0RA 1V2NT 1W3CA 2FOMB 2BHGA 1H8IH 1SGRE 3EDXB 3E91A 3RC6A 1V2VT 1WTGH 1H1BA 2P3UB 5F6MA 2BVRH 2QXJA 1AGJA 1DE7H 1MCTA 3ZZDA 2RDEA 3FZDA 2AERH 1A0LA 3SUGA 2A1DB 4D9RA 4MPWA 1GJ8B 3UB0A 1EAUA 5EOKA 4K3JA 1LHCH 2BD9A 5HXFA 2FP7B 3RXTA 1RTLA 3L6PA 1ESTA 1Q3XA 5F03A 1DXPA 1GI6A 5JBBS 2ZF0H 1ZMJA 3ATWA 4HTCH 4DG4A 1C2HA 1O2YA 1GBBA 1YCPH 3PMHB 1QBNA 1O2KA 3S7HB 2O9QA 1GG6C 5EJ1A 5I25A 3E3TA 3M35A 4JYVH 1BJVA 2D2DA 5FX6A 1UCYH 3RXOA 2QC2A 2BB4A 1LHEH 1E36B 1QBVH 1SLXB 2BY9X 2P94A 2ZGCA 2QF3A 4I32A 1GJCB 1NRNH 3U98H 4MG3A 1P3EA 5A8YA 1VZQH 3DSGA 1AQ7A 2ZP0H 1SQOA 1O2WA 2THFB 9LPRA 4VGCB 3O8BA 1KXBA 5EQQA 1XXFA 3P17H 4FETA 2BZ6H 2OLGA 1YPHE 3MOCA 1K21H 4Y10E 1TGCA 2BDAA 1G3BA 2WV5A 4LOYH 4A7IB 4Q2KA 4K69A 1G30B 1V2JT 3O8RA 1AWHB 3ENSB 1NBMD 3TJVA 1ZTJA 2BD2A 3ZZ5A 3GY6A 3KQBA 3W95A 3RU4D 2SGFE 2XYAA 2OD3B 4KTUA 5HKKD 1IQLA 1RRKA 1ANCA 1K28D 2W3IA 1A0JA 1TNGA 4O03A 1UHBA 2J2UA 1O3NA 1HJ9A 1Z71A 3LGWA 3PWCA 1C2IA 1A4WH 1D3DB 4LXBH 1OKXA 2Z9IA 1W0ZU 5GIBA 1DSTA 4JZFH 5EPYA 3M5MA 3ATIA 2PSYA 3F1SB 5HGGA 5DG6A 4AG1A 2KM0A 2ZFRH 8GCHF 2F4LA 4E06H 1RFNA 2G8TA 3M5LA 2ZU1A 1YLDA 2JIZD 1O3BA 2K0QA 4AFSA 3QGJA 4UFDH 3WWBA 5E0HA 3BTFE 5A09A 4BANB 4H4FA 1P02A 3ZVGA 3SJ8A 5HYOA 1EJAA 1BMNH 2W7UA 4U2WA 1QURH 4BTIB 5FL7D 3ESTA 4NIYA 2OCVB 3PRBA 1TRNA 3MMGA 2GV7A 2ZGBH 1FAXA 4B71A 2OC0A 2PTNA 1QHRB 3GCOA 4P00A 2TPIZ 2ULLA 5L2YH 1VCWA 4FUHA 1UVSH 2ZHWH 1K2I1 2FPZA 5BRRE 4CR5A 4I31A 1A5GH 1TE0A 2IPQX 1DS2E 1TPSA 2AYWA 2GGVB 4DT4A 3WWFA 1O3JA 4SGAE 1Z8IB 4XFQA 3CENA 3M36A 4OS7A 1H8ED 1RJXB 1ZRKA 1SGFA 5L2ZH 1GI9B 2STAE 1C4V2 4TPYA 3SUDA 1KY9A 1J17T 2EI6A 5EIYA 3AAVA 5LGOA 1MZAA 2Y7XA 2XWAA 1C1TA 2A2XH 2A7CA 3DD2H 3TITA 4A92A 3BTKE 1TNKA 1YY3A 3M3VA 1S6LA 5A0BA 4WJG2 1SFQB 2CF8H 1EATA 1TYNA 2O8WA 2FS9A 2G00A 2FESH 1DDJA 1EZQA 2ALPA 1O3MA 5FHTA 5ESBA 1MD8A 3SGQE 2RFKC 3QN7A 3RXBA 1EUFA 4ZKNU 1ARCA 1DITH 4FU8A 4YOGA 1SQTA 1NU7B 2TIOA 1GHVH 5TJXA 1HXEH 2UWPA 1YKTA 2JKHA 3VB5A 2GKVE 3GY8A 2EQNA 3QUMP 3L33A 3GDSA 2HPPH 3LT3A 4WXIA 5IYTA 2ZCLP 3D23A 3CNRA 2CJIA 3RXGA 3M61U 3A80A 2VWMA 1C9PA 1EZUC 4TT3D 4XOJA 2BD7A 1ZTKA 2PFEA 4P02A 3UPEA 3DFJA 4FU7A 1W10U 1GI0A 3RMNH 3UIRA 1E37B 1NPMA 2GZ9A 4BOHA 1C5UA 4MTBA 4B2AA 3UFAA 4D8NA 4ABHA 1GBMA 1SQRA 3KQDA 2YNBA 3BEFB 2VIQA 3SV8A 4BXWA 2GT7A 1O5GH 1UMAH 1O3GA 1O3DA 4UONA 4K8BA 4ABAA 2ANKH 3SUFA 2L74A 1GHBG 3KGPA 1OWKA 2VH0A 1NFUA 1CGJE 3MFJA 1ARBA 1SHYA 3MH4A 2HRVA 3ZZCA 1AVWA 1UK2A 2FLRH 4GCHG 1O3IA 2QY0B 2FLBH 4A6LA 1W0KD 1OS8A 1L4DA 2QF4A 2Q1JA 2ZPRA 4X2VA 4YOIA 2A5IA 4ACBA 2STBE 3Q3YA 1YGCH 3GCNA 3KQEA 1F0UA 2H6MA 1AB9C 1C1NA 5GCHF 2B7DH 1UO6A 4Z0KA 2EC9H 5I46H 1WTHD 5GDSH 5E0JA 1IQNA 3U8OH 5C0TA 5JB8S 3PMJA 1DLEA 2KZ4A 1UTOA 2ZCHP 2D26C 2YMSB 2CK3D 5EW2H 1O3OA 3C27B 4X2WA 5GCHG 5J4QA 1VITF 4AOQA 1WDIA 2HGTH 3DSPA 2F9UA 2WPIS 2XNDD 1GGDC 3M3SA 4GHTA 1BZXE 1TMUH 4X6OA 1GJ6A 3STJA 2W6JD 2O8MA 4I86A 2ODYB 4MPXA 1K1OA 3VGCC 5B6OA 3ODFA 2ZDNA 3ZZ3A 1VITG 3OY6U 2FYQA 1LVYA 4B1TA 1OHHD 2Y5GA 1OWJA 2TGPZ 1SSXA 2R3YA 3ZVAA 3BTQE 5T6GA 5C3NA 1Y3YA 5KECA 1BMLA 4AB8A 4YT7H 2NU4E 2ZDLA 3QDZB 1LQEA 4JK6A 5LH8A 4UFFH 5TCCA 1C2EA 4FUEA 4IMZA 1Y3VA 4FUGA 1G9IE 3SHAH 4ABJA 2GDEH 5K7RA 1D4PB 1QB6A 3NCLA 3A8CA 1GMDF 1BMFD 3L3TA 4B74A 1EQ9A 1CBWC 4M7GA 1NRQH 1HAVB 2VINA 3NUMA 5FCKA 1YF4A 1O37A 2ALVA 3GICB 4TY6A 3RXQA 4HFPB 5DP6A 1O2XA 1NFWA 2FOAA 2SGEE 3VFEA 2OBOA 3T25A 2IJOB 4X1NU 2UUJB 1P12E 3SN8A 2BDCA 2Z94A 1GJ5H 1P2MA 1TABE 2OXSA 2WPMS 2VIDA 1E1RD 3OTPA 1ZSLA 2H2ZA 1RIWB 5FAHA 2BY5X 4Y71A 2UWLA 2VIVA 2SNWA 1GJ9B 3FZZA 4ASUD 1EP6A 3ITIA 2R0KA 3U8RH 3SV2H 1EPTC 2ZZUH 2TGDA 3A89A 3C1KA 3LDXH 2W7SA 6GCHG 3MNCA 1C2MA 1AZZA 4B73A 3ZZ9A 5CHBA 2GT8A 4CRAA 7LPRA 4FUIA 3ZZ4A 1MCVA 2SGAA 2AIQA 3EAJA 3F9FA 1T4VH 3H5CB 4CR9A 2B0FA 2IOTA 2J94A 2XC5A 5T1VA 3BEUA 1MTUA 3LGYA 1LO6A 4ESTE 1QGFA 5E0GA 1FONA 2PSXA 2GCHG 1N1LA 4CRFA 1ETSH 2G51A 1KMHB 1GGDB 1C4U2 4NIXA 4Z6AH 4H6SB 5ETXA 3U69H 5GJ4B 1ZJKA 1ZMNA 2BDHA 2BDYA 1HAVA 2PHBA 1EZXC 1QL7A 2IJD1 1GDNA 4H6TA 2WZQA 1TNHA 2RA0A 2WPDD 1CHGA 2PTCE 3OTJE 1O31A 3BTWE 3K2UA 3MNSA 4WF8A 2WPKS 3RXAA 2Z6BD 1A3BH 3O8CA 4CRBA 1XKAC 2QCYA 2F83A 3CP7A 3FVFB 3OEED 1YPGH 1P9SA 3EA9A 4YESB 1AFQB 2GV6A 3ODDA 4O3UA 1VGCB 4YO9A 1GJBB 2YOLA 3OY5U 3SOSA 2RDLA 3KIDU 4Q63A 2FMJA 2SNVA 2BTCE 4R8TB 1CBWB 1C9TA 1T8OA 1F0TA 1BBRK 3E1XB 3IITA 5GWZA 4AYYB 1LHDH 3QK1A 3OAAD 1EJNA 3BG8A 4GAWA 4LZ1H 3T2NA 2BDGA 1XUJA 3VB4A 3ZVCA 1FY1A 1L4ZA 1DUEA 4IC5A 5TCAA 2ANWA 3B23B 4MDSA 3Q00A 4ISLA 2QAAA 3R3GB 2VGCC 1XUIA 2V3HH 5LPFA 3G01A 1BMMH 2FIRH 2KCPA 2BLWA 3T5FH 1PYTC 2J92A 2GD4B 1AIXH 1P57B 1W13U 2Z3DA 1C1UH 7ESTE 3F6UH 1C2LA 4I8GA 4IMQA 2SGPE 2SGQE 1O38A 4TWWA 3ZIAD 1LCYA 3SI4H 1BOQA 2F9VA 4ZHLU 3MO6A 3SNCA 4NSYA 4UD9H 1W14U 1GJ7B 1A1RA 1S6HA 1P8VC 2OQUA 2ZPQA 1BTPA 4MNWA 1IQKA 5JB9S 3O8DA 1C1PA 2C93B 2G81E 2QE7D 3MH6A 1YPMH 4QT8C 4X1PU 5L30H 3TH2H 7GCHF 1O5AB 1P2OA 1T32A 1ESAA 1BB0B 1TWXB 4X6PA 2VVVA 3MO3A 3FAOA 1JIRA 3W1EA 1QRXA 3N7EA 2VB0A 7GCHG 3PRDA 2NU3E 3TH3H 3DUXH 4Y0YE 1MU8B 1EX3A 1GHYH 1CT2E 4E7NA 1JWTA 3LJOA 4X1QU 1NTPA 1S83A 2WYGA 2A5KA 1TA6A 1MKXK 1GBDA 1C5NH 1S0RA 2D1JA 1ELEE 1ELTA 1UW7A 3AAUA 1LTOA 1BTXA 4DIIH 2J98B 3UNSA 4CREA 1C2DA 4VGCC 2ZFFH 1A2CH 3ZYDA 2D8WA 2J34A 4AFUA 3RMMH 1EPTA 4K8YA 1TPPA 1IHSH 1VCPA 1V6DA 1KTTB 1LQDB 2XCFA 1XX9A 3KYFA 3PO1B 1SGTA 4TSFD 1FN8A 2AMPA 2VGCB 4M9FA 2F9OA 2Z3EA 1C2KA 1FPCH 3RXHA 1O2PA 2WPHS 4XBBA 1LVOA 3A83A 1NROH 1CSOE 1EFRD 2DUCA 5A2MH 1K1LA 1GI1A 1IQHA 2FOCA 1IQJA 2V3MA 5L6NH 1MABB 2ZG0H 1BMAA 5AHGH 2HLDD 4TYDA 2Y7ZA 1LDTT 1FNIA 1THRH 1JIMA 2ZU3A 3SO3A 2OQ5A 1QTFA 3R0FA 3F68H 4O97A 1JRSA 2PUXB 3KN2A 1YCPM 2ZCKP 1BBRE 1OX1A 2RA3A 3M3TA 2J98A 5FPTA 1PQ8A 1V2PT 4YLQH 1OXGA 3PV5A 1O2LA 3F0PA 2DE8A 1E34B 2ZFSA 3SU0A 1AI8H 1PQAA 1FAKH 1Z8RA 3GDUA 2HOBA 2OC8A 1G3CA 2A0QB 2PLXA 1GWAA 3MNXA 4D76A 5C67A 4K1SA 3HATH 1AKSB 1C5MD 1UTJA 3URCA 2XOKD 3KNXA 3F2GA 1JOUB 2BVSH 1PPGE 1TOMH 4ACAA 1HNEE 1OWEA 2RCEA 4DW2U 2A7HA 1Z7KA 3ZZAA 4MPUA 4YTAA 5FBEA 1V2LT 1MTNB 1BRUP 3CS0A 1KXFA 3P6ZB 2GCTC 8ESTE 3A8DA 1QQUA 3A82A 2H9HA 1FIWA 5DPAA 2FXRA 5G4BA 2GZ8A 3RLWH 1QA0A 4DT7B 1JBUH 1H9IE 2JH5D 4CRGA 1HAPH 1SR5C 2Z3CA 3GCTF 2OUAA 4AGJA 1S0QA 4KTCA 4OGXA 4DVAU 1GI7B 3PROA 3A7TA 1Z1IA 1UVOA 2FOGA 1D9IA 2FYRA 4ISIH 2PKAB 1T8LA 2AEIH 1AUJA 3UTUH 1CQQA 1XVMA 2H5CA 1F5RA 1Y5UT 4B2BA 1FV9A 1KSNA 3T28A 2QV1A 2BY7X 1ZGVA 3QZRA 4X1RU 1CHOF 1Y3UA 2VVUA 5F8ZA 1FQ3A 4XSKU 1NZQH 7KMEH 4U01A 1K9OE 1BDAA 1E79D 1L1GA 3VPKA 5H4IB 2KX4A 1A5HA 1SGPE 3KQCA 3UOUA 1CHOG 2JJ2D 3NRLA 1YLNA 2ZU5A 8GCHG 2ODPA 1BTHH 1O2IA 1AD8H 3F2FA 1DFPA 1TX8A 1V2TT 5A8XA 3TGKE 1TNLA 2V6NA 4ZCNA 1L2EA 3GY3A 1YM0A 3PYHA 4FOUC 6LPRA 1S81A 2JH6D 4WMDA 1BRAA 3UR9A 1DSUA 3SYJA 3FP8E 3GY5A 4X2XA 4UEHH 4WMFA 1C1RA 1OP0A 4BAKB 8KME2 1BA8B 3BTEE 1ABJH 2AIPA 1MKWH 2BD3A 3LC3A 3LH3A 3GYMA 1RXPA 4BXSA 5T6FA 4FU9A 2K8IA 2PKAA 4Q80A 4Y8XA 4F49A 3LGVA 1G37A 1ANEA 5BPEA 4RT0A 3AW1A 2XW9A 1LMWB 1ZPBA 2AGEX 2GCTB 1N6XA 1YPLH 1HUTH 4OS6A 4UFGH 2BY6X 2QXIA 1A46H 3DFLA 4NFFA 1EAWA 3CS7A 1D3TB 1ZSKA 2L6OA 1AFEH 1GJAB 4CBOA 4JK5A 3HKJB 4B2CA 1DX5M 2BX3A 3OSYA 1PFXC 2LPRA 3JZ2B 1EOLA 2CF9H 2XWBI 4ZHMU 1CVWH 1O3EA 4MNXA 3S69A 1GBIA 1SQAA 1LKBA 1V2UT 1O39A 2ANMH 1FLEE 3D49H 2SGDE 1BTYA 3SU1A 1KDQB 4DURA 4UFEH 2P3FH 5KEDA 4MNVA 1BHXF 3EE0B 1GJ4H 1GL1A 2YMSC 1F7ZA 1GBJA 4ZKRU 4Y11E 3GCHB 3LKWA 2HVXA 2GZ7A 1YPJH 3UUZA 3RC4A 1DWDH 3D62A 1V2OT 2HNTC 1NRRH 3FFGA 1G2LA 1B7XB 1V2KT 1DANH 3VB6A 4IN1A 1ZPCA 2BD8A 3U1JB 3V3MA 1LHFH 2AMDA 1XVOA 1KXDA 2C8XB 3LOXA 3B8JA 1IAUA 2PP6A 3MH7A 3OU0A 4Q7ZA 4INHA 3AASA 4YM9A 1DLKB 5LPEA 2C8ZB 2KCOA 2Y5FA 4TPIZ 2YNAA 1G3DA 6ESTA 2XBWA 3MTYA 3SORA 2ZIQH 2A4RA 4B75A 2Q6DA 1AE8H 4KKDA 2EA3A 5DGJA 3TK9A 3HPTB 2TBSA 2NWNA 3TNTA 2I6QA 1C5RA 5EXNA 3A8AA 1TMTH 3F9GA 1TX7A 1PPCE 1PPHE 4I8JA 1O35A 1O2QA 1PQ5A 4RSPA 1SHHB 2BX4A 1EB2A 1ESBA 4WH8A 1UVTH 3ATMA 4JZDH 3TK5A 2C4FH 3SNBA 1JMOH 4SGBE 1C5PA 5EU8A 4BAHB 3TH4H 1ANDA 1ACBE 1C5OH 1DICA 1SI5H 2R2MB 1WU1A 1KDQA 3P8NA 1LKAA 3UY9A 1AZ8A 1V2QT 4CH8B 4OM9A 1HAOH 1C5YB 3GISB 3E0NB 2BLQA 1ABIH 2OBQA 3S9AA 4Y7AA 2ZI2H 2ASUB 4B6EA 1RIWC 3SGBE 3AVZA 1QQ4A 1NRPH 2R9PA 3SZEA 3ZV9A 4BTUB 2CHAB 4CBNA 1K1IA 1HYLA 2FI3E 1IQGA 1QR3E 1BITA 3KL6A 4PROA 2Y6TA 3N7OA 2ZTZA 3M5NA 4GHQA 1T8MA 1XM1A 4AG2A 1W12U 1FI8A 1UTMA 3UWJH 1MUEB 1CE5A 2SFAA 1PQ7A 3PLKA 1O3AA 2FX6A 1XUKA 1GI2A 2WPLS 4FUCA 5ESTE 3F2HA 2ILNA 1SFIA 4ISHH 3SNDA 1P2NA 3LIWA 3BIVH 2ZGHA 3VEQB 3TGJE 1A61H 1S82A 1FUJA 3BTTE 3SJKA 5JPMH 3E90B 4IS5A 5JBCS 2OC1A 2V3OH 4WVPE 1TBZH 1KLJH 2GP9B 1A7SA 3ZYEA 4ABGA 1TQ7B 5PTPA 3VB3A 1WUNH 1TPOA 1AFQC 1GI5A 4FUFA 2C90B 4AB9A 1VGCC 1VCQA 1P09A 3JZ1B 5CE1A 1EAIA 2P8OB 1DWBH 5IDKA 1TFXA 3A7XA 2A31A 1NC6A 1PPZA 4GUXA 1G36A 1TIOA 2C8YB 3RP2A 2VBCA 3I29A 1SVPA 2G5NA 1NY22 3ZV8A 4YZUA 2O8LA 2PV9B 4ZXXH 4YOJA 3I78A 1GMDG 4AGKA 1O2ZA 2VH6A 4XBDA 2QA9E 1PPFE 1GCTC 1Y59T 2XRCA 4K60A 1SGNE 2R2WU 1P0SH 3VXEH 2WUBA 1TGSZ 2VWLA 4BAQB 1WCZA 1C2JA 3MU0A 1P11E 1FY4A 2C3SA 5AF9H 1GI4A 4MQAA 4MVNA 5GNDA 1O2RA 5DKMA 1UK4A 3BTHE 1S6FA 4Y79A 1C2GA 1Y3WA 1JXPA 2NU1E 2VU8E 3A81A 4X8SH 4XRNA 3E16B 3MNBA 1QIXB 2BQWB 4AYVB 1EB1H 3LH1A 4ABIA 3F9HA 3BSQA 1QL8A 2ODQA 5HIZA 3STIA 2XXLA 2WV9A 1FZZA 1GHAF 2FOEA 2J95A 1YCPK 3M37A 1GI8B 2ZA5A 3SJIA 3NXPA 4DCDA 1FX0B 3V7TA 4UDWH 1CO7E 3SBKA 5FBIA 1O5BB 4ZH8A 2XC4A 1N6YA 1K1PA 3M7UA 4Y76A 1UCYK 1MQ6A 4NA7A 3LONA 1SGFG 2W26A 4Q7XA 3BIUH 2FX4A 4YXWD 1UVUH 3QGNB 1NESE 2PWXA 2H9TH 1RD3B 3BV9B 4Y8ZA 3SU2A 4Z1MD 2A45B 1P2KA 3S7KB 1HFDA 1E0FD 3OYPA 1KXEA 1OWDA 2LELA 3MI4A 5C20A 1TGTA 5CMXH 2ZGJA 3A87A 3P70B 3MH5A 2HVYB 1SL3A 1A0HB 2ZPSA 2ZTYA 1F5KU 3VXFH 1WV7H 1O32A 2CXVA 4HG6A 4ASHA 1FIZA 3PTNA 1FDPA 1EJMA 3OEHD 1B0FA 1RTKA 2CMYA 2ZFQH 4HGCA 2XCNA 3BEIB 1WOFA 1AHTH 5F53A 2BD5A 2O8UA 1HPGA 1O2HA 1TLDA 1E38B 1ORFA 1BCUH 4JCNA 3TU7H 4A1TA 5ABWA 1FXYA 3LGUA 3B9FH 5DP3A 1ZMLA 3PMBB 4GPGA 2EY4C 1W7XH 1GCTB 4J2YB 2QN5T 1QCPA 3PO1C 1UTNA 1ZPZA 3LJJA 3FP6E 2BLVA 4X6MA 1O5DH 1SB1H 1ZYOA 2H1UA 4MPVA 1OYQA 4D9QA 3GOVB 4NZQA 3T29A 1GJDB 2ZKSA 3P95A 3LC5A 2C8WB 2AGIX 1J15A 3E6PH 1O3PB 5IK2D 1MAXA 1AWFH 1GBKA 1UVPA 1J14A 2F91A 5KGOA 1SKYE 3ZVDA 2Z9LA 3H09A 2H5DA 1TAWA 3GY7A 1HBTH 3WW7A 1VITH 3KF2A 3RXRA 2UWOA 3QLPH 4WH6A 1J16A 1HLTH 2QXGA 2Y5HA 2HALA 3ZZBA 4INLA 1C1MA 1KXAA 3QO6A 4BAMB 2JETB 5GXPA 1QL9A 3MWIU 4Y6DA 8LPRA 1P04A 3HK6B 4B6FA 3MU8A 3SJ9A 3S9BA 1LHGH 1SGCA 1DWCH 3PV4A 2Z9KA 1G3EA 1V2WT 2O8TA 2Q6GA 3TPIZ 2K1QA 1PJPA 2FTMA 2R3UA 1W11U 1ZR0A 5FPYA 5JBAS 2KR7A 3K65B 3PLBA 1NT1A 1HIAB 1T31A 2ZO3H 3HGNA 2WYJA 1O2MA 1TNJA 3LPRA 2QF0A 3QX5H 3SZNA 5A8ZA 5HM2A 3RMLH 1A3EH 3VB7A 1MTNC 2ZHEH 1GMHF 3EA7A 1SGDE 3K9XB 1HDTH 4ZAEA 3MU4A 1YWUA 2BM2A 3GS9A 2JDID 3FANA 5A0CA 1UCYE 1UTPA 2B5TB 2UUKB 1QBOA 1QB1A 1C5ZB 1D3QB 1GPZA 4Q7YA 4HZHA 3PWBA 3ZZ6A 1J9CH 1BUIA 1IQFA 2Y82A 4NSVA 3BG4C 4GLYA 3P8OA 2A4GA 2XBYA 1QJ1B 2F43B 5LPRA 1SGIB 4ABFA 1ELCA 4LZ4B 3NWUA 2W3KA 1FY5A 2XBXA 1XUHA 1QFKH 1WQSA 3MU5A 3SUEA 2QYIA 3DSOA 3PLPA 1O2UA 1L1NA 1H8HD 2HNTF 1K0HA 3QZQA 1K1JA 4I33A 5FXLA 4HI3A 1V2RT 1C1OA 4A1XA 1HIAA 1W2KH 3ELAH 3TK6A 5HIYA 5T6DA 2BDIA 5DK1A 2ESTE 5EQSA 3M7TA 4ZHAA 2ZHDA 1O5CB 4XD7D 2ANYA 4CRCA 1SGYE 1KIGH 3OE7D 5F8TA 4XBCA 2VIWA 1T7CA 1DUAA 2KCAA 2P3TB 2PR3A 1QB9A 1SOZA 5EODA 2VIPA 3MYWA 2KAIB 3SHCH 4AFZA 1V2ST 2NU0E 1TA2A 5JYIA 1TGNA 5FCRA 4DGJA 4BAOB 1UHBB 3DA9B 1YP9A 2QIQA 2ZFTA 1EXFA 1TOCB 2WINI 2ZGXH 3EYDA 1HXFH 2B9LA 4MLFB 1CA0B 1TRYA 2J5UA 1O3CA 3SV7A 3SJOA 3RU4T 1LPKB 2BXUH 1C1SA 3ZZ8A 2AGGX 1QJ7B 1O30A 3TNSA 1O2JA 5JBTA 4K1EA 2G4UA 1Y5BT 1GBLA 2JJ1D 1MTWA 3DT0H 3TIUA 1PPBH 1C1QA 1IQEA 1SBWA 1CGIE 1FN6A 2B8OH 3N99A 4FVBA 4IN2A 4X6NA 1AE5A 1C2FA 1FY8E 1AVGH 1C1WH 2G52A 3E8LA 1VJ9U 1O2SA 1QZ8A 2OP9A 3F9EA 4AFQA 2WPJS 3BG4B 3FO8D 1O34A 2TRMA 3V0XA 1GVKB 1TONA 3V13A 3GCTG 1CA8B 5DP7A 3PB1E 1H4WA 3BF6H 3KQ5A 3Q76A 3TJUA 1ZLRA 2KFWA 2Y81A 2ZNKH 4CHAB 3GCHC 1XKBC 1AMHA 1DPOA 1AKSA 1D6WA 1RS0A 4BTTB 2LP6A 1MD7A 4IBLH 1BBRH 2KAIA 1Y8TA 2PKSB 2HNTE 3UAIC 1SLWB 1EKBB 1Z8JB 4F4OC 1O2VA 1HAZB 3QWCH 2GMTB 4TY7A 4B76A 4ZKOU 3HK3B 5EQRA 1EAXA 3PTBA 5EW1H 4A1VA 2BVXH 1LVMA 1PYTD 5EG4A 4FUBA 5EJZA 3HGPA 2XC0A 4XE4A 1IQMA 4K2YA 4CH2B 3PV2A 1EASA 1UK3A 2F9NA 1GVLA 1CGHA 4THNH 1GVZA 1KYNA 1O2TA 3HKIB 2BY8X 3NPSA 1HJAC 5DJ7A 1SLUB 3T26A 3UR6A 2EI7A 4DJZB 2ZC9H 4R0IA 1F0SA 3RXFA 3U28C 1VJAU 3SV6A 1GDUA 4X8UH 4X0WU 2F9PA 2EEKA 3SU6A 3IWMA 1GBEA 4JZIA 1GG6B 1TBQH 1ETTH 2HLCA 2V0BA 5EXLA 5E2PA 4OS5A 3SU5A 1TX6A 2FTLE 1O2NA 1S85A 1TQ0B 2FO9A 1SLVB 2QXHA 4ZUHA 2PGBB 2GTBA 1ZRBA 2ZFPH 2CV3A 4E05H 3BN9A 1MTVA 1SC8U 1ELGA 1UTQA 2CHAC 1H8DH 4OGYA 4UE7H 3SGAE 1HAIH 3Q3KA 1T8NA 3M5OA 1W7GH 3GDVA 1A5IA 2JH0D 3TJOA 2VWNA 3D65E 1K1NA 4O9VA 1YPHC 1WAYB 1P01A 3EQ0H 5SGAE 4TWYA 1MKXH 1O36A 4KP0A 1OYTH 1C5XB 4XDEA 1F92A 1P03A 1ANBA 5DSFA 1S5SA 2M2AA 3K6ZA 2ZECA 1AU8A 5C5OA 3RXMA 3A8BA 3FKSD 3TGIE 4X8VH 1OSSA 4KELA 1MQ5A 3KEEA 1FY3A 4IGDA 4ABBA 2VNTA 4NA9H 1KLIH 3PM3A 4J1YA 4I8LA 3VG8A 4X8TH 1O3KA 1B5GH 1PPEE 2WSSD 1D3PB 1F5LA 1OWHA 3Q3XA 1P2QA
chains in the Genus database with same CATH topology
1YYY1 3RUOA 2NU2E 3RLYH 3ZZ7A 4NWLA 1GBTA 4CRDA 1J8AA 4AX9H 1V2MT 1DWEH 1HJAB 4NIWA 1H9HE 4BNRA 4Y7BA 2XBVA 3EA8A 2GVFA 2ZTXA 1P9UA 5AVDA 2P8OC 1XMNB 2AS9A 4X1SU 1ZHMA 1N8OC 2VJ1A 2EI8A 1W0YH 3ZVEA 1DOJA 1BTZA 3UOPA 1Z6JH 5HMAA 2ZQ2A 3A84A 1TBRH 1K22H 2Z9GA 1WSSH 3RXUA 1QA7A 1SOTA 1DY8A 1NFXA 3SI3H 1ELDE 1QJ6B 4I7YH 1GBAA 4RKOB 2DE9A 2HWLB 1SG8B 4A5TS 2ZWLH 1NRSH 1SMFE 2FOFA 1ID5H 1GHBF 2AH4X 1THPB 3ZVBA 2BLOA 2FM2A 2XTTB 1BRCE 1AN1E 1ELVA 1M9UA 2FS8A 1LVBA 2F3CE 2GX4A 1V3XA 1CU1A 1SPJA 3GY2A 2ZQ1A 4GCHF 4FUJA 5CHAC 1GHZA 5E8EH 1ETRH 1HV7A 3H7OA 2R0LA 3RC5A 3UREA 2VIOA 2ZU2A 4ZKSU 3QTOH 4JZEH 4I8HA 1P05A 4OS2A 1JRTA 3S0NA 1DT2A 2UUYA 1HCGA 1G32B 1T4UH 4GSOA 1X7AC 1XUGA 3ATKA 3U8TH 3KHVA 2BOKA 2PW8H 1HGTH 2ZDKA 2H9EH 1BJUA 1O3FA 5F8XA 4AN7A 1GI3A 1L1JA 1GCDA 2ZHFH 3RXIA 1O33A 1IOEA 4IC6A 4DIHH 1ZTLA 3WY8A 3P92A 3OX7U 1TMBH 5GPIB 5K0HA 1GMCF 1QY6A 3U9AH 5HM9A 1O3HA 1U6QA 3LGTA 5C5NA 1ZOMA 2ZU4A 2BXTH 5EPNA 1UJ1A 2IPHA 1LPZB 3A86A 1GMCG 2Y80A 3A7WA 1NU9A 3SNEA 5DO4H 1ZZZA 5C2ZA 4MNYA 2P16A 3URDA 4JZ1A 3RXVA 5JDUB 3SQEE 3BTME 4RN6A 1N8OB 4Y8YA 1Z6EA 1SGEE 2A32A 1XXDA 1WBGB 2ZHQH 4ISOA 5DP4A 1Z8GA 1IHTH 1TRMA 3RU4E 1C5TA 4JMYA 1EOJA 3A85A 1UTLM 5A0AE 2A7JA 1LPGB 5FPSA 1OWIA 2FZZA 5AFYH 3MHWU 1XUFA 4KTSA 1TGBA 2Z7FE 1MMJN 3LGIA 5CHAB 4RKJB 1NS3A 3I77A 1VR1H 1DM4B 1GBFA 4O3TA 1G2MA 3GY4A 1HAYB 3SU3A 1KLTA 1KXCA 3RXEA 3RXPA 6GCHF 2PGQB 2WV4A 3RM2H 1WQVH 3KCGH 3EGKH 2BQ6B 4YLUA 6CHAC 2A5AA 2LNCA 4ABDA 2BQ7B 3FP7E 1OPHB 4ABEA 1MZDA 2V35A 1AVXA 3E0PB 1GBCA 1GHAG 5DP9A 4ZXYH 3SW2B 2TGAA 1AB9B 2JETC 1FJSA 4NGAH 1NM6A 2GCHF 1DVAH 1EP5A 1H9LB 1Y5AT 4DY7B 1YPKH 4D7FA 3UNQA 4KGAA 1BIOA 1W8BH 1C5QA 3RMOH 5DP5A 1YLCA 2PUQH 3K6YA 1O5FH 1F2SE 4NWKA 1CT4E 1OP2A 1ZJDA 1TPAE 3A7YA 4NFEA 3TVJB 2FODA 1MBQA 2QGRA 4FUDA 1MTSA 1UTKA 1P2JA 3VGCB 1THSH 1ELAA 2Q6FA 1E35B 4INKA 2A4OA 2FOBA 3RXLA 4X2YA 2A2QH 2P59A 1OP8A 2G4TA 3P8GA 1DXWA 1ELFA 3RM0H 2J38A 4E7RG 3IG6B 2J4IA 5J4SA 2VVCA 1ZSJA 4YT6H 2FEQH 4GVUA 5C1YA 1K1MA 5EXMA 5EGMA 4DOQA 3BTGE 2OTVA 1MU6B 1BTWA 1QNJA 3W94A 1RGQA 1FMGA 1Y3XA 3QTVH 2BD4A 1BTUA 1C5WB 1ZHPA 1ZHRA 1MAYA 2BOHB 2BMGB 1MBMA 3A88A 4WXVA 4NCYA 4FVDA 1TALA 1B0EA 5C1XA 3BTDE 3V12A 2TGTA 4ZMAH 9ESTA 3RXSA 1SGQE 1NN6A 4FXGH 2WUCA 3NK8A 4JYUH 2G5VA 1HAHH 4WMEA 1HJ8A 1KTSB 2CGAA 1CT0E 1ZGIA 3Q77A 1O3LA 1L0ZA 1D6RA 2W5EA 1C5VA 1GHXH 4NA8A 2J9NA 5T3HA 6CHAB 4AZ2B 3RXCA 4AORA 4U32A 1BT7A 1C4Y2 3U1IB 1BQYA 3T27A 1EPTB 3SV9A 5E2OA 1P10A 4K1TA 5FX5A 1P2IA 3DHKH 1AO5A 4D7GA 5C1UA 1HB0B 2FDAA 1MKWK 3RXDA 1YPEH 4NG9H 1WYKA 3TLOA 1O2OA 3RXJA 1BHXB 1EZSC 4K5ZA 2UUFB 1FPHH 1O5EH 1ELBA 1OOKB 2ZDAH 1YC0A 1Z1JA 3GYLB 4U30A 3S9CA 3AW0A 2BDBA 4IW4E 4NIVA 4ZROA 1QRZA 3ATLA 1HAXB 1IQIA 1NFYA 2FI4E 3RDZA 4JYTA 4I8KA 4LK4A 1MH0A 2FOHA 4Y0ZE 3PMAB 2P95A 2P93A 3NKKA 1CA0C 1INCA 2A4QA 1O0DH 1HRTH 3NZIA 1Q2WA 3UQVA 3A7VA 3H7TA 2BYAX 2RG3A 2IN2A 2BZAA 3ZVFA 2GDDA 1RTFB 4ISNA 3SU4A 2ZDVH 1NO9H 1C1VH 1GMHG 4H42U 3UWIA 1AY6H 3MU1A 2Z9JA 3UQOA 2FWWA 2XNIA 1BRBE 1GHWH 3UNRA 2AMQA 2OC7A 5DP8A 4WWYA 1QRWA 2ZEBA 2FI5E 3M7QA 4OS1A 1GBHA 2OINA 3SQHE 1C5SA 1GDQA 2AFQB 2CN0H 3P8FA 2G55A 3TJNA 1TNIA 4CHAC 1P06A 2VWOA 4OS4A 1TB6H 4NZLA 2I6SA 1AUTC 1DY9A 1YBWA 1GL0E 1O2GH 1Q31A 2HPQH 2PKSC 1P3CA 2M5TA 3SNAA 1C5LH 3MO9A 3T62A 3RXKA 2F9BH 3A7ZA 3LU9B 2GMTC 4WY3A 5AFZH 1S84A 2ZDMA 1HAGE 1F0RA 1V2NT 1W3CA 2FOMB 2BHGA 1H8IH 1SGRE 3EDXB 3E91A 3RC6A 1V2VT 1WTGH 1H1BA 2P3UB 5F6MA 2BVRH 2QXJA 1AGJA 1DE7H 1MCTA 3ZZDA 3FZDA 2AERH 1A0LA 3SUGA 2A1DB 4D9RA 4MPWA 1GJ8B 1EAUA 5EOKA 4K3JA 1LHCH 2BD9A 5HXFA 2FP7B 3RXTA 1RTLA 3L6PA 1ESTA 1Q3XA 5F03A 1DXPA 1GI6A 5JBBS 2ZF0H 1ZMJA 3ATWA 4HTCH 4DG4A 1C2HA 1O2YA 1GBBA 1YCPH 3PMHB 1QBNA 1O2KA 3S7HB 2O9QA 1GG6C 5I25A 3E3TA 3M35A 4JYVH 1BJVA 2D2DA 5FX6A 1UCYH 3RXOA 2QC2A 2BB4A 1LHEH 1E36B 1QBVH 2P94A 1SLXB 2BY9X 2ZGCA 2QF3A 4I32A 1GJCB 1NRNH 3U98H 4MG3A 1P3EA 5A8YA 1VZQH 1AQ7A 2ZP0H 1SQOA 1O2WA 2THFB 9LPRA 4VGCB 3O8BA 1KXBA 5EQQA 1XXFA 3P17H 2BZ6H 2OLGA 1YPHE 3MOCA 1K21H 4Y10E 1TGCA 2BDAA 1G3BA 2WV5A 4LOYH 4A7IB 4Q2KA 4K69A 1G30B 1V2JT 3O8RA 1AWHB 3ENSB 3TJVA 1ZTJA 2BD2A 3ZZ5A 3GY6A 3KQBA 3W95A 3RU4D 2SGFE 2XYAA 2OD3B 4KTUA 1IQLA 1RRKA 1ANCA 1K28D 2W3IA 1A0JA 1TNGA 4O03A 1UHBA 2J2UA 1O3NA 1HJ9A 1Z71A 3LGWA 3PWCA 1C2IA 1A4WH 1D3DB 4LXBH 1OKXA 2Z9IA 1W0ZU 5GIBA 1DSTA 4JZFH 5EPYA 3M5MA 3ATIA 2PSYA 3F1SB 5HGGA 5DG6A 4AG1A 2ZFRH 8GCHF 4E06H 1RFNA 2G8TA 3M5LA 2ZU1A 1YLDA 1O3BA 4AFSA 3QGJA 4UFDH 5E0HA 3BTFE 5A09A 4BANB 4H4FA 1P02A 3ZVGA 3SJ8A 5HYOA 1EJAA 1BMNH 2W7UA 4U2WA 1QURH 4BTIB 3ESTA 4NIYA 2OCVB 1TRNA 3MMGA 2GV7A 2ZGBH 1FAXA 4B71A 2OC0A 2PTNA 1QHRB 3GCOA 2TPIZ 2ULLA 5L2YH 1VCWA 4FUHA 1UVSH 2ZHWH 1K2I1 2FPZA 5BRRE 4CR5A 4I31A 1A5GH 1TE0A 1DS2E 1TPSA 2AYWA 2GGVB 1O3JA 4SGAE 1Z8IB 4XFQA 3CENA 3M36A 4OS7A 1RJXB 1ZRKA 1SGFA 5L2ZH 1GI9B 2STAE 1C4V2 4TPYA 3SUDA 1KY9A 1J17T 2EI6A 3AAVA 5LGOA 1MZAA 2Y7XA 2XWAA 1C1TA 2A2XH 2A7CA 3DD2H 3TITA 4A92A 3BTKE 1TNKA 3M3VA 5A0BA 4WJG2 1SFQB 2CF8H 1EATA 1TYNA 2O8WA 2FS9A 2G00A 2FESH 1DDJA 1EZQA 2ALPA 1O3MA 5FHTA 5ESBA 1MD8A 3SGQE 3QN7A 3RXBA 1EUFA 4ZKNU 1ARCA 1DITH 4FU8A 4YOGA 1SQTA 1NU7B 2TIOA 1GHVH 5TJXA 1HXEH 2UWPA 1YKTA 2JKHA 3VB5A 2GKVE 3GY8A 3QUMP 3L33A 3GDSA 2HPPH 3LT3A 4WXIA 5IYTA 2ZCLP 3D23A 3RXGA 2CJIA 3M61U 3A80A 2VWMA 1C9PA 1EZUC 4XOJA 2BD7A 1ZTKA 2PFEA 3UPEA 3DFJA 4FU7A 1W10U 1GI0A 3RMNH 3UIRA 1E37B 1NPMA 2GZ9A 4BOHA 1C5UA 4MTBA 4B2AA 3UFAA 4D8NA 4ABHA 1GBMA 3KQDA 2YNBA 3BEFB 2VIQA 3SV8A 4BXWA 2GT7A 1O5GH 1UMAH 1O3GA 1O3DA 4UONA 4K8BA 4ABAA 2ANKH 3SUFA 1GHBG 3KGPA 1OWKA 2VH0A 1NFUA 1CGJE 3MFJA 1ARBA 1SHYA 3MH4A 2HRVA 3ZZCA 1AVWA 1UK2A 2FLRH 4GCHG 1O3IA 2QY0B 2FLBH 4A6LA 1OS8A 1L4DA 2Q1JA 2ZPRA 4X2VA 4YOIA 2A5IA 2STBE 3Q3YA 1YGCH 3GCNA 3KQEA 1F0UA 2H6MA 1AB9C 1C1NA 5GCHF 2B7DH 1UO6A 4Z0KA 2EC9H 5I46H 1WTHD 5GDSH 5E0JA 1IQNA 3U8OH 5JB8S 3PMJA 1DLEA 1UTOA 2ZCHP 2D26C 5EW2H 1O3OA 3C27B 4X2WA 5GCHG 5J4QA 1VITF 4AOQA 2HGTH 2F9UA 2WPIS 1GGDC 3M3SA 4GHTA 1BZXE 1TMUH 4X6OA 1GJ6A 3STJA 2O8MA 2ODYB 4MPXA 1K1OA 3VGCC 5B6OA 3ODFA 2ZDNA 3ZZ3A 1VITG 3OY6U 2FYQA 1LVYA 4B1TA 2Y5GA 1OWJA 2TGPZ 1SSXA 2R3YA 3ZVAA 3BTQE 5T6GA 5C3NA 1Y3YA 1BMLA 4AB8A 4YT7H 2NU4E 2ZDLA 3QDZB 1LQEA 4JK6A 5LH8A 4UFFH 5TCCA 1C2EA 4FUEA 4IMZA 1Y3VA 4FUGA 1G9IE 3SHAH 4ABJA 2GDEH 5K7RA 1D4PB 1QB6A 3NCLA 3A8CA 1GMDF 3L3TA 4B74A 1EQ9A 1CBWC 4M7GA 1NRQH 1HAVB 2VINA 3NUMA 5FCKA 1YF4A 1O37A 2ALVA 3GICB 4TY6A 3RXQA 4HFPB 5DP6A 1O2XA 1NFWA 2FOAA 2SGEE 3VFEA 2OBOA 3T25A 2IJOB 4X1NU 2UUJB 1P12E 3SN8A 2BDCA 2Z94A 1GJ5H 1P2MA 1TABE 2OXSA 2WPMS 2VIDA 1ZSLA 2H2ZA 1RIWB 5FAHA 2BY5X 4Y71A 2UWLA 2VIVA 2SNWA 1GJ9B 3FZZA 1EP6A 3ITIA 2R0KA 3U8RH 3SV2H 1EPTC 2ZZUH 2TGDA 3A89A 3C1KA 3LDXH 2W7SA 6GCHG 3MNCA 1C2MA 1AZZA 4B73A 3ZZ9A 2GT8A 4CRAA 7LPRA 4FUIA 3ZZ4A 1MCVA 2SGAA 2AIQA 3EAJA 3F9FA 1T4VH 3H5CB 4CR9A 2B0FA 2IOTA 2J94A 2XC5A 3BEUA 1MTUA 3LGYA 1LO6A 4ESTE 1QGFA 5E0GA 1FONA 2PSXA 2GCHG 1N1LA 4CRFA 1ETSH 2G51A 1GGDB 1C4U2 4NIXA 4Z6AH 4H6SB 5ETXA 3U69H 5GJ4B 1ZJKA 1ZMNA 2BDHA 2BDYA 1HAVA 2PHBA 1EZXC 1QL7A 1GDNA 4H6TA 1TNHA 2RA0A 1CHGA 2PTCE 3OTJE 1O31A 3BTWE 3K2UA 3MNSA 4WF8A 2WPKS 3RXAA 2Z6BD 1A3BH 3O8CA 4CRBA 1XKAC 2QCYA 2F83A 3CP7A 3FVFB 1YPGH 1P9SA 3EA9A 4YESB 1AFQB 2GV6A 3ODDA 4O3UA 1VGCB 4YO9A 1GJBB 2YOLA 3OY5U 3SOSA 2RDLA 3KIDU 2FMJA 2SNVA 2BTCE 4R8TB 1CBWB 1C9TA 1T8OA 1F0TA 1BBRK 3E1XB 3IITA 5GWZA 4AYYB 1LHDH 3QK1A 1EJNA 3BG8A 4GAWA 4LZ1H 3T2NA 2BDGA 1XUJA 3VB4A 3ZVCA 1FY1A 1L4ZA 1DUEA 4IC5A 5TCAA 2ANWA 3B23B 4MDSA 3Q00A 4ISLA 2QAAA 3R3GB 2VGCC 1XUIA 2V3HH 5LPFA 3G01A 1BMMH 2FIRH 2BLWA 3T5FH 1PYTC 2J92A 2GD4B 1AIXH 1P57B 1W13U 2Z3DA 1C1UH 7ESTE 3F6UH 1C2LA 4I8GA 4IMQA 2SGPE 2SGQE 1O38A 4TWWA 1LCYA 3SI4H 1BOQA 2F9VA 4ZHLU 3MO6A 3SNCA 4NSYA 4UD9H 1W14U 1GJ7B 1A1RA 1S6HA 1P8VC 2OQUA 2ZPQA 1BTPA 4MNWA 1IQKA 5JB9S 3O8DA 1C1PA 2C93B 2G81E 3MH6A 1YPMH 4QT8C 4X1PU 5L30H 3TH2H 7GCHF 1O5AB 1P2OA 1T32A 1ESAA 1BB0B 1TWXB <